2H14A

Crystal of wdr5 (apo-form)
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
303
structure length
303
Chain Sequence
KPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords WD-repeat protein 5
publication title Molecular recognition of histone H3 by the WD40 protein WDR5.
pubmed doi rcsb
source organism Homo sapiens
total genus 100
structure length 303
sequence length 303
ec nomenclature
pdb deposition date 2006-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2h14A00
3IKOA 5GXHA 2IUVA 3JPXA 4GM9A 4E54A 2YNNA 3I8EA 4A11B 3EI2A 4K3ID 3RMZD 2YBAA 2QXVA 5H1MA 2P9KC 3I2NA 4L3GD 2H6QA 3C99A 4L3HD 2CE9A 3HFQA 5CXBA 4GM8A 4JSNC 3L4OD 3IJ0A 1TBGA 1PGUA 5I5MA 5FXYA 4N14A 3MZLA 2HKMA 1VYHC 3DWLC 2AGXA 1FWXA 5HQGA 4BH6A 1GOTB 2P9SC 4CZXA 4CZVA 2P9NC 2HJBA 4O1QD 4PNKB 5EMLB 5IGOA 2J56H 3PVWB 3EI3B 5TEFA 3UVOA 5I5IA 3SMRA 2UZXB 5IC7A 4PC0A 2H9PA 3SJLD 5EM2A 3PXSD 4PSXB 4CI2A 5C2WB 5C9ZB 5HE0B 5IJ8E 4QT8A 5H17A 4E5ZA 4FAND 4MK0B 4J8GA 4PBZA 2I0RA 3PE7A 3I7LA 1NR0A 2XYIA 4CY1A 1NEXB 4XYHA 4A08B 4O3UB 1QNIA 5EM2B 4H5IA 4J79A 3E0CA 4A2MA 2BBKH 5AJAA 5HE1B 4E5ZB 3AL9A 1SQ9A 3N0EA 2P9IC 4LGNA 4JSVC 2Z2PA 4X60B 4ES0A 5GSAA 3SFZA 3SHFA 4ZOVA 2H6NA 5GMKn 3OTTA 3SBQA 4J73A 2OVRB 2B5LA 4J82A 2Z2NA 3UVMA 1MG2A 5CYKA 2CN3A 3UVKA 4GGCA 1JMZB 2HESX 4QQEA 3EU7A 3JROA 4A0BA 4ZOXA 3A0FA 2J57G 2XL2A 4O9DA 5EMMB 3EMHA 4PXWA 3IIYA 1PI6A 3UKRC 4CI3A 4OZUA 2H13A 3OL2A 4GZ8A 2O9KA 4FA1D 2B5NA 4HDJA 4FB1D 3SLED 5A2Qg 1XHMA 2IWKA 4YVDA 4O45A 2H9NA 5FA5B 3F3PA 3DXKC 4JT5C 3AL8A 4K3JB 3B7FA 3OKYA 2OK4A 4E54B 3EG6A 3EI2B 4A0AA 3UVLA 2AGWA 2AH1A 3BWSA 3K27A 2XU7A 4FA4D 3CFVA 4ERQA 4H5JA 1GG2B 4GGDA 1B9XA 3V5WB 5CXBB 3AH8B 3PXWD 2YMUA 2PM9A 4AEZA 3DXMC 3SWSD 1GXRA 1N6FA 3I8CA 3JAMg 4TZ4A 1GP2B 1L0QA 2I3TA 2J55H 3PVUB 3BG1A 4U1EI 4CY2A 4CC9A 1N6DA 3MXXA 3PXTD 5FKRA 3DSMA 2CNXA 4A7JA 5AFU3 2IUQA 5FQDA 1XIPA 4Y7RA 4LG9A 3C75H 