4AOWA

Crystal structure of the human rack1 protein at a resolution of 2.45 angstrom
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
312
structure length
305
Chain Sequence
EQMTLRGTLKGHNGWVTQIATTPQFPDMILSASRDKTIIMWKLTRDETNYGIPQRALRGHSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSSDNRQIVSGSRDKTIKLWNTLGVCKYTVQDESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGKIIVDELKQEAEPPQCTSLAWSADGQTLFAGYTDNLVRVWQVTI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GUANINE NUCLEOTIDE-BINDING PROTEIN SUBUNIT BETA-2-LIKE 1
publication title Structure of Human Rack1 Protein at a Resolution of 2.45 A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Receptor
total genus 76
structure length 305
sequence length 312
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4aowA01
5FKQA 2CO0C 3F3FA 4JT5C 3VGZA 3B7FA 4A7JA 4J86A 4A11B 3OKWA 4QT8A 3AL8A 2H9MA 3K26A 3I7OA 2YMUA 3IIWA 2HKRA 2XL3A 3AL9A 1XIPA 4E54B 2GC4A 1K8KC 4L3HD 1B9XA 3JZHA 1MG3A 5HQGA 2H68A 4EWRA 2Z2OA 4NSXA 5K1CC 5C2VB 4X61B 3OW8A 3SWSD 4K3JB 4JSVC 1N6DA 2I0RA 4KFMB 3DXKC 2OJYA 2Z2NA 3CIKB 4E5ZB 1TYQC 1Q47A 1N6FA 2QXVA 4J81A 4BH6A 3NVXA 4AEZA 5AMSA 4LG9A 5EARA 4LGNA 3L4MD 4L3GD 5HE3B 2IUPA 3IJ1A 4GGAA 4Y5RD 3V5WB 4O3UB 2B5NA 4MK0B 2H6KA 3OKYB 5I5MA 3EI3B 2AH1A 2OVQB 4ERYA 3JPXA 2W18A 5EMKB 3C5MA 2IAAA 4GMBA 3OL2A 3JAMg 4X3EA 4J8GA 4YVDA 4J77A 4H5IA 2H3XA 1GG2B 2H6NA 4GZ8A 4CY2A 4ZOYA 3V7DB 4PXWA 2J57G 1PEVA 4BL0A 2J55H 4JXMA 4A0AB 5IJ8E 2HYEA 4H5JA 3ODTA 5FKTA 3W15A 1XKSA 5AJAA 4ZOVA 3PVWB 1PGUA 2H13A 3AL8B 2AGWA 2HKMA 1ERJA 3EI1A 4I79A 5EALA 2B4EA 2HESX 2MTAH 5CXCA 5FQDA 4GM3A 4FAND 5CXBA 1B9YA 2IWFA 3EMHA 2CE9A 4J87A 2PM7B 3CFVA 2P9SC 4A08B 3DXMC 4FAVD 3BG0A 5EM2A 4X63B 5AFU3 5C9ZB 4ERZA 3PE7A 2HJBA 1U2VC 3EU7A 4GM9A 4OZUA 3DWLC 2I0TA 4FB1D 3F3GA 5CYKB 4ES0A 3MKQA 1GOTB 2HXCA 2CN3A 2H9LA 5H17A 3CFSB 3I89A 1R5MA 2P9KC 3FGBA 2PBIB 1NR0A 3NVQA 3MMYA 3UVMA 4J79A 4BUJC 3JRPA 2Z2PA 4FHLA 4A09A 2B5MA 1GP2B 3VH0A 2YNOA 3ULEC 2AGXA 4QRJA 3ZWLB 3C9CA 3SVWD 3SBQA 5GMKn 2IUVA 3JROA 4Z8LA 4CZVA 5HYNB 4J78A 4K3ID 5IGOA 3SJLD 2IWKA 4XYHA 3MZLA 4HDJA 5IC7A 3MZKA 3V9FA 5A2Qg 4U7AA 5HE0B 5GSAA 4AOWA 4PNKB 2PM9B 4FWWA 4CY3A 2GNQA 3EI4A 3MKSB 4GQ1A 5C2WB 4O1QD 2P9NC 4CZYA 4O9DA 3RFHA 3IIYA 3EI1B 3I7LA 5CXCB 3OTTA 4Y7RA 4A2LA 3RRMC 3SBPA 4FA4D 3U4YA 3I8EA 3UVNA 2YNNA 3P4FA 2O9KA 4ZN4A 4G56B 5EMMB 2H9PA 2I3TA 2UZXB 2HJ4A 4X60B 4A11A 3C75H 3I7KA 2OIZA 2XU7A 2J56H 3AH8B 5GXIA 3EI2B 3UVLA 5TF2A 3RN1D 2GC7A 3RFGA 5I5IA 1JOFA 3SCYA 2AQ5A 4PC0A 4J8BA 4E54A 2P9IC 3PVUB 4CZXA 4A0BB 3BG1A 2IUQA 3ORVD 5TEFA 3RLMD 4JSNC 2H47A 1OMWB 3UKRC 2OK6A 2P9PC 4CC9A 4J84A 3MXXA 4A09B 4D0KA 4FA1D 4E5ZA 3J81g 2XYIA 3DSMA 4PBZA 3C99A 3PXTD 5H1MA 3JB9L 3AFCA 3N0DA 3E0CA 3KRWB 4GQ2P 3RN0D 5K19A 2AGZA 4CI3A 1SHYB 4U1EI 1A0RB 2XL2A 1P22A 3F3PA 3OKYA 3PSCB 3RMZD 5IT9g 4J0XA 5TDHB 5FKRA 4UI9R 3I2NA 3EI3A 4CI2A 2CNXA 4O3TB 3L4OD 4JD2C 4ERQA 4JT6C 4GGCA 1NEXB 2I3SA 1MG2A 2I0SA 3JZGA 4GM8A 3SLED 3UKUC 1XHMA 5IGQA 4ZOZA 4XEIC 3EG6A 5GXHA 2TRCB 4O45A 3J80g 4A0AA 2YBAA 2BBKH 3N0EA 1U4CA 3OL2B 3PXSD 4GGDA 2IURA 1MDAH 5TEEA 4XYIA 5EMLB 3A0FA 4QQEA 4FA9D 2B5LA 2OVRB 1K32A 2AGYA 2CO0A 1OLZA 4TZ4A 4A2MA 2G9AA 5KDOB 3JZNA 4A08A 4FA5D 1JMZB 3GFCA 3UVKA 5HE1B 5THAA 3SHFA 5EMJB 4ZOXA 3SXTD 3UR4A 3IKOA 2UZYB 3UVOA 2G99A 3IJCA 2CN2A 2YNPA 4OWRA 5CXBB 2CE8A 2AH0A 5CYKA 3I7HA 4CI8A 3RSEC 3FRXA 5FA5B 5FXYA 