2H14A

Crystal of wdr5 (apo-form)
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
303
structure length
303
Chain Sequence
KPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD-repeat protein 5
publication title Molecular recognition of histone H3 by the WD40 protein WDR5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 100
structure length 303
sequence length 303
ec nomenclature
pdb deposition date 2006-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2h14A00
5CXCA 3DXKC 2QC5A 1R5MA 2BBKH 4R7AB 4ZOXA 4FAVD 3SBPA 4A09B 2AGXA 1S4UX 5IT9g 4A0BB 5CXCB 3E0CA 3OL2A 5HE1B 3FRXA 2HYEA 2CN2A 3ORVD 3OL2B 5H17A 4YVDA 5CXBA 4FA4D 4BH6A 1L0QA 4K3JB 3AH8B 1GOTB 5CXBB 4JSPC 4LGNA 4GZ8A 3RSEC 4J87A 1K32A 1SHYB 5EAPA 3I89A 3J80g 1OLZA 3PE7A 2B5LA 4NSXA 3PXWD 5EMKB 4J77A 1JOFA 1TBGA 4GMBA 3F3PA 1MG2A 3SXTD 1TYQC 2H13A 5H14A 4GM9A 4J81A 2XU7A 1U4CA 3BG0A 5CYKA 3V7DB 1PBYB 4X61B 5AMSA 4H5JA 4GGDA 4FA1D 5CYKB 2P9IC 1B9YA 4PBYA 5GXIA 3SJLD 4A0AA 2GNQA 3I7LA 4Y7RA 2QXVA 4AEZA 2OK6A 4A0AB 4L3HD 2Z2PA 2YB8B 4BL0A 3RFHA 4ZN4A 3C75H 2HJ4A 5TEFA 4D0KA 4CC9A 3SBRA 4A2MA 5C2WB 4KFMB 2H3XA 1RI6A 5FKQA 3MXXA 3AFCA 4ERZA 4X63B 3C9CA 5FA5B 5FXYA 3W15A 3ULEC 1PEVA 3UKRC 5EARA 5FLXg 5EAMA 4A7JA 4J82A 3EWEA 1JJUB 4QL1A 5IJ7E 4GQ2P 5K1CC 5TEEA 2OVQB 4PBZA 4ERQA 4FA5D 2G9AA 5C2VB 2AGYA 4O1QD 2OK4A 4K3ID 1NR0A 3EI2A 5IC7A 4J8GA 4Y5RD 1MG3A 5HE3B 2IURA 4QQEA 3NVXA 4AOWA 3L4OD 5I5IA 2I0SA 3UVKA 3RN1D 4GQBB 4ERYA 2PM9A 2AGLA 3DSMA 4JT6C 4MK0B 3I2NA 4D6VA 3SHFA 2PM9B 3K26A 3V5WB 2G99A 2HESX 1XKSA 1XIPA 2IWKA 2B4EA 3FGBA 4FA9D 2H6NA 5C9ZB 3IJCA 2P9SC 3SBQA 1Q47A 3NVQA 3JZHA 2P9PC 4CI2A 3JB9L 3I8CA 3SFZA 5AJAA 2OVPB 2Z2NA 1U2VC 4CZXA 1GG2B 3RMZD 1GP2B 4FB1D 2J55H 3IKOA 4Z8LA 4J78A 4OZUA 2H14A 3FM0A 2I0TA 2H6KA 3EG6A 3SWSD 1NEXB 2AGZA 2XYIA 3IJ0A 4X3EA 2XL3A 3JPXA 4GGCA 4U7AA 4JD2C 5IGQA 4J73A 2CE9A 5SXMA 3IIYA 2IWFA 4L3GD 3PVWB 4J8BA 5HYNB 2CO0C 2W18A 4XYHA 4O3TB 3DWLC 3SLED 3VGZA 4TZ4A 5AFU3 4J84A 2GC4A 2HKMA 1SQJA 3EI4A 2H6QA 5TF2A 3AL9A 3MKQA 3SVWD 3KRWB 3EI4B 3P4FA 2PM7B 5A2Qg 3UKUC 2CN3A 2EBSA 3IIWA 2BCJB 1SQ9A 2AH1A 4O45A 4EWRA 5IJ8E 3F3GA 5EMJB 3EI3B 4ZOVA 2B5NA 1OMWB 5KDOB 3OW8A 3JZNA 1K8KC 3A0FA 4PSXB 4ES0A 2O9KA 4PC0A 3EMHA 3CIKB 2TRCB 5FQDA 5THAA 2HKRA 3SN6B 4CI3A 3I7KA 3RLMD 4J86A 2I0RA 4L1QD 4XEIC 3MZKA 4PSWB 4I79A 3MMYA 3K27A 3HFQA 3EU7A 3B7FA 2H9PA 4ESGA 3I7OA 4CY2A 4G56B 1PGUA 3SMRA 2CO0A 4JSNC 4LG9A 3V9FA 5HQGA 2YBAA 2HJBA 3MKSB 4H5IA 3PXTD 2CNXA 2XL2A 3I7HA 3JZGA 5TDHB 4A08A 2J57G 5FKSA 2I3TA 1P22A 4IA9A 3CFSB 1YFQA 4CY3A 2IAAA 4A08B 2PM6B 4A2LA 4UI9R 4O3UB 5EMLB 4U1EI 3SCYA 3U4YA 3I7NA 2H47A 1GXRA 3PSCB 3UR4A 3JAMg 2Q7QA 3GREA 2AGWA 3C99A 2UZYB 3UVMA 4A11A 2YNNA 4CZYA 3PSLA 1VYHC 3RN0D 2MTAH 4QT8A 4HDJA 4A11B 4GGAA 5EMMB 1N6EA 4GM8A 4X60B 4XYIA 3OKWA 4L9OA 3UVLA 2OVRB 4CY1A 5I5JA 3N0DA 1QNIA 3UVOA 5EM2A 4ZOZA 1N6FA 5H1MA 3F3FA 4CI8A 2HXCA 3KRXB 5EM2B 3VA6A 3DM0A 3GFCA 3C5MA 4PNKB 4CI1A 1ERJA 4IMMA 1XHMA 2IUPA 3IJ1A 3OKTA 3ZWLB 4BUJC 3I8EA 3PXSD 5HE0B 5I5MA 2I3SA 3NVNA 3BG1A 2OIZA 3AL8A 2H9NA 3OKYA 3EI1A 3JRPA 4JSXC 4PXWA 5GMKn 2YNPA 1B9XA 1JMXB 3AL8B 2P9NC 3OKYB 3EI1B 3RRMC 1A0RB 4GQ1A 5EALA 4JSVC 3MZLA 5GXHA 3EI3A 4FWWA 3ODTA 4J0WA 3N0EA 2J56H 3OTTA 3PVUB 4E5ZA 3RFGA 4LG8A 2CE8A 1PI6A 2IUVA 4CZVA 4N14A 4JXMA 2B5MA 4E5ZB 4O9DA 4GM3A 2OJYA 4QRJA 2IUQA 5HE2B 5FKRA 2YMUA 1FWXA 3L4MD 3JROA 2AQ5A 2PBIB 1JMZB 2H9MA 2P9KC 2UZXB 4ZOYA 4OWRA 5JWZA 4FAND 1N6DA 4J79A 4E54A 5K19A 3UVNA 1MDAH 4E54B 2Z2OA 2H68A 4CY5A 4JT5C 5FKTA 2GC7A 5IGOA 2AH0A 4FHLA 5GSAA 2YNOA 3I7PA 3DXMC 3CFVA 3EI2B 2H9LA 3J81g 4J0XA 3BWSA 5B4WA 2P9LC 3VH0A 4A09A 2P9UC 4A0BA
