4AOWA

Crystal structure of the human rack1 protein at a resolution of 2.45 angstrom
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
312
structure length
305
Chain Sequence
EQMTLRGTLKGHNGWVTQIATTPQFPDMILSASRDKTIIMWKLTRDETNYGIPQRALRGHSHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSSDNRQIVSGSRDKTIKLWNTLGVCKYTVQDESHSEWVSCVRFSPNSSNPIIVSCGWDKLVKVWNLANCKLKTNHIGHTGYLNTVTVSPDGSLCASGGKDGQAMLWDLNEGKHLYTLDGGDIINALCFSPNRYWLCAATGPSIKIWDLEGKIIVDELKQEAEPPQCTSLAWSADGQTLFAGYTDNLVRVWQVTI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GUANINE NUCLEOTIDE-BINDING PROTEIN SUBUNIT BETA-2-LIKE 1
publication title Structure of Human Rack1 Protein at a Resolution of 2.45 A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Receptor
total genus 76
structure length 305
sequence length 312
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4aowA01
1B9XA 3DM0A 2BBKH 3FM0A 1MG2A 4ZN4A 4A2MA 1PGUA 5HE3B 2CO0C 3I7LA 4JT5C 4PBYA 5GSAA 4Y5RD 1JMZB 2HJBA 2IWFA 5FQDA 3VGZA 4J8BA 2P9SC 4GMBA 3BG1A 4A09B 5HQGA 2I3TA 4J79A 3RN1D 3IJ1A 2GNQA 5TF2A 1PEVA 4FHLA 4NSXA 2Z2PA 1VYHC 4H5JA 1TBGA 5FKQA 1NEXB 2MTAH 3UVLA 3SMRA 4CC9A 4CI3A 3UVNA 1YFQA 3CFVA 2HJ4A 4J87A 2B5MA 4O9DA 1OLZA 3B7FA 3UR4A 4BUJC 5GXHA 2GC4A 4U1EI 3SVWD 3I7HA 5EALA 2PM9A 1RI6A 5HYNB 3NVQA 3V7DB 3K27A 1Q47A 2PM7B 4J0XA 3ORVD 5TEEA 1GG2B 2TRCB 3PSLA 1JJUB 4L9OA 5IGOA 3AL9A 3AH8B 5I5IA 2XU7A 2YB8B 2PM9B 1R5MA 3JB9L 3OKWA 4LG9A 2P9UC 4A08B 1K8KC 4BH6A 3SXTD 2I3SA 3UVOA 2AGXA 3EWEA 4XYHA 4JXMA 3I7NA 5TEFA 2IURA 3SN6B 4AEZA 4ERYA 3OW8A 5KDOB 3DSMA 4GM9A 5C2VB 5IT9g 2O9KA 5AFU3 5H14A 2UZXB 4PNKB 4A7JA 4QT8A 4K3ID 4QRJA 4CY5A 2H9LA 2EBSA 5EAPA 4L1QD 2OVQB 4KFMB 3EI3A 2AH0A 2CE9A 4O1QD 3EI1A 3C75H 2AGWA 3CIKB 4CZYA 4H5IA 3C99A 2B5NA 2IUQA 4LG8A 5H17A 3N0DA 2G99A 2P9IC 5HE1B 3UVKA 4CI1A 3RLMD 4CY1A 3A0FA 4A0BB 3E0CA 2P9LC 4GM3A 5SXMA 4A09A 4J77A 2OK6A 1JOFA 5AMSA 2OK4A 2YNPA 4L3HD 4JD2C 3JZNA 2H14A 2OVRB 3P4FA 3ODTA 3F3FA 3OL2B 3DXMC 1MDAH 4HDJA 4J73A 3SBPA 4ZOZA 1SQJA 5K1CC 3SFZA 3UKRC 2I0SA 5IGQA 1QNIA 3I8EA 2P9KC 4XEIC 5EM2A 3I8CA 4XYIA 3SWSD 4O45A 4UI9R 3PXSD 2J56H 4QL1A 3GFCA 3W15A 2PM6B 5EMJB 3U4YA 3KRWB 4PC0A 5C2WB 3JRPA 4JT6C 2J57G 2IUVA 3MXXA 2B4EA 3IIWA 3CFSB 3MKSB 3JZHA 3PXTD 4CZXA 5EM2B 1U2VC 1P22A 2BCJB 4OZUA 2AGYA 4J86A 3IJCA 4A08A 3EI4A 2AGZA 4X61B 1A0RB 3RSEC 4A11B 3FRXA 3SLED 2J55H 2H9PA 2CN2A 4ERZA 2YNNA 3ZWLB 2H9MA 3V9FA 3RMZD 5JWZA 1XIPA 1PBYB 4FA1D 4X3EA 3EI4B 2I0TA 4PXWA 3C5MA 3RFHA 3RN0D 4IMMA 2H47A 3FGBA 4PSXB 2P9PC 3ULEC 2G9AA 2HESX 2HXCA 2W18A 4A2LA 4D6VA 5IJ7E 2UZYB 5FA5B 5K19A 3MZLA 4K3JB 4O3UB 3HFQA 3SJLD 5I5MA 2H3XA 3KRXB 2OVPB 4CZVA 1FWXA 4X60B 3UVMA 3EG6A 4MK0B 5AJAA 5IC7A 4A0BA 1XHMA 2H6KA 3UKUC 1N6EA 5CYKB 5FLXg 1S4UX 5A2Qg 3L4OD 3I89A 4GM8A 4CI8A 4E5ZB 1B9YA 4CY3A 3J80g 3SBQA 4GZ8A 4ES0A 3JAMg 4J0WA 4OWRA 3PE7A 4GQBB 1N6FA 3OL2A 3C9CA 2AGLA 2HKRA 5C9ZB 2AH1A 5FXYA 3AFCA 4JSVC 4U7AA 5HE0B 3EI2A 1XKSA 4PBZA 3F3PA 3IIYA 4A0AB 4ZOXA 3I7PA 3OKYB 4GGCA 4IA9A 3IKOA 3MMYA 4FAND 3PVWB 4E54B 2YNOA 3EMHA 4GGDA 3VA6A 2CE8A 2QC5A 3EI2B 1PI6A 2B5LA 5EMLB 3RRMC 1GXRA 2XYIA 3JPXA 3MKQA 5GXIA 3DWLC 4LGNA 5B4WA 4JSNC 2Z2NA 5H1MA 3I7OA 2OJYA 4ZOYA 2IWKA 4Z8LA 3MZKA 1N6DA 1MG3A 4QQEA 4A11A 2AQ5A 2H9NA 4PSWB 3DXKC 3VH0A 4FA5D 2CNXA 3JROA 3PSCB 2XL3A 2XL2A 4GGAA 5CXBA 2OIZA 2Q7QA 3NVNA 3SBRA 2H6NA 4TZ4A 3NVXA 4FA4D 2P9NC 1ERJA 1GOTB 5CXCA 2QXVA 2CN3A 3IJ0A 5FKSA 