2I0TA 3EI1A 2H9LA 3FRXA 4QRJA 4ZN4A 5FKQA 2H47A 4J0WA 5EMJB 3IJ1A 4G56B 2I0SA 1TYQC 3OW8A 4O3TB 2YB8B 4JT6C 4FA9D 4GMBA 1PEVA 2OIZA 1ERJA 2AH0A 3EI4A 4X63B 4CI8A 3UKUC 2TRCB 4XYIA 4ZOYA 3MKSB 5KDOB 3PSCB 1SHYB 3SXTD 3JB9L 4ESGA 5IJ7E 4J8BA 2GC4A 3U4YA 3OKWA 4NSXA 5AMSA 3I7HA 3V9FA 3GFCA 2IWFA 3RN0D 4KFMB 3FM0A 2GNQA 1MDAH 5SXMA 4IMMA 5CYKB 2QC5A 3MZKA 4BL0A 3F3FA 2P9UC 5FLXg 4X61B 1SQJA 4A0BB 3I7OA 2HYEA 4L1QD 2B5MA 4JSXC 2H3XA 3I7KA 5FKTA 3ULEC 4Z8LA 4JSPC 2IUPA 4J78A 3V7DB 4A11A 3ORVD 1YFQA 4CY5A 3OL2B 3SN6B 4CZYA 5EMKB 3I7PA 3SVWD 2CE8A 4CY3A 3N0DA 4LG8A 4PBYA 1JJUB 3IJCA 3UR4A 3RFHA 2OVPB 3ZWLB 3RN1D 4PSWB 2AQ5A 3C9CA 4A2LA 3AL8B 5K19A 3OKYB 5I5JA 2PBIB 4J77A 1N6EA 3AFCA 2W18A 4J81A 1S4UX 3F3GA 3MKQA 3J81g 4J0XA 4A0AB 3W15A 4ERZA 2P9PC 1JMXB 3IIWA 5HE2B 4BUJC 2OJYA 2H9MA 2CN2A 5TF2A 4JXMA 4FHLA 2H68A 3JZHA 3KRWB 2OVQB 5C2VB 4GQ1A 2PM9B 5GXIA 3NVNA 4XEIC 4EWRA 2HJ4A 1U4CA 3MMYA 3BG0A 3EI3A 3I89A 1OLZA 4JD2C 5B4WA 2G99A 1XKSA 2H14A 2XL3A 1Q47A 2OK6A 2G9AA 5HYNB 5TDHB 4FAVD 4CI1A 5IT9g 4Y5RD 1RI6A 3VGZA 4D6VA 3NVQA 4A08A 2CO0C 3J80g 3JRPA 3EI1B 4GQBB 2I3SA 4U7AA 3RFGA 2Q7QA 3NVXA 1JOFA 3DM0A 5TEEA 4UI9R 4FA5D 4ERYA 1OMWB 2AGZA 3RLMD 1A0RB 1P22A 1PBYB 3K26A 4AOWA 4OWRA 2GC7A 2MTAH 3L4MD 5EARA 1R5MA 2UZYB 3EI4B 3SBPA 4J84A 1U2VC 2AGLA 3VA6A 3JZGA 5H14A 3ODTA 3EWEA 3KRXB 1B9YA 4R7AB 2IURA 5CXCA 4J86A 4J87A 5EAMA 3CIKB 3JZNA 2B4EA 2YNOA 1K32A 1MG3A 2H6KA 4X3EA 5IGQA 4A09A 3I7NA 3UVNA 3SBRA 3VH0A 2PM6B 5CXCB 3PSLA 2YNPA 4FWWA 2CO0A 5K1CC 3FGBA 2EBSA 4ZOZA 3RSEC 2HXCA 4D0KA 3RRMC 5EALA 5THAA 5JWZA 2AGYA 5FKSA 3OKTA 4A09B 2BCJB 3CFSB 4I79A 3C5MA 2IAAA 3P4FA 2HKRA 2P9LC 4L9OA 3SCYA 2PM7B 5EAPA 5HE3B 1K8KC 4GQ2P 4IA9A 4QL1A 3GREA 4GGAA 4GM3A 2Z2OA
chains in the Genus database with same CATH superfamily