chains in the Genus database with same CATH superfamily
5CXCA 4DNUA 3DXKC 2QC5A 1R5MA 2BBKH 4R7AB 4ZOXA 4FAVD 3SBPA 4A09B 2AGXA 1S4UX 5IT9g 4A0BB 5CXCB 3E0CA 3NIGA 1O6GA 3OL2A 2VZ3A 5M61A 5HE1B 3T3MA 3FRXA 2HYEA 2CN2A 3ORVD 3OL2B 5E6UA 1A12A 5H17A 4YVDA 5CXBA 4FA4D 4AMYA 4BH6A 5M5TA 1L0QA 4K3JB 4NENA 3AH8B 1GOTB 5CXBB 4JSPC 4LGNA 4G1MA 1UTCA 4GZ8A 3RSEC 4J87A 1K32A 1SHYB 5EAPA 3I89A 3J80g 1OLZA 3PE7A 2B5LA 4ESGA 4NSXA 3PXWD 5EMKB 4J77A 1JOFA 1GOHA 1TBGA 2XE4A 4GMBA 4DNVA 3F3PA 1MG2A 3SXTD 1TYQC 2H13A 3ZE2A 5H14A 3ZDZA 4G55A 3O4IA 4GM9A 4J81A 2XU7A 1U4CA 3BG0A 5CYKA 3V7DB 1PBYB 4X61B 5AMSA 4H5JA 2VDRA 2HU5A 4GGDA 4FA1D 5CYKB 2VDPA 2P9IC 4JHNA 1B9YA 4MMXA 4PBYA 5GXIA 3SJLD 1VE6A 4A0AA 2GNQA 3I7LA 4MMZA 4Y7RA 1H2YA 2QXVA 4AEZA 2JKXA 2OK6A 4A0AB 4L3HD 2Z2PA 2YB8B 4BL0A 3RFHA 4ZN4A 3C75H 2HJ4A 5TEFA 4D0KA 4CC9A 2VDMA 3SBRA 4A2MA 4UM9A 5C2WB 4KFMB 2H3XA 1RI6A 5FKQA 3MXXA 3AFCA 4WK4A 4ERZA 5FFGA 4X63B 3C9CA 5FA5B 5FXYA 3W15A 2QR5A 3ULEC 1PEVA 1E8NA 3IURA 3UKRC 5EARA 3OF7A 1QFSA 3IUQA 5FLXg 5EAMA 4A7JA 4J82A 3EWEA 1JJUB 4QL1A 3DDUA 4BCCA 5IJ7E 4GQ2P 4NAAA 5K1CC 5TEEA 2OVQB 4PBZA 1E5TA 2VDKA 4G1EA 4BP9A 4ERQA 4FA5D 2G9AA 5C2VB 2AGYA 4O1QD 2OK4A 3ZDXA 4K3ID 1NR0A 3NIFA 3EI2A 5IC7A 4J8GA 4Y5RD 1MG3A 5HE3B 2IURA 4QQEA 3ZE1A 3NVXA 4AOWA 3L4OD 5I5IA 2I0SA 3UVKA 3RN1D 2VZ1A 4WK2A 4GQBB 1VE7A 4ERYA 5HDBA 2PM9A 2AGLA 3DSMA 4JT6C 4MK0B 4Z7OA 3I2NA 4D6VA 3SHFA 2PM9B 3K26A 3V5WB 2G99A 2HESX 1XKSA 1XIPA 4O02A 2IWKA 2B4EA 3FGBA 4FA9D 4NC4A 2H6NA 5C9ZB 3IJCA 2P9SC 3SBQA 1Q47A 3NVQA 3JZHA 1M1XA 2P9PC 4CI2A 4JHPC 3JB9L 3I8CA 3SFZA 5AJAA 2OVPB 1UOOA 4AX4A 1VZ2A 2Z2NA 1U2VC 4CZXA 1GG2B 4Z7NA 3RMZD 1GP2B 3VI4A 4FB1D 5FFOA 2BKLA 3EQ7A 2J55H 1H2ZA 3IKOA 1UOQA 4Z8LA 4J78A 4L1MA 5M5RA 4OZUA 2H14A 3FM0A 2I0TA 3MUOA 2H6KA 1UOPA 3EG6A 3SWSD 1NEXB 2AGZA 2XYIA 3IJ0A 4X3EA 2XL3A 4BCBA 1U8CA 3JPXA 4GGCA 4U7AA 4JD2C 5IGQA 4J73A 2CE9A 5SXMA 3IIYA 2IWFA 4L3GD 3PVWB 4J8BA 5HYNB 2HU7A 2CO0C 5C92A 2W18A 4MMYA 4XYHA 4O3TB 3DWLC 3SLED 3VGZA 1O6FA 4TZ4A 5AFU3 3IUNA 4J84A 2GC4A 2HKMA 1SQJA 3EI4A 2H6QA 5TF2A 2VDQA 3AL9A 3MKQA 3SVWD 3KRWB 3EI4B 3P4FA 3QHYB 2PM7B 3EQ9A 1GOGA 5A2Qg 3UKUC 4D9SA 2CN3A 4WJKA 2EBSA 2VDLA 3IIWA 3QI0A 2BCJB 1I2MB 1SQ9A 4NBMA 2AH1A 2VC2A 2VDNA 4O45A 4EWRA 5IJ8E 3F3GA 5EMJB 3EI3B 4ZOVA 2B5NA 1OMWB 3K71A 5KDOB 4Z7QA 3OW8A 4AN0A 3JZNA 1K8KC 3A0FA 4PSXB 4ES0A 2O9KA 4PC0A 3KCIA 3EMHA 3CIKB 2TRCB 5FQDA 5THAA 2HKRA 3SN6B 4CI3A 3I7KA 3RLMD 2EIEA 4J86A 2I0RA 4L1QD 3IULA 4O2WA 4XEIC 3MZKA 4PSWB 4I79A 3MMYA 3K27A 3HFQA 3EU7A 3B7FA 3K6SA 2H9PA 3IUJA 2HU8A 3I7OA 4G56B 1PGUA 4CY2A 3SMRA 2CO0A 3GD1I 4JSNC 4LG9A 3V9FA 5HQGA 2YBAA 2HJBA 3MKSB 3FCSA 4H5IA 1C9IA 3PXTD 3IJEA 2CNXA 2EIDA 2XL2A 3I7HA 3JZGA 5TDHB 4A08A 2J57G 5FKSA 2I3TA 1P22A 4IA9A 3CFSB 1YFQA 4CY3A 2IAAA 4WK0A 4A08B 2PM6B 4A2LA 1T2XA 4UI9R 4O3UB 5M5VA 1VZ3A 3V4PA 1E8MA 5EMLB 1TYEA 4AMZA 3IUMA 4U1EI 3SCYA 3U4YA 3MVDK 3I7NA 2H47A 1GXRA 3PSCB 3UR4A 3ZDYA 3JAMg 2EICA 2XZGA 1GOFA 2Q7QA 3GREA 2AGWA 3C99A 2UZYB 1YR2A 3UVMA 4A11A 2YNNA 4CZYA 3PSLA 1VYHC 3V4VA 3RN0D 2MTAH 5E6RA 4QT8A 4HDJA 4A11B 