2H6QA 4AOWA 3I7KA 4BL0A 3OKTA 5FKTA 4D0KA 5THAA 3F3GA 4ESGA 4R7AB 5CXBB 2YBAA 4I79A 4O3TB 4FB1D 1SQ9A 4J81A 5I5JA 2CO0A 5CXCB 2HYEA 3AL8A 5EMMB 3RFGA 5FKRA 3PVUB 2HKMA 3PXWD 4FA9D 4J78A 5CYKA 4G56B 4JSXC 4YVDA 3V5WB 1TYQC 5EARA 3I2NA 3BG0A 4E5ZA 2H13A 5HE2B 2I0RA 4GQ1A 2GC7A 3SCYA 3JZGA 5EMKB 3AL8B 3J81g 5GMKn 4J8GA 4J82A 4CI2A 3GREA 2IUPA 4FAVD 4L3GD 2IAAA 2H68A 2Z2OA 3N0EA 4Y7RA 3L4MD 4J84A 4A0AA 1JMXB 1K32A 3OKYA 1NR0A 5TDHB 5EAMA 4FWWA 1U4CA 1SHYB 4E54A 3EU7A 2YMUA 4ERQA 4GQ2P 4EWRA 3SHFA 1GP2B 5IJ8E 4X63B 4CY2A 4JSPC 1OMWB 4N14A 3BWSA 3EI3B 4ZOVA 2PBIB 1L0QA 3OTTA 3EI1B 3K26A
chains in the Genus database with same CATH superfamily
1B9XA 3DM0A 2BBKH 3FM0A 3FCSA 1MG2A 4ZN4A 4A2MA 1PGUA 5HE3B 2CO0C 3I7LA 1JV2A 4JT5C 4PBYA 1GOFA 5GSAA 1VZ3A 2EICA 1K3IA 4Y5RD 1JMZB 2HJBA 2IWFA 2VZ1A 3O4JA 5FQDA 3VGZA 4J8BA 2P9SC 4WK4A 4GMBA 4BCCA 3BG1A 4A09B 5HQGA 2I3TA 4J79A 3RN1D 4AMYA 4AX4A 3IJ1A 2GNQA 3T3PA 4AN0A 2QZPA 5TF2A 3MUOA 1PEVA 1GOGA 4FHLA 4NSXA 2Z2PA 3MUNA 1VYHC 3IUJA 4H5JA 4NAAA 1TBGA 5FKQA 1NEXB 2MTAH 4O02A 3UVLA 1H2WA 3SMRA 4CC9A 4CI3A 3UVNA 1YFQA 3CFVA 2HU7A 2HJ4A 4J87A 2VDLA 2B5MA 4UM9A 4O9DA 1OLZA 3B7FA 3UR4A 4BUJC 5GXHA 5E6UA 2GC4A 4U1EI 3SVWD 3I7HA 5EALA 2PM9A 1RI6A 1E5TA 5HYNB 3NVQA 3V4PA 3V7DB 3K27A 1Q47A 2PM7B 2BKLA 4J0XA 3ORVD 5TEEA 1GG2B 2TRCB 3O4HA 1JJUB 3PSLA 4L9OA 4RE6A 5IGOA 3AL9A 3AH8B 5I5IA 2XU7A 2YB8B 4CY5A 2PM9B 1R5MA 3GD1I 3JB9L 3OKWA 2VDMA 4LG9A 2P9UC 4A08B 4AN1A 1K8KC 4BH6A 4IRZA 3SXTD 2I3SA 3NIFA 3UVOA 2AGXA 3EWEA 3QI0A 4XYHA 4JXMA 3I7NA 5TEFA 2IURA 3SN6B 4AEZA 4ERYA 3O4IA 3OW8A 5KDOB 3DSMA 3DDUA 4GM9A 1UOPA 5C2VB 2VZ3A 5IT9g 2O9KA 5AFU3 5H14A 2UZXB 4PNKB 4A7JA 5M5UA 4QT8A 4K3ID 1BPOA 4QRJA 2H9LA 2EBSA 5EAPA 4L1QD 2OVQB 4KFMB 3EI3A 2AH0A 2CE9A 3FCUA 4O1QD 5HDBA 3EI1A 3C75H 2AGWA 1UTCA 3CIKB 4CZYA 4L1MA 4H5IA 3C99A 2B5NA 2IUQA 4LG8A 5H17A 2XDWA 2WQ8A 3N0DA 4JHNA 2G99A 2P9IC 5HE1B 3UVKA 4BCBA 4CI1A 5C86A 3RLMD 1JTDB 4CY1A 3A0FA 4A0BB 3E0CA 2P9LC 4GM3A 3VI4A 5SXMA 3V4VA 4A09A 4J77A 4DNWA 2OK6A 4AMZA 1JOFA 5AMSA 1QFMA 2OK4A 2YNPA 4L3HD 4JD2C 3JZNA 2H14A 2OVRB 3MVDK 3P4FA 3ODTA 3F3FA 3OL2B 1M1XA 3DXMC 4DNVA 1MDAH 4HDJA 4J73A 4NC4A 3SBPA 4ZOZA 1SQJA 5K1CC 3SFZA 1QFSA 3UKRC 2I0SA 1A12A 3ZE1A 5IGQA 1QNIA 3I8EA 4NENA 2P9KC 2VC2A 4XEIC 2QR5A 5EM2A 3I8CA 4XYIA 3SWSD 4O45A 4UI9R 3PXSD 2J56H 4QL1A 1L5GA 1U8CA 3GFCA 3W15A 2HU5A 2PM6B 4WK0A 5EMJB 3U4YA 3K71A 3KRWB 4PC0A 5C2WB 4MMXA 3JRPA 4JT6C 2J57G 1VE7A 2IUVA 3MXXA 2B4EA 2EIDA 4MMYA 3IIWA 3CFSB 3MKSB 3JZHA 3PXTD 4CZXA 5EM2B 1U2VC 1P22A 2BCJB 4OZUA 2AGYA 4J86A 1TYEA 3IJCA 4A08A 4Z7QA 3EI4A 2AGZA 1YR2A 3IUNA 2VDKA 3ZDYA 4X61B 1A0RB 3RSEC 4A11B 4BP8A 3FRXA 5FFOA 3SLED 2J55H 2XE4A 2H9PA 2CN2A 3NIDA 4ERZA 2YNNA 3ZWLB 2H9MA 3V9FA 2XZGA 3RMZD 5JWZA 1XIPA 1PBYB 4FA1D 4X3EA 3EI4B 3EQ7A 4G55A 2I0TA 4PXWA 3C5MA 3IULA 3EQ9A 3RFHA 3EQ8A 3RN0D 4Z7OA 4IMMA 2H47A 3FGBA 4PSXB 2P9PC 3ULEC 2G9AA 1H2XA 2HESX 3ZE2A 2HXCA 2W18A 4A2LA 4D6VA 5IJ7E 2UZYB 5FA5B 3IJEA 5K19A 5M5VA 3MZLA 4K3JB 1T2XA 4Z7NA 1E8MA 4O3UB 3HFQA 3SJLD 5I5MA 5M5SA 2H3XA 3KRXB 4BP9A 2OVPB 4CZVA 1FWXA 4X60B 3UVMA 3EG6A 4MK0B 5AJAA 5IC7A 4A0BA 1XHMA 2H6KA 3UKUC 1N6EA 3K72A 5CYKB 1VE6A 5FLXg 1S4UX 5A2Qg 3L4OD 3T3MA 3I89A 4DNUA 4GM8A 4CI8A 3K6SA 4E5ZB 1B9YA 4CY3A 3IUMA 1I2MB 5FFGA 3J80g 3SBQA 4GZ8A 4ES0A 3JAMg 4J0WA 4OWRA 3VI3A 2VDNA 1O6GA 3PE7A 4GQBB 1N6FA 3OL2A 4O2WA 3C9CA 2AGLA 4NBMA 2HKRA 2VDRA 5C9ZB 2AH1A 