4AOWA

Crystal structure of the human rack1 protein at a resolution of 2.45 angstrom
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
312
structure length
305
Chain Sequence
EQMTLRGTLKGHNGWVTQIATTPQFPDMILSASRDKTIIMWKLTRDETNYGIPQRALRGHSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSSDNRQIVSGSRDKTIKLWNTLGVCKYTVQDESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGKIIVDELKQEAEPPQCTSLAWSADGQTLFAGYTDNLVRVWQVTI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Receptor
molecule keywords GUANINE NUCLEOTIDE-BINDING PROTEIN SUBUNIT BETA-2-LIKE 1
publication title Structure of Human Rack1 Protein at a Resolution of 2.45 A.
pubmed doi rcsb
source organism Homo sapiens
total genus 76
structure length 305
sequence length 312
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4aowA01
4L9OA 3OKTA 1A0RB 4E54B 3V7DB 5GMKn 3C99A 3FM0A 4U7AA 4Y7RA 1YFQA 5HYNB 5AJAA 4N14A 2O9KA 1QNIA 3PSLA 3DXKC 4XEIC 4FAVD 2HESX 4O3TB 4QL1A 3EI1A 2P9NC 5EM2B 4IA9A 4JT6C 2XL3A 3EWEA 4AOWA 4FWWA 2PM9A 2CNXA 2CO0C 4J8GA 4J84A 4IMMA 2J55H 4JT5C 1SHYB 3BWSA 4ERQA 5FKTA 1PBYB 1PEVA 4GQ1A 4JSNC 4J82A 2H6KA 4PBZA 2QXVA 3JZHA 3JB9L 2Z2NA 2YNPA 4GQ2P 4PBYA 4LG9A 2BBKH 5CYKA 4GMBA 4HDJA 4GZ8A 3PXWD 2H3XA 3PE7A 4EWRA 4J77A 4A11A 5EMJB 3UR4A 1XIPA 3DSMA 2HYEA 4A08A 5EALA 4J86A 5HE2B 3U4YA 5IC7A 3NVQA 3I8EA 2PBIB 5TF2A 4A0BA 1JMXB 2HJ4A 4GM3A 4AEZA 3VGZA 2HKRA 4I79A 2CE9A 3A0FA 4D6VA 2IUQA 3IJ1A 2J57G 3AH8B 3SXTD 3SJLD 2AGZA 3J80g 2G99A 2AGLA 4YVDA 1B9XA 2GC7A 4CI1A 5EMKB 3CIKB 2CO0A 3E0CA 3IIYA 2G9AA 3VA6A 2OJYA 4BH6A 5CXCA 3ULEC 2AGYA 4FA4D 4XYIA 4D0KA 3MKSB 3JZNA 5EMLB 3SLED 3C75H 2QC5A 2AH0A 5C9ZB 3I8CA 3N0EA 5I5MA 4X60B 4G56B 3EI1B 4K3JB 4OWRA 3EI3A 3IJ0A 1U2VC 5K1CC 2I0RA 3MZLA 2PM9B 3K27A 1MG3A 2AGXA 5HQGA 5EAPA 3IIWA 5EARA 3UVMA 1JMZB 4A0AB 3F3FA 3F3GA 3EI4A 5IJ8E 1U4CA 5EMMB 2P9KC 4ESGA 4FAND 4TZ4A 2P9SC 3JZGA 1OLZA 5CYKB 3DXMC 3SBPA 4CY1A 1PI6A 3RLMD 3OTTA 5JWZA 4LG8A 1XKSA 4A08B 4ERYA 2B5NA 2XYIA 4A2MA 5CXBB 1NEXB 4JSPC 4X63B 3K26A 1B9YA 3EI2A 4A0BB 2XL2A 3KRWB 2B4EA 2H9LA 2P9IC 2AH1A 3J81g 3SFZA 1OMWB 4UI9R 4FA5D 5AMSA 4GM9A 5FKSA 3UVOA 3FGBA 4CI8A 3L4OD 4O9DA 4JXMA 4OZUA 5TDHB 3CFVA 3PSCB 3AL8A 4X61B 3I7OA 5EAMA 3C9CA 2UZXB 4J8BA 2IAAA 5GXIA 3OKWA 4H5JA 5AFU3 3RN1D 1Q47A 1XHMA 2IUVA 1PGUA 5GXHA 5H1MA 3OL2A 2Z2PA 3ODTA 3SWSD 4QT8A 3SBRA 3EG6A 4A09A 3JAMg 3EI3B 4E5ZA 3OKYB 3I89A 4KFMB 5IGOA 3UKRC 2H9NA 4MK0B 3RFGA 4PSWB 5FKRA 3PVUB 2I3TA 3OW8A 3EMHA 3EU7A 5A2Qg 4FA1D 3IKOA 5C2VB 5TEEA 2J56H 3RMZD 4PSXB 3V5WB 2XU7A 3PXTD 3KRXB 4Y5RD 2EBSA 3I7HA 4LGNA 4FA9D 3N0DA 1MG2A 5K19A 4QQEA 3IJCA 3NVXA 3JRPA 3EI2B 3C5MA 5GSAA 3PXSD 5C2WB 5FKQA 4BL0A 2I0SA 2YNOA 5H14A 4NSXA 1ERJA 2P9LC 2PM6B 4JD2C 4FB1D 4J0WA 2OVQB 4O1QD 2CN3A 2Q7QA 5IJ7E 4CI2A 2AQ5A 5I5JA 2H6NA 2OK6A 4A7JA 3MXXA 4L3GD 4ZOYA 3UVLA 1GP2B 1NR0A 5IT9g 4L1QD 4ERZA 3MZKA 3RSEC 2H47A 4A11B 2H68A 4X3EA 5HE1B 3I7PA 3OL2B 5FLXg 2I0TA 5HE3B 4GGAA 3RN0D 1S4UX 2OIZA 4J0XA 5B4WA 2GNQA 4A09B 1FWXA 5IGQA 4E5ZB 4J73A 3SVWD 1TBGA 5H17A 3B7FA 4JSXC 2OVRB 4FHLA 3I7KA 4PXWA 2H14A 5KDOB 2B5LA 4QRJA 4CY3A 4J87A 3FRXA 2I3SA 1L0QA 2CE8A 3MMYA 2P9PC 2Z2OA 1TYQC 1VYHC 4K3ID 4CY2A 2GC4A 4GQBB 3NVNA 1SQ9A 1K8KC 4CZVA 5FQDA 4CI3A 1GXRA 4PC0A 1R5MA 5CXCB 3ZWLB 5I5IA 5FXYA 4J81A 2H13A 2YNNA 4J78A 2IWFA 4ZOZA 4ZOVA 4A0AA 3AFCA 5TEFA 4H5IA 2PM7B 1JOFA 4ZN4A 4O3UB 4PNKB 3I7NA 4JSVC 3L4MD 2HJBA 4O45A 