1SQJA 1L0QA 4J73A 3OKTA 3PSLA 5EM2B 2Q7QA 1GXRA 2EBSA 3DM0A 1VYHC 4PSWB 5JWZA 4CI1A 5FLXg 2QC5A 4CY5A 4PBYA 3GREA 2H6QA 4IA9A 3IJ0A 3I8CA 2H14A 3BWSA 3PXWD 1PI6A 1TBGA 5EAPA 4N14A 1FWXA 1S4UX 2P9LC 4JSXC 5IJ7E 4ESGA 3KRXB 2BCJB 4J82A 4CY1A 1JJUB 4R7AB 1QNIA 4JSPC 1RI6A 2OVPB 2PM9A 4GQBB 5EAMA 2PM6B 4QL1A 3I7PA 3I7NA 3SN6B 3SFZA 2YB8B 3FM0A 5HE2B 1N6EA 5H14A 4J0WA 1YFQA 4L1QD 2AGLA 4L9OA 3K27A 5B4WA 5FKSA 4D6VA 3EI4B 1SQ9A 3EWEA 3SBRA 4PSXB 4LG8A 3HFQA 2P9UC 5SXMA 3VA6A 4IMMA 3EI2A 5I5JA 1PBYB 3SMRA 2H9NA 2OK4A 1JMXB 3NVNA 4A0BA
chains in the Genus database with same CATH superfamily
3DDUA 5FKQA 2CO0C 3F3FA 4JT5C 2VZ1A 3VGZA 3B7FA 4A7JA 4J86A 5C86A 2VDRA 3OKWA 4QT8A 3AL8A 4A11B 3O4JA 5M5VA 2H9MA 3K26A 5FFGA 3I7OA 2YMUA 3IIWA 2HKRA 2XL3A 4JHPC 3AL9A 1XIPA 4E54B 2GC4A 1K8KC 4L3HD 1E8MA 5M5UA 1B9XA 2VZ3A 3JZHA 1MG3A 5HQGA 2H68A 4EWRA 2Z2OA 4NSXA 5K1CC 5C2VB 4X61B 3OW8A 4NENA 3SWSD 4K3JB 4JSVC 1N6DA 2EICA 2I0RA 4KFMB 3DXKC 2OJYA 2Z2NA 3CIKB 4E5ZB 1TYQC 1VE7A 1Q47A 1N6FA 2QXVA 4J81A 4BH6A 3NVXA 4AEZA 5AMSA 4LG9A 5EARA 4LGNA 3L4MD 4L3GD 5HE3B 2IUPA 3IJ1A 4GGAA 4Y5RD 3T3PA 4O3UB 3V5WB 4DNVA 2B5NA 4MK0B 4MMXA 2H6KA 3OKYB 5I5MA 3O4IA 3EI3B 2AH1A 2OVQB 4ERYA 3JPXA 2W18A 5EMKB 3C5MA 2IAAA 4Z7OA 4GMBA 3OL2A 1UOQA 3JAMg 2VDPA 3NIFA 4X3EA 4J8GA 1U8CA 4YVDA 4J77A 4H5IA 2H3XA 1GG2B 2H6NA 4GZ8A 4CY2A 4ZOYA 3V7DB 4PXWA 2J57G 4G1MA 2VDNA 1PEVA 4BL0A 2J55H 4WK0A 4JXMA 4A0AB 1YR2A 5IJ8E 3QHYB 2HYEA 4H5JA 3ODTA 3IULA 4RE6A 5FKTA 3W15A 2HU7A 1XKSA 5AJAA 4ZOVA 3PVWB 5M61A 1PGUA 2H13A 3AL8B 2AGWA 2HKMA 4IRZA 1ERJA 3QI0A 3ZDYA 3EI1A 1E8NA 4I79A 5EALA 2B4EA 2HESX 2MTAH 5CXCA 5FQDA 4GM3A 4FAND 5CXBA 1B9YA 1O6GA 2IWFA 3EMHA 2CE9A 4J87A 2PM7B 3CFVA 3IUJA 2WQ8A 2P9SC 1TYEA 2XZGA 1H2YA 4A08B 3DXMC 4FAVD 4MMYA 4NBMA 3K6SA 3BG0A 5EM2A 4X63B 1O6FA 5AFU3 5C9ZB 4ERZA 3PE7A 2HJBA 3V4PA 1U2VC 3EU7A 4GM9A 4OZUA 3DWLC 2I0TA 2HU5A 4FB1D 3F3GA 5CYKB 4ES0A 3MKQA 1GOTB 4WK2A 2HXCA 2CN3A 2H9LA 5H17A 3CFSB 3I89A 1R5MA 2P9KC 3FGBA 2PBIB 1NR0A 3NVQA 3MMYA 5E6SA 3UVMA 4J79A 4BUJC 3JRPA 3MUOA 2Z2PA 1H2XA 4FHLA 4A09A 2B5MA 1GP2B 3VH0A 2YNOA 1I2MB 3ULEC 2VDOA 5M5TA 2AGXA 4AMZA 4QRJA 3ZWLB 3C9CA 1GOGA 2XDWA 3SVWD 3SBQA 5GMKn 2IUVA 3JROA 4Z8LA 4BP9A 4CZVA 1VE6A 5HYNB 3EQ7A 4J78A 4K3ID 1E5TA 3IVMA 5IGOA 4UM8A 3SJLD 2EIDA 2IWKA 1QFMA 4XYHA 3MZLA 4HDJA 2JKXA 5IC7A 1VZ3A 3MZKA 3V9FA 5A2Qg 4U7AA 5HE0B 5GSAA 4AOWA 4PNKB 2PM9B 5HDBA 4FWWA 4CY3A 2GNQA 3EI4A 1VZ2A 3MKSB 4GQ1A 4JHNA 4O1QD 5C2WB 4AMYA 2P9NC 4CZYA 2QZPA 4NAAA 4O9DA 4BCCA 3RFHA 3IIYA 3EI1B 3I7LA 5CXCB 3OTTA 3GC3B 4Y7RA 4A2LA 3RRMC 3SBPA 4FA4D 3U4YA 3I8EA 3UVNA 2YNNA 3P4FA 2O9KA 4ZN4A 4G56B 5EMMB 2H9PA 2I3TA 2UZXB 2HJ4A 4X60B 1GOFA 4A11A 3C75H 3I7KA 2OIZA 2XU7A 2J56H 3AH8B 5GXIA 3EI2B 3K71A 3UVLA 5TF2A 3RN1D 2GC7A 1JTDB 3RFGA 5I5IA 1JOFA 3SCYA 2AQ5A 4PC0A 4J8BA 4E54A 2P9IC 3PVUB 4CZXA 4A0BB 3BG1A 2IUQA 3ORVD 5TEFA 3RLMD 3ZDXA 3FCUA 3ZE0A 4JSNC 2H47A 4MMZA 1QFSA 5E6RA 1BPOA 1OMWB 3T3MA 3UKRC 4DNWA 2OK6A 2P9PC 4O02A 4CC9A 4J84A 3MXXA 4RE5A 4D0KA 4A09B 4FA1D 4E5ZA 3J81g 2XYIA 3DSMA 4PBZA 3FCSA 3C99A 5M5RA 3PXTD 5H1MA 3JB9L 3AFCA 3N0DA 3E0CA 3KRWB 4UM9A 4GQ2P 3RN0D 5K19A 2AGZA 4CI3A 1SHYB 2HU8A 4U1EI 2XE4A 1A0RB 2XL2A 1P22A 3F3PA 4BCDA 3OKYA 3PSCB 3RMZD 5IT9g 4J0XA 5TDHB 5FKRA 4UI9R 3I2NA 3EI3A 1H2ZA 4CI2A 2CNXA 3L4OD 4JD2C 4O3TB 1A12A 4ERQA 3VI4A 4JT6C 4GGCA 1NEXB 1T2XA 2I3SA 3IURA 1MG2A 3IUMA 3V4VA 2I0SA 3EQ9A 