4AOWA

Crystal structure of the human rack1 protein at a resolution of 2.45 angstrom
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
312
structure length
305
Chain Sequence
b'EQMTLRGTLKGHNGWVTQIATTPQFPDMILSASRDKTIIMWKLTRDETNYGIPQRALRGHSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSSDNRQIVSGSRDKTIKLWNTLGVCKYTVQDESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGKIIVDELKQEAEPPQCTSLAWSADGQTLFAGYTDNLVRVWQVTI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GUANINE NUCLEOTIDE-BINDING PROTEIN SUBUNIT BETA-2-LIKE 1
molecule tags Receptor
source organism Homo sapiens
publication title Structure of Human Rack1 Protein at a Resolution of 2.45 A.
pubmed doi rcsb
total genus 76
structure length 305
sequence length 312
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4aowA01
4A09A 4QRJA 4CZVA 4JSXC 3MXXA 4O3UB 4A2LA 4E5ZA 5JWZA 3C5MA 2PM6B 4IA9A 4ESGA 1VYHC 2H6QA 3SWSD 4QQEA 5C9ZB 4GM9A 3SJLD 2YMUA 2H9LA 3RRMC 2YBAA 3AL8A 4KFMB 4K3ID 1MG3A 3F3FA 3EWEA 4YVDA 2CO0C 1JMXB 2PBIB 1GXRA 4J87A 5I5MA 4PSWB 4AOWA 3PXWD 5TF2A 5EMMB 2CE8A 2H9MA 4JSPC 4FAND 3PXSD 4ZN4A 2HXCA 5FKSA 3VGZA 4J8BA 4LGNA 2YNOA 5H17A 4CI2A 3RN1D 3EI4A 4J79A 1GG2B 3JZNA 4FA1D 2IWKA 4CY3A 4FWWA 4PNKB 2EBSA 2UZYB 5IJ7E 3IIYA 3C75H 4XEIC 3SBRA 4CI1A 2XL2A 4FA5D 2H14A 5EMKB 3CFVA 2H3XA 3EG6A 3I7NA 4CY1A 4X61B 3I7KA 4PXWA 3AL9A 3IKOA 4A0BA 2GC7A 3GFCA 3KRWB 4Y7RA 4JXMA 4ZOZA 3JZGA 3L4OD 2I0RA 2OVPB 3SXTD 5TEFA 3UKRC 2AGXA 4A09B 1FWXA 2J55H 4CZXA 3N0EA 5EM2B 3RFGA 3SLED 1SHYB 3K27A 4E54B 1B9YA 2P9IC 1JOFA 2AGWA 1QNIA 2H47A 3EI1B 2XU7A 3A0FA 3IJ0A 4X3EA 5EMJB 1U2VC 5B4WA 5C2WB 4EWRA 2QC5A 3IJCA 4Y5RD 4ZOXA 2OK6A 2P9UC 2Z2PA 2PM7B 2H13A 3BG1A 5HE0B 3AL8B 5HE2B 3W15A 2CE9A 3I7OA 4QL1A 5H1MA 2PM9A 2P9PC 4PBZA 1N6EA 4X60B 3SN6B 2GC4A 5AJAA 5EARA 4J84A 3RMZD 4FA9D 2Q7QA 4GQBB 5FLXg 3I8CA 3DSMA 3OKYA 4PBYA 2CN2A 4UI9R 4A11A 1ERJA 2P9KC 3B7FA 3UVNA 4CY2A 1JMZB 5CXBB 3OL2B 4TZ4A 3P4FA 4XYHA 5SXMA 2IUPA 3C99A 3GREA 5CYKA 3RN0D 5GXHA 2UZXB 3UKUC 5KDOB 2J56H 2HJBA 3I89A 3KRXB 2QXVA 4U7AA 3L4MD 1PI6A 5EAMA 1PGUA 2MTAH 3IJ1A 5C2VB 3EI3A 4FB1D 2HYEA 4A08A 2B5NA 1MG2A 2TRCB 2HKRA 4A2MA 3PVWB 4GM8A 1OMWB 3DM0A 2AGYA 3I7LA 2XYIA 2CO0A 4GMBA 1XHMA 4K3JB 2HKMA 4N14A 3PSLA 1N6FA 1N6DA 4G56B 3MZKA 2CNXA 3MZLA 2H6KA 5EMLB 2H9PA 3UVLA 2H6NA 2AGZA 4ERZA 3JAMg 4ERQA 3MKSB 4D0KA 4L1QD 1SQ9A 1SQJA 2XL3A 4GGAA 3RLMD 5I5IA 2I0SA 2IWFA 1U4CA 4Z8LA 4JSVC 3EMHA 3FM0A 1R5MA 2YNPA 4OZUA 2I3SA 3ULEC 3PXTD 4U1EI 3ORVD 3UVKA 2BCJB 4LG9A 3EI2A 2OVQB 1XKSA 2PM9B 4D6VA 4CI8A 4CZYA 2P9SC 3UVMA 3E0CA 3JZHA 1TBGA 2AQ5A 3OKWA 3ODTA 4ZOYA 3V5WB 4CY5A 3RFHA 3OW8A 2P9NC 4A11B 5IT9g 5CXBA 4JT6C 4R7AB 5CYKB 3DXMC 2B4EA 2GNQA 2IURA 4JT5C 5CXCB 4PC0A 3K26A 4JD2C 3MMYA 5FKRA 3V7DB 4NSXA 3IIWA 3AFCA 5EM2A 3SBQA 2OJYA 1NR0A 3NVXA 3I7PA 4A08B 4GQ2P 3SCYA 3PE7A 3JPXA 3U4YA 3VH0A 1JJUB 3EI1A 5FXYA 4J73A 4AEZA 2YB8B 4IMMA 2B5MA 1GOTB 4PSXB 1XIPA 4GZ8A 3OTTA 4LG8A 3BG0A 4J0WA 4H5IA 5K19A 4A0AB 3N0DA 4H5JA 3C9CA 5K1CC 3JRPA 4JSNC 3SMRA 4BL0A 3NVNA 4CI3A 2IUVA 1RI6A 4X63B 2I0TA 2CN3A 5I5JA 4GQ1A 2O9KA 4J81A 1TYQC 4L3HD 1B9XA 1L0QA 3I2NA 2IUQA 2I3TA 2Z2NA 2G99A 3F3GA 3HFQA 3PVUB 5IJ8E 4XYIA 3MKQA 4J77A 4O1QD 3OL2A 1GP2B 4ES0A 3EI2B 4GGCA 3VA6A 5IC7A 5HE1B 3BWSA 3PSCB 3DXKC 4GGDA 4O45A 4BUJC 5GMKn 2HJ4A 3NVQA 4E5ZB 3J80g 4HDJA 4O3TB 5FQDA 3EI3B 2P9LC 2J57G 5EAPA 3F3PA 2B5LA 1A0RB 1K8KC 2OIZA 3RSEC 