1VZ2A 5FXYA 3AFCA 4JSVC 4U7AA 5HE0B 3EI2A 1XKSA 4PBZA 3F3PA 3IIYA 4A0AB 4UM8A 2VDOA 4ZOXA 3I7PA 3OKYB 4GGCA 1UOQA 4IA9A 5E6RA 3IKOA 1UOOA 3MMYA 4FAND 3PVWB 4E54B 2YNOA 3EMHA 4GGDA 3VA6A 2CE8A 2QC5A 3EI2B 1PI6A 2B5LA 5EMLB 5M61A 3RRMC 1GXRA 2XYIA 3JPXA 3IUQA 3MKQA 5GXIA 3DWLC 4LGNA 5B4WA 4JSNC 2Z2NA 5H1MA 3I7OA 2OJYA 4ZOYA 2VDPA 3OF7A 2IWKA 4Z8LA 4JHPC 3MZKA 1H2YA 1N6DA 2VDQA 1MG3A 4QQEA 4G1MA 4A11A 2AQ5A 2H9NA 4PSWB 3DXKC 3VH0A 4FA5D 3ZE0A 2CNXA 3JROA 3PSCB 3GC3B 2XL3A 2XL2A 4GGAA 5CXBA 2OIZA 2Q7QA 3IVMA 3NVNA 3SBRA 2H6NA 1O6FA 3NVXA 4TZ4A 4FA4D 1C9LA 2P9NC 1ERJA 1GOTB 5CXCA 2QXVA 2CN3A 3IJ0A 5FKSA 2H6QA 4AOWA 3I7KA 4BL0A 3OKTA 5FKTA 4D0KA 5THAA 3F3GA 4ESGA 4R7AB 5CXBB 2YBAA 4I79A 4O3TB 4FB1D 1SQ9A 4J81A 5I5JA 2CO0A 5CXCB 2HYEA 3AL8A 5EMMB 1C9IA 3RFGA 5FKRA 4G1EA 4RE5A 3PVUB 2HKMA 3PXWD 4FA9D 4J78A 5CYKA 4G56B 4JSXC 1E8NA 4YVDA 4QAMA 3V5WB 1TYQC 3ZDXA 5EARA 5C92A 1GOHA 3KCIA 3I2NA 3BG0A 4E5ZA 2H13A 5HE2B 2I0RA 4GQ1A 2GC7A 1H2ZA 3IURA 2HU8A 3SCYA 3JZGA 5EMKB 3AL8B 3J81g 5GMKn 4D9SA 4J8GA 4J82A 4CI2A 3O4GA 3GREA 5M5RA 2IUPA 4WK2A 4FAVD 3NIGA 2JKXA 4L3GD 4MMZA 2IAAA 2EIEA 2H68A 3N0EA 2Z2OA 4Y7RA 3L4MD 4J84A 4A0AA 1JMXB 1K32A 3OKYA 1NR0A 5TDHB 5EAMA 4FWWA 1U4CA 1SHYB 4E54A 3EU7A 2YMUA 4ERQA 4GQ2P 5M5TA 4EWRA 3SHFA 1GP2B 5IJ8E 4X63B 4WJKA 4CY2A 4JSPC 1OMWB 4N14A 3QHYB 5E6SA 2EIBA 4BCDA 3BWSA 3EI3B 4ZOVA 3ZDZA 2PBIB 1L0QA 3OTTA 3EI1B 3K26A
chains in the Genus database with same CATH topology
1B9XA 3DM0A 2BBKH 3FM0A 1MG2A 4ZN4A 4A2MA 1PGUA 5HE3B 2CO0C 3I7LA 4JT5C 4PBYA 5GSAA 4Y5RD 1JMZB 2HJBA 2IWFA 5FQDA 3VGZA 4J8BA 2P9SC 4GMBA 3BG1A 4A09B 5HQGA 2I3TA 4J79A 3RN1D 3IJ1A 2GNQA 5TF2A 1PEVA 4FHLA 4NSXA 2Z2PA 1VYHC 4H5JA 1TBGA 5FKQA 1NEXB 2MTAH 3UVLA 3SMRA 4CC9A 4CI3A 3UVNA 1YFQA 3CFVA 2HJ4A 4J87A 2B5MA 4O9DA 1OLZA 3B7FA 3UR4A 4BUJC 5GXHA 2GC4A 4U1EI 3SVWD 3I7HA 5EALA 2PM9A 1RI6A 5HYNB 3NVQA 3V7DB 3K27A 1Q47A 2PM7B 4J0XA 3ORVD 5TEEA 1GG2B 2TRCB 3PSLA 1JJUB 4L9OA 5IGOA 3AL9A 3AH8B 5I5IA 2XU7A 2YB8B 2PM9B 1R5MA 3JB9L 3OKWA 4LG9A 2P9UC 4A08B 1K8KC 4BH6A 3SXTD 2I3SA 3UVOA 2AGXA 3EWEA 4XYHA 4JXMA 3I7NA 5TEFA 2IURA 3SN6B 4AEZA 4ERYA 3OW8A 5KDOB 3DSMA 4GM9A 5C2VB 5IT9g 2O9KA 5AFU3 5H14A 2UZXB 4PNKB 4A7JA 4QT8A 4K3ID 4QRJA 4CY5A 2H9LA 2EBSA 5EAPA 4L1QD 2OVQB 4KFMB 3EI3A 2AH0A 2CE9A 4O1QD 3EI1A 3C75H 2AGWA 3CIKB 4CZYA 4H5IA 3C99A 2B5NA 2IUQA 4LG8A 5H17A 3N0DA 2G99A 2P9IC 5HE1B 3UVKA 4CI1A 3RLMD 4CY1A 3A0FA 4A0BB 3E0CA 2P9LC 4GM3A 5SXMA 4A09A 4J77A 2OK6A 1JOFA 5AMSA 2OK4A 2YNPA 4L3HD 4JD2C 3JZNA 2H14A 2OVRB 3P4FA 3ODTA 3F3FA 3OL2B 3DXMC 1MDAH 4HDJA 4J73A 3SBPA 4ZOZA 1SQJA 5K1CC 3SFZA 3UKRC 2I0SA 5IGQA 1QNIA 3I8EA 2P9KC 4XEIC 5EM2A 3I8CA 4XYIA 3SWSD 4O45A 4UI9R 3PXSD 2J56H 4QL1A 3GFCA 3W15A 2PM6B 5EMJB 3U4YA 3KRWB 4PC0A 5C2WB 3JRPA 4JT6C 2J57G 2IUVA 3MXXA 2B4EA 3IIWA 3CFSB 3MKSB 3JZHA 3PXTD 4CZXA 5EM2B 1U2VC 1P22A 2BCJB 4OZUA 2AGYA 4J86A 3IJCA 4A08A 3EI4A 2AGZA 4X61B 1A0RB 3RSEC 4A11B 3FRXA 3SLED 2J55H 2H9PA 2CN2A 4ERZA 2YNNA 3ZWLB 2H9MA 3V9FA 3RMZD 5JWZA 1XIPA 1PBYB 4FA1D 4X3EA 3EI4B 2I0TA 4PXWA 3C5MA 3RFHA 3RN0D 4IMMA 2H47A 3FGBA 4PSXB 2P9PC 3ULEC 2G9AA 2HESX 2HXCA 2W18A 4A2LA 4D6VA 5IJ7E 2UZYB 5FA5B 5K19A 3MZLA 4K3JB 4O3UB 3HFQA 3SJLD 5I5MA 2H3XA 3KRXB 2OVPB 4CZVA 1FWXA 4X60B 3UVMA 3EG6A 4MK0B 5AJAA 5IC7A 4A0BA 1XHMA 2H6KA 3UKUC 1N6EA 5CYKB 5FLXg 1S4UX 5A2Qg 3L4OD 3I89A 4GM8A 4CI8A 4E5ZB 1B9YA 4CY3A 3J80g 3SBQA 4GZ8A 4ES0A 3JAMg 