3EI4B 4E54A 3SCYA 3HFQA 5CXBA 5SXMA 2YB8B 1JJUB 3PVWB 5HE0B 3JROA 5EM2A 3BG0A 4CC9A 4GGCA 2HKMA 2IUPA 2HXCA 3UVNA 4GM8A 4A2LA 3GREA 3DWLC 3ORVD 4GGDA 2OVPB 3SN6B 1RI6A 2AGWA 5THAA 3SMRA 3V9FA 4CY5A 3SBQA 1GG2B 3UKUC 2IWKA 1P22A 2YBAA 3VH0A 1N6DA 3F3PA 1N6FA 4U1EI 3AL8B 2IURA 4CZXA 2OK4A 3I2NA 2B5MA 2H9MA 4ES0A 3P4FA 3UVKA 2H6QA 1SQJA 3OKYA 3CFSB 1N6EA 4XYHA 1GOTB 2BCJB 2YMUA 4CZYA 5FA5B 3GFCA 2UZYB 2W18A 2MTAH 4Z8LA 3AL9A 2TRCB 2P9UC 3W15A 4J79A 4ZOXA 3RRMC 4R7AB 2H9PA 3DM0A 3SHFA 4L3HD 2CN2A 3MKQA 3JPXA 1MDAH 3RFHA 4BUJC 1K32A 3BG1A 3I7LA
chains in the Genus database with same CATH superfamily
4L9OA 3OKTA 4MMZA 1A0RB 4G55A 4E54B 3V7DB 5GMKn 1UOPA 3C99A 3FM0A 4U7AA 4Y7RA 5E6SA 1YFQA 5HYNB 5AJAA 4N14A 2O9KA 1QNIA 3PSLA 3DXKC 2QZPA 4XEIC 1JV2A 2VDQA 4FAVD 2HESX 4O3TB 4QL1A 3FCSA 3EI1A 2P9NC 5EM2B 4IA9A 4JT6C 2XL3A 3EWEA 4AOWA 4FWWA 2PM9A 2BKLA 2CNXA 2CO0C 4J8GA 4J84A 4IMMA 1GOGA 2J55H 4JT5C 4O2WA 1SHYB 3K71A 4BCCA 3BWSA 4ERQA 5FKTA 1PBYB 1PEVA 4GQ1A 4JSNC 4J82A 2H6KA 3O4GA 2QXVA 4PBZA 3JZHA 3JB9L 2Z2NA 2YNPA 4GQ2P 4PBYA 4LG9A 3DDUA 5E6UA 2BBKH 5CYKA 4GMBA 4HDJA 3ZE1A 3K72A 4GZ8A 3IUJA 3PXWD 2H3XA 4JHNA 3PE7A 4EWRA 4J77A 4A11A 3MUOA 2VZ1A 5EMJB 5HDBA 3UR4A 1XIPA 3DSMA 2HYEA 4A08A 5EALA 4J86A 3T3PA 5HE2B 3U4YA 3QHYB 5IC7A 3NVQA 3I8EA 2PBIB 1JTDB 5TF2A 4A0BA 4AMYA 1JMXB 2HJ4A 4GM3A 4AEZA 3VGZA 2HKRA 4I79A 2CE9A 5M5UA 3A0FA 4D6VA 2IUQA 3IJ1A 3VI3A 4IRZA 2J57G 4NENA 3AH8B 3SXTD 3SJLD 2AGZA 5M5SA 3J80g 2G99A 2AGLA 4YVDA 1B9XA 2GC7A 4WK4A 4CI1A 4NC4A 5EMKB 3CIKB 2CO0A 3E0CA 3IIYA 2G9AA 4QAMA 2OJYA 3VA6A 4AX4A 3EQ9A 4BH6A 5CXCA 3ULEC 2AGYA 4FA4D 4XYIA 4D0KA 3MKSB 3JZNA 5EMLB 3SLED 3C75H 2QC5A 2AH0A 5C9ZB 3I8CA 3N0EA 5I5MA 4X60B 4G56B 3EI1B 4K3JB 4OWRA 3EI3A 3IJ0A 1U2VC 5K1CC 2I0RA 3VI4A 3MZLA 2PM9B 3K27A 4BCBA 1MG3A 2AGXA 5HQGA 5EAPA 3IIWA 5EARA 3UVMA 1JMZB 4A0AB 2XDWA 3F3GA 3F3FA 3EI4A 3MVDK 5IJ8E 1U4CA 5EMMB 2P9KC 4ESGA 4FAND 4TZ4A 2P9SC 3JZGA 1OLZA 5CYKB 3DXMC 5FFGA 3SBPA 4CY1A 1PI6A 3RLMD 3OTTA 5JWZA 4LG8A 1YR2A 3NIGA 4L1MA 1XKSA 2EIEA 4A08B 4ERYA 2B5NA 2XYIA 3O4HA 4A2MA 5CXBB 3ZDXA 1NEXB 4JSPC 4X63B 3K26A 1B9YA 2XE4A 3EI2A 2XL2A 4A0BB 3KRWB 2B4EA 2H9LA 2P9IC 2AH1A 3NIFA 3J81g 4NAAA 3SFZA 1QFMA 1OMWB 4UI9R 4FA5D 2VDLA 5AMSA 1O6FA 4GM9A 5FKSA 3UVOA 5FFOA 3FGBA 2XZGA 1T2XA 3L4OD 4CI8A 1C9IA 4O9DA 4JXMA 1E8MA 4OZUA 4MMXA 5TDHB 3CFVA 3PSCB 3AL8A 4X61B 3I7OA 5EAMA 4O02A 3C9CA 2UZXB 4J8BA 2IAAA 1C9LA 5GXIA 3OKWA 4H5JA 5C86A 5AFU3 3RN1D 1Q47A 1XHMA 2IUVA 1PGUA 5GXHA 5H1MA 3OL2A 2Z2PA 3ODTA 5M5TA 2VZ3A 3SWSD 1VE7A 1K3IA 4QT8A 3SBRA 3EG6A 1U8CA 4A09A 3FCUA 3JAMg 3EI3B 4E5ZA 3OKYB 4DNVA 3O4IA 3I89A 5C92A 4KFMB 5IGOA 3UKRC 2EIBA 1TYEA 2H9NA 4MK0B 1H2WA 4UM8A 3RFGA 4PSWB 5FKRA 1UTCA 2I3TA 3OW8A 3PVUB 3EMHA 2VC2A 3EU7A 5A2Qg 2WQ8A 4WK0A 4FA1D 3IKOA 5C2VB 5TEEA 3IUMA 4G1EA 2J56H 3RMZD 4PSXB 3MUNA 3V5WB 2XU7A 2VDMA 2HU8A 3PXTD 3KRXB 2HU7A 4Y5RD 2EBSA 3I7HA 4LGNA 1I2MB 4FA9D 3N0DA 1MG2A 1H2YA 2JKXA 5K19A 4JHPC 4QQEA 3IJCA 3NVXA 1A12A 5E6RA 3JRPA 3EI2B 3C5MA 5GSAA 3PXSD 5C2WB 5FKQA 4BL0A 4DNWA 2I0SA 2YNOA 5H14A 4NSXA 1ERJA 2P9LC 2PM6B 4JD2C 4FB1D 3O4JA 4DNUA 4J0WA 3EQ7A 2OVQB 2EIDA 4O1QD 2CN3A 2Q7QA 5IJ7E 4CI2A 2AQ5A 3IUQA 5I5JA 3K6SA 2H6NA 2OK6A 4A7JA 3MXXA 4L3GD 4ZOYA 1UOOA 3QI0A 3UVLA 4AN0A 1GP2B 1NR0A 5IT9g 4L1QD 1GOHA 4ERZA 3MZKA 3RSEC 3ZE2A 2H47A 4A11B 4Z7OA 2H68A 4X3EA 5HE1B 3I7PA 3OL2B 5FLXg 2I0TA 5M61A 5HE3B 4GGAA 4Z7NA 