5FKTA 1NEXB 4A0BB 2W18A 3DWLC 4O9DA 5A2Qg 4J8GA 4J78A 2IAAA 2Z2OA 2HESX 4BH6A 5GSAA 5TEEA 5H14A 4FAVD 3SFZA 3CFSB 1K32A 4MK0B 2OK4A 1P22A 5FKQA 3UR4A 4E54A 1MDAH 3SVWD 3FRXA 5HQGA 5TDHB 2OVRB 3JB9L 3ZWLB 2YNNA 1YFQA 5HYNB 5IGQA 5IGOA 4ZOVA 4J86A 1OLZA 4L3GD 3EI4B 5THAA 5FA5B 4I79A 4A0AA 3FGBA 5AMSA 4A7JA 3OKTA 1PEVA 3AH8B 3V9FA 3I7HA 2AH1A 4OWRA 3SHFA 4GM3A 1PBYB 3I8EA 4ERYA 3JROA 3J81g 4CC9A 3OKYB 2G9AA 2BBKH 5AFU3 4L9OA 3CIKB 2H68A 5GXIA 3EU7A 2H9NA 4FA4D 5EALA 3UVOA 5HE3B 2AH0A 4QT8A 4J0XA 4J82A 1Q47A 1S4UX 4FHLA 3SBPA 5CXCA 2AGLA
chains in the Genus database with same CATH superfamily
3NIDA 4A09A 4QRJA 2VZ1A 4CZVA 4JSXC 3MXXA 4O3UB 4A2LA 4E5ZA 5JWZA 3C5MA 2PM6B 4IA9A 4ESGA 1K3IA 1VYHC 2H6QA 3SWSD 4QQEA 1VE7A 2VDMA 5C9ZB 4GM9A 3O4GA 3SJLD 3IULA 3VI3A 2YMUA 2H9LA 3OF7A 3RRMC 2YBAA 3AL8A 4KFMB 4K3ID 1MG3A 3F3FA 1QFSA 3EWEA 2VDRA 4YVDA 3IUNA 2CO0C 4UM8A 1JMXB 2PBIB 1GXRA 4J87A 4WJKA 2XZGA 4Z7NA 5I5MA 1TYEA 2EIEA 4PSWB 2XE4A 4AOWA 3PXWD 5TF2A 2QR5A 5EMMB 2CE8A 2H9MA 4JSPC 4FAND 4QAMA 3PXSD 4ZN4A 1O6GA 2HXCA 5FKSA 3VGZA 4J8BA 4LGNA 2YNOA 5H17A 4CI2A 3RN1D 1UTCA 3EI4A 4J79A 1JV2A 1GG2B 3JZNA 4FA1D 4BCBA 2IWKA 4CY3A 4FWWA 4PNKB 4DNWA 2EBSA 4NC4A 2UZYB 5IJ7E 3IIYA 5C86A 3C75H 4XEIC 3SBRA 4CI1A 2XL2A 4FA5D 2H14A 5EMKB 3CFVA 2H3XA 3EG6A 3ZDXA 3I7NA 4CY1A 4O02A 4X61B 3I7KA 4PXWA 3AL9A 3IKOA 4A0BA 1A12A 1UOOA 5E6RA 3MUOA 2GC7A 3GFCA 3KCIA 3KRWB 4Y7RA 4Z7OA 4JXMA 4ZOZA 3JZGA 3L4OD 1BPOA 2I0RA 2OVPB 4MMZA 2WQ8A 4Z7QA 2VDPA 3SXTD 5TEFA 3UKRC 2AGXA 4A09B 1FWXA 2J55H 4CZXA 3N0EA 5EM2B 1QFMA 3RFGA 3SLED 1SHYB 3K6SA 3K27A 4E54B 1B9YA 1T2XA 2P9IC 3K72A 1JOFA 2AGWA 1QNIA 2H47A 3EI1B 2XU7A 3A0FA 3IJ0A 4X3EA 5EMJB 1U2VC 5B4WA 5C2WB 1YR2A 4EWRA 2QC5A 3IJCA 4Y5RD 4ZOXA 2OK6A 2P9UC 2Z2PA 2PM7B 2H13A 3BG1A 5HE0B 3AL8B 5HE2B 3W15A 2CE9A 3I7OA 4QL1A 5H1MA 2PM9A 4WK4A 1E5TA 3FCUA 2P9PC 4PBZA 1N6EA 4X60B 3SN6B 2VDQA 2GC4A 5AJAA 5EARA 4J84A 3RMZD 4FA9D 2Q7QA 4GQBB 5FLXg 3I8CA 3DSMA 3OKYA 4PBYA 2CN2A 2EICA 4UI9R 4A11A 1ERJA 1O6FA 2P9KC 3B7FA 3UVNA 4CY2A 5FFOA 1JMZB 5CXBB 3OL2B 5C92A 4TZ4A 5FFGA 2VC2A 3P4FA 3GC3B 4XYHA 5SXMA 2IUPA 3C99A 3GREA 5CYKA 3RN0D 5GXHA 2UZXB 3UKUC 5KDOB 2J56H 2HJBA 3I89A 3O4IA 2HU8A 3KRXB 3IVMA 2QXVA 4U7AA 3L4MD 1PI6A 5EAMA 2VDNA 3IUQA 1PGUA 2MTAH 3IJ1A 3O4JA 5C2VB 3EI3A 4FB1D 2HYEA 4A08A 2B5NA 1MG2A 2TRCB 2HKRA 3MVDK 4A2MA 3PVWB 4GM8A 1OMWB 3DM0A 3IURA 2AGYA 3I7LA 2XYIA 2CO0A 4GMBA 1XHMA 4K3JB 2VDLA 2HKMA 5M5SA 1H2ZA 4N14A 3PSLA 1N6FA 1N6DA 4G55A 4G56B 5E6UA 3MZKA 2CNXA 3MZLA 2H6KA 5EMLB 2H9PA 3UVLA 2H6NA 5M5UA 2JKXA 2AGZA 4ERZA 3JAMg 2BKLA 4ERQA 3MKSB 4D0KA 4L1QD 5HDBA 4O2WA 2VZ3A 1SQ9A 1SQJA 2XL3A 4GGAA 3RLMD 5I5IA 3V4VA 1E8MA 2I0SA 3EQ8A 2IWFA 1U4CA 4NBMA 4Z8LA 4G1MA 4JSVC 3EMHA 3FM0A 1R5MA 2YNPA 4OZUA 2I3SA 3ULEC 3PXTD 4U1EI 1JTDB 1VZ2A 3ORVD 3NIFA 3UVKA 4NAAA 2BCJB 4LG9A 3EI2A 2OVQB 1XKSA 2PM9B 1GOFA 2HU5A 4D6VA 4CI8A 4CZYA 2P9SC 3UVMA 1GOGA 3E0CA 3MUNA 4JHNA 3JZHA 1TBGA 2AQ5A 3OKWA 3ODTA 3NIGA 4ZOYA 3IJEA 3T3PA 3V5WB 4CY5A 1L5GA 3RFHA 3OW8A 2P9NC 4NENA 4A11B 5IT9g 5CXBA 3T3MA 4AN1A 4JT6C 3V4PA 4R7AB 5CYKB 4MMXA 3DXMC 2B4EA 1UOQA 2GNQA 2IURA 4JT5C 4IRZA 5CXCB 3K71A 4PC0A 3DDUA 3K26A 4JD2C 3MMYA 5FKRA 3V7DB 4NSXA 3IIWA 3AFCA 5EM2A 3SBQA 2OJYA 1NR0A 4RE5A 3NVXA 3I7PA 5E6SA 2EIBA 1GOHA 4A08B 4GQ2P 3SCYA 3PE7A 3JPXA 3U4YA 1H2XA 3VH0A 1JJUB 3EI1A 5M5RA 5FXYA 4J73A 4AEZA 2YB8B 4IMMA 1H2YA 1GOTB 2B5MA 4PSXB 