4J0WA 4OWRA 3PE7A 4GQBB 1N6FA 3OL2A 3C9CA 2AGLA 2HKRA 5C9ZB 2AH1A 5FXYA 3AFCA 4JSVC 4U7AA 5HE0B 3EI2A 1XKSA 4PBZA 3F3PA 3IIYA 4A0AB 4ZOXA 3I7PA 3OKYB 4GGCA 4IA9A 3IKOA 3MMYA 4FAND 3PVWB 4E54B 2YNOA 3EMHA 4GGDA 3VA6A 2CE8A 2QC5A 3EI2B 1PI6A 2B5LA 5EMLB 3RRMC 1GXRA 2XYIA 3JPXA 3MKQA 5GXIA 3DWLC 4LGNA 5B4WA 4JSNC 2Z2NA 5H1MA 3I7OA 2OJYA 4ZOYA 2IWKA 4Z8LA 3MZKA 1N6DA 1MG3A 4QQEA 4A11A 2AQ5A 2H9NA 4PSWB 3DXKC 3VH0A 4FA5D 2CNXA 3JROA 3PSCB 2XL3A 2XL2A 4GGAA 5CXBA 2OIZA 2Q7QA 3NVNA 3SBRA 2H6NA 4TZ4A 3NVXA 4FA4D 2P9NC 1ERJA 1GOTB 5CXCA 2QXVA 2CN3A 3IJ0A 5FKSA 2H6QA 4AOWA 3I7KA 4BL0A 3OKTA 5FKTA 4D0KA 5THAA 3F3GA 4ESGA 4R7AB 5CXBB 2YBAA 4I79A 4O3TB 4FB1D 1SQ9A 4J81A 5I5JA 2CO0A 5CXCB 2HYEA 3AL8A 5EMMB 3RFGA 5FKRA 3PVUB 2HKMA 3PXWD 4FA9D 4J78A 5CYKA 4G56B 4JSXC 4YVDA 3V5WB 1TYQC 5EARA 3I2NA 3BG0A 4E5ZA 2H13A 5HE2B 2I0RA 4GQ1A 2GC7A 3SCYA 3JZGA 5EMKB 3AL8B 3J81g 5GMKn 4J8GA 4J82A 4CI2A 3GREA 2IUPA 4FAVD 4L3GD 2IAAA 2H68A 2Z2OA 3N0EA 4Y7RA 3L4MD 4J84A 4A0AA 1JMXB 1K32A 3OKYA 1NR0A 5TDHB 5EAMA 4FWWA 1U4CA 1SHYB 4E54A 3EU7A 2YMUA 4ERQA 4GQ2P 4EWRA 3SHFA 1GP2B 5IJ8E 4X63B 4CY2A 4JSPC 1OMWB 4N14A 3BWSA 3EI3B 4ZOVA 2PBIB 1L0QA 3OTTA 3EI1B 3K26A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B9X A;  3DM0 A;  2BBK H;  3FM0 A;  1MG2 A;  4ZN4 A;  4A2M A;  1PGU A;  5HE3 B;  2CO0 C;  3I7L A;  4JT5 C;  4PBY A;  5GSA A;  4Y5R D;  1JMZ B;  2HJB A;  2IWF A;  5FQD A;  3VGZ A;  4J8B A;  2P9S C;  4GMB A;  3BG1 A;  4A09 B;  5HQG A;  2I3T A;  4J79 A;  3RN1 D;  3IJ1 A;  2GNQ A;  5TF2 A;  1PEV A;  4FHL A;  4NSX A;  2Z2P A;  1VYH C;  4H5J A;  1TBG A;  5FKQ A;  1NEX B;  2MTA H;  3UVL A;  3SMR A;  4CC9 A;  4CI3 A;  3UVN A;  1YFQ A;  3CFV A;  2HJ4 A;  4J87 A;  2B5M A;  4O9D A;  1OLZ A;  3B7F A;  3UR4 A;  4BUJ C;  5GXH A;  2GC4 A;  4U1E I;  3SVW D;  3I7H A;  5EAL A;  2PM9 A;  1RI6 A;  5HYN B;  3NVQ A;  3V7D B;  3K27 A;  1Q47 A;  2PM7 B;  4J0X A;  3ORV D;  5TEE A;  1GG2 B;  2TRC B;  3PSL A;  1JJU B;  4L9O A;  5IGO A;  3AL9 A;  3AH8 B;  5I5I A;  2XU7 A;  2YB8 B;  2PM9 B;  1R5M A;  3JB9 L;  3OKW A;  4LG9 A;  2P9U C;  4A08 B;  1K8K C;  4BH6 A;  3SXT D;  2I3S A;  3UVO A;  2AGX A;  3EWE A;  4XYH A;  4JXM A;  3I7N A;  5TEF A;  2IUR A;  3SN6 B;  4AEZ A;  4ERY A;  3OW8 A;  5KDO B;  3DSM A;  4GM9 A;  5C2V B;  5IT9 g;  2O9K A;  5AFU 3;  5H14 A;  2UZX B;  4PNK B;  4A7J A;  4QT8 A;  4K3I D;  4QRJ A;  4CY5 A;  2H9L A;  2EBS A;  5EAP A;  4L1Q D;  2OVQ B;  4KFM B;  3EI3 A;  2AH0 A;  2CE9 A;  4O1Q D;  3EI1 A;  3C75 H;  2AGW A;  3CIK B;  4CZY A;  4H5I A;  3C99 A;  2B5N A;  2IUQ A;  4LG8 A;  5H17 A;  3N0D A;  2G99 A;  2P9I C;  5HE1 B;  3UVK A;  4CI1 A;  3RLM D;  4CY1 A;  3A0F A;  4A0B B;  3E0C A;  2P9L C;  4GM3 A;  5SXM A;  4A09 A;  4J77 A;  2OK6 A;  1JOF A;  5AMS A;  2OK4 A;  2YNP A;  4L3H D;  4JD2 C;  3JZN A;  2H14 A;  2OVR B;  3P4F A;  3ODT A;  3F3F A;  3OL2 B;  3DXM C;  1MDA H;  4HDJ A;  4J73 A;  3SBP A;  4ZOZ A;  1SQJ A;  5K1C C;  3SFZ A;  3UKR C;  2I0S A;  5IGQ A;  1QNI A;  3I8E A;  2P9K C;  4XEI C;  5EM2 A;  3I8C A;  4XYI A;  3SWS D;  4O45 A;  4UI9 R;  3PXS D;  2J56 H;  4QL1 A;  3GFC A;  3W15 A;  2PM6 B;  5EMJ B;  3U4Y A;  3KRW B;  4PC0 A;  5C2W B;  3JRP A;  4JT6 C;  2J57 G;  2IUV A;  3MXX A;  2B4E A;  3IIW A;  3CFS B;  3MKS B;  3JZH A;  3PXT D;  4CZX A;  5EM2 B;  1U2V C;  1P22 A;  2BCJ B;  4OZU A;  2AGY A;  4J86 A;  3IJC A;  4A08 A;  3EI4 A;  2AGZ A;  4X61 