3RN0D 1S4UX 2HU5A 2OIZA 4J0XA 5B4WA 2GNQA 4A09B 1FWXA 5IGQA 5M5VA 4E5ZB 4J73A 5M5RA 3SVWD 1TBGA 5H17A 3B7FA 4JSXC 4WK2A 2VDRA 2OVRB 4FHLA 2QR5A 1L5GA 3I7KA 4PXWA 2H14A 5KDOB 2B5LA 3GD1I 4QRJA 4CY3A 4J87A 3FRXA 2I3SA 1L0QA 2CE8A 3MMYA 2P9PC 2Z2OA 4WJKA 4MMYA 3GC3B 1TYQC 1VYHC 4K3ID 3IVMA 4BCDA 4CY2A 2GC4A 2VDKA 4GQBB 4BP8A 3NVNA 1GOFA 1SQ9A 1K8KC 4CZVA 5FQDA 4CI3A 1GXRA 3IURA 1R5MA 4PC0A 3V4PA 5CXCB 3ZWLB 5I5IA 5FXYA 3IJEA 1UOQA 4J81A 3T3MA 2H13A 2YNNA 1VZ3A 4J78A 2IWFA 3KCIA 4ZOZA 4ZOVA 4A0AA 4AMZA 3AFCA 4RE6A 5TEFA 4H5IA 1O6GA 2PM7B 1JOFA 4ZN4A 4O3UB 4PNKB 3I7NA 4JSVC 3L4MD 3ZDZA 2HJBA 4O45A 3EI4B 4E54A 3EQ8A 1QFSA 3SCYA 3HFQA 3NIDA 5CXBA 5SXMA 2YB8B 1JJUB 3PVWB 5HE0B 3JROA 1BPOA 5EM2A 1E8NA 3BG0A 4CC9A 4GGCA 2HKMA 2IUPA 2HXCA 1H2XA 3UVNA 4GM8A 4A2LA 3GREA 3DWLC 4NBMA 3ORVD 4GGDA 4G1MA 2OVPB 1VE6A 4Z7QA 1M1XA 1H2ZA 3SN6B 1RI6A 4AN1A 2AGWA 5THAA 3SMRA 2EICA 3V9FA 4CY5A 3SBQA 1GG2B 3ZE0A 3UKUC 2IWKA 1P22A 2YBAA 3VH0A 1N6DA 1VZ2A 3ZDYA 3F3PA 1N6FA 2VDNA 4U1EI 3AL8B 4BP9A 3IUNA 2IURA 4CZXA 2OK4A 3I2NA 2B5MA 2H9MA 4ES0A 1E5TA 3P4FA 3UVKA 2H6QA 1SQJA 3CFSB 3OKYA 2VDOA 1N6EA 4XYHA 1GOTB 2BCJB 2YMUA 4RE5A 5FA5B 4CZYA 3GFCA 3OF7A 2UZYB 2W18A 2MTAH 4Z8LA 3AL9A 2TRCB 2P9UC 3W15A 4J79A 4ZOXA 4D9SA 3RRMC 4R7AB 3V4VA 2H9PA 3DM0A 3SHFA 4UM9A 2VDPA 2CN2A 4L3HD 3MKQA 3JPXA 1MDAH 3RFHA 4BUJC 1K32A 3BG1A 3I7LA 3IULA
chains in the Genus database with same CATH topology
4L9OA 3OKTA 1A0RB 4E54B 3V7DB 5GMKn 3C99A 3FM0A 4U7AA 4Y7RA 1YFQA 5HYNB 5AJAA 4N14A 2O9KA 1QNIA 3PSLA 3DXKC 4XEIC 4FAVD 2HESX 4O3TB 4QL1A 3EI1A 2P9NC 5EM2B 4IA9A 4JT6C 2XL3A 3EWEA 4AOWA 4FWWA 2PM9A 2CNXA 2CO0C 4J8GA 4J84A 4IMMA 2J55H 4JT5C 1SHYB 3BWSA 4ERQA 5FKTA 1PBYB 1PEVA 4GQ1A 4JSNC 4J82A 2H6KA 4PBZA 2QXVA 3JZHA 3JB9L 2Z2NA 2YNPA 4GQ2P 4PBYA 4LG9A 2BBKH 5CYKA 4GMBA 4HDJA 4GZ8A 3PXWD 2H3XA 3PE7A 4EWRA 4J77A 4A11A 5EMJB 3UR4A 1XIPA 3DSMA 2HYEA 4A08A 5EALA 4J86A 5HE2B 3U4YA 5IC7A 3NVQA 3I8EA 2PBIB 5TF2A 4A0BA 1JMXB 2HJ4A 4GM3A 4AEZA 3VGZA 2HKRA 4I79A 2CE9A 3A0FA 4D6VA 2IUQA 3IJ1A 2J57G 3AH8B 3SXTD 3SJLD 2AGZA 3J80g 2G99A 2AGLA 4YVDA 1B9XA 2GC7A 4CI1A 5EMKB 3CIKB 2CO0A 3E0CA 3IIYA 2G9AA 3VA6A 2OJYA 4BH6A 5CXCA 3ULEC 2AGYA 4FA4D 4XYIA 4D0KA 3MKSB 3JZNA 5EMLB 3SLED 3C75H 2QC5A 2AH0A 5C9ZB 3I8CA 3N0EA 5I5MA 4X60B 4G56B 3EI1B 4K3JB 4OWRA 3EI3A 3IJ0A 1U2VC 5K1CC 2I0RA 3MZLA 2PM9B 3K27A 1MG3A 2AGXA 5HQGA 5EAPA 3IIWA 5EARA 3UVMA 1JMZB 4A0AB 3F3FA 3F3GA 3EI4A 5IJ8E 1U4CA 5EMMB 2P9KC 4ESGA 4FAND 4TZ4A 2P9SC 3JZGA 1OLZA 5CYKB 3DXMC 3SBPA 4CY1A 1PI6A 3RLMD 3OTTA 5JWZA 4LG8A 1XKSA 4A08B 4ERYA 2B5NA 2XYIA 4A2MA 5CXBB 1NEXB 4JSPC 4X63B 3K26A 1B9YA 3EI2A 4A0BB 2XL2A 3KRWB 2B4EA 2H9LA 2P9IC 2AH1A 3J81g 3SFZA 1OMWB 4UI9R 4FA5D 5AMSA 4GM9A 5FKSA 3UVOA 3FGBA 4CI8A 3L4OD 4O9DA 4JXMA 4OZUA 5TDHB 3CFVA 3PSCB 3AL8A 4X61B 3I7OA 5EAMA 3C9CA 2UZXB 4J8BA 2IAAA 5GXIA 3OKWA 4H5JA 5AFU3 3RN1D 1Q47A 1XHMA 2IUVA 1PGUA 5GXHA 5H1MA 3OL2A 2Z2PA 3ODTA 3SWSD 4QT8A 3SBRA 3EG6A 4A09A 3JAMg 3EI3B 4E5ZA 3OKYB 3I89A 4KFMB 5IGOA 3UKRC 2H9NA 4MK0B 3RFGA 4PSWB 5FKRA 3PVUB 2I3TA 3OW8A 3EMHA 3EU7A 5A2Qg 4FA1D 3IKOA 5C2VB 5TEEA 2J56H 3RMZD 4PSXB 3V5WB 2XU7A 3PXTD 3KRXB 4Y5RD 2EBSA 3I7HA 4LGNA 4FA9D 3N0DA 1MG2A 5K19A 4QQEA 3IJCA 3NVXA 3JRPA 3EI2B 3C5MA 5GSAA 3PXSD 5C2WB 5FKQA 4BL0A 2I0SA 2YNOA 5H14A 4NSXA 1ERJA 2P9LC 2PM6B 4JD2C 4FB1D 4J0WA 2OVQB 4O1QD 2CN3A 2Q7QA 5IJ7E 4CI2A 2AQ5A 5I5JA 2H6NA 2OK6A 4A7JA 