4DNVA 1XIPA 4GZ8A 3OTTA 4LG8A 3BG0A 4J0WA 4H5IA 5K19A 4A0AB 3QHYB 3N0DA 3ZDZA 4H5JA 3C9CA 5K1CC 3JRPA 4JSNC 3SMRA 4BL0A 2XDWA 3NVNA 2EIDA 4CI3A 2IUVA 1RI6A 4X63B 2I0TA 2CN3A 5I5JA 3EQ7A 4GQ1A 2O9KA 1I2MB 4J81A 1TYQC 4L3HD 1B9XA 1L0QA 3I2NA 3IUMA 2IUQA 2I3TA 2Z2NA 2G99A 3F3GA 4BP9A 3HFQA 3PVUB 1C9IA 5IJ8E 3ZE0A 3FCSA 4XYIA 4AMYA 4AX4A 3MKQA 4J77A 4O1QD 3OL2A 1GP2B 4ES0A 5M5VA 4GGCA 4BCCA 3EI2B 3O4HA 3VA6A 4RE6A 5IC7A 5HE1B 3EQ9A 3BWSA 3PSCB 4BCDA 3DXKC 4GGDA 4MMYA 4O45A 1M1XA 2VDKA 4BUJC 5GMKn 3ZE2A 2HJ4A 3NVQA 4BP8A 4E5ZB 3J80g 4HDJA 4O3TB 5FQDA 3EI3B 2P9LC 1UOPA 2J57G 4AMZA 5EAPA 3F3PA 2B5LA 1A0RB 1K8KC 4UM9A 2OIZA 3RSEC 4WK2A 5FKTA 1NEXB 4A0BB 4G1EA 4AN0A 2W18A 3DWLC 4O9DA 5A2Qg 4J8GA 4J78A 4WK0A 2IAAA 2Z2OA 2HESX 4BH6A 5GSAA 5TEEA 5H14A 4FAVD 3ZE1A 1VE6A 3SFZA 3CFSB 2VDOA 1H2WA 1K32A 4MK0B 2OK4A 3VI4A 1P22A 5FKQA 3UR4A 4E54A 1MDAH 4D9SA 3SVWD 3FRXA 5HQGA 5TDHB 2OVRB 3JB9L 3ZWLB 2YNNA 1YFQA 5HYNB 2QZPA 5IGQA 5IGOA 4ZOVA 4J86A 1OLZA 4L3GD 3EI4B 5THAA 3GD1I 5FA5B 4I79A 3ZDYA 4A0AA 3FGBA 1VZ3A 1E8NA 5AMSA 4A7JA 3OKTA 1PEVA 3IUJA 3AH8B 3V9FA 3I7HA 2AH1A 4OWRA 3SHFA 4GM3A 1PBYB 3I8EA 4ERYA 3JROA 4JHPC 3J81g 4CC9A 3OKYB 2G9AA 1C9LA 2BBKH 5AFU3 2HU7A 4L9OA 3QI0A 3CIKB 2H68A 5GXIA 1U8CA 5M5TA 3EU7A 2H9NA 4FA4D 5EALA 3UVOA 5HE3B 2AH0A 5M61A 4QT8A 4J0XA 4J82A 1Q47A 1S4UX 4FHLA 3SBPA 5CXCA 4L1MA 4DNUA 2AGLA
chains in the Genus database with same CATH topology
4A09A 4QRJA 4CZVA 4JSXC 3MXXA 4O3UB 4A2LA 4E5ZA 5JWZA 3C5MA 2PM6B 4IA9A 4ESGA 1VYHC 2H6QA 3SWSD 4QQEA 5C9ZB 4GM9A 3SJLD 2YMUA 2H9LA 3RRMC 2YBAA 3AL8A 4KFMB 4K3ID 1MG3A 3F3FA 3EWEA 4YVDA 2CO0C 1JMXB 2PBIB 1GXRA 4J87A 5I5MA 4PSWB 4AOWA 3PXWD 5TF2A 5EMMB 2CE8A 2H9MA 4JSPC 4FAND 3PXSD 4ZN4A 2HXCA 5FKSA 3VGZA 4J8BA 4LGNA 2YNOA 5H17A 4CI2A 3RN1D 3EI4A 4J79A 1GG2B 3JZNA 4FA1D 2IWKA 4CY3A 4FWWA 4PNKB 2EBSA 2UZYB 5IJ7E 3IIYA 3C75H 4XEIC 3SBRA 4CI1A 2XL2A 4FA5D 2H14A 5EMKB 3CFVA 2H3XA 3EG6A 3I7NA 4CY1A 4X61B 3I7KA 4PXWA 3AL9A 3IKOA 4A0BA 2GC7A 3GFCA 3KRWB 4Y7RA 4JXMA 4ZOZA 3JZGA 3L4OD 2I0RA 2OVPB 3SXTD 5TEFA 3UKRC 2AGXA 4A09B 1FWXA 2J55H 4CZXA 3N0EA 5EM2B 3RFGA 3SLED 1SHYB 3K27A 4E54B 1B9YA 2P9IC 1JOFA 2AGWA 1QNIA 2H47A 3EI1B 2XU7A 3A0FA 3IJ0A 4X3EA 5EMJB 1U2VC 5B4WA 5C2WB 4EWRA 2QC5A 3IJCA 4Y5RD 4ZOXA 2OK6A 2P9UC 2Z2PA 2PM7B 2H13A 3BG1A 5HE0B 3AL8B 5HE2B 3W15A 2CE9A 3I7OA 4QL1A 5H1MA 2PM9A 2P9PC 4PBZA 1N6EA 4X60B 3SN6B 2GC4A 5AJAA 5EARA 4J84A 3RMZD 4FA9D 2Q7QA 4GQBB 5FLXg 3I8CA 3DSMA 3OKYA 4PBYA 2CN2A 4UI9R 4A11A 1ERJA 2P9KC 3B7FA 3UVNA 4CY2A 1JMZB 5CXBB 3OL2B 4TZ4A 3P4FA 4XYHA 5SXMA 2IUPA 3C99A 3GREA 5CYKA 3RN0D 5GXHA 2UZXB 3UKUC 5KDOB 2J56H 2HJBA 3I89A 3KRXB 2QXVA 4U7AA 3L4MD 1PI6A 5EAMA 1PGUA 2MTAH 3IJ1A 5C2VB 3EI3A 4FB1D 2HYEA 4A08A 2B5NA 1MG2A 2TRCB 2HKRA 4A2MA 3PVWB 4GM8A 1OMWB 3DM0A 2AGYA 3I7LA 2XYIA 2CO0A 4GMBA 1XHMA 4K3JB 2HKMA 4N14A 3PSLA 1N6FA 1N6DA 4G56B 3MZKA 2CNXA 3MZLA 2H6KA 5EMLB 2H9PA 3UVLA 2H6NA 2AGZA 4ERZA 3JAMg 4ERQA 3MKSB 4D0KA 4L1QD 1SQ9A 1SQJA 2XL3A 4GGAA 3RLMD 5I5IA 2I0SA 2IWFA 1U4CA 4Z8LA 4JSVC 3EMHA 3FM0A 1R5MA 2YNPA 4OZUA 2I3SA 3ULEC 3PXTD 4U1EI 3ORVD 3UVKA 2BCJB 4LG9A 3EI2A 2OVQB 1XKSA 2PM9B 4D6VA 4CI8A 4CZYA 2P9SC 3UVMA 3E0CA 3JZHA 1TBGA 2AQ5A 3OKWA 3ODTA 4ZOYA 3V5WB 4CY5A 3RFHA 3OW8A 2P9NC 4A11B 5IT9g 5CXBA 4JT6C 4R7AB 5CYKB 3DXMC 2B4EA 2GNQA 2IURA 4JT5C 5CXCB 4PC0A 3K26A 4JD2C 3MMYA 5FKRA 3V7DB 4NSXA 3IIWA 3AFCA 5EM2A 3SBQA 2OJYA 1NR0A 