B;  1A0R B;  3RSE C;  4A11 B;  3FRX A;  3SLE D;  2J55 H;  2H9P A;  2CN2 A;  4ERZ A;  2YNN A;  3ZWL B;  2H9M A;  3V9F A;  3RMZ D;  5JWZ A;  1XIP A;  1PBY B;  4FA1 D;  4X3E A;  3EI4 B;  2I0T A;  4PXW A;  3C5M A;  3RFH A;  3RN0 D;  4IMM A;  2H47 A;  3FGB A;  4PSX B;  2P9P C;  3ULE C;  2G9A A;  2HES X;  2HXC A;  2W18 A;  4A2L A;  4D6V A;  5IJ7 E;  2UZY B;  5FA5 B;  5K19 A;  3MZL A;  4K3J B;  4O3U B;  3HFQ A;  3SJL D;  5I5M A;  2H3X A;  3KRX B;  2OVP B;  4CZV A;  1FWX A;  4X60 B;  3UVM A;  3EG6 A;  4MK0 B;  5AJA A;  5IC7 A;  4A0B A;  1XHM A;  2H6K A;  3UKU C;  1N6E A;  5CYK B;  5FLX g;  1S4U X;  5A2Q g;  3L4O D;  3I89 A;  4GM8 A;  4CI8 A;  4E5Z B;  1B9Y A;  4CY3 A;  3J80 g;  3SBQ A;  4GZ8 A;  4ES0 A;  3JAM g;  4J0W A;  4OWR A;  3PE7 A;  4GQB B;  1N6F A;  3OL2 A;  3C9C A;  2AGL A;  2HKR A;  5C9Z B;  2AH1 A;  5FXY A;  3AFC A;  4JSV C;  4U7A A;  5HE0 B;  3EI2 A;  1XKS A;  4PBZ A;  3F3P A;  3IIY A;  4A0A B;  4ZOX A;  3I7P A;  3OKY B;  4GGC A;  4IA9 A;  3IKO A;  3MMY A;  4FAN D;  3PVW B;  4E54 B;  2YNO A;  3EMH A;  4GGD A;  3VA6 A;  2CE8 A;  2QC5 A;  3EI2 B;  1PI6 A;  2B5L A;  5EML B;  3RRM C;  1GXR A;  2XYI A;  3JPX A;  3MKQ A;  5GXI A;  3DWL C;  4LGN A;  5B4W A;  4JSN C;  2Z2N A;  5H1M A;  3I7O A;  2OJY A;  4ZOY A;  2IWK A;  4Z8L A;  3MZK A;  1N6D A;  1MG3 A;  4QQE A;  4A11 A;  2AQ5 A;  2H9N A;  4PSW B;  3DXK C;  3VH0 A;  4FA5 D;  2CNX A;  3JRO A;  3PSC B;  2XL3 A;  2XL2 A;  4GGA A;  5CXB A;  2OIZ A;  2Q7Q A;  3NVN A;  3SBR A;  2H6N A;  4TZ4 A;  3NVX A;  4FA4 D;  2P9N C;  1ERJ A;  1GOT B;  5CXC A;  2QXV A;  2CN3 A;  3IJ0 A;  5FKS A;  2H6Q A;  4AOW A;  3I7K A;  4BL0 A;  3OKT A;  5FKT A;  4D0K A;  5THA A;  3F3G A;  4ESG A;  4R7A B;  5CXB B;  2YBA A;  4I79 A;  4O3T B;  4FB1 D;  1SQ9 A;  4J81 A;  5I5J A;  2CO0 A;  5CXC B;  2HYE A;  3AL8 A;  5EMM B;  3RFG A;  5FKR A;  3PVU B;  2HKM A;  3PXW D;  4FA9 D;  4J78 A;  5CYK A;  4G56 B;  4JSX C;  4YVD A;  3V5W B;  1TYQ C;  5EAR A;  3I2N A;  3BG0 A;  4E5Z A;  2H13 A;  5HE2 B;  2I0R A;  4GQ1 A;  2GC7 A;  3SCY A;  3JZG A;  5EMK B;  3AL8 B;  3J81 g;  5GMK n;  4J8G A;  4J82 A;  4CI2 A;  3GRE A;  2IUP A;  4FAV D;  4L3G D;  2IAA A;  2H68 A;  2Z2O A;  3N0E A;  4Y7R A;  3L4M D;  4J84 A;  4A0A A;  1JMX B;  1K32 A;  3OKY A;  1NR0 A;  5TDH B;  5EAM A;  4FWW A;  1U4C A;  1SHY B;  4E54 A;  3EU7 A;  2YMU A;  4ERQ A;  4GQ2 P;  4EWR A;  3SHF A;  1GP2 B;  5IJ8 E;  4X63 B;  4CY2 A;  4JSP C;  1OMW B;  4N14 A;  3BWS A;  3EI3 B;  4ZOV A;  2PBI B;  1L0Q A;  3OTT A;  3EI1 B;  3K26 A; 
#chains in the Genus database with same CATH topology
 1B9X A;  3DM0 A;  2BBK H;  3FM0 A;  3FCS A;  1MG2 A;  4ZN4 A;  4A2M A;  1PGU A;  5HE3 B;  2CO0 C;  3I7L A;  1JV2 A;  4JT5 C;  4PBY A;  1GOF A;  5GSA A;  1VZ3 A;  2EIC A;  1K3I A;  4Y5R D;  1JMZ B;  2HJB A;  2IWF A;  2VZ1 A;  3O4J A;  5FQD A;  3VGZ A;  4J8B A;  2P9S C;  4WK4 A;  4GMB A;  4BCC A;  3BG1 A;  4A09 B;  5HQG A;  2I3T A;  4J79 A;  3RN1 D;  4AMY A;  4AX4 A;  3IJ1 A;  2GNQ A;  3T3P A;  4AN0 A;  2QZP A;  5TF2 A;  3MUO A;  1PEV A;  1GOG A;  4FHL A;  4NSX A;  2Z2P A;  3MUN A;  1VYH C;  3IUJ A;  4H5J A;  4NAA A;  1TBG A;  5FKQ A;  1NEX B;  2MTA H;  4O02 A;  3UVL A;  1H2W A;  3SMR A;  4CC9 A;  4CI3 A;  3UVN A;  1YFQ A;  3CFV A;  2HU7 A;  2HJ4 A;  4J87 A;  2VDL A;  2B5M A;  4UM9 A;  4O9D A;  1OLZ A;  3B7F A;  3UR4 A;  4BUJ C;  5GXH A;  5E6U A;  2GC4 A;  4U1E I;  3SVW