3MXXA 4L3GD 4ZOYA 3UVLA 1GP2B 1NR0A 5IT9g 4L1QD 4ERZA 3MZKA 3RSEC 2H47A 4A11B 2H68A 4X3EA 5HE1B 3I7PA 3OL2B 5FLXg 2I0TA 5HE3B 4GGAA 3RN0D 1S4UX 2OIZA 4J0XA 5B4WA 2GNQA 4A09B 1FWXA 5IGQA 4E5ZB 4J73A 3SVWD 1TBGA 5H17A 3B7FA 4JSXC 2OVRB 4FHLA 3I7KA 4PXWA 2H14A 5KDOB 2B5LA 4QRJA 4CY3A 4J87A 3FRXA 2I3SA 1L0QA 2CE8A 3MMYA 2P9PC 2Z2OA 1TYQC 1VYHC 4K3ID 4CY2A 2GC4A 4GQBB 3NVNA 1SQ9A 1K8KC 4CZVA 5FQDA 4CI3A 1GXRA 4PC0A 1R5MA 5CXCB 3ZWLB 5I5IA 5FXYA 4J81A 2H13A 2YNNA 4J78A 2IWFA 4ZOZA 4ZOVA 4A0AA 3AFCA 5TEFA 4H5IA 2PM7B 1JOFA 4ZN4A 4O3UB 4PNKB 3I7NA 4JSVC 3L4MD 2HJBA 4O45A 3EI4B 4E54A 3SCYA 3HFQA 5CXBA 5SXMA 2YB8B 1JJUB 3PVWB 5HE0B 3JROA 5EM2A 3BG0A 4CC9A 4GGCA 2HKMA 2IUPA 2HXCA 3UVNA 4GM8A 4A2LA 3GREA 3DWLC 3ORVD 4GGDA 2OVPB 3SN6B 1RI6A 2AGWA 5THAA 3SMRA 3V9FA 4CY5A 3SBQA 1GG2B 3UKUC 2IWKA 1P22A 2YBAA 3VH0A 1N6DA 3F3PA 1N6FA 4U1EI 3AL8B 2IURA 4CZXA 2OK4A 3I2NA 2B5MA 2H9MA 4ES0A 3P4FA 3UVKA 2H6QA 1SQJA 3OKYA 3CFSB 1N6EA 4XYHA 1GOTB 2BCJB 2YMUA 4CZYA 5FA5B 3GFCA 2UZYB 2W18A 2MTAH 4Z8LA 3AL9A 2TRCB 2P9UC 3W15A 4J79A 4ZOXA 3RRMC 4R7AB 2H9PA 3DM0A 3SHFA 4L3HD 2CN2A 3MKQA 3JPXA 1MDAH 3RFHA 4BUJC 1K32A 3BG1A 3I7LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L9O A;  3OKT A;  1A0R B;  4E54 B;  3V7D B;  5GMK n;  3C99 A;  3FM0 A;  4U7A A;  4Y7R A;  1YFQ A;  5HYN B;  5AJA A;  4N14 A;  2O9K A;  1QNI A;  3PSL A;  3DXK C;  4XEI C;  4FAV D;  2HES X;  4O3T B;  4QL1 A;  3EI1 A;  2P9N C;  5EM2 B;  4IA9 A;  4JT6 C;  2XL3 A;  3EWE A;  4AOW A;  4FWW A;  2PM9 A;  2CNX A;  2CO0 C;  4J8G A;  4J84 A;  4IMM A;  2J55 H;  4JT5 C;  1SHY B;  3BWS A;  4ERQ A;  5FKT A;  1PBY B;  1PEV A;  4GQ1 A;  4JSN C;  4J82 A;  2H6K A;  4PBZ A;  2QXV A;  3JZH A;  3JB9 L;  2Z2N A;  2YNP A;  4GQ2 P;  4PBY A;  4LG9 A;  2BBK H;  5CYK A;  4GMB A;  4HDJ A;  4GZ8 A;  3PXW D;  2H3X A;  3PE7 A;  4EWR A;  4J77 A;  4A11 A;  5EMJ B;  3UR4 A;  1XIP A;  3DSM A;  2HYE A;  4A08 A;  5EAL A;  4J86 A;  5HE2 B;  3U4Y A;  5IC7 A;  3NVQ A;  3I8E A;  2PBI B;  5TF2 A;  4A0B A;  1JMX B;  2HJ4 A;  4GM3 A;  4AEZ A;  3VGZ A;  2HKR A;  4I79 A;  2CE9 A;  3A0F A;  4D6V A;  2IUQ A;  3IJ1 A;  2J57 G;  3AH8 B;  3SXT D;  3SJL D;  2AGZ A;  3J80 g;  2G99 A;  2AGL A;  4YVD A;  1B9X A;  2GC7 A;  4CI1 A;  5EMK B;  3CIK B;  2CO0 A;  3E0C A;  3IIY A;  2G9A A;  3VA6 A;  2OJY A;  4BH6 A;  5CXC A;  3ULE C;  2AGY A;  4FA4 D;  4XYI A;  4D0K A;  3MKS B;  3JZN A;  5EML B;  3SLE D;  3C75 H;  2QC5 A;  2AH0 A;  5C9Z B;  3I8C A;  3N0E A;  5I5M A;  4X60 B;  4G56 B;  3EI1 B;  4K3J B;  4OWR A;  3EI3 A;  3IJ0 A;  1U2V C;  5K1C C;  2I0R A;  3MZL A;  2PM9 B;  3K27 A;  1MG3 A;  2AGX A;  5HQG A;  5EAP A;  3IIW A;  5EAR A;  3UVM A;  1JMZ B;  4A0A B;  3F3F A;  3F3G A;  3EI4 A;  5IJ8 E;  1U4C A;  5EMM B;  2P9K C;  4ESG A;  4FAN D;  4TZ4 A;  2P9S C;  3JZG A;  1OLZ A;  5CYK B;  3DXM C;  3SBP A;  4CY1 A;  1PI6 A;  3RLM D;  3OTT A;  5JWZ A;  4LG8 A;  1XKS A;  4A08 B;  4ERY A;  2B5N A;  2XYI A;  4A2M A;  5CXB B;  1NEX B;  4JSP C;  4X63 B;  3K26 A;  1B9Y A;  3EI2 A;  4A0B B;  2XL2 A;  3KRW B;  2B4E A;  2H9L A;  2P9I C;  2AH1 A;  3J81 g;  3SFZ A;  1OMW B;  4UI9 R;  4FA5 D;  5AMS A;  4GM9 A;  5FKS A;  3UVO A;  3FGB A;  4CI8 A;  3L4O D;  4O9D A;  4JXM A;  4OZU A;  5TDH B;  3CFV A;  3PSC B;  3AL8 A;  4X61 B;  3I7O A;  5EAM A;  3C9C A;  2UZX B;  4J8B A;  2IAA A;  5GXI A;  3OKW A;  4H5J A;  5AFU 3;  3RN1 D;  1Q47 A;  1XHM A;  