3NVXA 3I7PA 4A08B 4GQ2P 3SCYA 3PE7A 3JPXA 3U4YA 3VH0A 1JJUB 3EI1A 5FXYA 4J73A 4AEZA 2YB8B 4IMMA 2B5MA 1GOTB 4PSXB 1XIPA 4GZ8A 3OTTA 4LG8A 3BG0A 4J0WA 4H5IA 5K19A 4A0AB 3N0DA 4H5JA 3C9CA 5K1CC 3JRPA 4JSNC 3SMRA 4BL0A 3NVNA 4CI3A 2IUVA 1RI6A 4X63B 2I0TA 2CN3A 5I5JA 4GQ1A 2O9KA 4J81A 1TYQC 4L3HD 1B9XA 1L0QA 3I2NA 2IUQA 2I3TA 2Z2NA 2G99A 3F3GA 3HFQA 3PVUB 5IJ8E 4XYIA 3MKQA 4J77A 4O1QD 3OL2A 1GP2B 4ES0A 3EI2B 4GGCA 3VA6A 5IC7A 5HE1B 3BWSA 3PSCB 3DXKC 4GGDA 4O45A 4BUJC 5GMKn 2HJ4A 3NVQA 4E5ZB 3J80g 4HDJA 4O3TB 5FQDA 3EI3B 2P9LC 2J57G 5EAPA 3F3PA 2B5LA 1A0RB 1K8KC 2OIZA 3RSEC 5FKTA 1NEXB 4A0BB 2W18A 3DWLC 4O9DA 5A2Qg 4J8GA 4J78A 2IAAA 2Z2OA 2HESX 4BH6A 5GSAA 5TEEA 5H14A 4FAVD 3SFZA 3CFSB 1K32A 4MK0B 2OK4A 1P22A 5FKQA 3UR4A 4E54A 1MDAH 3SVWD 3FRXA 5HQGA 5TDHB 2OVRB 3JB9L 3ZWLB 2YNNA 1YFQA 5HYNB 5IGQA 5IGOA 4ZOVA 4J86A 1OLZA 4L3GD 3EI4B 5THAA 5FA5B 4I79A 4A0AA 3FGBA 5AMSA 4A7JA 3OKTA 1PEVA 3AH8B 3V9FA 3I7HA 2AH1A 4OWRA 3SHFA 4GM3A 1PBYB 3I8EA 4ERYA 3JROA 3J81g 4CC9A 3OKYB 2G9AA 2BBKH 5AFU3 4L9OA 3CIKB 2H68A 5GXIA 3EU7A 2H9NA 4FA4D 5EALA 3UVOA 5HE3B 2AH0A 4QT8A 4J0XA 4J82A 1Q47A 1S4UX 4FHLA 3SBPA 5CXCA 2AGLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A09 A;  4QRJ A;  4CZV A;  4JSX C;  3MXX A;  4O3U B;  4A2L A;  4E5Z A;  5JWZ A;  3C5M A;  2PM6 B;  4IA9 A;  4ESG A;  1VYH C;  2H6Q A;  3SWS D;  4QQE A;  5C9Z B;  4GM9 A;  3SJL D;  2YMU A;  2H9L A;  3RRM C;  2YBA A;  3AL8 A;  4KFM B;  4K3I D;  1MG3 A;  3F3F A;  3EWE A;  4YVD A;  2CO0 C;  1JMX B;  2PBI B;  1GXR A;  4J87 A;  5I5M A;  4PSW B;  4AOW A;  3PXW D;  5TF2 A;  5EMM B;  2CE8 A;  2H9M A;  4JSP C;  4FAN D;  3PXS D;  4ZN4 A;  2HXC A;  5FKS A;  3VGZ A;  4J8B A;  4LGN A;  2YNO A;  5H17 A;  4CI2 A;  3RN1 D;  3EI4 A;  4J79 A;  1GG2 B;  3JZN A;  4FA1 D;  2IWK A;  4CY3 A;  4FWW A;  4PNK B;  2EBS A;  2UZY B;  5IJ7 E;  3IIY A;  3C75 H;  4XEI C;  3SBR A;  4CI1 A;  2XL2 A;  4FA5 D;  2H14 A;  5EMK B;  3CFV A;  2H3X A;  3EG6 A;  3I7N A;  4CY1 A;  4X61 B;  3I7K A;  4PXW A;  3AL9 A;  3IKO A;  4A0B A;  2GC7 A;  3GFC A;  3KRW B;  4Y7R A;  4JXM A;  4ZOZ A;  3JZG A;  3L4O D;  2I0R A;  2OVP B;  3SXT D;  5TEF A;  3UKR C;  2AGX A;  4A09 B;  1FWX A;  2J55 H;  4CZX A;  3N0E A;  5EM2 B;  3RFG A;  3SLE D;  1SHY B;  3K27 A;  4E54 B;  1B9Y A;  2P9I C;  1JOF A;  2AGW A;  1QNI A;  2H47 A;  3EI1 B;  2XU7 A;  3A0F A;  3IJ0 A;  4X3E A;  5EMJ B;  1U2V C;  5B4W A;  5C2W B;  4EWR A;  2QC5 A;  3IJC A;  4Y5R D;  4ZOX A;  2OK6 A;  2P9U C;  2Z2P A;  2PM7 B;  2H13 A;  3BG1 A;  5HE0 B;  3AL8 B;  5HE2 B;  3W15 A;  2CE9 A;  3I7O A;  4QL1 A;  5H1M A;  2PM9 A;  2P9P C;  4PBZ A;  1N6E A;  4X60 B;  3SN6 B;  2GC4 A;  5AJA A;  5EAR A;  4J84 A;  3RMZ D;  4FA9 D;  2Q7Q A;  4GQB B;  5FLX g;  3I8C A;  3DSM A;  3OKY A;  4PBY A;  2CN2 A;  4UI9 R;  4A11 A;  1ERJ A;  2P9K C;  3B7F A;  3UVN A;  4CY2 A;  1JMZ B;  5CXB B;  3OL2 B;  4TZ4 A;  3P4F A;  4XYH A;  5SXM A;  2IUP A;  3C99 A;  3GRE A;  5CYK A;  3RN0 D;  5GXH A;  2UZX B;  3UKU C;  5KDO B;  2J56 H;  2HJB A;  3I89 A;  3KRX B;  2QXV A;  4U7A A;  3L4M D;  1PI6 A;  5EAM A;  1PGU A;  2MTA H;  3IJ1 A;  5C2V B;  3EI3 A;  4FB1 D;  2HYE A;  4A08 A;  2B5N A;  1MG2 A;  2TRC B;  2HKR A;  4A2M A;  3PVW B;  4GM8 A;  1OMW B;  3DM0 A;  2AGY A;  3I7L A;  2XYI A;  2CO0 A;  4GMB A;  1XHM A;  4K3J B;  2HKM A;  4N14 A;  3PSL A;  1N6F A;  1N6D A;  4G56 B;  3MZK A;  2CNX A;  3MZL A;  2H6K