3IKOA 2QZPA 1GOHA 5GXHA 1E8NA 1TYEA 2IUVA 3JPXA 4GM9A 4E54A 2YNNA 3I8EA 4A11B 1H2YA 2VC2A 3EI2A 4K3ID 3RMZD 1UTCA 2YBAA 2QXVA 5H1MA 2P9KC 3I2NA 4L3GD 2H6QA 1QFMA 2CE9A 3C99A 3HFQA 4L3HD 5CXBA 4GM8A 4JSNC 3L4OD 3IJ0A 1TBGA 1PGUA 2XE4A 3MVDK 5I5MA 5FXYA 4N14A 3IUMA 2HKMA 3MZLA 1VYHC 3DWLC 2AGXA 1FWXA 5HQGA 4G55A 4Z7OA 4BH6A 1GOTB 3OF7A 2P9SC 4CZXA 4CZVA 2P9NC 2HJBA 4O1QD 4PNKB 5EMLB 2VDPA 3K72A 5IGOA 2J56H 3PVWB 3EI3B 5M61A 5TEFA 3UVOA 3ZE0A 5I5IA 3ZE2A 3SMRA 4DNUA 2UZXB 5IC7A 1H2WA 4PC0A 3EQ8A 2H9PA 3SJLD 5EM2A 3PXSD 4PSXB 4QAMA 4CI2A 5C2WB 5C9ZB 5HE0B 5IJ8E 4QT8A 4JHNA 5H17A 4FAND 4MK0B 4E5ZA 4J8GA 4PBZA 2I0RA 3PE7A 3I7LA 1NR0A 2XYIA 4CY1A 1NEXB 4XYHA 4A08B 4O3UB 4L1MA 1QNIA 5EM2B 4H5IA 4J79A 3E0CA 4A2MA 2BBKH 5AJAA 5HE1B 4E5ZB 3AL9A 1SQ9A 3O4JA 1U8CA 4AMZA 3N0EA 2QR5A 4AX4A 2P9IC 4LGNA 2WQ8A 4JSVC 2Z2PA 4UM9A 3V4PA 3NIFA 5HDBA 3NIGA 3IURA 4X60B 4ES0A 5GSAA 3SFZA 3ZDXA 3SHFA 3T3PA 3ZE1A 4ZOVA 2H6NA 5GMKn 2JKXA 3OTTA 3SBQA 4J73A 2OVRB 2B5LA 4J82A 2Z2NA 3UVMA 2BKLA 1MG2A 3ZDYA 5CYKA 3T3MA 1BPOA 2CN3A 3UVKA 3QHYB 1K3IA 1JMZB 4GGCA 2HESX 4AMYA 2EICA 4QQEA 4IRZA 3EU7A 3JROA 4A0BA 2VDNA 1H2XA 4ZOXA 3A0FA 2J57G 2XL2A 4O9DA 5EMMB 3EMHA 4DNWA 4WK0A 4PXWA 3IIYA 1PI6A 4AN1A 4O2WA 3UKRC 4CI3A 4OZUA 1UOPA 2H13A 1UOQA 3OL2A 4GZ8A 1C9LA 4BP8A 2O9KA 4FA1D 2B5NA 4HDJA 2VDQA 1VE7A 4FB1D 3SLED 5A2Qg 1XHMA 2IWKA 4YVDA 3FCSA 4O45A 2H9NA 5FA5B 3F3PA 3DXKC 4JT5C 3AL8A 4K3JB 1YR2A 3B7FA 3OKYA 2EIBA 2OK4A 4E54B 3EG6A 5M5UA 3EI2B 4NENA 4A0AA 3UVLA 3K27A 2AGWA 2AH1A 3BWSA 5M5VA 2XU7A 4JHPC 4FA4D 3CFVA 4ERQA 4AN0A 4H5JA 1GG2B 4GGDA 1B9XA 1A12A 3V5WB 5CXBB 3AH8B 3PXWD 2XZGA 2YMUA 3O4GA 2PM9A 4AEZA 3DXMC 3SWSD 3IUQA 1GXRA 2EIDA 1N6FA 5M5SA 3I8CA 3JAMg 2VZ3A 4D9SA 4TZ4A 1JTDB 1GP2B 1L0QA 2I3TA 2J55H 3PVUB 3BG1A 4U1EI 4CY2A 4CC9A 1N6DA 3MXXA 3PXTD 1QFSA 5FKRA 3DSMA 2CNXA 4A7JA 5AFU3 4WK4A 2IUQA 5FQDA 1XIPA 4Y7RA 3MUNA 3C75H 4LG9A 2I0TA 3EI1A 2H9LA 3FRXA 4MMZA 1VE6A 4QRJA 4ZN4A 5FKQA 2H47A 4J0WA 5EMJB 3IJ1A 4G56B 4WK2A 2I0SA 4O02A 1TYQC 