2IUV A;  1PGU A;  5GXH A;  5H1M A;  3OL2 A;  2Z2P A;  3ODT A;  3SWS D;  4QT8 A;  3SBR A;  3EG6 A;  4A09 A;  3JAM g;  3EI3 B;  4E5Z A;  3OKY B;  3I89 A;  4KFM B;  5IGO A;  3UKR C;  2H9N A;  4MK0 B;  3RFG A;  4PSW B;  5FKR A;  3PVU B;  2I3T A;  3OW8 A;  3EMH A;  3EU7 A;  5A2Q g;  4FA1 D;  3IKO A;  5C2V B;  5TEE A;  2J56 H;  3RMZ D;  4PSX B;  3V5W B;  2XU7 A;  3PXT D;  3KRX B;  4Y5R D;  2EBS A;  3I7H A;  4LGN A;  4FA9 D;  3N0D A;  1MG2 A;  5K19 A;  4QQE A;  3IJC A;  3NVX A;  3JRP A;  3EI2 B;  3C5M A;  5GSA A;  3PXS D;  5C2W B;  5FKQ A;  4BL0 A;  2I0S A;  2YNO A;  5H14 A;  4NSX A;  1ERJ A;  2P9L C;  2PM6 B;  4JD2 C;  4FB1 D;  4J0W A;  2OVQ B;  4O1Q D;  2CN3 A;  2Q7Q A;  5IJ7 E;  4CI2 A;  2AQ5 A;  5I5J A;  2H6N A;  2OK6 A;  4A7J A;  3MXX A;  4L3G D;  4ZOY A;  3UVL A;  1GP2 B;  1NR0 A;  5IT9 g;  4L1Q D;  4ERZ A;  3MZK A;  3RSE C;  2H47 A;  4A11 B;  2H68 A;  4X3E A;  5HE1 B;  3I7P A;  3OL2 B;  5FLX g;  2I0T A;  5HE3 B;  4GGA A;  3RN0 D;  1S4U X;  2OIZ A;  4J0X A;  5B4W A;  2GNQ A;  4A09 B;  1FWX A;  5IGQ A;  4E5Z B;  4J73 A;  3SVW D;  1TBG A;  5H17 A;  3B7F A;  4JSX C;  2OVR B;  4FHL A;  3I7K A;  4PXW A;  2H14 A;  5KDO B;  2B5L A;  4QRJ A;  4CY3 A;  4J87 A;  3FRX A;  2I3S A;  1L0Q A;  2CE8 A;  3MMY A;  2P9P C;  2Z2O A;  1TYQ C;  1VYH C;  4K3I D;  4CY2 A;  2GC4 A;  4GQB B;  3NVN A;  1SQ9 A;  1K8K C;  4CZV A;  5FQD A;  4CI3 A;  1GXR A;  4PC0 A;  1R5M A;  5CXC B;  3ZWL B;  5I5I A;  5FXY A;  4J81 A;  2H13 A;  2YNN A;  4J78 A;  2IWF A;  4ZOZ A;  4ZOV A;  4A0A A;  3AFC A;  5TEF A;  4H5I A;  2PM7 B;  1JOF A;  4ZN4 A;  4O3U B;  4PNK B;  3I7N A;  4JSV C;  3L4M D;  2HJB A;  4O45 A;  3EI4 B;  4E54 A;  3SCY A;  3HFQ A;  5CXB A;  5SXM A;  2YB8 B;  1JJU B;  3PVW B;  5HE0 B;  3JRO A;  5EM2 A;  3BG0 A;  4CC9 A;  4GGC A;  2HKM A;  2IUP A;  2HXC A;  3UVN A;  4GM8 A;  4A2L A;  3GRE A;  3DWL C;  3ORV D;  4GGD A;  2OVP B;  3SN6 B;  1RI6 A;  2AGW A;  5THA A;  3SMR A;  3V9F A;  4CY5 A;  3SBQ A;  1GG2 B;  3UKU C;  2IWK A;  1P22 A;  2YBA A;  3VH0 A;  1N6D A;  3F3P A;  1N6F A;  4U1E I;  3AL8 B;  2IUR A;  4CZX A;  2OK4 A;  3I2N A;  2B5M A;  2H9M A;  4ES0 A;  3P4F A;  3UVK A;  2H6Q A;  1SQJ A;  3OKY A;  3CFS B;  1N6E A;  4XYH A;  1GOT B;  2BCJ B;  2YMU A;  4CZY A;  5FA5 B;  3GFC A;  2UZY B;  2W18 A;  2MTA H;  4Z8L A;  3AL9 A;  2TRC B;  2P9U C;  3W15 A;  4J79 A;  4ZOX A;  3RRM C;  4R7A B;  2H9P A;  3DM0 A;  3SHF A;  4L3H D;  2CN2 A;  3MKQ A;  3JPX A;  1MDA H;  3RFH A;  4BUJ C;  1K32 A;  3BG1 A;  3I7L A; 
#chains in the Genus database with same CATH topology
 4L9O A;  3OKT A;  4MMZ A;  1A0R B;  4G55 A;  4E54 B;  3V7D B;  5GMK n;  1UOP A;  3C99 A;  3FM0 A;  4U7A A;  4Y7R A;  5E6S A;  1YFQ A;  5HYN B;  5AJA A;  4N14 A;  2O9K A;  1QNI A;  3PSL A;  3DXK C;  2QZP A;  4XEI C;  1JV2 A;  2VDQ A;  4FAV D;  2HES X;  4O3T B;  4QL1 A;  3FCS A;  3EI1 A;  2P9N C;  5EM2 B;  4IA9 A;  4JT6 C;  2XL3 A;  3EWE A;  4AOW A;  4FWW A;  2PM9 A;  2BKL A;  2CNX A;  2CO0 C;  4J8G A;  4J84 A;  4IMM A;  1GOG A;  2J55 H;  4JT5 C;  4O2W A;  1SHY B;  3K71 A;  4BCC A;  3BWS A;  4ERQ A;  5FKT A;  1PBY B;  1PEV A;  4GQ1 A;  4JSN C;  4J82 A;  2H6K A;  3O4G A;  2QXV A;  4PBZ A;  3JZH A;  3JB9 L;  2Z2N A;  2YNP A;  4GQ2 P;  4PBY A;  4LG9 A;  3DDU A;  5E6U A;  2BBK H;  5CYK A;  4GMB A;  4HDJ A;  3ZE1 A;  3K72 A;  4GZ8 A;  3IUJ A;  3PXW D;  2H3X A;  4JHN A;  3PE7 A;  4EWR A;  4J77 A;  