4GGAA 5EMMB 1N6EA 4GM8A 4X60B 4XYIA 3OKWA 3K72A 4L9OA 3UVLA 2OVRB 4CY1A 5I5JA 3T3PA 3N0DA 1JTDB 1QNIA 3UVOA 5EM2A 4ZOZA 3O4JA 1N6FA 5H1MA 3F3FA 4CI8A 1JV2A 2HXCA 3KRXB 4AN1A 5EM2B 3VA6A 3DM0A 3GFCA 3C5MA 4PNKB 4CI1A 1ERJA 4IMMA 1XHMA 2IUPA 3IJ1A 3OKTA 3ZWLB 2EIBA 4BUJC 3I8EA 3PXSD 5M5SA 5HE0B 5I5MA 2I3SA 3NVNA 2WQ8A 3BG1A 3IVMA 2OIZA 3AL8A 2H9NA 3OKYA 4BP8A 3EI1A 4UM8A 3JRPA 4JSXC 1H2XA 4PXWA 5GMKn 2YNPA 1B9XA 3AL8B 1JMXB 3EQ8A 2P9NC 3OKYB 5E6SA 3EI1B 3RRMC 1A0RB 4GQ1A 5EALA 4JSVC 3MZLA 5GXHA 3EI3A 4FWWA 4RE6A 3ODTA 4J0WA 3N0EA 2J56H 3OTTA 4RE5A 5M5UA 3PVUB 4E5ZA 3RFGA 4LG8A 2CE8A 1PI6A 2IUVA 4CZVA 4N14A 4JXMA 3GC3B 1BPOA 2B5MA 4E5ZB 4O9DA 4GM3A 2OJYA 4QRJA 2IUQA 5HE2B 1L5GA 5FKRA 3VI3A 2YMUA 1FWXA 2XDWA 3L4MD 3JROA 2AQ5A 3ZE0A 2PBIB 1JMZB 1C9LA 2H9MA 2P9KC 2UZXB 3MUNA 4ZOYA 4OWRA 5JWZA 4FAND 1N6DA 4J79A 1QFMA 4E54A 3O4HA 1K3IA 5K19A 3UVNA 2VDOA 2QZPA 1MDAH 4E54B 4DNWA 2Z2OA 2H68A 4CY5A 4QAMA 4JT5C 5FKTA 2GC7A 5IGOA 2AH0A 3NIDA 4BCDA 4FHLA 5GSAA 2YNOA 3I7PA 3FCUA 3DXMC 3CFVA 3EI2B 5C86A 2H9LA 4IRZA 3J81g 4J0XA 3O4GA 3BWSA 5B4WA 1H2WA 2P9LC 3VH0A 4A09A 2P9UC 4A0BA
chains in the Genus database with same CATH topology
5CXCA 3DXKC 2QC5A 1R5MA 2BBKH 4R7AB 4ZOXA 4FAVD 3SBPA 4A09B 2AGXA 1S4UX 5IT9g 4A0BB 5CXCB 3E0CA 3OL2A 5HE1B 3FRXA 2HYEA 2CN2A 3ORVD 3OL2B 5H17A 4YVDA 5CXBA 4FA4D 4BH6A 1L0QA 4K3JB 3AH8B 1GOTB 5CXBB 4JSPC 4LGNA 4GZ8A 3RSEC 4J87A 1K32A 1SHYB 5EAPA 3I89A 3J80g 1OLZA 3PE7A 2B5LA 4NSXA 3PXWD 5EMKB 4J77A 1JOFA 1TBGA 4GMBA 3F3PA 1MG2A 3SXTD 1TYQC 2H13A 5H14A 4GM9A 4J81A 2XU7A 1U4CA 3BG0A 5CYKA 3V7DB 1PBYB 4X61B 5AMSA 4H5JA 4GGDA 4FA1D 5CYKB 2P9IC 1B9YA 4PBYA 5GXIA 3SJLD 4A0AA 2GNQA 3I7LA 4Y7RA 2QXVA 4AEZA 2OK6A 4A0AB 4L3HD 2Z2PA 2YB8B 4BL0A 3RFHA 4ZN4A 3C75H 2HJ4A 5TEFA 4D0KA 4CC9A 3SBRA 4A2MA 5C2WB 4KFMB 2H3XA 1RI6A 5FKQA 3MXXA 3AFCA 4ERZA 4X63B 3C9CA 5FA5B 5FXYA 3W15A 3ULEC 1PEVA 3UKRC 5EARA 5FLXg 5EAMA 4A7JA 4J82A 3EWEA 1JJUB 4QL1A 5IJ7E 4GQ2P 5K1CC 5TEEA 2OVQB 4PBZA 4ERQA 4FA5D 2G9AA 5C2VB 2AGYA 4O1QD 2OK4A 4K3ID 1NR0A 3EI2A 5IC7A 4J8GA 4Y5RD 1MG3A 5HE3B 2IURA 4QQEA 3NVXA 4AOWA 3L4OD 5I5IA 2I0SA 3UVKA 3RN1D 4GQBB 4ERYA 2PM9A 2AGLA 3DSMA 4JT6C 4MK0B 3I2NA 4D6VA 3SHFA 2PM9B 3K26A 3V5WB 2G99A 2HESX 1XKSA 1XIPA 2IWKA 2B4EA 3FGBA 4FA9D 2H6NA 5C9ZB 3IJCA 2P9SC 3SBQA 1Q47A 3NVQA 3JZHA 2P9PC 4CI2A 3JB9L 3I8CA 3SFZA 5AJAA 2OVPB 2Z2NA 1U2VC 4CZXA 1GG2B 3RMZD 1GP2B 4FB1D 2J55H 3IKOA 4Z8LA 4J78A 4OZUA 2H14A 3FM0A 2I0TA 2H6KA 3EG6A 3SWSD 1NEXB 2AGZA 2XYIA 3IJ0A 4X3EA 2XL3A 3JPXA 4GGCA 4U7AA 4JD2C 5IGQA 4J73A 2CE9A 5SXMA 3IIYA 2IWFA 4L3GD 3PVWB 4J8BA 5HYNB 2CO0C 2W18A 4XYHA 4O3TB 3DWLC 3SLED 3VGZA 4TZ4A 5AFU3 4J84A 2GC4A 2HKMA 1SQJA 3EI4A 2H6QA 5TF2A 3AL9A 3MKQA 3SVWD 3KRWB 3EI4B 3P4FA 2PM7B 5A2Qg 3UKUC 2CN3A 2EBSA 3IIWA 2BCJB 1SQ9A 2AH1A 4O45A 4EWRA 5IJ8E 3F3GA 5EMJB 3EI3B 4ZOVA 2B5NA 1OMWB 5KDOB 3OW8A 3JZNA 1K8KC 3A0FA 4PSXB 4ES0A 2O9KA 4PC0A 3EMHA 3CIKB 2TRCB 5FQDA 5THAA 2HKRA 3SN6B 4CI3A 3I7KA 3RLMD 4J86A 2I0RA 4L1QD 4XEIC 3MZKA 4PSWB 4I79A 3MMYA 3K27A 3HFQA 3EU7A 3B7FA 2H9PA 4ESGA 3I7OA 4CY2A 4G56B 1PGUA 3SMRA 2CO0A 4JSNC 4LG9A 3V9FA 5HQGA 2YBAA 2HJBA 3MKSB 4H5IA 3PXTD 2CNXA 2XL2A 3I7HA 3JZGA 5TDHB 4A08A 2J57G 5FKSA 2I3TA 1P22A 4IA9A 3CFSB 1YFQA 4CY3A 2IAAA 4A08B 2PM6B 4A2LA 4UI9R 4O3UB 5EMLB 4U1EI 3SCYA 3U4YA 3I7NA 2H47A 1GXRA 3PSCB 3UR4A 3JAMg 2Q7QA 3GREA 2AGWA 3C99A 