3OW8A 4O3TB 2YB8B 2VZ1A 4JT6C 4FA9D 4GMBA 1PEVA 2OIZA 1ERJA 3ZDZA 2AH0A 4NC4A 3EI4A 4X63B 3K6SA 4CI8A 3QI0A 3UKUC 2TRCB 4XYIA 4ZOYA 3MKSB 5KDOB 3PSCB 1SHYB 3SXTD 3JB9L 4ESGA 5IJ7E 4RE6A 1I2MB 4NBMA 4J8BA 1H2ZA 2GC4A 3U4YA 1UOOA 3OKWA 4NSXA 5C86A 5AMSA 3I7HA 3V9FA 3GFCA 4DNVA 5M5TA 2IWFA 3RN0D 4KFMB 3K71A 1JV2A 1VZ2A 3FM0A 5FFOA 2GNQA 1MDAH 1T2XA 5SXMA 3IUNA 4IMMA 5CYKB 2QC5A 3MZKA 5E6UA 4BL0A 3F3FA 3DDUA 2VDRA 2P9UC 3FCUA 5FLXg 4X61B 1SQJA 4A0BB 4Z7NA 3I7OA 2HYEA 4L1QD 2B5MA 4JSXC 2H3XA 3I7KA 5FKTA 3ULEC 4Z8LA 4JSPC 2IUPA 4J78A 3V7DB 4A11A 3ORVD 1YFQA 4CY5A 1M1XA 3OL2B 2XDWA 3SN6B 4CZYA 5EMKB 3I7PA 3VI4A 3SVWD 2CE8A 4CY3A 3N0DA 4LG8A 4PBYA 1JJUB 3IJCA 3UR4A 4WJKA 1VZ3A 3RFHA 1L5GA 2OVPB 3ZWLB 3RN1D 4PSWB 1O6GA 2AQ5A 3C9CA 4A2LA 3AL8B 5K19A 3OKYB 5I5JA 2PBIB 4J77A 1N6EA 3AFCA 2W18A 2HU5A 4G1MA 5FFGA 4J81A 1S4UX 3F3GA 3MKQA 3J81g 3MUOA 4J0XA 4A0AB 3W15A 4ERZA 2P9PC 1JMXB 3IIWA 5HE2B 4BUJC 2OJYA 2H9MA 2CN2A 5TF2A 4JXMA 4FHLA 4BCDA 2H68A 3JZHA 3KRWB 2OVQB 5C2VB 4GQ1A 2PM9B 5GXIA 3NVNA 4XEIC 4EWRA 2HJ4A 1U4CA 3MMYA 3O4HA 3BG0A 3EI3A 3I89A 3NIDA 4RE5A 1OLZA 4JD2C 3IJEA 5B4WA 2G99A 4NAAA 1XKSA 2H14A 2XL3A 5E6SA 1Q47A 2OK6A 2G9AA 5HYNB 5TDHB 4FAVD 4CI1A 5IT9g 4Y5RD 4MMXA 1O6FA 3O4IA 1RI6A 3VGZA 2HU8A 4D6VA 4BCBA 3NVQA 4A08A 1C9IA 2CO0C 3J80g 3JRPA 3EI1B 4GQBB 2I3SA 4U7AA 2VDLA 3RFGA 2Q7QA 3NVXA 1JOFA 3DM0A 5TEEA 4UI9R 4BCCA 4FA5D 3VI3A 4ERYA 3IVMA 1E5TA 1OMWB 2AGZA 3RLMD 1A0RB 1P22A 1PBYB 3K26A 4AOWA 4OWRA 5M5RA 3IULA 3V4VA 2GC7A 2MTAH 3L4MD 5EARA 1R5MA 2UZYB 3EI4B 3SBPA 4J84A 1U2VC 2AGLA 2VDMA 3VA6A 3JZGA 5H14A 3ODTA 2HU7A 3EWEA 3GD1I 3KRXB 1B9YA 4R7AB 2IURA 5CXCA 3EQ7A 4J86A 4J87A 5EAMA 3CIKB 1E8MA 2VDKA 3JZNA 2B4EA 3KCIA 3GC3B 2YNOA 1GOGA 1K32A 1MG3A 2EIEA 2H6KA 4X3EA 5IGQA 4A09A 3I7NA 3UVNA 3SBRA 5C92A 3VH0A 2PM6B 4BP9A 5CXCB 4UM8A 3PSLA 2YNPA 4FWWA 2CO0A 5K1CC 3FGBA 2EBSA 4MMYA 4ZOZA 5E6RA 3RSEC 2HXCA 4D0KA 3RRMC 5EALA 5THAA 5JWZA 2AGYA 5FKSA 3OKTA 4Z7QA 4A09B 2BCJB 2VDOA 3CFSB 4I79A 3C5MA 2IAAA 1GOFA 3P4FA 4G1EA 2HKRA 2P9LC 4L9OA 3SCYA 2PM7B 3IUJA 5EAPA 5HE3B 1K8KC 4GQ2P 4IA9A 4QL1A 3GREA 4GGAA 4GM3A 2Z2OA 3EQ9A