3JZGA 4GM8A 3SLED 3UKUC 1XHMA 5IGQA 4ZOZA 4XEIC 3EG6A 5GXHA 2TRCB 3MVDK 4O45A 3J80g 4A0AA 2YBAA 2BBKH 3NIDA 1K3IA 3N0EA 2QR5A 1U4CA 3OL2B 3K72A 3PXSD 4GGDA 2IURA 1M1XA 1MDAH 3GD1I 3ZE1A 5TEEA 1UOPA 4XYIA 5EMLB 3O4GA 3A0FA 4QAMA 4QQEA 4FA9D 4BP8A 2B5LA 2OVRB 4WK4A 1K32A 2AGYA 2CO0A 1OLZA 2EIEA 4TZ4A 2EIBA 4A2MA 2G9AA 5KDOB 4G1EA 1H2WA 3JZNA 4A08A 4FA5D 1JMZB 3GFCA 3MUNA 3UVKA 5HE1B 5THAA 3SHFA 5EMJB 4ZOXA 3SXTD 3UR4A 4Z7NA 1JV2A 3IKOA 2UZYB 3UVOA 2G99A 3IJCA 2CN2A 2YNPA 4OWRA 5CXBB 4Z7QA 4G55A 2CE8A 2AH0A 5FFOA 3IUQA 5CYKA 3NIGA 3I7HA 4CI8A 3RSEC 3FRXA 5FA5B 5FXYA 1SQJA 1L0QA 2VDLA 4J73A 3OKTA 3PSLA 1GOHA 5EM2B 5C92A 2Q7QA 1GXRA 2EBSA 5E6UA 4BCBA 3DM0A 4O2WA 1VYHC 4PSWB 5JWZA 4CI1A 5FLXg 2QC5A 4CY5A 2VDKA 3O4HA 4PBYA 3GREA 2H6QA 4IA9A 3IJ0A 1L5GA 3I8CA 1UOOA 2H14A 3BWSA 3PXWD 1PI6A 1TBGA 3VI3A 5EAPA 3OF7A 4N14A 1FWXA 3ZDZA 1S4UX 2P9LC 4JSXC 4AN0A 4AX4A 5IJ7E 4ESGA 3KRXB 2BCJB 2VDMA 4J82A 4CY1A 3IUNA 4NC4A 1JJUB 4R7AB 1QNIA 4JSPC 1RI6A 2OVPB 2PM9A 4GQBB 5EAMA 2PM6B 3EQ8A 5M5SA 4DNUA 4QL1A 3I7PA 3I7NA 3SN6B 1C9LA 3SFZA 2YB8B 3FM0A 3IJEA 1N6EA 4L1MA 5HE2B 5H14A 1C9IA 4J0WA 1YFQA 4L1QD 4AN1A 3KCIA 4WJKA 2AGLA 4L9OA 3K27A 5B4WA 5FKSA 4D6VA 1UTCA 3EI4B 1SQ9A 3EWEA 2VDQA 3SBRA 2VC2A 4PSXB 4LG8A 3HFQA 2P9UC 5SXMA 3VA6A 3ZE2A 4IMMA 3EI2A 5I5JA 1PBYB 3SMRA 2H9NA 2OK4A 1JMXB 2BKLA 3NVNA 4D9SA 4A0BA
chains in the Genus database with same CATH topology
5FKQA 2CO0C 3F3FA 4JT5C 3VGZA 3B7FA 4A7JA 4J86A 4A11B 3OKWA 4QT8A 3AL8A 2H9MA 3K26A 3I7OA 2YMUA 3IIWA 2HKRA 2XL3A 3AL9A 1XIPA 4E54B 2GC4A 1K8KC 4L3HD 1B9XA 3JZHA 1MG3A 5HQGA 2H68A 4EWRA 2Z2OA 4NSXA 5K1CC 5C2VB 4X61B 3OW8A 3SWSD 4K3JB 4JSVC 1N6DA 2I0RA 4KFMB 3DXKC 2OJYA 2Z2NA 3CIKB 4E5ZB 1TYQC 1Q47A 1N6FA 2QXVA 4J81A 4BH6A 3NVXA 4AEZA 5AMSA 4LG9A 5EARA 4LGNA 3L4MD 4L3GD 5HE3B 2IUPA 3IJ1A 4GGAA 4Y5RD 3V5WB 4O3UB 2B5NA 4MK0B 2H6KA 3OKYB 5I5MA 3EI3B 2AH1A 2OVQB 4ERYA 3JPXA 2W18A 5EMKB 3C5MA 2IAAA 4GMBA 3OL2A 3JAMg 4X3EA 4J8GA 4YVDA 4J77A 4H5IA 2H3XA 1GG2B 2H6NA 4GZ8A 4CY2A 4ZOYA 3V7DB 4PXWA 2J57G 1PEVA 4BL0A 2J55H 4JXMA 4A0AB 5IJ8E 2HYEA 4H5JA 3ODTA 5FKTA 3W15A 1XKSA 5AJAA 4ZOVA 3PVWB 1PGUA 2H13A 3AL8B 2AGWA 2HKMA 1ERJA 3EI1A 4I79A 5EALA 2B4EA 2HESX 2MTAH 5CXCA 5FQDA 4GM3A 4FAND 5CXBA 1B9YA 2IWFA 3EMHA 2CE9A 4J87A 2PM7B 3CFVA 2P9SC 4A08B 3DXMC 4FAVD 3BG0A 5EM2A 4X63B 5AFU3 5C9ZB 4ERZA 3PE7A 2HJBA 1U2VC 3EU7A 4GM9A 4OZUA 3DWLC 2I0TA 4FB1D 3F3GA 5CYKB 4ES0A 3MKQA 1GOTB 2HXCA 2CN3A 2H9LA 5H17A 3CFSB 3I89A 1R5MA 2P9KC 3FGBA 2PBIB 1NR0A 3NVQA 3MMYA 3UVMA 4J79A 4BUJC 3JRPA 2Z2PA 4FHLA 4A09A 2B5MA 1GP2B 3VH0A 2YNOA 3ULEC 2AGXA 4QRJA 3ZWLB 3C9CA 3SVWD 3SBQA 5GMKn 2IUVA 3JROA 4Z8LA 4CZVA 5HYNB 4J78A 4K3ID 5IGOA 3SJLD 2IWKA 4XYHA 3MZLA 4HDJA 5IC7A 3MZKA 3V9FA 5A2Qg 4U7AA 5HE0B 5GSAA 4AOWA 4PNKB 2PM9B 4FWWA 4CY3A 2GNQA 3EI4A 3MKSB 4GQ1A 5C2WB 4O1QD 2P9NC 4CZYA 4O9DA 3RFHA 3IIYA 3EI1B 3I7LA 5CXCB 3OTTA 4Y7RA 4A2LA 3RRMC 3SBPA 4FA4D 3U4YA 3I8EA 3UVNA 2YNNA 3P4FA 2O9KA 4ZN4A 4G56B 5EMMB 2H9PA 2I3TA 2UZXB 2HJ4A 4X60B 4A11A 3C75H 3I7KA 2OIZA 2XU7A 2J56H 3AH8B 5GXIA 3EI2B 3UVLA 5TF2A 3RN1D 2GC7A 3RFGA 5I5IA 1JOFA 3SCYA 2AQ5A 4PC0A 4J8BA 4E54A 2P9IC 3PVUB 4CZXA 4A0BB 3BG1A 2IUQA 3ORVD 5TEFA 3RLMD 4JSNC 2H47A 1OMWB 3UKRC 2OK6A 2P9PC 4CC9A 4J84A 3MXXA 4A09B 4D0KA 4FA1D 4E5ZA 3J81g 2XYIA 3DSMA 4PBZA 3C99A 3PXTD 5H1MA 3JB9L 3AFCA 3N0DA 3E0CA 3KRWB 4GQ2P 3RN0D 5K19A 2AGZA 4CI3A 1SHYB 4U1EI 