4A11 A;  3MUO A;  2VZ1 A;  5EMJ B;  5HDB A;  3UR4 A;  1XIP A;  3DSM A;  2HYE A;  4A08 A;  5EAL A;  4J86 A;  3T3P A;  5HE2 B;  3U4Y A;  3QHY B;  5IC7 A;  3NVQ A;  3I8E A;  2PBI B;  1JTD B;  5TF2 A;  4A0B A;  4AMY A;  1JMX B;  2HJ4 A;  4GM3 A;  4AEZ A;  3VGZ A;  2HKR A;  4I79 A;  2CE9 A;  5M5U A;  3A0F A;  4D6V A;  2IUQ A;  3IJ1 A;  3VI3 A;  4IRZ A;  2J57 G;  4NEN A;  3AH8 B;  3SXT D;  3SJL D;  2AGZ A;  5M5S A;  3J80 g;  2G99 A;  2AGL A;  4YVD A;  1B9X A;  2GC7 A;  4WK4 A;  4CI1 A;  4NC4 A;  5EMK B;  3CIK B;  2CO0 A;  3E0C A;  3IIY A;  2G9A A;  4QAM A;  2OJY A;  3VA6 A;  4AX4 A;  3EQ9 A;  4BH6 A;  5CXC A;  3ULE C;  2AGY A;  4FA4 D;  4XYI A;  4D0K A;  3MKS B;  3JZN A;  5EML B;  3SLE D;  3C75 H;  2QC5 A;  2AH0 A;  5C9Z B;  3I8C A;  3N0E A;  5I5M A;  4X60 B;  4G56 B;  3EI1 B;  4K3J B;  4OWR A;  3EI3 A;  3IJ0 A;  1U2V C;  5K1C C;  2I0R A;  3VI4 A;  3MZL A;  2PM9 B;  3K27 A;  4BCB A;  1MG3 A;  2AGX A;  5HQG A;  5EAP A;  3IIW A;  5EAR A;  3UVM A;  1JMZ B;  4A0A B;  2XDW A;  3F3G A;  3F3F A;  3EI4 A;  3MVD K;  5IJ8 E;  1U4C A;  5EMM B;  2P9K C;  4ESG A;  4FAN D;  4TZ4 A;  2P9S C;  3JZG A;  1OLZ A;  5CYK B;  3DXM C;  5FFG A;  3SBP A;  4CY1 A;  1PI6 A;  3RLM D;  3OTT A;  5JWZ A;  4LG8 A;  1YR2 A;  3NIG A;  4L1M A;  1XKS A;  2EIE A;  4A08 B;  4ERY A;  2B5N A;  2XYI A;  3O4H A;  4A2M A;  5CXB B;  3ZDX A;  1NEX B;  4JSP C;  4X63 B;  3K26 A;  1B9Y A;  2XE4 A;  3EI2 A;  2XL2 A;  4A0B B;  3KRW B;  2B4E A;  2H9L A;  2P9I C;  2AH1 A;  3NIF A;  3J81 g;  4NAA A;  3SFZ A;  1QFM A;  1OMW B;  4UI9 R;  4FA5 D;  2VDL A;  5AMS A;  1O6F A;  4GM9 A;  5FKS A;  3UVO A;  5FFO A;  3FGB A;  2XZG A;  1T2X A;  3L4O D;  4CI8 A;  1C9I A;  4O9D A;  4JXM A;  1E8M A;  4OZU A;  4MMX A;  5TDH B;  3CFV A;  3PSC B;  3AL8 A;  4X61 B;  3I7O A;  5EAM A;  4O02 A;  3C9C A;  2UZX B;  4J8B A;  2IAA A;  1C9L A;  5GXI A;  3OKW A;  4H5J A;  5C86 A;  5AFU 3;  3RN1 D;  1Q47 A;  1XHM A;  2IUV A;  1PGU A;  5GXH A;  5H1M A;  3OL2 A;  2Z2P A;  3ODT A;  5M5T A;  2VZ3 A;  3SWS D;  1VE7 A;  1K3I A;  4QT8 A;  3SBR A;  3EG6 A;  1U8C A;  4A09 A;  3FCU A;  3JAM g;  3EI3 B;  4E5Z A;  3OKY B;  4DNV A;  3O4I A;  3I89 A;  5C92 A;  4KFM B;  5IGO A;  3UKR C;  2EIB A;  1TYE A;  2H9N A;  4MK0 B;  1H2W A;  4UM8 A;  3RFG A;  4PSW B;  5FKR A;  1UTC A;  2I3T A;  3OW8 A;  3PVU B;  3EMH A;  2VC2 A;  3EU7 A;  5A2Q g;  2WQ8 A;  4WK0 A;  4FA1 D;  3IKO A;  5C2V B;  5TEE A;  3IUM A;  4G1E A;  2J56 H;  3RMZ D;  4PSX B;  3MUN A;  3V5W B;  2XU7 A;  2VDM A;  2HU8 A;  3PXT D;  3KRX B;  2HU7 A;  4Y5R D;  2EBS A;  3I7H A;  4LGN A;  1I2M B;  4FA9 D;  3N0D A;  1MG2 A;  1H2Y A;  2JKX A;  5K19 A;  4JHP C;  4QQE A;  3IJC A;  3NVX A;  1A12 A;  5E6R A;  3JRP A;  3EI2 B;  3C5M A;  5GSA A;  3PXS D;  5C2W B;  5FKQ A;  4BL0 A;  4DNW A;  2I0S A;  2YNO A;  5H14 A;  4NSX A;  1ERJ A;  2P9L C;  2PM6 B;  4JD2 C;  4FB1 D;  3O4J A;  4DNU A;  4J0W A;  3EQ7 A;  2OVQ B;  2EID A;  4O1Q D;  2CN3 A;  2Q7Q A;  5IJ7 E;  4CI2 A;  2AQ5 A;  3IUQ A;  5I5J A;  3K6S A;  2H6N A;  2OK6 A;  4A7J A;  3MXX A;  4L3G D;  4ZOY A;  1UOO A;  3QI0 A;  3UVL A;  4AN0 A;  1GP2 B;  1NR0 A;  5IT9 g;  4L1Q D;  1GOH A;  4ERZ A;  3MZK A;  3RSE C;  3ZE2 A;  2H47 A;  4A11 B;  4Z7O A;  2H68 A;  4X3E A;  5HE1 B;  3I7P A;  3OL2 B;  5FLX g;  2I0T A;  5M61 A;  5HE3 B;  4GGA A;  4Z7N A;  3RN0 D;  1S4U X;  2HU5 A;  2OIZ A;  4J0X A;  5B4W A;  2GNQ A;  4A09 B;  1FWX A;  5IGQ A;  5M5V A;  4E5Z B;  4J73 A;  5M5R A;  3SVW D;  1TBG A;  5H17 A;  3B7F A;  4JSX C;  4WK2 A;  2VDR A;  2OVR B;  4FHL A;  2QR5 A;  1L5G A;  3I7K A;  4PXW A;  2H14 A;  5KDO B;  2B5L A;  3GD1 I;  4QRJ A;  4CY3 A;  4J87 A;  3FRX A;  2I3S A;  1L0Q A;  2CE8 A;  3MMY A;  2P9P C;  2Z2O A;  4WJK A;  4MMY A;  3GC3 B;  1TYQ C;  1VYH C;  4K3I D;  3IVM A;  4BCD A;  4CY2 A;  2GC4 A;  2VDK A;  4GQB B;  4BP8 A;  3NVN A;  1GOF A;  1SQ9 A;  1K8K C;  4CZV A;  5FQD A;  4CI3 A;  1GXR A;  3IUR A;  1R5M A;  4PC0 A;  3V4P A;  5CXC B;  3ZWL B;  5I5I A;  5FXY A;  3IJE A;  1UOQ A;  4J81 A;  3T3M A;  2H13 A;  2YNN A;  1VZ3 A;  4J78 A;  2IWF A;  3KCI A;  4ZOZ A;  4ZOV A;  4A0A A;  4AMZ A;  3AFC A;  4RE6 A;  5TEF A;  4H5I A;  1O6G A;  2PM7 B;  1JOF A;  4ZN4 A;  4O3U B;  4PNK B;  3I7N A;  4JSV C;  3L4M D;  3ZDZ A;  2HJB A;  4O45 A;  3EI4 B;  4E54 A;  3EQ8 A;  1QFS A;  3SCY A;  3HFQ A;  3NID A;  5CXB A;  5SXM A;  2YB8 B;  1JJU B;  3PVW B;  5HE0 B;  3JRO A;  1BPO A;  5EM2 A;  1E8N A;  3BG0 A;  4CC9 A;  4GGC A;  2HKM A;  2IUP A;  2HXC A;  1H2X A;  3UVN A;  4GM8 A;  4A2L A;  3GRE A;  3DWL C;  4NBM A;  3ORV D;  4GGD A;  4G1M A;  2OVP B;  1VE6 A;  4Z7Q A;  1M1X A;  1H2Z A;  3SN6 B;  1RI6 A;  4AN1 A;  2AGW A;  5THA A;  3SMR A;  2EIC A;  3V9F A;  4CY5 A;  3SBQ A;  1GG2 B;  3ZE0 A;  3UKU C;  2IWK A;  1P22 A;  2YBA A;  3VH0 A;  1N6D A;  1VZ2 A;  3ZDY A;  3F3P A;  1N6F A;  2VDN A;  4U1E I;  3AL8 B;  4BP9 A;  3IUN A;  2IUR A;  4CZX A;  2OK4 A;  3I2N A;  2B5M A;  2H9M A;  4ES0 A;  1E5T A;  3P4F A;  3UVK A;  2H6Q A;  1SQJ A;  3CFS B;  3OKY A;  2VDO A;  1N6E A;  4XYH A;  1GOT B;  2BCJ B;  2YMU A;  4RE5 A;  5FA5 B;  4CZY A;  3GFC A;  3OF7 A;  2UZY B;  2W18 A;  2MTA H;  4Z8L A;  3AL9 A;  2TRC B;  2P9U C;  3W15 A;  4J79 A;  4ZOX A;  4D9S A;  3RRM C;  4R7A B;  3V4V A;  2H9P A;  3DM0 A;  3SHF A;  4UM9 A;  2VDP A;  2CN2 A;  4L3H D;  3MKQ A;  3JPX A;  1MDA H;  3RFH A;  4BUJ C;  1K32 A;  3BG1 A;  3I7L A;  3IUL A; 
#chains in the Genus database with same CATH homology
 4L9O A;  3OKT A;  1A0R B;  4E54 B;  3V7D B;  5GMK n;  3C99 A;  3FM0 A;  4U7A A;  4Y7R A;  1YFQ A;  5HYN B;  5AJA A;  4N14 A;  2O9K A;  1QNI A;  3PSL A;  3DXK C;  4XEI C;  4FAV D;  2HES X;  4O3T B;  4QL1 A;  3EI1 A;  2P9N C;  5EM2 B;  4IA9 A;  4JT6 C;  2XL3 A;  3EWE A;  4AOW A;  4FWW A;  2PM9 A;  2CNX A;  2CO0 C;  4J8G A;  4J84 A;  4IMM A;  2J55 H;  4JT5 C;  1SHY B;  3BWS A;  4ERQ A;  5FKT A;  1PBY B;  1PEV A;  4GQ1 A;  4JSN C;  4J82 A;  2H6K A;  4PBZ A;  2QXV A;  3JZH A;  3JB9 L;  2Z2N A;  2YNP A;  4GQ2 P;  4PBY A;  4LG9 A;  2BBK H;  5CYK A;  4GMB A;  4HDJ A;  4GZ8 A;  3PXW D;  2H3X A;  3PE7 A;  4EWR A;  4J77 A;  4A11 A;  5EMJ B;  3UR4 A;  1XIP A;  3DSM A;  2HYE A;  4A08 A;  5EAL A;  4J86 A;  5HE2 B;  3U4Y A;  5IC7 A;  3NVQ A;  3I8E A;  2PBI B;  5TF2 A;  4A0B A;  1JMX B;  2HJ4 A;  4GM3 A;  4AEZ A;  3VGZ A;  2HKR A;  4I79 A;  2CE9 A;  3A0F A;  4D6V A;  2IUQ A;  3IJ1 A;  2J57 G;  3AH8 B;  3SXT D;  3SJL D;  2AGZ A;  3J80 g;  2G99 A;  2AGL A;  4YVD A;  1B9X A;  2GC7 A;  4CI1 A;  5EMK B;  3CIK B;  2CO0 A;  3E0C A;  3IIY A;  2G9A A;  3VA6 A;  2OJY A;  4BH6 A;  5CXC A;  3ULE C;  2AGY A;  4FA4 D;  4XYI A;  4D0K A;  3MKS B;  3JZN A;  5EML B;  3SLE D;  3C75 H;  2QC5 A;  2AH0 A;  5C9Z B;  3I8C A;  3N0E A;  5I5M A;  4X60 B;  4G56 B;  3EI1 B;  4K3J B;  4OWR A;  3EI3 A;  3IJ0 A;  1U2V C;  