2UZYB 3UVMA 4A11A 2YNNA 4CZYA 3PSLA 1VYHC 3RN0D 2MTAH 4QT8A 4HDJA 4A11B 4GGAA 5EMMB 1N6EA 4GM8A 4X60B 4XYIA 3OKWA 4L9OA 3UVLA 2OVRB 4CY1A 5I5JA 3N0DA 1QNIA 3UVOA 5EM2A 4ZOZA 1N6FA 5H1MA 3F3FA 4CI8A 2HXCA 3KRXB 5EM2B 3VA6A 3DM0A 3GFCA 3C5MA 4PNKB 4CI1A 1ERJA 4IMMA 1XHMA 2IUPA 3IJ1A 3OKTA 3ZWLB 4BUJC 3I8EA 3PXSD 5HE0B 5I5MA 2I3SA 3NVNA 3BG1A 2OIZA 3AL8A 2H9NA 3OKYA 3EI1A 3JRPA 4JSXC 4PXWA 5GMKn 2YNPA 1B9XA 1JMXB 3AL8B 2P9NC 3OKYB 3EI1B 3RRMC 1A0RB 4GQ1A 5EALA 4JSVC 3MZLA 5GXHA 3EI3A 4FWWA 3ODTA 4J0WA 3N0EA 2J56H 3OTTA 3PVUB 4E5ZA 3RFGA 4LG8A 2CE8A 1PI6A 2IUVA 4CZVA 4N14A 4JXMA 2B5MA 4E5ZB 4O9DA 4GM3A 2OJYA 4QRJA 2IUQA 5HE2B 5FKRA 2YMUA 1FWXA 3L4MD 3JROA 2AQ5A 2PBIB 1JMZB 2H9MA 2P9KC 2UZXB 4ZOYA 4OWRA 5JWZA 4FAND 1N6DA 4J79A 4E54A 5K19A 3UVNA 1MDAH 4E54B 2Z2OA 2H68A 4CY5A 4JT5C 5FKTA 2GC7A 5IGOA 2AH0A 4FHLA 5GSAA 2YNOA 3I7PA 3DXMC 3CFVA 3EI2B 2H9LA 3J81g 4J0XA 3BWSA 5B4WA 2P9LC 3VH0A 4A09A 2P9UC 4A0BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CXC A;  3DXK C;  2QC5 A;  1R5M A;  2BBK H;  4R7A B;  4ZOX A;  4FAV D;  3SBP A;  4A09 B;  2AGX A;  1S4U X;  5IT9 g;  4A0B B;  5CXC B;  3E0C A;  3OL2 A;  5HE1 B;  3FRX A;  2HYE A;  2CN2 A;  3ORV D;  3OL2 B;  5H17 A;  4YVD A;  5CXB A;  4FA4 D;  4BH6 A;  1L0Q A;  4K3J B;  3AH8 B;  1GOT B;  5CXB B;  4JSP C;  4LGN A;  4GZ8 A;  3RSE C;  4J87 A;  1K32 A;  1SHY B;  5EAP A;  3I89 A;  3J80 g;  1OLZ A;  3PE7 A;  2B5L A;  4NSX A;  3PXW D;  5EMK B;  4J77 A;  1JOF A;  1TBG A;  4GMB A;  3F3P A;  1MG2 A;  3SXT D;  1TYQ C;  2H13 A;  5H14 A;  4GM9 A;  4J81 A;  2XU7 A;  1U4C A;  3BG0 A;  5CYK A;  3V7D B;  1PBY B;  4X61 B;  5AMS A;  4H5J A;  4GGD A;  4FA1 D;  5CYK B;  2P9I C;  1B9Y A;  4PBY A;  5GXI A;  3SJL D;  4A0A A;  2GNQ A;  3I7L A;  4Y7R A;  2QXV A;  4AEZ A;  2OK6 A;  4A0A B;  4L3H D;  2Z2P A;  2YB8 B;  4BL0 A;  3RFH A;  4ZN4 A;  3C75 H;  2HJ4 A;  5TEF A;  4D0K A;  4CC9 A;  3SBR A;  4A2M A;  5C2W B;  4KFM B;  2H3X A;  1RI6 A;  5FKQ A;  3MXX A;  3AFC A;  4ERZ A;  4X63 B;  3C9C A;  5FA5 B;  5FXY A;  3W15 A;  3ULE C;  1PEV A;  3UKR C;  5EAR A;  5FLX g;  5EAM A;  4A7J A;  4J82 A;  3EWE A;  1JJU B;  4QL1 A;  5IJ7 E;  4GQ2 P;  5K1C C;  5TEE A;  2OVQ B;  4PBZ A;  4ERQ A;  4FA5 D;  2G9A A;  5C2V B;  2AGY A;  4O1Q D;  2OK4 A;  4K3I D;  1NR0 A;  3EI2 A;  5IC7 A;  4J8G A;  4Y5R D;  1MG3 A;  5HE3 B;  2IUR A;  4QQE A;  3NVX A;  4AOW A;  3L4O D;  5I5I A;  2I0S A;  3UVK A;  3RN1 D;  4GQB B;  4ERY A;  2PM9 A;  2AGL A;  3DSM A;  4JT6 C;  4MK0 B;  3I2N A;  4D6V A;  3SHF A;  2PM9 B;  3K26 A;  3V5W B;  2G99 A;  2HES X;  1XKS A;  1XIP A;  2IWK A;  2B4E A;  3FGB A;  4FA9 D;  2H6N A;  5C9Z B;  3IJC A;  2P9S C;  3SBQ A;  1Q47 A;  3NVQ A;  3JZH A;  2P9P C;  4CI2 A;  3JB9 L;  3I8C A;  3SFZ A;  5AJA A;  2OVP B;  2Z2N A;  1U2V C;  4CZX A;  1GG2 B;  3RMZ D;  1GP2 B;  4FB1 D;  2J55 H;  3IKO A;  4Z8L A;  4J78 A;  4OZU A;  2H14 A;  3FM0 A;  2I0T A;  2H6K A;  3EG6 A;  3SWS D;  1NEX B;  2AGZ A;  2XYI A;  3IJ0 A;  4X3E A;  2XL3 A;  3JPX A;  4GGC A;  4U7A A;  4JD2 C;  5IGQ A;  4J73 A;  2CE9 A;  5SXM A;  3IIY A;  2IWF A;  4L3G D;  3PVW B;  4J8B A;  5HYN B;  2CO0 C;  2W18 A;  4XYH A;  4O3T B;  3DWL C;  3SLE D;  3VGZ A;  4TZ4 A;  5AFU 3;  4J84 A;  2GC4 A;  2HKM A;  1SQJ A;  3EI4 A;  2H6Q A;  5TF2 A;  3AL9 A;  3MKQ A;  3SVW D;  3KRW B;  3EI4 B;  3P4F A;  2PM7 B;  5A2Q g;  