1A0RB 2XL2A 1P22A 3F3PA 3OKYA 3PSCB 3RMZD 5IT9g 4J0XA 5TDHB 5FKRA 4UI9R 3I2NA 3EI3A 4CI2A 2CNXA 4O3TB 3L4OD 4JD2C 4ERQA 4JT6C 4GGCA 1NEXB 2I3SA 1MG2A 2I0SA 3JZGA 4GM8A 3SLED 3UKUC 1XHMA 5IGQA 4ZOZA 4XEIC 3EG6A 5GXHA 2TRCB 4O45A 3J80g 4A0AA 2YBAA 2BBKH 3N0EA 1U4CA 3OL2B 3PXSD 4GGDA 2IURA 1MDAH 5TEEA 4XYIA 5EMLB 3A0FA 4QQEA 4FA9D 2B5LA 2OVRB 1K32A 2AGYA 2CO0A 1OLZA 4TZ4A 4A2MA 2G9AA 5KDOB 3JZNA 4A08A 4FA5D 1JMZB 3GFCA 3UVKA 5HE1B 5THAA 3SHFA 5EMJB 4ZOXA 3SXTD 3UR4A 3IKOA 2UZYB 3UVOA 2G99A 3IJCA 2CN2A 2YNPA 4OWRA 5CXBB 2CE8A 2AH0A 5CYKA 3I7HA 4CI8A 3RSEC 3FRXA 5FA5B 5FXYA 1SQJA 1L0QA 4J73A 3OKTA 3PSLA 5EM2B 2Q7QA 1GXRA 2EBSA 3DM0A 1VYHC 4PSWB 5JWZA 4CI1A 5FLXg 2QC5A 4CY5A 4PBYA 3GREA 2H6QA 4IA9A 3IJ0A 3I8CA 2H14A 3BWSA 3PXWD 1PI6A 1TBGA 5EAPA 4N14A 1FWXA 1S4UX 2P9LC 4JSXC 5IJ7E 4ESGA 3KRXB 2BCJB 4J82A 4CY1A 1JJUB 4R7AB 1QNIA 4JSPC 1RI6A 2OVPB 2PM9A 4GQBB 5EAMA 2PM6B 4QL1A 3I7PA 3I7NA 3SN6B 3SFZA 2YB8B 3FM0A 5HE2B 1N6EA 5H14A 4J0WA 1YFQA 4L1QD 2AGLA 4L9OA 3K27A 5B4WA 5FKSA 4D6VA 3EI4B 1SQ9A 3EWEA 3SBRA 4PSXB 4LG8A 3HFQA 2P9UC 5SXMA 3VA6A 4IMMA 3EI2A 5I5JA 1PBYB 3SMRA 2H9NA 2OK4A 1JMXB 3NVNA 4A0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FKQ A;  2CO0 C;  3F3F A;  4JT5 C;  3VGZ A;  3B7F A;  4A7J A;  4J86 A;  4A11 B;  3OKW A;  4QT8 A;  3AL8 A;  2H9M A;  3K26 A;  3I7O A;  2YMU A;  3IIW A;  2HKR A;  2XL3 A;  3AL9 A;  1XIP A;  4E54 B;  2GC4 A;  1K8K C;  4L3H D;  1B9X A;  3JZH A;  1MG3 A;  5HQG A;  2H68 A;  4EWR A;  2Z2O A;  4NSX A;  5K1C C;  5C2V B;  4X61 B;  3OW8 A;  3SWS D;  4K3J B;  4JSV C;  1N6D A;  2I0R A;  4KFM B;  3DXK C;  2OJY A;  2Z2N A;  3CIK B;  4E5Z B;  1TYQ C;  1Q47 A;  1N6F A;  2QXV A;  4J81 A;  4BH6 A;  3NVX A;  4AEZ A;  5AMS A;  4LG9 A;  5EAR A;  4LGN A;  3L4M D;  4L3G D;  5HE3 B;  2IUP A;  3IJ1 A;  4GGA A;  4Y5R D;  3V5W B;  4O3U B;  2B5N A;  4MK0 B;  2H6K A;  3OKY B;  5I5M A;  3EI3 B;  2AH1 A;  2OVQ B;  4ERY A;  3JPX A;  2W18 A;  5EMK B;  3C5M A;  2IAA A;  4GMB A;  3OL2 A;  3JAM g;  4X3E A;  4J8G A;  4YVD A;  4J77 A;  4H5I A;  2H3X A;  1GG2 B;  2H6N A;  4GZ8 A;  4CY2 A;  4ZOY A;  3V7D B;  4PXW A;  2J57 G;  1PEV A;  4BL0 A;  2J55 H;  4JXM A;  4A0A B;  5IJ8 E;  2HYE A;  4H5J A;  3ODT A;  5FKT A;  3W15 A;  1XKS A;  5AJA A;  4ZOV A;  3PVW B;  1PGU A;  2H13 A;  3AL8 B;  2AGW A;  2HKM A;  1ERJ A;  3EI1 A;  4I79 A;  5EAL A;  2B4E A;  2HES X;  2MTA H;  5CXC A;  5FQD A;  4GM3 A;  4FAN D;  5CXB A;  1B9Y A;  2IWF A;  3EMH A;  2CE9 A;  4J87 A;  2PM7 B;  3CFV A;  2P9S C;  4A08 B;  3DXM C;  4FAV D;  3BG0 A;  5EM2 A;  4X63 B;  5AFU 3;  5C9Z B;  4ERZ A;  3PE7 A;  2HJB A;  1U2V C;  3EU7 A;  4GM9 A;  4OZU A;  3DWL C;  2I0T A;  4FB1 D;  3F3G A;  5CYK B;  4ES0 A;  3MKQ A;  1GOT B;  2HXC A;  2CN3 A;  2H9L A;  5H17 A;  3CFS B;  3I89 A;  1R5M A;  2P9K C;  3FGB A;  2PBI B;  1NR0 A;  3NVQ A;  3MMY A;  3UVM A;  4J79 A;  4BUJ C;  3JRP A;  2Z2P A;  4FHL A;  4A09 A;  2B5M A;  1GP2 B;  3VH0 A;  2YNO A;  3ULE C;  2AGX A;  4QRJ A;  3ZWL B;  3C9C A;  3SVW D;  3SBQ A;  5GMK n;  2IUV A;  3JRO A;  4Z8L A;  4CZV A;  5HYN B;  4J78 A;  4K3I D;  5IGO A;  3SJL D;  2IWK A;  4XYH A;  3MZL A;  4HDJ A;  5IC7 A;  3MZK A;  3V9F A;  5A2Q g;  4U7A A;  5HE0 B;  5GSA A;  4AOW A;  4PNK B;  2PM9 B;  4FWW A;  4CY3 A;  2GNQ A;  3EI4 A;  3MKS B;  4GQ1 A;  5C2W B;  4O1Q D;  2P9N C;  4CZY A;  4O9D A;  3RFH A;  3IIY A;  3EI1 B;  3I7L A;  5CXC B;  