D;  3I7H A;  5EAL A;  2PM9 A;  1RI6 A;  1E5T A;  5HYN B;  3NVQ A;  3V4P A;  3V7D B;  3K27 A;  1Q47 A;  2PM7 B;  2BKL A;  4J0X A;  3ORV D;  5TEE A;  1GG2 B;  2TRC B;  3O4H A;  1JJU B;  3PSL A;  4L9O A;  4RE6 A;  5IGO A;  3AL9 A;  3AH8 B;  5I5I A;  2XU7 A;  2YB8 B;  4CY5 A;  2PM9 B;  1R5M A;  3GD1 I;  3JB9 L;  3OKW A;  2VDM A;  4LG9 A;  2P9U C;  4A08 B;  4AN1 A;  1K8K C;  4BH6 A;  4IRZ A;  3SXT D;  2I3S A;  3NIF A;  3UVO A;  2AGX A;  3EWE A;  3QI0 A;  4XYH A;  4JXM A;  3I7N A;  5TEF A;  2IUR A;  3SN6 B;  4AEZ A;  4ERY A;  3O4I A;  3OW8 A;  5KDO B;  3DSM A;  3DDU A;  4GM9 A;  1UOP A;  5C2V B;  2VZ3 A;  5IT9 g;  2O9K A;  5AFU 3;  5H14 A;  2UZX B;  4PNK B;  4A7J A;  5M5U A;  4QT8 A;  4K3I D;  1BPO A;  4QRJ A;  2H9L A;  2EBS A;  5EAP A;  4L1Q D;  2OVQ B;  4KFM B;  3EI3 A;  2AH0 A;  2CE9 A;  3FCU A;  4O1Q D;  5HDB A;  3EI1 A;  3C75 H;  2AGW A;  1UTC A;  3CIK B;  4CZY A;  4L1M A;  4H5I A;  3C99 A;  2B5N A;  2IUQ A;  4LG8 A;  5H17 A;  2XDW A;  2WQ8 A;  3N0D A;  4JHN A;  2G99 A;  2P9I C;  5HE1 B;  3UVK A;  4BCB A;  4CI1 A;  5C86 A;  3RLM D;  1JTD B;  4CY1 A;  3A0F A;  4A0B B;  3E0C A;  2P9L C;  4GM3 A;  3VI4 A;  5SXM A;  3V4V A;  4A09 A;  4J77 A;  4DNW A;  2OK6 A;  4AMZ A;  1JOF A;  5AMS A;  1QFM A;  2OK4 A;  2YNP A;  4L3H D;  4JD2 C;  3JZN A;  2H14 A;  2OVR B;  3MVD K;  3P4F A;  3ODT A;  3F3F A;  3OL2 B;  1M1X A;  3DXM C;  4DNV A;  1MDA H;  4HDJ A;  4J73 A;  4NC4 A;  3SBP A;  4ZOZ A;  1SQJ A;  5K1C C;  3SFZ A;  1QFS A;  3UKR C;  2I0S A;  1A12 A;  3ZE1 A;  5IGQ A;  1QNI A;  3I8E A;  4NEN A;  2P9K C;  2VC2 A;  4XEI C;  2QR5 A;  5EM2 A;  3I8C A;  4XYI A;  3SWS D;  4O45 A;  4UI9 R;  3PXS D;  2J56 H;  4QL1 A;  1L5G A;  1U8C A;  3GFC A;  3W15 A;  2HU5 A;  2PM6 B;  4WK0 A;  5EMJ B;  3U4Y A;  3K71 A;  3KRW B;  4PC0 A;  5C2W B;  4MMX A;  3JRP A;  4JT6 C;  2J57 G;  1VE7 A;  2IUV A;  3MXX A;  2B4E A;  2EID A;  4MMY A;  3IIW A;  3CFS B;  3MKS B;  3JZH A;  3PXT D;  4CZX A;  5EM2 B;  1U2V C;  1P22 A;  2BCJ B;  4OZU A;  2AGY A;  4J86 A;  1TYE A;  3IJC A;  4A08 A;  4Z7Q A;  3EI4 A;  2AGZ A;  1YR2 A;  3IUN A;  2VDK A;  3ZDY A;  4X61 B;  1A0R B;  3RSE C;  4A11 B;  4BP8 A;  3FRX A;  5FFO A;  3SLE D;  2J55 H;  2XE4 A;  2H9P A;  2CN2 A;  3NID A;  4ERZ A;  2YNN A;  3ZWL B;  2H9M A;  3V9F A;  2XZG A;  3RMZ D;  5JWZ A;  1XIP A;  1PBY B;  4FA1 D;  4X3E A;  3EI4 B;  3EQ7 A;  4G55 A;  2I0T A;  4PXW A;  3C5M A;  3IUL A;  3EQ9 A;  3RFH A;  3EQ8 A;  3RN0 D;  4Z7O A;  4IMM A;  2H47 A;  3FGB A;  4PSX B;  2P9P C;  3ULE C;  2G9A A;  1H2X A;  2HES X;  3ZE2 A;  2HXC A;  2W18 A;  4A2L A;  4D6V A;  5IJ7 E;  2UZY B;  5FA5 B;  3IJE A;  5K19 A;  5M5V A;  3MZL A;  4K3J B;  1T2X A;  4Z7N A;  1E8M A;  4O3U B;  3HFQ A;  3SJL D;  5I5M A;  5M5S A;  2H3X A;  3KRX B;  4BP9 A;  2OVP B;  4CZV A;  1FWX A;  4X60 B;  3UVM A;  3EG6 A;  4MK0 B;  5AJA A;  5IC7 A;  4A0B A;  1XHM A;  2H6K A;  3UKU C;  1N6E A;  3K72 A;  5CYK B;  1VE6 A;  5FLX g;  1S4U X;  5A2Q g;  3L4O D;  3T3M A;  3I89 A;  4DNU A;  4GM8 A;  4CI8 A;  3K6S A;  4E5Z B;  1B9Y A;  4CY3 A;  3IUM A;  1I2M B;  5FFG A;  3J80 g;  3SBQ A;  4GZ8 A;  4ES0 A;  3JAM g;  4J0W A;  4OWR A;  3VI3 A;  2VDN A;  1O6G A;  3PE7 A;  4GQB B;  1N6F A;  3OL2 A;  4O2W A;  3C9C A;  2AGL A;  4NBM A;  2HKR A;  2VDR A;  5C9Z B;  2AH1 A;  1VZ2 A;  5FXY A;  3AFC A;  4JSV C;  4U7A A;  5HE0 B;  3EI2 A;  1XKS A;  4PBZ A;  3F3P A;  3IIY A;  4A0A B;  