3UKU C;  2CN3 A;  2EBS A;  3IIW A;  2BCJ B;  1SQ9 A;  2AH1 A;  4O45 A;  4EWR A;  5IJ8 E;  3F3G A;  5EMJ B;  3EI3 B;  4ZOV A;  2B5N A;  1OMW B;  5KDO B;  3OW8 A;  3JZN A;  1K8K C;  3A0F A;  4PSX B;  4ES0 A;  2O9K A;  4PC0 A;  3EMH A;  3CIK B;  2TRC B;  5FQD A;  5THA A;  2HKR A;  3SN6 B;  4CI3 A;  3I7K A;  3RLM D;  4J86 A;  2I0R A;  4L1Q D;  4XEI C;  3MZK A;  4PSW B;  4I79 A;  3MMY A;  3K27 A;  3HFQ A;  3EU7 A;  3B7F A;  2H9P A;  4ESG A;  3I7O A;  4CY2 A;  4G56 B;  1PGU A;  3SMR A;  2CO0 A;  4JSN C;  4LG9 A;  3V9F A;  5HQG A;  2YBA A;  2HJB A;  3MKS B;  4H5I A;  3PXT D;  2CNX A;  2XL2 A;  3I7H A;  3JZG A;  5TDH B;  4A08 A;  2J57 G;  5FKS A;  2I3T A;  1P22 A;  4IA9 A;  3CFS B;  1YFQ A;  4CY3 A;  2IAA A;  4A08 B;  2PM6 B;  4A2L A;  4UI9 R;  4O3U B;  5EML B;  4U1E I;  3SCY A;  3U4Y A;  3I7N A;  2H47 A;  1GXR A;  3PSC B;  3UR4 A;  3JAM g;  2Q7Q A;  3GRE A;  2AGW A;  3C99 A;  2UZY B;  3UVM A;  4A11 A;  2YNN A;  4CZY A;  3PSL A;  1VYH C;  3RN0 D;  2MTA H;  4QT8 A;  4HDJ A;  4A11 B;  4GGA A;  5EMM B;  1N6E A;  4GM8 A;  4X60 B;  4XYI A;  3OKW A;  4L9O A;  3UVL A;  2OVR B;  4CY1 A;  5I5J A;  3N0D A;  1QNI A;  3UVO A;  5EM2 A;  4ZOZ A;  1N6F A;  5H1M A;  3F3F A;  4CI8 A;  2HXC A;  3KRX B;  5EM2 B;  3VA6 A;  3DM0 A;  3GFC A;  3C5M A;  4PNK B;  4CI1 A;  1ERJ A;  4IMM A;  1XHM A;  2IUP A;  3IJ1 A;  3OKT A;  3ZWL B;  4BUJ C;  3I8E A;  3PXS D;  5HE0 B;  5I5M A;  2I3S A;  3NVN A;  3BG1 A;  2OIZ A;  3AL8 A;  2H9N A;  3OKY A;  3EI1 A;  3JRP A;  4JSX C;  4PXW A;  5GMK n;  2YNP A;  1B9X A;  1JMX B;  3AL8 B;  2P9N C;  3OKY B;  3EI1 B;  3RRM C;  1A0R B;  4GQ1 A;  5EAL A;  4JSV C;  3MZL A;  5GXH A;  3EI3 A;  4FWW A;  3ODT A;  4J0W A;  3N0E A;  2J56 H;  3OTT A;  3PVU B;  4E5Z A;  3RFG A;  4LG8 A;  2CE8 A;  1PI6 A;  2IUV A;  4CZV A;  4N14 A;  4JXM A;  2B5M A;  4E5Z B;  4O9D A;  4GM3 A;  2OJY A;  4QRJ A;  2IUQ A;  5HE2 B;  5FKR A;  2YMU A;  1FWX A;  3L4M D;  3JRO A;  2AQ5 A;  2PBI B;  1JMZ B;  2H9M A;  2P9K C;  2UZX B;  4ZOY A;  4OWR A;  5JWZ A;  4FAN D;  1N6D A;  4J79 A;  4E54 A;  5K19 A;  3UVN A;  1MDA H;  4E54 B;  2Z2O A;  2H68 A;  4CY5 A;  4JT5 C;  5FKT A;  2GC7 A;  5IGO A;  2AH0 A;  4FHL A;  5GSA A;  2YNO A;  3I7P A;  3DXM C;  3CFV A;  3EI2 B;  2H9L A;  3J81 g;  4J0X A;  3BWS A;  5B4W A;  2P9L C;  3VH0 A;  4A09 A;  2P9U C;  4A0B A; 
#chains in the Genus database with same CATH topology
 5CXC A;  4DNU A;  3DXK C;  2QC5 A;  1R5M A;  2BBK H;  4R7A B;  4ZOX A;  4FAV D;  3SBP A;  4A09 B;  2AGX A;  1S4U X;  5IT9 g;  4A0B B;  5CXC B;  3E0C A;  3NIG A;  1O6G A;  3OL2 A;  2VZ3 A;  5M61 A;  5HE1 B;  3T3M A;  3FRX A;  2HYE A;  2CN2 A;  3ORV D;  3OL2 B;  5E6U A;  1A12 A;  5H17 A;  4YVD A;  5CXB A;  4FA4 D;  4AMY A;  4BH6 A;  5M5T A;  1L0Q A;  4K3J B;  4NEN A;  3AH8 B;  1GOT B;  5CXB B;  4JSP C;  4LGN A;  4G1M A;  1UTC A;  4GZ8 A;  3RSE C;  4J87 A;  1K32 A;  1SHY B;  5EAP A;  3I89 A;  3J80 g;  1OLZ A;  3PE7 A;  2B5L A;  4ESG A;  4NSX A;  3PXW D;  5EMK B;  4J77 A;  1JOF A;  1GOH A;  1TBG A;  2XE4 A;  4GMB A;  4DNV A;  3F3P A;  1MG2 A;  3SXT D;  1TYQ C;  2H13 A;  3ZE2 A;  5H14 A;  3ZDZ A;  4G55 A;  3O4I A;  4GM9 A;  4J81 A;  2XU7 A;  1U4C A;  3BG0 A;  5CYK A;  3V7D B;  1PBY B;  4X61 B;  5AMS A;  4H5J A;  2VDR A;  2HU5 A;  4GGD A;  4FA1 D;  5CYK B;  2VDP A;  2P9I C;  4JHN A;  1B9Y A;  4MMX A;  4PBY A;  