3OTT A;  4Y7R A;  4A2L A;  3RRM C;  3SBP A;  4FA4 D;  3U4Y A;  3I8E A;  3UVN A;  2YNN A;  3P4F A;  2O9K A;  4ZN4 A;  4G56 B;  5EMM B;  2H9P A;  2I3T A;  2UZX B;  2HJ4 A;  4X60 B;  4A11 A;  3C75 H;  3I7K A;  2OIZ A;  2XU7 A;  2J56 H;  3AH8 B;  5GXI A;  3EI2 B;  3UVL A;  5TF2 A;  3RN1 D;  2GC7 A;  3RFG A;  5I5I A;  1JOF A;  3SCY A;  2AQ5 A;  4PC0 A;  4J8B A;  4E54 A;  2P9I C;  3PVU B;  4CZX A;  4A0B B;  3BG1 A;  2IUQ A;  3ORV D;  5TEF A;  3RLM D;  4JSN C;  2H47 A;  1OMW B;  3UKR C;  2OK6 A;  2P9P C;  4CC9 A;  4J84 A;  3MXX A;  4A09 B;  4D0K A;  4FA1 D;  4E5Z A;  3J81 g;  2XYI A;  3DSM A;  4PBZ A;  3C99 A;  3PXT D;  5H1M A;  3JB9 L;  3AFC A;  3N0D A;  3E0C A;  3KRW B;  4GQ2 P;  3RN0 D;  5K19 A;  2AGZ A;  4CI3 A;  1SHY B;  4U1E I;  1A0R B;  2XL2 A;  1P22 A;  3F3P A;  3OKY A;  3PSC B;  3RMZ D;  5IT9 g;  4J0X A;  5TDH B;  5FKR A;  4UI9 R;  3I2N A;  3EI3 A;  4CI2 A;  2CNX A;  4O3T B;  3L4O D;  4JD2 C;  4ERQ A;  4JT6 C;  4GGC A;  1NEX B;  2I3S A;  1MG2 A;  2I0S A;  3JZG A;  4GM8 A;  3SLE D;  3UKU C;  1XHM A;  5IGQ A;  4ZOZ A;  4XEI C;  3EG6 A;  5GXH A;  2TRC B;  4O45 A;  3J80 g;  4A0A A;  2YBA A;  2BBK H;  3N0E A;  1U4C A;  3OL2 B;  3PXS D;  4GGD A;  2IUR A;  1MDA H;  5TEE A;  4XYI A;  5EML B;  3A0F A;  4QQE A;  4FA9 D;  2B5L A;  2OVR B;  1K32 A;  2AGY A;  2CO0 A;  1OLZ A;  4TZ4 A;  4A2M A;  2G9A A;  5KDO B;  3JZN A;  4A08 A;  4FA5 D;  1JMZ B;  3GFC A;  3UVK A;  5HE1 B;  5THA A;  3SHF A;  5EMJ B;  4ZOX A;  3SXT D;  3UR4 A;  3IKO A;  2UZY B;  3UVO A;  2G99 A;  3IJC A;  2CN2 A;  2YNP A;  4OWR A;  5CXB B;  2CE8 A;  2AH0 A;  5CYK A;  3I7H A;  4CI8 A;  3RSE C;  3FRX A;  5FA5 B;  5FXY A;  1SQJ A;  1L0Q A;  4J73 A;  3OKT A;  3PSL A;  5EM2 B;  2Q7Q A;  1GXR A;  2EBS A;  3DM0 A;  1VYH C;  4PSW B;  5JWZ A;  4CI1 A;  5FLX g;  2QC5 A;  4CY5 A;  4PBY A;  3GRE A;  2H6Q A;  4IA9 A;  3IJ0 A;  3I8C A;  2H14 A;  3BWS A;  3PXW D;  1PI6 A;  1TBG A;  5EAP A;  4N14 A;  1FWX A;  1S4U X;  2P9L C;  4JSX C;  5IJ7 E;  4ESG A;  3KRX B;  2BCJ B;  4J82 A;  4CY1 A;  1JJU B;  4R7A B;  1QNI A;  4JSP C;  1RI6 A;  2OVP B;  2PM9 A;  4GQB B;  5EAM A;  2PM6 B;  4QL1 A;  3I7P A;  3I7N A;  3SN6 B;  3SFZ A;  2YB8 B;  3FM0 A;  5HE2 B;  1N6E A;  5H14 A;  4J0W A;  1YFQ A;  4L1Q D;  2AGL A;  4L9O A;  3K27 A;  5B4W A;  5FKS A;  4D6V A;  3EI4 B;  1SQ9 A;  3EWE A;  3SBR A;  4PSX B;  4LG8 A;  3HFQ A;  2P9U C;  5SXM A;  3VA6 A;  4IMM A;  3EI2 A;  5I5J A;  1PBY B;  3SMR A;  2H9N A;  2OK4 A;  1JMX B;  3NVN A;  4A0B A; 
#chains in the Genus database with same CATH topology
 3DDU A;  5FKQ A;  2CO0 C;  3F3F A;  4JT5 C;  2VZ1 A;  3VGZ A;  3B7F A;  4A7J A;  4J86 A;  5C86 A;  2VDR A;  3OKW A;  4QT8 A;  3AL8 A;  4A11 B;  3O4J A;  5M5V A;  2H9M A;  3K26 A;  5FFG A;  3I7O A;  2YMU A;  3IIW A;  2HKR A;  2XL3 A;  4JHP C;  3AL9 A;  1XIP A;  4E54 B;  2GC4 A;  1K8K C;  4L3H D;  1E8M A;  5M5U A;  1B9X A;  2VZ3 A;  3JZH A;  1MG3 A;  5HQG A;  2H68 A;  4EWR A;  2Z2O A;  4NSX A;  5K1C C;  5C2V B;  4X61 B;  3OW8 A;  4NEN A;  3SWS D;  4K3J B;  4JSV C;  1N6D A;  2EIC A;  2I0R A;  4KFM B;  3DXK C;  2OJY A;  2Z2N A;  3CIK B;  4E5Z B;  1TYQ C;  1VE7 A;  1Q47 A;  1N6F A;  2QXV A;  4J81 A;  4BH6 A;  3NVX A;  4AEZ A;  5AMS A;  4LG9 A;  5EAR A;  4LGN A;  3L4M D;  4L3G D;  5HE3 B;  2IUP A;  3IJ1 A;  4GGA A;  4Y5R D;  3T3P A;  4O3U B;  3V5W B;  4DNV A;  2B5N A;  4MK0 B;  4MMX A;  2H6K A;  3OKY