5K1C C;  2I0R A;  3MZL A;  2PM9 B;  3K27 A;  1MG3 A;  2AGX A;  5HQG A;  5EAP A;  3IIW A;  5EAR A;  3UVM A;  1JMZ B;  4A0A B;  3F3F A;  3F3G A;  3EI4 A;  5IJ8 E;  1U4C A;  5EMM B;  2P9K C;  4ESG A;  4FAN D;  4TZ4 A;  2P9S C;  3JZG A;  1OLZ A;  5CYK B;  3DXM C;  3SBP A;  4CY1 A;  1PI6 A;  3RLM D;  3OTT A;  5JWZ A;  4LG8 A;  1XKS A;  4A08 B;  4ERY A;  2B5N A;  2XYI A;  4A2M A;  5CXB B;  1NEX B;  4JSP C;  4X63 B;  3K26 A;  1B9Y A;  3EI2 A;  4A0B B;  2XL2 A;  3KRW B;  2B4E A;  2H9L A;  2P9I C;  2AH1 A;  3J81 g;  3SFZ A;  1OMW B;  4UI9 R;  4FA5 D;  5AMS A;  4GM9 A;  5FKS A;  3UVO A;  3FGB A;  4CI8 A;  3L4O D;  4O9D A;  4JXM A;  4OZU A;  5TDH B;  3CFV A;  3PSC B;  3AL8 A;  4X61 B;  3I7O A;  5EAM A;  3C9C A;  2UZX B;  4J8B A;  2IAA A;  5GXI A;  3OKW A;  4H5J A;  5AFU 3;  3RN1 D;  1Q47 A;  1XHM A;  2IUV A;  1PGU A;  5GXH A;  5H1M A;  3OL2 A;  2Z2P A;  3ODT A;  3SWS D;  4QT8 A;  3SBR A;  3EG6 A;  4A09 A;  3JAM g;  3EI3 B;  4E5Z A;  3OKY B;  3I89 A;  4KFM B;  5IGO A;  3UKR C;  2H9N A;  4MK0 B;  3RFG A;  4PSW B;  5FKR A;  3PVU B;  2I3T A;  3OW8 A;  3EMH A;  3EU7 A;  5A2Q g;  4FA1 D;  3IKO A;  5C2V B;  5TEE A;  2J56 H;  3RMZ D;  4PSX B;  3V5W B;  2XU7 A;  3PXT D;  3KRX B;  4Y5R D;  2EBS A;  3I7H A;  4LGN A;  4FA9 D;  3N0D A;  1MG2 A;  5K19 A;  4QQE A;  3IJC A;  3NVX A;  3JRP A;  3EI2 B;  3C5M A;  5GSA A;  3PXS D;  5C2W B;  5FKQ A;  4BL0 A;  2I0S A;  2YNO A;  5H14 A;  4NSX A;  1ERJ A;  2P9L C;  2PM6 B;  4JD2 C;  4FB1 D;  4J0W A;  2OVQ B;  4O1Q D;  2CN3 A;  2Q7Q A;  5IJ7 E;  4CI2 A;  2AQ5 A;  5I5J A;  2H6N A;  2OK6 A;  4A7J A;  3MXX A;  4L3G D;  4ZOY A;  3UVL A;  1GP2 B;  1NR0 A;  5IT9 g;  4L1Q D;  4ERZ A;  3MZK A;  3RSE C;  2H47 A;  4A11 B;  2H68 A;  4X3E A;  5HE1 B;  3I7P A;  3OL2 B;  5FLX g;  2I0T A;  5HE3 B;  4GGA A;  3RN0 D;  1S4U X;  2OIZ A;  4J0X A;  5B4W A;  2GNQ A;  4A09 B;  1FWX A;  5IGQ A;  4E5Z B;  4J73 A;  3SVW D;  1TBG A;  5H17 A;  3B7F A;  4JSX C;  2OVR B;  4FHL A;  3I7K A;  4PXW A;  2H14 A;  5KDO B;  2B5L A;  4QRJ A;  4CY3 A;  4J87 A;  3FRX A;  2I3S A;  1L0Q A;  2CE8 A;  3MMY A;  2P9P C;  2Z2O A;  1TYQ C;  1VYH C;  4K3I D;  4CY2 A;  2GC4 A;  4GQB B;  3NVN A;  1SQ9 A;  1K8K C;  4CZV A;  5FQD A;  4CI3 A;  1GXR A;  4PC0 A;  1R5M A;  5CXC B;  3ZWL B;  5I5I A;  5FXY A;  4J81 A;  2H13 A;  2YNN A;  4J78 A;  2IWF A;  4ZOZ A;  4ZOV A;  4A0A A;  3AFC A;  5TEF A;  4H5I A;  2PM7 B;  1JOF A;  4ZN4 A;  4O3U B;  4PNK B;  3I7N A;  4JSV C;  3L4M D;  2HJB A;  4O45 A;  3EI4 B;  4E54 A;  3SCY A;  3HFQ A;  5CXB A;  5SXM A;  2YB8 B;  1JJU B;  3PVW B;  5HE0 B;  3JRO A;  5EM2 A;  3BG0 A;  4CC9 A;  4GGC A;  2HKM A;  2IUP A;  2HXC A;  3UVN A;  4GM8 A;  4A2L A;  3GRE A;  3DWL C;  3ORV D;  4GGD A;  2OVP B;  3SN6 B;  1RI6 A;  2AGW A;  5THA A;  3SMR A;  3V9F A;  4CY5 A;  3SBQ A;  1GG2 B;  3UKU C;  2IWK A;  1P22 A;  2YBA A;  3VH0 A;  1N6D A;  3F3P A;  1N6F A;  4U1E I;  3AL8 B;  2IUR A;  4CZX A;  2OK4 A;  3I2N A;  2B5M A;  2H9M A;  4ES0 A;  3P4F A;  3UVK A;  2H6Q A;  1SQJ A;  3OKY A;  3CFS B;  1N6E A;  4XYH A;  1GOT B;  2BCJ B;  2YMU A;  4CZY A;  5FA5 B;  3GFC A;  2UZY B;  2W18 A;  2MTA H;  4Z8L A;  3AL9 A;  2TRC B;  2P9U C;  3W15 A;  4J79 A;  4ZOX A;  3RRM C;  4R7A B;  2H9P A;  3DM0 A;  3SHF A;  4L3H D;  2CN2 A;  3MKQ A;  3JPX A;  1MDA H;  3RFH A;  4BUJ C;  1K32 A;  3BG1 A;  3I7L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...