5GXI A;  3SJL D;  1VE6 A;  4A0A A;  2GNQ A;  3I7L A;  4MMZ A;  4Y7R A;  1H2Y A;  2QXV A;  4AEZ A;  2JKX A;  2OK6 A;  4A0A B;  4L3H D;  2Z2P A;  2YB8 B;  4BL0 A;  3RFH A;  4ZN4 A;  3C75 H;  2HJ4 A;  5TEF A;  4D0K A;  4CC9 A;  2VDM A;  3SBR A;  4A2M A;  4UM9 A;  5C2W B;  4KFM B;  2H3X A;  1RI6 A;  5FKQ A;  3MXX A;  3AFC A;  4WK4 A;  4ERZ A;  5FFG A;  4X63 B;  3C9C A;  5FA5 B;  5FXY A;  3W15 A;  2QR5 A;  3ULE C;  1PEV A;  1E8N A;  3IUR A;  3UKR C;  5EAR A;  3OF7 A;  1QFS A;  3IUQ A;  5FLX g;  5EAM A;  4A7J A;  4J82 A;  3EWE A;  1JJU B;  4QL1 A;  3DDU A;  4BCC A;  5IJ7 E;  4GQ2 P;  4NAA A;  5K1C C;  5TEE A;  2OVQ B;  4PBZ A;  1E5T A;  2VDK A;  4G1E A;  4BP9 A;  4ERQ A;  4FA5 D;  2G9A A;  5C2V B;  2AGY A;  4O1Q D;  2OK4 A;  3ZDX A;  4K3I D;  1NR0 A;  3NIF A;  3EI2 A;  5IC7 A;  4J8G A;  4Y5R D;  1MG3 A;  5HE3 B;  2IUR A;  4QQE A;  3ZE1 A;  3NVX A;  4AOW A;  3L4O D;  5I5I A;  2I0S A;  3UVK A;  3RN1 D;  2VZ1 A;  4WK2 A;  4GQB B;  1VE7 A;  4ERY A;  5HDB A;  2PM9 A;  2AGL A;  3DSM A;  4JT6 C;  4MK0 B;  4Z7O A;  3I2N A;  4D6V A;  3SHF A;  2PM9 B;  3K26 A;  3V5W B;  2G99 A;  2HES X;  1XKS A;  1XIP A;  4O02 A;  2IWK A;  2B4E A;  3FGB A;  4FA9 D;  4NC4 A;  2H6N A;  5C9Z B;  3IJC A;  2P9S C;  3SBQ A;  1Q47 A;  3NVQ A;  3JZH A;  1M1X A;  2P9P C;  4CI2 A;  4JHP C;  3JB9 L;  3I8C A;  3SFZ A;  5AJA A;  2OVP B;  1UOO A;  4AX4 A;  1VZ2 A;  2Z2N A;  1U2V C;  4CZX A;  1GG2 B;  4Z7N A;  3RMZ D;  1GP2 B;  3VI4 A;  4FB1 D;  5FFO A;  2BKL A;  3EQ7 A;  2J55 H;  1H2Z A;  3IKO A;  1UOQ A;  4Z8L A;  4J78 A;  4L1M A;  5M5R A;  4OZU A;  2H14 A;  3FM0 A;  2I0T A;  3MUO A;  2H6K A;  1UOP A;  3EG6 A;  3SWS D;  1NEX B;  2AGZ A;  2XYI A;  3IJ0 A;  4X3E A;  2XL3 A;  4BCB A;  1U8C A;  3JPX A;  4GGC A;  4U7A A;  4JD2 C;  5IGQ A;  4J73 A;  2CE9 A;  5SXM A;  3IIY A;  2IWF A;  4L3G D;  3PVW B;  4J8B A;  5HYN B;  2HU7 A;  2CO0 C;  5C92 A;  2W18 A;  4MMY A;  4XYH A;  4O3T B;  3DWL C;  3SLE D;  3VGZ A;  1O6F A;  4TZ4 A;  5AFU 3;  3IUN A;  4J84 A;  2GC4 A;  2HKM A;  1SQJ A;  3EI4 A;  2H6Q A;  5TF2 A;  2VDQ A;  3AL9 A;  3MKQ A;  3SVW D;  3KRW B;  3EI4 B;  3P4F A;  3QHY B;  2PM7 B;  3EQ9 A;  1GOG A;  5A2Q g;  3UKU C;  4D9S A;  2CN3 A;  4WJK A;  2EBS A;  2VDL A;  3IIW A;  3QI0 A;  2BCJ B;  1I2M B;  1SQ9 A;  4NBM A;  2AH1 A;  2VC2 A;  2VDN A;  4O45 A;  4EWR A;  5IJ8 E;  3F3G A;  5EMJ B;  3EI3 B;  4ZOV A;  2B5N A;  1OMW B;  3K71 A;  5KDO B;  4Z7Q A;  3OW8 A;  4AN0 A;  3JZN A;  1K8K C;  3A0F A;  4PSX B;  4ES0 A;  2O9K A;  4PC0 A;  3KCI A;  3EMH A;  3CIK B;  2TRC B;  5FQD A;  5THA A;  2HKR A;  3SN6 B;  4CI3 A;  3I7K A;  3RLM D;  2EIE A;  4J86 A;  2I0R A;  4L1Q D;  3IUL A;  4O2W A;  4XEI C;  3MZK A;  4PSW B;  4I79 A;  3MMY A;  3K27 A;  3HFQ A;  3EU7 A;  3B7F A;  3K6S A;  2H9P A;  3IUJ A;  2HU8 A;  3I7O A;  4G56 B;  1PGU A;  4CY2 A;  3SMR A;  2CO0 A;  3GD1 I;  4JSN C;  4LG9 A;  3V9F A;  5HQG A;  2YBA A;  2HJB A;  3MKS B;  3FCS A;  4H5I A;  1C9I A;  3PXT D;  3IJE A;  2CNX A;  2EID A;  2XL2 A;  3I7H A;  3JZG A;  5TDH B;  4A08 A;  2J57 G;  5FKS A;  2I3T A;  1P22 A;  4IA9 A;  3CFS B;  1YFQ A;  4CY3 A;  2IAA A;  4WK0 A;  4A08 B;  2PM6 B;  4A2L A;  1T2X A;  4UI9 R;  4O3U B;  5M5V A;  1VZ3 A;  3V4P A;  1E8M A;  5EML B;  1TYE A;  4AMZ A;  3IUM A;  4U1E I;  3SCY A;  3U4Y A;  3MVD K;  3I7N A;  2H47 A;  1GXR A;  3PSC B;  3UR4 A;  3ZDY