A;  5EML B;  2H9P A;  3UVL A;  2H6N A;  2AGZ A;  4ERZ A;  3JAM g;  4ERQ A;  3MKS B;  4D0K A;  4L1Q D;  1SQ9 A;  1SQJ A;  2XL3 A;  4GGA A;  3RLM D;  5I5I A;  2I0S A;  2IWF A;  1U4C A;  4Z8L A;  4JSV C;  3EMH A;  3FM0 A;  1R5M A;  2YNP A;  4OZU A;  2I3S A;  3ULE C;  3PXT D;  4U1E I;  3ORV D;  3UVK A;  2BCJ B;  4LG9 A;  3EI2 A;  2OVQ B;  1XKS A;  2PM9 B;  4D6V A;  4CI8 A;  4CZY A;  2P9S C;  3UVM A;  3E0C A;  3JZH A;  1TBG A;  2AQ5 A;  3OKW A;  3ODT A;  4ZOY A;  3V5W B;  4CY5 A;  3RFH A;  3OW8 A;  2P9N C;  4A11 B;  5IT9 g;  5CXB A;  4JT6 C;  4R7A B;  5CYK B;  3DXM C;  2B4E A;  2GNQ A;  2IUR A;  4JT5 C;  5CXC B;  4PC0 A;  3K26 A;  4JD2 C;  3MMY A;  5FKR A;  3V7D B;  4NSX A;  3IIW A;  3AFC A;  5EM2 A;  3SBQ A;  2OJY A;  1NR0 A;  3NVX A;  3I7P A;  4A08 B;  4GQ2 P;  3SCY A;  3PE7 A;  3JPX A;  3U4Y A;  3VH0 A;  1JJU B;  3EI1 A;  5FXY A;  4J73 A;  4AEZ A;  2YB8 B;  4IMM A;  2B5M A;  1GOT B;  4PSX B;  1XIP A;  4GZ8 A;  3OTT A;  4LG8 A;  3BG0 A;  4J0W A;  4H5I A;  5K19 A;  4A0A B;  3N0D A;  4H5J A;  3C9C A;  5K1C C;  3JRP A;  4JSN C;  3SMR A;  4BL0 A;  3NVN A;  4CI3 A;  2IUV A;  1RI6 A;  4X63 B;  2I0T A;  2CN3 A;  5I5J A;  4GQ1 A;  2O9K A;  4J81 A;  1TYQ C;  4L3H D;  1B9X A;  1L0Q A;  3I2N A;  2IUQ A;  2I3T A;  2Z2N A;  2G99 A;  3F3G A;  3HFQ A;  3PVU B;  5IJ8 E;  4XYI A;  3MKQ A;  4J77 A;  4O1Q D;  3OL2 A;  1GP2 B;  4ES0 A;  3EI2 B;  4GGC A;  3VA6 A;  5IC7 A;  5HE1 B;  3BWS A;  3PSC B;  3DXK C;  4GGD A;  4O45 A;  4BUJ C;  5GMK n;  2HJ4 A;  3NVQ A;  4E5Z B;  3J80 g;  4HDJ A;  4O3T B;  5FQD A;  3EI3 B;  2P9L C;  2J57 G;  5EAP A;  3F3P A;  2B5L A;  1A0R B;  1K8K C;  2OIZ A;  3RSE C;  5FKT A;  1NEX B;  4A0B B;  2W18 A;  3DWL C;  4O9D A;  5A2Q g;  4J8G A;  4J78 A;  2IAA A;  2Z2O A;  2HES X;  4BH6 A;  5GSA A;  5TEE A;  5H14 A;  4FAV D;  3SFZ A;  3CFS B;  1K32 A;  4MK0 B;  2OK4 A;  1P22 A;  5FKQ A;  3UR4 A;  4E54 A;  1MDA H;  3SVW D;  3FRX A;  5HQG A;  5TDH B;  2OVR B;  3JB9 L;  3ZWL B;  2YNN A;  1YFQ A;  5HYN B;  5IGQ A;  5IGO A;  4ZOV A;  4J86 A;  1OLZ A;  4L3G D;  3EI4 B;  5THA A;  5FA5 B;  4I79 A;  4A0A A;  3FGB A;  5AMS A;  4A7J A;  3OKT A;  1PEV A;  3AH8 B;  3V9F A;  3I7H A;  2AH1 A;  4OWR A;  3SHF A;  4GM3 A;  1PBY B;  3I8E A;  4ERY A;  3JRO A;  3J81 g;  4CC9 A;  3OKY B;  2G9A A;  2BBK H;  5AFU 3;  4L9O A;  3CIK B;  2H68 A;  5GXI A;  3EU7 A;  2H9N A;  4FA4 D;  5EAL A;  3UVO A;  5HE3 B;  2AH0 A;  4QT8 A;  4J0X A;  4J82 A;  1Q47 A;  1S4U X;  4FHL A;  3SBP A;  5CXC A;  2AGL A; 
#chains in the Genus database with same CATH topology
 3NID A;  4A09 A;  4QRJ A;  2VZ1 A;  4CZV A;  4JSX C;  3MXX A;  4O3U B;  4A2L A;  4E5Z A;  5JWZ A;  3C5M A;  2PM6 B;  4IA9 A;  4ESG A;  1K3I A;  1VYH C;  2H6Q A;  3SWS D;  4QQE A;  1VE7 A;  2VDM A;  5C9Z B;  4GM9 A;  3O4G A;  3SJL D;  3IUL A;  3VI3 A;  2YMU A;  2H9L A;  3OF7 A;  3RRM C;  2YBA A;  3AL8 A;  4KFM B;  4K3I D;  1MG3 A;  3F3F A;  1QFS A;  3EWE A;  2VDR A;  4YVD A;  3IUN A;  2CO0 C;  4UM8 A;  1JMX B;  2PBI B;  1GXR A;  4J87 A;  4WJK A;  2XZG A;  4Z7N A;  5I5M A;  1TYE A;  2EIE A;  4PSW B;  2XE4 A;  4AOW A;  3PXW D;  5TF2 A;  2QR5 A;  5EMM B;  2CE8 A;  2H9M A;  4JSP C;  4FAN D;  4QAM A;  3PXS D;  4ZN4 A;  1O6G A;  2HXC A;  5FKS A;  3VGZ A;  4J8B A;  4LGN A;  2YNO A;  5H17 A;  4CI2 A;  3RN1 D;  1UTC A;  3EI4 A;  4J79 A;  1JV2 A;  1GG2 B;  3JZN A;  4FA1 D;  4BCB A;  2IWK A;  4CY3 A;  