B;  5I5M A;  3O4I A;  3EI3 B;  2AH1 A;  2OVQ B;  4ERY A;  3JPX A;  2W18 A;  5EMK B;  3C5M A;  2IAA A;  4Z7O A;  4GMB A;  3OL2 A;  1UOQ A;  3JAM g;  2VDP A;  3NIF A;  4X3E A;  4J8G A;  1U8C A;  4YVD A;  4J77 A;  4H5I A;  2H3X A;  1GG2 B;  2H6N A;  4GZ8 A;  4CY2 A;  4ZOY A;  3V7D B;  4PXW A;  2J57 G;  4G1M A;  2VDN A;  1PEV A;  4BL0 A;  2J55 H;  4WK0 A;  4JXM A;  4A0A B;  1YR2 A;  5IJ8 E;  3QHY B;  2HYE A;  4H5J A;  3ODT A;  3IUL A;  4RE6 A;  5FKT A;  3W15 A;  2HU7 A;  1XKS A;  5AJA A;  4ZOV A;  3PVW B;  5M61 A;  1PGU A;  2H13 A;  3AL8 B;  2AGW A;  2HKM A;  4IRZ A;  1ERJ A;  3QI0 A;  3ZDY A;  3EI1 A;  1E8N A;  4I79 A;  5EAL A;  2B4E A;  2HES X;  2MTA H;  5CXC A;  5FQD A;  4GM3 A;  4FAN D;  5CXB A;  1B9Y A;  1O6G A;  2IWF A;  3EMH A;  2CE9 A;  4J87 A;  2PM7 B;  3CFV A;  3IUJ A;  2WQ8 A;  2P9S C;  1TYE A;  2XZG A;  1H2Y A;  4A08 B;  3DXM C;  4FAV D;  4MMY A;  4NBM A;  3K6S A;  3BG0 A;  5EM2 A;  4X63 B;  1O6F A;  5AFU 3;  5C9Z B;  4ERZ A;  3PE7 A;  2HJB A;  3V4P A;  1U2V C;  3EU7 A;  4GM9 A;  4OZU A;  3DWL C;  2I0T A;  2HU5 A;  4FB1 D;  3F3G A;  5CYK B;  4ES0 A;  3MKQ A;  1GOT B;  4WK2 A;  2HXC A;  2CN3 A;  2H9L A;  5H17 A;  3CFS B;  3I89 A;  1R5M A;  2P9K C;  3FGB A;  2PBI B;  1NR0 A;  3NVQ A;  3MMY A;  5E6S A;  3UVM A;  4J79 A;  4BUJ C;  3JRP A;  3MUO A;  2Z2P A;  1H2X A;  4FHL A;  4A09 A;  2B5M A;  1GP2 B;  3VH0 A;  2YNO A;  1I2M B;  3ULE C;  2VDO A;  5M5T A;  2AGX A;  4AMZ A;  4QRJ A;  3ZWL B;  3C9C A;  1GOG A;  2XDW A;  3SVW D;  3SBQ A;  5GMK n;  2IUV A;  3JRO A;  4Z8L A;  4BP9 A;  4CZV A;  1VE6 A;  5HYN B;  3EQ7 A;  4J78 A;  4K3I D;  1E5T A;  3IVM A;  5IGO A;  4UM8 A;  3SJL D;  2EID A;  2IWK A;  1QFM A;  4XYH A;  3MZL A;  4HDJ A;  2JKX A;  5IC7 A;  1VZ3 A;  3MZK A;  3V9F A;  5A2Q g;  4U7A A;  5HE0 B;  5GSA A;  4AOW A;  4PNK B;  2PM9 B;  5HDB A;  4FWW A;  4CY3 A;  2GNQ A;  3EI4 A;  1VZ2 A;  3MKS B;  4GQ1 A;  4JHN A;  4O1Q D;  5C2W B;  4AMY A;  2P9N C;  4CZY A;  2QZP A;  4NAA A;  4O9D A;  4BCC A;  3RFH A;  3IIY A;  3EI1 B;  3I7L A;  5CXC B;  3OTT A;  3GC3 B;  4Y7R A;  4A2L A;  3RRM C;  3SBP A;  4FA4 D;  3U4Y A;  3I8E A;  3UVN A;  2YNN A;  3P4F A;  2O9K A;  4ZN4 A;  4G56 B;  5EMM B;  2H9P A;  2I3T A;  2UZX B;  2HJ4 A;  4X60 B;  1GOF A;  4A11 A;  3C75 H;  3I7K A;  2OIZ A;  2XU7 A;  2J56 H;  3AH8 B;  5GXI A;  3EI2 B;  3K71 A;  3UVL A;  5TF2 A;  3RN1 D;  2GC7 A;  1JTD B;  3RFG A;  5I5I A;  1JOF A;  3SCY A;  2AQ5 A;  4PC0 A;  4J8B A;  4E54 A;  2P9I C;  3PVU B;  4CZX A;  4A0B B;  3BG1 A;  2IUQ A;  3ORV D;  5TEF A;  3RLM D;  3ZDX A;  3FCU A;  3ZE0 A;  4JSN C;  2H47 A;  4MMZ A;  1QFS A;  5E6R A;  1BPO A;  1OMW B;  3T3M A;  3UKR C;  4DNW A;  2OK6 A;  2P9P C;  4O02 A;  4CC9 A;  4J84 A;  3MXX A;  4RE5 A;  4D0K A;  4A09 B;  4FA1 D;  4E5Z A;  3J81 g;  2XYI A;  3DSM A;  4PBZ A;  3FCS A;  3C99 A;  5M5R A;  3PXT D;  5H1M A;  3JB9 L;  3AFC A;  3N0D A;  3E0C A;  3KRW B;  4UM9 A;  4GQ2 P;  3RN0 D;  5K19 A;  2AGZ A;  4CI3 A;  1SHY B;  2HU8 A;  4U1E I;  2XE4 A;  1A0R B;  2XL2 A;  1P22 A;  3F3P A;  4BCD A;  3OKY A;  3PSC B;  3RMZ D;  5IT9 g;  4J0X A;  5TDH B;  5FKR A;  4UI9 R;  3I2N A;  3EI3 A;  1H2Z A;  4CI2 A;  2CNX A;  3L4O D;  4JD2 C;  4O3T B;  1A12 A;  4ERQ A;  3VI4 A;  4JT6 C;  4GGC A;  1NEX B;  1T2X A;  2I3S A;  3IUR A;  1MG2 A;  3IUM A;  3V4V A;  2I0S A;  3EQ9 A;  3JZG A;  4GM8 A;  3SLE D;  3UKU C;  1XHM A;  5IGQ A;  4ZOZ A;  4XEI C;  3EG6 A;  5GXH A;  2TRC B;  3MVD K;  4O45 A;  3J80 g;  4A0A A;  2YBA A;  2BBK H;  3NID A;  1K3I A;  3N0E A;  2QR5 A;  1U4C A;  3OL2 B;  3K72 A;  3PXS D;  4GGD A;  2IUR A;  1M1X A;  1MDA H;  3GD1 I;  3ZE1 A;  5TEE A;  1UOP A;  4XYI A;  5EML B;  3O4G A;  3A0F A;  4QAM A;  4QQE A;  4FA9 D;  4BP8 A;  2B5L A;  2OVR B;  4WK4 A;  1K32 A;  2AGY A;  2CO0 A;  1OLZ A;  2EIE A;  4TZ4 A;  2EIB A;  4A2M A;  2G9A A;  5KDO B;  4G1E A;  1H2W A;  3JZN A;  4A08 A;  4FA5 D;  1JMZ B;  3GFC A;  3MUN A;  3UVK A;  5HE1 B;  5THA A;  3SHF A;  5EMJ B;  4ZOX A;  3SXT D;  3UR4 A;  4Z7N A;  1JV2 A;  3IKO A;  2UZY B;  3UVO A;  2G99 A;  3IJC A;  2CN2 A;  2YNP A;  4OWR A;  5CXB B;  4Z7Q A;  4G55 A;  2CE8 A;  2AH0 A;  5FFO A;  3IUQ A;  5CYK A;  3NIG A;  3I7H A;  4CI8 A;  3RSE C;  3FRX A;  5FA5 B;  5FXY A;  1SQJ A;  1L0Q A;  2VDL A;  4J73 A;  3OKT A;  3PSL A;  1GOH A;  5EM2 B;  5C92 A;  2Q7Q A;  1GXR A;  2EBS A;  5E6U A;  4BCB A;  3DM0 A;  4O2W A;  1VYH C;  4PSW B;  5JWZ A;  4CI1 A;  5FLX g;  2QC5 A;  4CY5 A;  2VDK A;  3O4H A;  4PBY A;  3GRE A;  2H6Q A;  4IA9 A;  3IJ0 A;  1L5G A;  3I8C A;  1UOO A;  2H14 A;  3BWS A;  3PXW D;  1PI6 A;  1TBG A;  3VI3 A;  5EAP A;  3OF7 A;  4N14 A;  1FWX A;  3ZDZ A;  1S4U X;  2P9L C;  4JSX C;  4AN0 A;  4AX4 A;  5IJ7 E;  4ESG A;  3KRX B;  2BCJ B;  2VDM A;  4J82 A;  4CY1 A;  3IUN A;  4NC4 A;  1JJU B;  4R7A B;  1QNI A;  4JSP C;  1RI6 A;  2OVP B;  2PM9 A;  4GQB B;  5EAM A;  2PM6 B;  3EQ8 A;  5M5S A;  4DNU A;  4QL1 A;  3I7P A;  3I7N A;  3SN6 B;  1C9L A;  3SFZ A;  2YB8 B;  3FM0 A;  3IJE A;  1N6E A;  4L1M A;  5HE2 B;  5H14 A;  1C9I A;  4J0W A;  1YFQ A;  4L1Q D;  4AN1 A;  3KCI A;  4WJK A;  2AGL A;  4L9O A;  3K27 A;  5B4W A;  5FKS A;  4D6V A;  1UTC A;  3EI4 B;  1SQ9 A;  3EWE A;  2VDQ A;  3SBR A;  2VC2 A;  4PSX B;  4LG8 A;  3HFQ A;  2P9U C;  5SXM A;  3VA6 A;  3ZE2 A;  4IMM A;  3EI2 A;  5I5J A;  1PBY B;  3SMR A;  2H9N A;  2OK4 A;  1JMX B;  2BKL A;  3NVN A;  4D9S A;  4A0B A; 
#chains in the Genus database with same CATH homology
 5FKQ A;  2CO0 C;  3F3F A;  4JT5 C;  3VGZ A;  3B7F A;  4A7J A;  4J86 A;  4A11 B;  3OKW A;  4QT8 A;  3AL8 A;  2H9M A;  3K26 A;  3I7O A;  2YMU A;  3IIW A;  2HKR A;  2XL3 A;  3AL9 A;  1XIP A;  4E54 B;  2GC4 A;  1K8K C;  4L3H D;  1B9X A;  3JZH A;  1MG3 A;  5HQG A;  2H68 A;  4EWR A;  2Z2O A;  4NSX A;  5K1C C;  5C2V B;  4X61 B;  3OW8 A;  3SWS D;  4K3J B;  4JSV C;  1N6D A;  2I0R A;  4KFM B;  3DXK C;  2OJY A;  2Z2N A;  3CIK B;  4E5Z B;  1TYQ C;  1Q47 A;  1N6F A;  2QXV A;  4J81 A;  4BH6 A;  3NVX A;  4AEZ A;  5AMS A;  4LG9 A;  5EAR A;  4LGN A;  3L4M D;  4L3G D;  5HE3 B;  2IUP A;  3IJ1 A;  4GGA A;  4Y5R D;  3V5W B;  4O3U B;  2B5N A;  4MK0 B;  2H6K A;  3OKY B;  5I5M A;  3EI3 B;  2AH1 A;  2OVQ B;  4ERY A;  3JPX A;  2W18 A;  5EMK B;  3C5M A;  2IAA A;  4GMB A;  3OL2 A;  3JAM g;  4X3E A;  4J8G A;  4YVD A;  4J77 A;  4H5I A;  2H3X A;  1GG2 B;  2H6N A;  4GZ8 A;  4CY2 A;  4ZOY A;  3V7D B;  4PXW A;  2J57 G;  1PEV A;  4BL0 A;  2J55 H;  4JXM A;  4A0A B;  5IJ8 E;  2HYE A;  4H5J A;  3ODT A;  5FKT A;  3W15 A;  1XKS A;  5AJA A;  4ZOV A;  3PVW B;  1PGU A;  2H13 A;  3AL8 B;  2AGW A;  2HKM A;  1ERJ A;  3EI1 A;  4I79 A;  5EAL A;  2B4E A;  2HES X;  2MTA H;  5CXC A;  5FQD A;  4GM3 A;  4FAN D;  5CXB A;  1B9Y A;  2IWF A;  3EMH A;  2CE9 A;  4J87 A;  2PM7 B;  3CFV A;  2P9S C;  4A08 B;  3DXM C;  4FAV D;  3BG0 A;  