4UM8 A;  2VDO A;  4ZOX A;  3I7P A;  3OKY B;  4GGC A;  1UOQ A;  4IA9 A;  5E6R A;  3IKO A;  1UOO A;  3MMY A;  4FAN D;  3PVW B;  4E54 B;  2YNO A;  3EMH A;  4GGD A;  3VA6 A;  2CE8 A;  2QC5 A;  3EI2 B;  1PI6 A;  2B5L A;  5EML B;  5M61 A;  3RRM C;  1GXR A;  2XYI A;  3JPX A;  3IUQ A;  3MKQ A;  5GXI A;  3DWL C;  4LGN A;  5B4W A;  4JSN C;  2Z2N A;  5H1M A;  3I7O A;  2OJY A;  4ZOY A;  2VDP A;  3OF7 A;  2IWK A;  4Z8L A;  4JHP C;  3MZK A;  1H2Y A;  1N6D A;  2VDQ A;  1MG3 A;  4QQE A;  4G1M A;  4A11 A;  2AQ5 A;  2H9N A;  4PSW B;  3DXK C;  3VH0 A;  4FA5 D;  3ZE0 A;  2CNX A;  3JRO A;  3PSC B;  3GC3 B;  2XL3 A;  2XL2 A;  4GGA A;  5CXB A;  2OIZ A;  2Q7Q A;  3IVM A;  3NVN A;  3SBR A;  2H6N A;  1O6F A;  3NVX A;  4TZ4 A;  4FA4 D;  1C9L A;  2P9N C;  1ERJ A;  1GOT B;  5CXC A;  2QXV A;  2CN3 A;  3IJ0 A;  5FKS A;  2H6Q A;  4AOW A;  3I7K A;  4BL0 A;  3OKT A;  5FKT A;  4D0K A;  5THA A;  3F3G A;  4ESG A;  4R7A B;  5CXB B;  2YBA A;  4I79 A;  4O3T B;  4FB1 D;  1SQ9 A;  4J81 A;  5I5J A;  2CO0 A;  5CXC B;  2HYE A;  3AL8 A;  5EMM B;  1C9I A;  3RFG A;  5FKR A;  4G1E A;  4RE5 A;  3PVU B;  2HKM A;  3PXW D;  4FA9 D;  4J78 A;  5CYK A;  4G56 B;  4JSX C;  1E8N A;  4YVD A;  4QAM A;  3V5W B;  1TYQ C;  3ZDX A;  5EAR A;  5C92 A;  1GOH A;  3KCI A;  3I2N A;  3BG0 A;  4E5Z A;  2H13 A;  5HE2 B;  2I0R A;  4GQ1 A;  2GC7 A;  1H2Z A;  3IUR A;  2HU8 A;  3SCY A;  3JZG A;  5EMK B;  3AL8 B;  3J81 g;  5GMK n;  4D9S A;  4J8G A;  4J82 A;  4CI2 A;  3O4G A;  3GRE A;  5M5R A;  2IUP A;  4WK2 A;  4FAV D;  3NIG A;  2JKX A;  4L3G D;  4MMZ A;  2IAA A;  2EIE A;  2H68 A;  3N0E A;  2Z2O A;  4Y7R A;  3L4M D;  4J84 A;  4A0A A;  1JMX B;  1K32 A;  3OKY A;  1NR0 A;  5TDH B;  5EAM A;  4FWW A;  1U4C A;  1SHY B;  4E54 A;  3EU7 A;  2YMU A;  4ERQ A;  4GQ2 P;  5M5T A;  4EWR A;  3SHF A;  1GP2 B;  5IJ8 E;  4X63 B;  4WJK A;  4CY2 A;  4JSP C;  1OMW B;  4N14 A;  3QHY B;  5E6S A;  2EIB A;  4BCD A;  3BWS A;  3EI3 B;  4ZOV A;  3ZDZ A;  2PBI B;  1L0Q A;  3OTT A;  3EI1 B;  3K26 A; 
#chains in the Genus database with same CATH homology
 1B9X A;  3DM0 A;  2BBK H;  3FM0 A;  1MG2 A;  4ZN4 A;  4A2M A;  1PGU A;  5HE3 B;  2CO0 C;  3I7L A;  4JT5 C;  4PBY A;  5GSA A;  4Y5R D;  1JMZ B;  2HJB A;  2IWF A;  5FQD A;  3VGZ A;  4J8B A;  2P9S C;  4GMB A;  3BG1 A;  4A09 B;  5HQG A;  2I3T A;  4J79 A;  3RN1 D;  3IJ1 A;  2GNQ A;  5TF2 A;  1PEV A;  4FHL A;  4NSX A;  2Z2P A;  1VYH C;  4H5J A;  1TBG A;  5FKQ A;  1NEX B;  2MTA H;  3UVL A;  3SMR A;  4CC9 A;  4CI3 A;  3UVN A;  1YFQ A;  3CFV A;  2HJ4 A;  4J87 A;  2B5M A;  4O9D A;  1OLZ A;  3B7F A;  3UR4 A;  4BUJ C;  5GXH A;  2GC4 A;  4U1E I;  3SVW D;  3I7H A;  5EAL A;  2PM9 A;  1RI6 A;  5HYN B;  3NVQ A;  3V7D B;  3K27 A;  1Q47 A;  2PM7 B;  4J0X A;  3ORV D;  5TEE A;  1GG2 B;  2TRC B;  3PSL A;  1JJU B;  4L9O A;  5IGO A;  3AL9 A;  3AH8 B;  5I5I A;  2XU7 A;  2YB8 B;  2PM9 B;  1R5M A;  3JB9 L;  3OKW A;  4LG9 A;  2P9U C;  4A08 B;  1K8K C;  4BH6 A;  3SXT D;  2I3S A;  3UVO A;  2AGX A;  3EWE A;  4XYH A;  4JXM A;  3I7N A;  5TEF A;  2IUR A;  3SN6 B;  4AEZ A;  4ERY A;  3OW8 A;  5KDO B;  3DSM A;  4GM9 A;  5C2V B;  5IT9 g;  2O9K A;  5AFU 3;  5H14 A;  2UZX B;  4PNK B;  4A7J A;  4QT8 A;  4K3I D;  4QRJ A;  4CY5 A;  2H9L A;  2EBS A;  5EAP A;  4L1Q D;  2OVQ B;  4KFM B;  3EI3 A;  2AH0 A;  2CE9 A;  4O1Q D;  3EI1 A;  3C75 H;  2AGW A;  3CIK B;  4CZY A;  4H5I A;  3C99 A;  2B5N A;  2IUQ A;  4LG8 A;  5H17 