4FWW A;  4PNK B;  4DNW A;  2EBS A;  4NC4 A;  2UZY B;  5IJ7 E;  3IIY A;  5C86 A;  3C75 H;  4XEI C;  3SBR A;  4CI1 A;  2XL2 A;  4FA5 D;  2H14 A;  5EMK B;  3CFV A;  2H3X A;  3EG6 A;  3ZDX A;  3I7N A;  4CY1 A;  4O02 A;  4X61 B;  3I7K A;  4PXW A;  3AL9 A;  3IKO A;  4A0B A;  1A12 A;  1UOO A;  5E6R A;  3MUO A;  2GC7 A;  3GFC A;  3KCI A;  3KRW B;  4Y7R A;  4Z7O A;  4JXM A;  4ZOZ A;  3JZG A;  3L4O D;  1BPO A;  2I0R A;  2OVP B;  4MMZ A;  2WQ8 A;  4Z7Q A;  2VDP A;  3SXT D;  5TEF A;  3UKR C;  2AGX A;  4A09 B;  1FWX A;  2J55 H;  4CZX A;  3N0E A;  5EM2 B;  1QFM A;  3RFG A;  3SLE D;  1SHY B;  3K6S A;  3K27 A;  4E54 B;  1B9Y A;  1T2X A;  2P9I C;  3K72 A;  1JOF A;  2AGW A;  1QNI A;  2H47 A;  3EI1 B;  2XU7 A;  3A0F A;  3IJ0 A;  4X3E A;  5EMJ B;  1U2V C;  5B4W A;  5C2W B;  1YR2 A;  4EWR A;  2QC5 A;  3IJC A;  4Y5R D;  4ZOX A;  2OK6 A;  2P9U C;  2Z2P A;  2PM7 B;  2H13 A;  3BG1 A;  5HE0 B;  3AL8 B;  5HE2 B;  3W15 A;  2CE9 A;  3I7O A;  4QL1 A;  5H1M A;  2PM9 A;  4WK4 A;  1E5T A;  3FCU A;  2P9P C;  4PBZ A;  1N6E A;  4X60 B;  3SN6 B;  2VDQ A;  2GC4 A;  5AJA A;  5EAR A;  4J84 A;  3RMZ D;  4FA9 D;  2Q7Q A;  4GQB B;  5FLX g;  3I8C A;  3DSM A;  3OKY A;  4PBY A;  2CN2 A;  2EIC A;  4UI9 R;  4A11 A;  1ERJ A;  1O6F A;  2P9K C;  3B7F A;  3UVN A;  4CY2 A;  5FFO A;  1JMZ B;  5CXB B;  3OL2 B;  5C92 A;  4TZ4 A;  5FFG A;  2VC2 A;  3P4F A;  3GC3 B;  4XYH A;  5SXM A;  2IUP A;  3C99 A;  3GRE A;  5CYK A;  3RN0 D;  5GXH A;  2UZX B;  3UKU C;  5KDO B;  2J56 H;  2HJB A;  3I89 A;  3O4I A;  2HU8 A;  3KRX B;  3IVM A;  2QXV A;  4U7A A;  3L4M D;  1PI6 A;  5EAM A;  2VDN A;  3IUQ A;  1PGU A;  2MTA H;  3IJ1 A;  3O4J A;  5C2V B;  3EI3 A;  4FB1 D;  2HYE A;  4A08 A;  2B5N A;  1MG2 A;  2TRC B;  2HKR A;  3MVD K;  4A2M A;  3PVW B;  4GM8 A;  1OMW B;  3DM0 A;  3IUR A;  2AGY A;  3I7L A;  2XYI A;  2CO0 A;  4GMB A;  1XHM A;  4K3J B;  2VDL A;  2HKM A;  5M5S A;  1H2Z A;  4N14 A;  3PSL A;  1N6F A;  1N6D A;  4G55 A;  4G56 B;  5E6U A;  3MZK A;  2CNX A;  3MZL A;  2H6K A;  5EML B;  2H9P A;  3UVL A;  2H6N A;  5M5U A;  2JKX A;  2AGZ A;  4ERZ A;  3JAM g;  2BKL A;  4ERQ A;  3MKS B;  4D0K A;  4L1Q D;  5HDB A;  4O2W A;  2VZ3 A;  1SQ9 A;  1SQJ A;  2XL3 A;  4GGA A;  3RLM D;  5I5I A;  3V4V A;  1E8M A;  2I0S A;  3EQ8 A;  2IWF A;  1U4C A;  4NBM A;  4Z8L A;  4G1M A;  4JSV C;  3EMH A;  3FM0 A;  1R5M A;  2YNP A;  4OZU A;  2I3S A;  3ULE C;  3PXT D;  4U1E I;  1JTD B;  1VZ2 A;  3ORV D;  3NIF A;  3UVK A;  4NAA A;  2BCJ B;  4LG9 A;  3EI2 A;  2OVQ B;  1XKS A;  2PM9 B;  1GOF A;  2HU5 A;  4D6V A;  4CI8 A;  4CZY A;  2P9S C;  3UVM A;  1GOG A;  3E0C A;  3MUN A;  4JHN A;  3JZH A;  1TBG A;  2AQ5 A;  3OKW A;  3ODT A;  3NIG A;  4ZOY A;  3IJE A;  3T3P A;  3V5W B;  4CY5 A;  1L5G A;  3RFH A;  3OW8 A;  2P9N C;  4NEN A;  4A11 B;  5IT9 g;  5CXB A;  3T3M A;  4AN1 A;  4JT6 C;  3V4P A;  4R7A B;  5CYK B;  4MMX A;  3DXM C;  2B4E A;  1UOQ A;  2GNQ A;  2IUR A;  4JT5 C;  4IRZ A;  5CXC B;  3K71 A;  4PC0 A;  3DDU A;  3K26 A;  4JD2 C;  3MMY A;  5FKR A;  3V7D B;  4NSX A;  3IIW A;  3AFC A;  5EM2 A;  3SBQ A;  2OJY A;  1NR0 A;  4RE5 A;  3NVX A;  3I7P A;  5E6S A;  2EIB A;  1GOH A;  4A08 B;  4GQ2 P;  3SCY A;  3PE7 A;  3JPX A;  3U4Y A;  1H2X A;  3VH0 A;  1JJU B;  3EI1 A;  5M5R A;  5FXY A;  4J73 A;  4AEZ A;  2YB8 B;  4IMM A;  1H2Y A;  1GOT B;  2B5M A;  4PSX B;  4DNV A;  1XIP A;  4GZ8 A;  3OTT A;  4LG8 A;  3BG0 A;  4J0W A;  4H5I