chains in the Genus database with same CATH topology
3IKOA 5GXHA 2IUVA 3JPXA 4GM9A 4E54A 2YNNA 3I8EA 4A11B 3EI2A 4K3ID 3RMZD 2YBAA 2QXVA 5H1MA 2P9KC 3I2NA 4L3GD 2H6QA 3C99A 4L3HD 2CE9A 3HFQA 5CXBA 4GM8A 4JSNC 3L4OD 3IJ0A 1TBGA 1PGUA 5I5MA 5FXYA 4N14A 3MZLA 2HKMA 1VYHC 3DWLC 2AGXA 1FWXA 5HQGA 4BH6A 1GOTB 2P9SC 4CZXA 4CZVA 2P9NC 2HJBA 4O1QD 4PNKB 5EMLB 5IGOA 2J56H 3PVWB 3EI3B 5TEFA 3UVOA 5I5IA 3SMRA 2UZXB 5IC7A 4PC0A 2H9PA 3SJLD 5EM2A 3PXSD 4PSXB 4CI2A 5C2WB 5C9ZB 5HE0B 5IJ8E 4QT8A 5H17A 4E5ZA 4FAND 4MK0B 4J8GA 4PBZA 2I0RA 3PE7A 3I7LA 1NR0A 2XYIA 4CY1A 1NEXB 4XYHA 4A08B 4O3UB 1QNIA 5EM2B 4H5IA 4J79A 3E0CA 4A2MA 2BBKH 5AJAA 5HE1B 4E5ZB 3AL9A 1SQ9A 3N0EA 2P9IC 4LGNA 4JSVC 2Z2PA 4X60B 4ES0A 5GSAA 3SFZA 3SHFA 4ZOVA 2H6NA 5GMKn 3OTTA 3SBQA 4J73A 2OVRB 2B5LA 4J82A 2Z2NA 3UVMA 1MG2A 5CYKA 2CN3A 3UVKA 4GGCA 1JMZB 2HESX 4QQEA 3EU7A 3JROA 4A0BA 4ZOXA 3A0FA 2J57G 2XL2A 4O9DA 5EMMB 3EMHA 4PXWA 3IIYA 1PI6A 3UKRC 4CI3A 4OZUA 2H13A 3OL2A 4GZ8A 2O9KA 4FA1D 2B5NA 4HDJA 4FB1D 3SLED 5A2Qg 1XHMA 2IWKA 4YVDA 4O45A 2H9NA 5FA5B 3F3PA 3DXKC 4JT5C 3AL8A 4K3JB 3B7FA 3OKYA 2OK4A 4E54B 3EG6A 3EI2B 4A0AA 3UVLA 2AGWA 2AH1A 3BWSA 3K27A 2XU7A 4FA4D 3CFVA 4ERQA 4H5JA 1GG2B 4GGDA 1B9XA 3V5WB 5CXBB 3AH8B 3PXWD 2YMUA 2PM9A 4AEZA 3DXMC 3SWSD 1GXRA 1N6FA 3I8CA 3JAMg 4TZ4A 1GP2B 1L0QA 2I3TA 2J55H 3PVUB 3BG1A 4U1EI 4CY2A 4CC9A 1N6DA 3MXXA 3PXTD 5FKRA 3DSMA 2CNXA 4A7JA 5AFU3 2IUQA 5FQDA 1XIPA 4Y7RA 4LG9A 3C75H 2I0TA 3EI1A 2H9LA 3FRXA 4QRJA 4ZN4A 5FKQA 2H47A 4J0WA 5EMJB 3IJ1A 4G56B 2I0SA 1TYQC 3OW8A 4O3TB 2YB8B 4JT6C 4FA9D 4GMBA 1PEVA 2OIZA 1ERJA 2AH0A 3EI4A 4X63B 4CI8A 3UKUC 2TRCB 4XYIA 4ZOYA 3MKSB 5KDOB 3PSCB 1SHYB 3SXTD 3JB9L 