A;  3JAM g;  2EIC A;  2XZG A;  1GOF A;  2Q7Q A;  3GRE A;  2AGW A;  3C99 A;  2UZY B;  1YR2 A;  3UVM A;  4A11 A;  2YNN A;  4CZY A;  3PSL A;  1VYH C;  3V4V A;  3RN0 D;  2MTA H;  5E6R A;  4QT8 A;  4HDJ A;  4A11 B;  4GGA A;  5EMM B;  1N6E A;  4GM8 A;  4X60 B;  4XYI A;  3OKW A;  3K72 A;  4L9O A;  3UVL A;  2OVR B;  4CY1 A;  5I5J A;  3T3P A;  3N0D A;  1JTD B;  1QNI A;  3UVO A;  5EM2 A;  4ZOZ A;  3O4J A;  1N6F A;  5H1M A;  3F3F A;  4CI8 A;  1JV2 A;  2HXC A;  3KRX B;  4AN1 A;  5EM2 B;  3VA6 A;  3DM0 A;  3GFC A;  3C5M A;  4PNK B;  4CI1 A;  1ERJ A;  4IMM A;  1XHM A;  2IUP A;  3IJ1 A;  3OKT A;  3ZWL B;  2EIB A;  4BUJ C;  3I8E A;  3PXS D;  5M5S A;  5HE0 B;  5I5M A;  2I3S A;  3NVN A;  2WQ8 A;  3BG1 A;  3IVM A;  2OIZ A;  3AL8 A;  2H9N A;  3OKY A;  4BP8 A;  3EI1 A;  4UM8 A;  3JRP A;  4JSX C;  1H2X A;  4PXW A;  5GMK n;  2YNP A;  1B9X A;  3AL8 B;  1JMX B;  3EQ8 A;  2P9N C;  3OKY B;  5E6S A;  3EI1 B;  3RRM C;  1A0R B;  4GQ1 A;  5EAL A;  4JSV C;  3MZL A;  5GXH A;  3EI3 A;  4FWW A;  4RE6 A;  3ODT A;  4J0W A;  3N0E A;  2J56 H;  3OTT A;  4RE5 A;  5M5U A;  3PVU B;  4E5Z A;  3RFG A;  4LG8 A;  2CE8 A;  1PI6 A;  2IUV A;  4CZV A;  4N14 A;  4JXM A;  3GC3 B;  1BPO A;  2B5M A;  4E5Z B;  4O9D A;  4GM3 A;  2OJY A;  4QRJ A;  2IUQ A;  5HE2 B;  1L5G A;  5FKR A;  3VI3 A;  2YMU A;  1FWX A;  2XDW A;  3L4M D;  3JRO A;  2AQ5 A;  3ZE0 A;  2PBI B;  1JMZ B;  1C9L A;  2H9M A;  2P9K C;  2UZX B;  3MUN A;  4ZOY A;  4OWR A;  5JWZ A;  4FAN D;  1N6D A;  4J79 A;  1QFM A;  4E54 A;  3O4H A;  1K3I A;  5K19 A;  3UVN A;  2VDO A;  2QZP A;  1MDA H;  4E54 B;  4DNW A;  2Z2O A;  2H68 A;  4CY5 A;  4QAM A;  4JT5 C;  5FKT A;  2GC7 A;  5IGO A;  2AH0 A;  3NID A;  4BCD A;  4FHL A;  5GSA A;  2YNO A;  3I7P A;  3FCU A;  3DXM C;  3CFV A;  3EI2 B;  5C86 A;  2H9L A;  4IRZ A;  3J81 g;  4J0X A;  3O4G A;  3BWS A;  5B4W A;  1H2W A;  2P9L C;  3VH0 A;  4A09 A;  2P9U C;  4A0B A; 
#chains in the Genus database with same CATH homology
 5CXC A;  3DXK C;  2QC5 A;  1R5M A;  2BBK H;  4R7A B;  4ZOX A;  4FAV D;  3SBP A;  4A09 B;  2AGX A;  1S4U X;  5IT9 g;  4A0B B;  5CXC B;  3E0C A;  3OL2 A;  5HE1 B;  3FRX A;  2HYE A;  2CN2 A;  3ORV D;  3OL2 B;  5H17 A;  4YVD A;  5CXB A;  4FA4 D;  4BH6 A;  1L0Q A;  4K3J B;  3AH8 B;  1GOT B;  5CXB B;  4JSP C;  4LGN A;  4GZ8 A;  3RSE C;  4J87 A;  1K32 A;  1SHY B;  5EAP A;  3I89 A;  3J80 g;  1OLZ A;  3PE7 A;  2B5L A;  4NSX A;  3PXW D;  5EMK B;  4J77 A;  1JOF A;  1TBG A;  4GMB A;  3F3P A;  1MG2 A;  3SXT D;  1TYQ C;  2H13 A;  5H14 A;  4GM9 A;  4J81 A;  2XU7 A;  1U4C A;  3BG0 A;  5CYK A;  3V7D B;  1PBY B;  4X61 B;  5AMS A;  4H5J A;  4GGD A;  4FA1 D;  5CYK B;  2P9I C;  1B9Y A;  4PBY A;  5GXI A;  3SJL D;  4A0A A;  2GNQ A;  3I7L A;  4Y7R A;  2QXV A;  4AEZ A;  2OK6 A;  4A0A B;  4L3H D;  2Z2P A;  2YB8 B;  4BL0 A;  3RFH A;  4ZN4 A;  3C75 H;  2HJ4 A;  5TEF A;  4D0K A;  4CC9 A;  3SBR A;  4A2M A;  5C2W B;  4KFM B;  2H3X A;  1RI6 A;  5FKQ A;  3MXX A;  3AFC A;  4ERZ A;  4X63 B;  3C9C A;  5FA5 B;  5FXY A;  3W15 A;  3ULE C;  1PEV A;  3UKR C;  5EAR A;  5FLX g;  5EAM A;  4A7J A;  4J82 A;  3EWE A;  1JJU B;  4QL1 A;  5IJ7 E;  4GQ2 P;  5K1C C;  5TEE A;  2OVQ B;  4PBZ A;  4ERQ A;  4FA5 D;  2G9A A;  5C2V B;  2AGY A;  4O1Q D;  2OK4 A;  4K3I D;  1NR0 A;  3EI2 A;  5IC7 A;  4J8G A;  4Y5R D;  1MG3 A;  5HE3 B;  2IUR A;  4QQE A;  3NVX A;  4AOW A;  3L4O