A;  5K19 A;  4A0A B;  3QHY B;  3N0D A;  3ZDZ A;  4H5J A;  3C9C A;  5K1C C;  3JRP A;  4JSN C;  3SMR A;  4BL0 A;  2XDW A;  3NVN A;  2EID A;  4CI3 A;  2IUV A;  1RI6 A;  4X63 B;  2I0T A;  2CN3 A;  5I5J A;  3EQ7 A;  4GQ1 A;  2O9K A;  1I2M B;  4J81 A;  1TYQ C;  4L3H D;  1B9X A;  1L0Q A;  3I2N A;  3IUM A;  2IUQ A;  2I3T A;  2Z2N A;  2G99 A;  3F3G A;  4BP9 A;  3HFQ A;  3PVU B;  1C9I A;  5IJ8 E;  3ZE0 A;  3FCS A;  4XYI A;  4AMY A;  4AX4 A;  3MKQ A;  4J77 A;  4O1Q D;  3OL2 A;  1GP2 B;  4ES0 A;  5M5V A;  4GGC A;  4BCC A;  3EI2 B;  3O4H A;  3VA6 A;  4RE6 A;  5IC7 A;  5HE1 B;  3EQ9 A;  3BWS A;  3PSC B;  4BCD A;  3DXK C;  4GGD A;  4MMY A;  4O45 A;  1M1X A;  2VDK A;  4BUJ C;  5GMK n;  3ZE2 A;  2HJ4 A;  3NVQ A;  4BP8 A;  4E5Z B;  3J80 g;  4HDJ A;  4O3T B;  5FQD A;  3EI3 B;  2P9L C;  1UOP A;  2J57 G;  4AMZ A;  5EAP A;  3F3P A;  2B5L A;  1A0R B;  1K8K C;  4UM9 A;  2OIZ A;  3RSE C;  4WK2 A;  5FKT A;  1NEX B;  4A0B B;  4G1E A;  4AN0 A;  2W18 A;  3DWL C;  4O9D A;  5A2Q g;  4J8G A;  4J78 A;  4WK0 A;  2IAA A;  2Z2O A;  2HES X;  4BH6 A;  5GSA A;  5TEE A;  5H14 A;  4FAV D;  3ZE1 A;  1VE6 A;  3SFZ A;  3CFS B;  2VDO A;  1H2W A;  1K32 A;  4MK0 B;  2OK4 A;  3VI4 A;  1P22 A;  5FKQ A;  3UR4 A;  4E54 A;  1MDA H;  4D9S A;  3SVW D;  3FRX A;  5HQG A;  5TDH B;  2OVR B;  3JB9 L;  3ZWL B;  2YNN A;  1YFQ A;  5HYN B;  2QZP A;  5IGQ A;  5IGO A;  4ZOV A;  4J86 A;  1OLZ A;  4L3G D;  3EI4 B;  5THA A;  3GD1 I;  5FA5 B;  4I79 A;  3ZDY A;  4A0A A;  3FGB A;  1VZ3 A;  1E8N A;  5AMS A;  4A7J A;  3OKT A;  1PEV A;  3IUJ A;  3AH8 B;  3V9F A;  3I7H A;  2AH1 A;  4OWR A;  3SHF A;  4GM3 A;  1PBY B;  3I8E A;  4ERY A;  3JRO A;  4JHP C;  3J81 g;  4CC9 A;  3OKY B;  2G9A A;  1C9L A;  2BBK H;  5AFU 3;  2HU7 A;  4L9O A;  3QI0 A;  3CIK B;  2H68 A;  5GXI A;  1U8C A;  5M5T A;  3EU7 A;  2H9N A;  4FA4 D;  5EAL A;  3UVO A;  5HE3 B;  2AH0 A;  5M61 A;  4QT8 A;  4J0X A;  4J82 A;  1Q47 A;  1S4U X;  4FHL A;  3SBP A;  5CXC A;  4L1M A;  4DNU A;  2AGL A; 
#chains in the Genus database with same CATH homology
 4A09 A;  4QRJ A;  4CZV A;  4JSX C;  3MXX A;  4O3U B;  4A2L A;  4E5Z A;  5JWZ A;  3C5M A;  2PM6 B;  4IA9 A;  4ESG A;  1VYH C;  2H6Q A;  3SWS D;  4QQE A;  5C9Z B;  4GM9 A;  3SJL D;  2YMU A;  2H9L A;  3RRM C;  2YBA A;  3AL8 A;  4KFM B;  4K3I D;  1MG3 A;  3F3F A;  3EWE A;  4YVD A;  2CO0 C;  1JMX B;  2PBI B;  1GXR A;  4J87 A;  5I5M A;  4PSW B;  4AOW A;  3PXW D;  5TF2 A;  5EMM B;  2CE8 A;  2H9M A;  4JSP C;  4FAN D;  3PXS D;  4ZN4 A;  2HXC A;  5FKS A;  3VGZ A;  4J8B A;  4LGN A;  2YNO A;  5H17 A;  4CI2 A;  3RN1 D;  3EI4 A;  4J79 A;  1GG2 B;  3JZN A;  4FA1 D;  2IWK A;  4CY3 A;  4FWW A;  4PNK B;  2EBS A;  2UZY B;  5IJ7 E;  3IIY A;  3C75 H;  4XEI C;  3SBR A;  4CI1 A;  2XL2 A;  4FA5 D;  2H14 A;  5EMK B;  3CFV A;  2H3X A;  3EG6 A;  3I7N A;  4CY1 A;  4X61 B;  3I7K A;  4PXW A;  3AL9 A;  3IKO A;  4A0B A;  2GC7 A;  3GFC A;  3KRW B;  4Y7R A;  4JXM A;  4ZOZ A;  3JZG A;  3L4O D;  2I0R A;  2OVP B;  3SXT D;  5TEF A;  3UKR C;  2AGX A;  4A09 B;  1FWX A;  2J55 H;  4CZX A;  3N0E A;  5EM2 B;  3RFG A;  3SLE D;  1SHY B;  3K27 A;  4E54 B;  1B9Y A;  2P9I C;  1JOF A;  2AGW A;  1QNI A;  2H47 A;  3EI1 B;  2XU7 A;  3A0F A;  3IJ0 A;  4X3E A;  5EMJ B;  1U2V C;  5B4W A;  5C2W B;  4EWR A;  2QC5 A;  3IJC A;  4Y5R D;  4ZOX A;  2OK6 A;  2P9U C;  2Z2P A;  2PM7 B;  2H13 A;  3BG1 A;  5HE0 B;  3AL8 B;  5HE2 B;  3W15 A;  