5EM2 A;  4X63 B;  5AFU 3;  5C9Z B;  4ERZ A;  3PE7 A;  2HJB A;  1U2V C;  3EU7 A;  4GM9 A;  4OZU A;  3DWL C;  2I0T A;  4FB1 D;  3F3G A;  5CYK B;  4ES0 A;  3MKQ A;  1GOT B;  2HXC A;  2CN3 A;  2H9L A;  5H17 A;  3CFS B;  3I89 A;  1R5M A;  2P9K C;  3FGB A;  2PBI B;  1NR0 A;  3NVQ A;  3MMY A;  3UVM A;  4J79 A;  4BUJ C;  3JRP A;  2Z2P A;  4FHL A;  4A09 A;  2B5M A;  1GP2 B;  3VH0 A;  2YNO A;  3ULE C;  2AGX A;  4QRJ A;  3ZWL B;  3C9C A;  3SVW D;  3SBQ A;  5GMK n;  2IUV A;  3JRO A;  4Z8L A;  4CZV A;  5HYN B;  4J78 A;  4K3I D;  5IGO A;  3SJL D;  2IWK A;  4XYH A;  3MZL A;  4HDJ A;  5IC7 A;  3MZK A;  3V9F A;  5A2Q g;  4U7A A;  5HE0 B;  5GSA A;  4AOW A;  4PNK B;  2PM9 B;  4FWW A;  4CY3 A;  2GNQ A;  3EI4 A;  3MKS B;  4GQ1 A;  5C2W B;  4O1Q D;  2P9N C;  4CZY A;  4O9D A;  3RFH A;  3IIY A;  3EI1 B;  3I7L A;  5CXC B;  3OTT A;  4Y7R A;  4A2L A;  3RRM C;  3SBP A;  4FA4 D;  3U4Y A;  3I8E A;  3UVN A;  2YNN A;  3P4F A;  2O9K A;  4ZN4 A;  4G56 B;  5EMM B;  2H9P A;  2I3T A;  2UZX B;  2HJ4 A;  4X60 B;  4A11 A;  3C75 H;  3I7K A;  2OIZ A;  2XU7 A;  2J56 H;  3AH8 B;  5GXI A;  3EI2 B;  3UVL A;  5TF2 A;  3RN1 D;  2GC7 A;  3RFG A;  5I5I A;  1JOF A;  3SCY A;  2AQ5 A;  4PC0 A;  4J8B A;  4E54 A;  2P9I C;  3PVU B;  4CZX A;  4A0B B;  3BG1 A;  2IUQ A;  3ORV D;  5TEF A;  3RLM D;  4JSN C;  2H47 A;  1OMW B;  3UKR C;  2OK6 A;  2P9P C;  4CC9 A;  4J84 A;  3MXX A;  4A09 B;  4D0K A;  4FA1 D;  4E5Z A;  3J81 g;  2XYI A;  3DSM A;  4PBZ A;  3C99 A;  3PXT D;  5H1M A;  3JB9 L;  3AFC A;  3N0D A;  3E0C A;  3KRW B;  4GQ2 P;  3RN0 D;  5K19 A;  2AGZ A;  4CI3 A;  1SHY B;  4U1E I;  1A0R B;  2XL2 A;  1P22 A;  3F3P A;  3OKY A;  3PSC B;  3RMZ D;  5IT9 g;  4J0X A;  5TDH B;  5FKR A;  4UI9 R;  3I2N A;  3EI3 A;  4CI2 A;  2CNX A;  4O3T B;  3L4O D;  4JD2 C;  4ERQ A;  4JT6 C;  4GGC A;  1NEX B;  2I3S A;  1MG2 A;  2I0S A;  3JZG A;  4GM8 A;  3SLE D;  3UKU C;  1XHM A;  5IGQ A;  4ZOZ A;  4XEI C;  3EG6 A;  5GXH A;  2TRC B;  4O45 A;  3J80 g;  4A0A A;  2YBA A;  2BBK H;  3N0E A;  1U4C A;  3OL2 B;  3PXS D;  4GGD A;  2IUR A;  1MDA H;  5TEE A;  4XYI A;  5EML B;  3A0F A;  4QQE A;  4FA9 D;  2B5L A;  2OVR B;  1K32 A;  2AGY A;  2CO0 A;  1OLZ A;  4TZ4 A;  4A2M A;  2G9A A;  5KDO B;  3JZN A;  4A08 A;  4FA5 D;  1JMZ B;  3GFC A;  3UVK A;  5HE1 B;  5THA A;  3SHF A;  5EMJ B;  4ZOX A;  3SXT D;  3UR4 A;  3IKO A;  2UZY B;  3UVO A;  2G99 A;  3IJC A;  2CN2 A;  2YNP A;  4OWR A;  5CXB B;  2CE8 A;  2AH0 A;  5CYK A;  3I7H A;  4CI8 A;  3RSE C;  3FRX A;  5FA5 B;  5FXY A;  1SQJ A;  1L0Q A;  4J73 A;  3OKT A;  3PSL A;  5EM2 B;  2Q7Q A;  1GXR A;  2EBS A;  3DM0 A;  1VYH C;  4PSW B;  5JWZ A;  4CI1 A;  5FLX g;  2QC5 A;  4CY5 A;  4PBY A;  3GRE A;  2H6Q A;  4IA9 A;  3IJ0 A;  3I8C A;  2H14 A;  3BWS A;  3PXW D;  1PI6 A;  1TBG A;  5EAP A;  4N14 A;  1FWX A;  1S4U X;  2P9L C;  4JSX C;  5IJ7 E;  4ESG A;  3KRX B;  2BCJ B;  4J82 A;  4CY1 A;  1JJU B;  4R7A B;  1QNI A;  4JSP C;  1RI6 A;  2OVP B;  2PM9 A;  4GQB B;  5EAM A;  2PM6 B;  4QL1 A;  3I7P A;  3I7N A;  3SN6 B;  3SFZ A;  2YB8 B;  3FM0 A;  5HE2 B;  1N6E A;  5H14 A;  4J0W A;  1YFQ A;  4L1Q D;  2AGL A;  4L9O A;  3K27 A;  5B4W A;  5FKS A;  4D6V A;  3EI4 B;  1SQ9 A;  3EWE A;  3SBR A;  4PSX B;  4LG8 A;  3HFQ A;  2P9U C;  5SXM A;  3VA6 A;  4IMM A;  3EI2 A;  5I5J A;  1PBY B;  3SMR A;  2H9N A;  2OK4 A;  1JMX B;  3NVN A;  4A0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...