A;  3N0D A;  2G99 A;  2P9I C;  5HE1 B;  3UVK A;  4CI1 A;  3RLM D;  4CY1 A;  3A0F A;  4A0B B;  3E0C A;  2P9L C;  4GM3 A;  5SXM A;  4A09 A;  4J77 A;  2OK6 A;  1JOF A;  5AMS A;  2OK4 A;  2YNP A;  4L3H D;  4JD2 C;  3JZN A;  2H14 A;  2OVR B;  3P4F A;  3ODT A;  3F3F A;  3OL2 B;  3DXM C;  1MDA H;  4HDJ A;  4J73 A;  3SBP A;  4ZOZ A;  1SQJ A;  5K1C C;  3SFZ A;  3UKR C;  2I0S A;  5IGQ A;  1QNI A;  3I8E A;  2P9K C;  4XEI C;  5EM2 A;  3I8C A;  4XYI A;  3SWS D;  4O45 A;  4UI9 R;  3PXS D;  2J56 H;  4QL1 A;  3GFC A;  3W15 A;  2PM6 B;  5EMJ B;  3U4Y A;  3KRW B;  4PC0 A;  5C2W B;  3JRP A;  4JT6 C;  2J57 G;  2IUV A;  3MXX A;  2B4E A;  3IIW A;  3CFS B;  3MKS B;  3JZH A;  3PXT D;  4CZX A;  5EM2 B;  1U2V C;  1P22 A;  2BCJ B;  4OZU A;  2AGY A;  4J86 A;  3IJC A;  4A08 A;  3EI4 A;  2AGZ A;  4X61 B;  1A0R B;  3RSE C;  4A11 B;  3FRX A;  3SLE D;  2J55 H;  2H9P A;  2CN2 A;  4ERZ A;  2YNN A;  3ZWL B;  2H9M A;  3V9F A;  3RMZ D;  5JWZ A;  1XIP A;  1PBY B;  4FA1 D;  4X3E A;  3EI4 B;  2I0T A;  4PXW A;  3C5M A;  3RFH A;  3RN0 D;  4IMM A;  2H47 A;  3FGB A;  4PSX B;  2P9P C;  3ULE C;  2G9A A;  2HES X;  2HXC A;  2W18 A;  4A2L A;  4D6V A;  5IJ7 E;  2UZY B;  5FA5 B;  5K19 A;  3MZL A;  4K3J B;  4O3U B;  3HFQ A;  3SJL D;  5I5M A;  2H3X A;  3KRX B;  2OVP B;  4CZV A;  1FWX A;  4X60 B;  3UVM A;  3EG6 A;  4MK0 B;  5AJA A;  5IC7 A;  4A0B A;  1XHM A;  2H6K A;  3UKU C;  1N6E A;  5CYK B;  5FLX g;  1S4U X;  5A2Q g;  3L4O D;  3I89 A;  4GM8 A;  4CI8 A;  4E5Z B;  1B9Y A;  4CY3 A;  3J80 g;  3SBQ A;  4GZ8 A;  4ES0 A;  3JAM g;  4J0W A;  4OWR A;  3PE7 A;  4GQB B;  1N6F A;  3OL2 A;  3C9C A;  2AGL A;  2HKR A;  5C9Z B;  2AH1 A;  5FXY A;  3AFC A;  4JSV C;  4U7A A;  5HE0 B;  3EI2 A;  1XKS A;  4PBZ A;  3F3P A;  3IIY A;  4A0A B;  4ZOX A;  3I7P A;  3OKY B;  4GGC A;  4IA9 A;  3IKO A;  3MMY A;  4FAN D;  3PVW B;  4E54 B;  2YNO A;  3EMH A;  4GGD A;  3VA6 A;  2CE8 A;  2QC5 A;  3EI2 B;  1PI6 A;  2B5L A;  5EML B;  3RRM C;  1GXR A;  2XYI A;  3JPX A;  3MKQ A;  5GXI A;  3DWL C;  4LGN A;  5B4W A;  4JSN C;  2Z2N A;  5H1M A;  3I7O A;  2OJY A;  4ZOY A;  2IWK A;  4Z8L A;  3MZK A;  1N6D A;  1MG3 A;  4QQE A;  4A11 A;  2AQ5 A;  2H9N A;  4PSW B;  3DXK C;  3VH0 A;  4FA5 D;  2CNX A;  3JRO A;  3PSC B;  2XL3 A;  2XL2 A;  4GGA A;  5CXB A;  2OIZ A;  2Q7Q A;  3NVN A;  3SBR A;  2H6N A;  4TZ4 A;  3NVX A;  4FA4 D;  2P9N C;  1ERJ A;  1GOT B;  5CXC A;  2QXV A;  2CN3 A;  3IJ0 A;  5FKS A;  2H6Q A;  4AOW A;  3I7K A;  4BL0 A;  3OKT A;  5FKT A;  4D0K A;  5THA A;  3F3G A;  4ESG A;  4R7A B;  5CXB B;  2YBA A;  4I79 A;  4O3T B;  4FB1 D;  1SQ9 A;  4J81 A;  5I5J A;  2CO0 A;  5CXC B;  2HYE A;  3AL8 A;  5EMM B;  3RFG A;  5FKR A;  3PVU B;  2HKM A;  3PXW D;  4FA9 D;  4J78 A;  5CYK A;  4G56 B;  4JSX C;  4YVD A;  3V5W B;  1TYQ C;  5EAR A;  3I2N A;  3BG0 A;  4E5Z A;  2H13 A;  5HE2 B;  2I0R A;  4GQ1 A;  2GC7 A;  3SCY A;  3JZG A;  5EMK B;  3AL8 B;  3J81 g;  5GMK n;  4J8G A;  4J82 A;  4CI2 A;  3GRE A;  2IUP A;  4FAV D;  4L3G D;  2IAA A;  2H68 A;  2Z2O A;  3N0E A;  4Y7R A;  3L4M D;  4J84 A;  4A0A A;  1JMX B;  1K32 A;  3OKY A;  1NR0 A;  5TDH B;  5EAM A;  4FWW A;  1U4C A;  1SHY B;  4E54 A;  3EU7 A;  2YMU A;  4ERQ A;  4GQ2 P;  4EWR A;  3SHF A;  1GP2 B;  5IJ8 E;  4X63 B;  4CY2 A;  4JSP C;  1OMW B;  4N14 A;  3BWS A;  3EI3 B;  4ZOV A;  2PBI B;  1L0Q A;  3OTT A;  3EI1 B;  3K26 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...