4ESGA 5IJ7E 4J8BA 2GC4A 3U4YA 3OKWA 4NSXA 5AMSA 3I7HA 3V9FA 3GFCA 2IWFA 3RN0D 4KFMB 3FM0A 2GNQA 1MDAH 5SXMA 4IMMA 5CYKB 2QC5A 3MZKA 4BL0A 3F3FA 2P9UC 5FLXg 4X61B 1SQJA 4A0BB 3I7OA 2HYEA 4L1QD 2B5MA 4JSXC 2H3XA 3I7KA 5FKTA 3ULEC 4Z8LA 4JSPC 2IUPA 4J78A 3V7DB 4A11A 3ORVD 1YFQA 4CY5A 3OL2B 3SN6B 4CZYA 5EMKB 3I7PA 3SVWD 2CE8A 4CY3A 3N0DA 4LG8A 4PBYA 1JJUB 3IJCA 3UR4A 3RFHA 2OVPB 3ZWLB 3RN1D 4PSWB 2AQ5A 3C9CA 4A2LA 3AL8B 5K19A 3OKYB 5I5JA 2PBIB 4J77A 1N6EA 3AFCA 2W18A 4J81A 1S4UX 3F3GA 3MKQA 3J81g 4J0XA 4A0AB 3W15A 4ERZA 2P9PC 1JMXB 3IIWA 5HE2B 4BUJC 2OJYA 2H9MA 2CN2A 5TF2A 4JXMA 4FHLA 2H68A 3JZHA 3KRWB 2OVQB 5C2VB 4GQ1A 2PM9B 5GXIA 3NVNA 4XEIC 4EWRA 2HJ4A 1U4CA 3MMYA 3BG0A 3EI3A 3I89A 1OLZA 4JD2C 5B4WA 2G99A 1XKSA 2H14A 2XL3A 1Q47A 2OK6A 2G9AA 5HYNB 5TDHB 4FAVD 4CI1A 5IT9g 4Y5RD 1RI6A 3VGZA 4D6VA 3NVQA 4A08A 2CO0C 3J80g 3JRPA 3EI1B 4GQBB 2I3SA 4U7AA 3RFGA 2Q7QA 3NVXA 1JOFA 3DM0A 5TEEA 4UI9R 4FA5D 4ERYA 1OMWB 2AGZA 3RLMD 1A0RB 1P22A 1PBYB 3K26A 4AOWA 4OWRA 2GC7A 2MTAH 3L4MD 5EARA 1R5MA 2UZYB 3EI4B 3SBPA 4J84A 1U2VC 2AGLA 3VA6A 3JZGA 5H14A 3ODTA 3EWEA 3KRXB 1B9YA 4R7AB 2IURA 5CXCA 4J86A 4J87A 5EAMA 3CIKB 3JZNA 2B4EA 2YNOA 1K32A 1MG3A 2H6KA 4X3EA 5IGQA 4A09A 3I7NA 3UVNA 3SBRA 3VH0A 2PM6B 5CXCB 3PSLA 2YNPA 4FWWA 2CO0A 5K1CC 3FGBA 2EBSA 4ZOZA 3RSEC 2HXCA 4D0KA 3RRMC 5EALA 5THAA 5JWZA 2AGYA 5FKSA 3OKTA 4A09B 2BCJB 3CFSB 4I79A 3C5MA 2IAAA 3P4FA 2HKRA 2P9LC 4L9OA 3SCYA 2PM7B 5EAPA 5HE3B 1K8KC 4GQ2P 4IA9A 4QL1A 3GREA 4GGAA 4GM3A 2Z2OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IKO A;  5GXH A;  2IUV A;  3JPX A;  4GM9 A;  4E54 A;  2YNN A;  3I8E A;  4A11 B;  3EI2 A;  4K3I D;  3RMZ D;  2YBA A;  2QXV A;  5H1M A;  2P9K C;  3I2N A;  4L3G D;  2H6Q A;  3C99 A;  4L3H D;  2CE9 A;  3HFQ A;  5CXB A;  4GM8 A;  4JSN C;  3L4O D;  3IJ0 A;  1TBG A;  1PGU A;  5I5M A;  5FXY A;  4N14 A;  3MZL A;  2HKM A;  1VYH C;  3DWL C;  