2CE9 A;  3I7O A;  4QL1 A;  5H1M A;  2PM9 A;  2P9P C;  4PBZ A;  1N6E A;  4X60 B;  3SN6 B;  2GC4 A;  5AJA A;  5EAR A;  4J84 A;  3RMZ D;  4FA9 D;  2Q7Q A;  4GQB B;  5FLX g;  3I8C A;  3DSM A;  3OKY A;  4PBY A;  2CN2 A;  4UI9 R;  4A11 A;  1ERJ A;  2P9K C;  3B7F A;  3UVN A;  4CY2 A;  1JMZ B;  5CXB B;  3OL2 B;  4TZ4 A;  3P4F A;  4XYH A;  5SXM A;  2IUP A;  3C99 A;  3GRE A;  5CYK A;  3RN0 D;  5GXH A;  2UZX B;  3UKU C;  5KDO B;  2J56 H;  2HJB A;  3I89 A;  3KRX B;  2QXV A;  4U7A A;  3L4M D;  1PI6 A;  5EAM A;  1PGU A;  2MTA H;  3IJ1 A;  5C2V B;  3EI3 A;  4FB1 D;  2HYE A;  4A08 A;  2B5N A;  1MG2 A;  2TRC B;  2HKR A;  4A2M A;  3PVW B;  4GM8 A;  1OMW B;  3DM0 A;  2AGY A;  3I7L A;  2XYI A;  2CO0 A;  4GMB A;  1XHM A;  4K3J B;  2HKM A;  4N14 A;  3PSL A;  1N6F A;  1N6D A;  4G56 B;  3MZK A;  2CNX A;  3MZL A;  2H6K A;  5EML B;  2H9P A;  3UVL A;  2H6N A;  2AGZ A;  4ERZ A;  3JAM g;  4ERQ A;  3MKS B;  4D0K A;  4L1Q D;  1SQ9 A;  1SQJ A;  2XL3 A;  4GGA A;  3RLM D;  5I5I A;  2I0S A;  2IWF A;  1U4C A;  4Z8L A;  4JSV C;  3EMH A;  3FM0 A;  1R5M A;  2YNP A;  4OZU A;  2I3S A;  3ULE C;  3PXT D;  4U1E I;  3ORV D;  3UVK A;  2BCJ B;  4LG9 A;  3EI2 A;  2OVQ B;  1XKS A;  2PM9 B;  4D6V A;  4CI8 A;  4CZY A;  2P9S C;  3UVM A;  3E0C A;  3JZH A;  1TBG A;  2AQ5 A;  3OKW A;  3ODT A;  4ZOY A;  3V5W B;  4CY5 A;  3RFH A;  3OW8 A;  2P9N C;  4A11 B;  5IT9 g;  5CXB A;  4JT6 C;  4R7A B;  5CYK B;  3DXM C;  2B4E A;  2GNQ A;  2IUR A;  4JT5 C;  5CXC B;  4PC0 A;  3K26 A;  4JD2 C;  3MMY A;  5FKR A;  3V7D B;  4NSX A;  3IIW A;  3AFC A;  5EM2 A;  3SBQ A;  2OJY A;  1NR0 A;  3NVX A;  3I7P A;  4A08 B;  4GQ2 P;  3SCY A;  3PE7 A;  3JPX A;  3U4Y A;  3VH0 A;  1JJU B;  3EI1 A;  5FXY A;  4J73 A;  4AEZ A;  2YB8 B;  4IMM A;  2B5M A;  1GOT B;  4PSX B;  1XIP A;  4GZ8 A;  3OTT A;  4LG8 A;  3BG0 A;  4J0W A;  4H5I A;  5K19 A;  4A0A B;  3N0D A;  4H5J A;  3C9C A;  5K1C C;  3JRP A;  4JSN C;  3SMR A;  4BL0 A;  3NVN A;  4CI3 A;  2IUV A;  1RI6 A;  4X63 B;  2I0T A;  2CN3 A;  5I5J A;  4GQ1 A;  2O9K A;  4J81 A;  1TYQ C;  4L3H D;  1B9X A;  1L0Q A;  3I2N A;  2IUQ A;  2I3T A;  2Z2N A;  2G99 A;  3F3G A;  3HFQ A;  3PVU B;  5IJ8 E;  4XYI A;  3MKQ A;  4J77 A;  4O1Q D;  3OL2 A;  1GP2 B;  4ES0 A;  3EI2 B;  4GGC A;  3VA6 A;  5IC7 A;  5HE1 B;  3BWS A;  3PSC B;  3DXK C;  4GGD A;  4O45 A;  4BUJ C;  5GMK n;  2HJ4 A;  3NVQ A;  4E5Z B;  3J80 g;  4HDJ A;  4O3T B;  5FQD A;  3EI3 B;  2P9L C;  2J57 G;  5EAP A;  3F3P A;  2B5L A;  1A0R B;  1K8K C;  2OIZ A;  3RSE C;  5FKT A;  1NEX B;  4A0B B;  2W18 A;  3DWL C;  4O9D A;  5A2Q g;  4J8G A;  4J78 A;  2IAA A;  2Z2O A;  2HES X;  4BH6 A;  5GSA A;  5TEE A;  5H14 A;  4FAV D;  3SFZ A;  3CFS B;  1K32 A;  4MK0 B;  2OK4 A;  1P22 A;  5FKQ A;  3UR4 A;  4E54 A;  1MDA H;  3SVW D;  3FRX A;  5HQG A;  5TDH B;  2OVR B;  3JB9 L;  3ZWL B;  2YNN A;  1YFQ A;  5HYN B;  5IGQ A;  5IGO A;  4ZOV A;  4J86 A;  1OLZ A;  4L3G D;  3EI4 B;  5THA A;  5FA5 B;  4I79 A;  4A0A A;  3FGB A;  5AMS A;  4A7J A;  3OKT A;  1PEV A;  3AH8 B;  3V9F A;  3I7H A;  2AH1 A;  4OWR A;  3SHF A;  4GM3 A;  1PBY B;  3I8E A;  4ERY A;  3JRO A;  3J81 g;  4CC9 A;  3OKY B;  2G9A A;  2BBK H;  5AFU 3;  4L9O A;  3CIK B;  2H68 A;  5GXI A;  3EU7 A;  2H9N A;  4FA4 D;  5EAL A;  3UVO A;  5HE3 B;  2AH0 A;  4QT8 A;  4J0X A;  4J82 A;  1Q47 A;  1S4U X;  4FHL A;  3SBP A;  5CXC A;  2AGL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...