D;  5I5I A;  2I0S A;  3UVK A;  3RN1 D;  4GQB B;  4ERY A;  2PM9 A;  2AGL A;  3DSM A;  4JT6 C;  4MK0 B;  3I2N A;  4D6V A;  3SHF A;  2PM9 B;  3K26 A;  3V5W B;  2G99 A;  2HES X;  1XKS A;  1XIP A;  2IWK A;  2B4E A;  3FGB A;  4FA9 D;  2H6N A;  5C9Z B;  3IJC A;  2P9S C;  3SBQ A;  1Q47 A;  3NVQ A;  3JZH A;  2P9P C;  4CI2 A;  3JB9 L;  3I8C A;  3SFZ A;  5AJA A;  2OVP B;  2Z2N A;  1U2V C;  4CZX A;  1GG2 B;  3RMZ D;  1GP2 B;  4FB1 D;  2J55 H;  3IKO A;  4Z8L A;  4J78 A;  4OZU A;  2H14 A;  3FM0 A;  2I0T A;  2H6K A;  3EG6 A;  3SWS D;  1NEX B;  2AGZ A;  2XYI A;  3IJ0 A;  4X3E A;  2XL3 A;  3JPX A;  4GGC A;  4U7A A;  4JD2 C;  5IGQ A;  4J73 A;  2CE9 A;  5SXM A;  3IIY A;  2IWF A;  4L3G D;  3PVW B;  4J8B A;  5HYN B;  2CO0 C;  2W18 A;  4XYH A;  4O3T B;  3DWL C;  3SLE D;  3VGZ A;  4TZ4 A;  5AFU 3;  4J84 A;  2GC4 A;  2HKM A;  1SQJ A;  3EI4 A;  2H6Q A;  5TF2 A;  3AL9 A;  3MKQ A;  3SVW D;  3KRW B;  3EI4 B;  3P4F A;  2PM7 B;  5A2Q g;  3UKU C;  2CN3 A;  2EBS A;  3IIW A;  2BCJ B;  1SQ9 A;  2AH1 A;  4O45 A;  4EWR A;  5IJ8 E;  3F3G A;  5EMJ B;  3EI3 B;  4ZOV A;  2B5N A;  1OMW B;  5KDO B;  3OW8 A;  3JZN A;  1K8K C;  3A0F A;  4PSX B;  4ES0 A;  2O9K A;  4PC0 A;  3EMH A;  3CIK B;  2TRC B;  5FQD A;  5THA A;  2HKR A;  3SN6 B;  4CI3 A;  3I7K A;  3RLM D;  4J86 A;  2I0R A;  4L1Q D;  4XEI C;  3MZK A;  4PSW B;  4I79 A;  3MMY A;  3K27 A;  3HFQ A;  3EU7 A;  3B7F A;  2H9P A;  4ESG A;  3I7O A;  4CY2 A;  4G56 B;  1PGU A;  3SMR A;  2CO0 A;  4JSN C;  4LG9 A;  3V9F A;  5HQG A;  2YBA A;  2HJB A;  3MKS B;  4H5I A;  3PXT D;  2CNX A;  2XL2 A;  3I7H A;  3JZG A;  5TDH B;  4A08 A;  2J57 G;  5FKS A;  2I3T A;  1P22 A;  4IA9 A;  3CFS B;  1YFQ A;  4CY3 A;  2IAA A;  4A08 B;  2PM6 B;  4A2L A;  4UI9 R;  4O3U B;  5EML B;  4U1E I;  3SCY A;  3U4Y A;  3I7N A;  2H47 A;  1GXR A;  3PSC B;  3UR4 A;  3JAM g;  2Q7Q A;  3GRE A;  2AGW A;  3C99 A;  2UZY B;  3UVM A;  4A11 A;  2YNN A;  4CZY A;  3PSL A;  1VYH C;  3RN0 D;  2MTA H;  4QT8 A;  4HDJ A;  4A11 B;  4GGA A;  5EMM B;  1N6E A;  4GM8 A;  4X60 B;  4XYI A;  3OKW A;  4L9O A;  3UVL A;  2OVR B;  4CY1 A;  5I5J A;  3N0D A;  1QNI A;  3UVO A;  5EM2 A;  4ZOZ A;  1N6F A;  5H1M A;  3F3F A;  4CI8 A;  2HXC A;  3KRX B;  5EM2 B;  3VA6 A;  3DM0 A;  3GFC A;  3C5M A;  4PNK B;  4CI1 A;  1ERJ A;  4IMM A;  1XHM A;  2IUP A;  3IJ1 A;  3OKT A;  3ZWL B;  4BUJ C;  3I8E A;  3PXS D;  5HE0 B;  5I5M A;  2I3S A;  3NVN A;  3BG1 A;  2OIZ A;  3AL8 A;  2H9N A;  3OKY A;  3EI1 A;  3JRP A;  4JSX C;  4PXW A;  5GMK n;  2YNP A;  1B9X A;  1JMX B;  3AL8 B;  2P9N C;  3OKY B;  3EI1 B;  3RRM C;  1A0R B;  4GQ1 A;  5EAL A;  4JSV C;  3MZL A;  5GXH A;  3EI3 A;  4FWW A;  3ODT A;  4J0W A;  3N0E A;  2J56 H;  3OTT A;  3PVU B;  4E5Z A;  3RFG A;  4LG8 A;  2CE8 A;  1PI6 A;  2IUV A;  4CZV A;  4N14 A;  4JXM A;  2B5M A;  4E5Z B;  4O9D A;  4GM3 A;  2OJY A;  4QRJ A;  2IUQ A;  5HE2 B;  5FKR A;  2YMU A;  1FWX A;  3L4M D;  3JRO A;  2AQ5 A;  2PBI B;  1JMZ B;  2H9M A;  2P9K C;  2UZX B;  4ZOY A;  4OWR A;  5JWZ A;  4FAN D;  1N6D A;  4J79 A;  4E54 A;  5K19 A;  3UVN A;  1MDA H;  4E54 B;  2Z2O A;  2H68 A;  4CY5 A;  4JT5 C;  5FKT A;  2GC7 A;  5IGO A;  2AH0 A;  4FHL A;  5GSA A;  2YNO A;  3I7P A;  3DXM C;  3CFV A;  3EI2 B;  2H9L A;  3J81 g;  4J0X A;  3BWS A;  5B4W A;  2P9L C;  3VH0 A;  4A09 A;  2P9U C;  4A0B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...