2AGX A;  1FWX A;  5HQG A;  4BH6 A;  1GOT B;  2P9S C;  4CZX A;  4CZV A;  2P9N C;  2HJB A;  4O1Q D;  4PNK B;  5EML B;  5IGO A;  2J56 H;  3PVW B;  3EI3 B;  5TEF A;  3UVO A;  5I5I A;  3SMR A;  2UZX B;  5IC7 A;  4PC0 A;  2H9P A;  3SJL D;  5EM2 A;  3PXS D;  4PSX B;  4CI2 A;  5C2W B;  5C9Z B;  5HE0 B;  5IJ8 E;  4QT8 A;  5H17 A;  4E5Z A;  4FAN D;  4MK0 B;  4J8G A;  4PBZ A;  2I0R A;  3PE7 A;  3I7L A;  1NR0 A;  2XYI A;  4CY1 A;  1NEX B;  4XYH A;  4A08 B;  4O3U B;  1QNI A;  5EM2 B;  4H5I A;  4J79 A;  3E0C A;  4A2M A;  2BBK H;  5AJA A;  5HE1 B;  4E5Z B;  3AL9 A;  1SQ9 A;  3N0E A;  2P9I C;  4LGN A;  4JSV C;  2Z2P A;  4X60 B;  4ES0 A;  5GSA A;  3SFZ A;  3SHF A;  4ZOV A;  2H6N A;  5GMK n;  3OTT A;  3SBQ A;  4J73 A;  2OVR B;  2B5L A;  4J82 A;  2Z2N A;  3UVM A;  1MG2 A;  5CYK A;  2CN3 A;  3UVK A;  4GGC A;  1JMZ B;  2HES X;  4QQE A;  3EU7 A;  3JRO A;  4A0B A;  4ZOX A;  3A0F A;  2J57 G;  2XL2 A;  4O9D A;  5EMM B;  3EMH A;  4PXW A;  3IIY A;  1PI6 A;  3UKR C;  4CI3 A;  4OZU A;  2H13 A;  3OL2 A;  4GZ8 A;  2O9K A;  4FA1 D;  2B5N A;  4HDJ A;  4FB1 D;  3SLE D;  5A2Q g;  1XHM A;  2IWK A;  4YVD A;  4O45 A;  2H9N A;  5FA5 B;  3F3P A;  3DXK C;  4JT5 C;  3AL8 A;  4K3J B;  3B7F A;  3OKY A;  2OK4 A;  4E54 B;  3EG6 A;  3EI2 B;  4A0A A;  3UVL A;  2AGW A;  2AH1 A;  3BWS A;  3K27 A;  2XU7 A;  4FA4 D;  3CFV A;  4ERQ A;  4H5J A;  1GG2 B;  4GGD A;  1B9X A;  3V5W B;  5CXB B;  3AH8 B;  3PXW D;  2YMU A;  2PM9 A;  4AEZ A;  3DXM C;  3SWS D;  1GXR A;  1N6F A;  3I8C A;  3JAM g;  4TZ4 A;  1GP2 B;  1L0Q A;  2I3T A;  2J55 H;  3PVU B;  3BG1 A;  4U1E I;  4CY2 A;  4CC9 A;  1N6D A;  3MXX A;  3PXT D;  5FKR A;  3DSM A;  2CNX A;  4A7J A;  5AFU 3;  2IUQ A;  5FQD A;  1XIP A;  4Y7R A;  4LG9 A;  3C75 H;  2I0T A;  3EI1 A;  2H9L A;  3FRX A;  4QRJ A;  4ZN4 A;  5FKQ A;  2H47 A;  4J0W A;  5EMJ B;  3IJ1 A;  4G56 B;  2I0S A;  1TYQ C;  3OW8 A;  4O3T B;  2YB8 B;  4JT6 C;  4FA9 D;  4GMB A;  1PEV A;  2OIZ A;  1ERJ A;  2AH0 A;  3EI4 A;  4X63 B;  4CI8 A;  3UKU C;  2TRC B;  4XYI A;  4ZOY A;  3MKS B;  5KDO B;  3PSC B;  1SHY B;  3SXT D;  3JB9 L;  4ESG A;  5IJ7 E;  4J8B A;  2GC4 A;  3U4Y A;  3OKW A;  4NSX A;  5AMS A;  3I7H A;  3V9F A;  3GFC A;  2IWF A;  3RN0 D;  4KFM B;  3FM0 A;  2GNQ A;  1MDA H;  5SXM A;  4IMM A;  5CYK B;  2QC5 A;  3MZK A;  4BL0 A;  3F3F A;  2P9U C;  5FLX g;  4X61 B;  1SQJ A;  4A0B B;  3I7O A;  2HYE A;  4L1Q D;  2B5M A;  4JSX C;  2H3X A;  3I7K A;  5FKT A;  3ULE C;  4Z8L A;  4JSP C;  2IUP A;  4J78 A;  3V7D B;  4A11 A;  3ORV D;  1YFQ A;  4CY5 A;  3OL2 B;  3SN6 B;  4CZY A;  5EMK B;  3I7P A;  3SVW D;  2CE8 A;  4CY3 A;  3N0D A;  4LG8 A;  4PBY A;  1JJU B;  3IJC A;  3UR4 A;  3RFH A;  2OVP B;  3ZWL B;  3RN1 D;  4PSW B;  2AQ5 A;  3C9C A;  4A2L A;  3AL8 B;  5K19 A;  3OKY B;  5I5J A;  2PBI B;  4J77 A;  1N6E A;  3AFC A;  2W18 A;  4J81 A;  1S4U X;  3F3G A;  3MKQ A;  3J81 g;  4J0X A;  4A0A B;  3W15 A;  4ERZ A;  2P9P C;  1JMX B;  3IIW A;  5HE2 B;  4BUJ C;  2OJY A;  2H9M A;  2CN2 A;  5TF2 A;  4JXM A;  4FHL A;  2H68 A;  3JZH A;  3KRW B;  2OVQ B;  5C2V B;  4GQ1 A;  2PM9 B;  5GXI A;  3NVN A;  4XEI C;  4EWR A;  2HJ4 A;  1U4C A;  3MMY A;  3BG0 A;  3EI3 A;  3I89 A;  1OLZ A;  4JD2 C;  5B4W A;  2G99 A;  1XKS A;  2H14 A;  2XL3 A;  1Q47 A;  2OK6 A;  2G9A A;  5HYN B;  5TDH B;  4FAV D;  4CI1 A;  5IT9 g;  4Y5R D;  1RI6 A;  3VGZ A;  4D6V A;  3NVQ A;  4A08 A;  2CO0 C;  3J80 g;  3JRP A;  3EI1 B;  4GQB B;  2I3S A;  4U7A A;  3RFG A;  2Q7Q A;  3NVX A;  1JOF A;  3DM0 A;  5TEE A;  4UI9 R;  4FA5 D;  4ERY A;  1OMW B;  2AGZ A;  3RLM D;  1A0R B;  1P22 A;  1PBY B;  3K26 A;  4AOW A;  4OWR A;  2GC7 A;  2MTA H;  3L4M D;  5EAR A;  1R5M A;  2UZY B;  3EI4 B;  3SBP A;  4J84 A;  1U2V C;  2AGL A;  3VA6 A;  3JZG A;  5H14 A;  3ODT A;  3EWE A;  3KRX B;  1B9Y A;  4R7A B;  2IUR A;  5CXC A;  4J86 A;  4J87 A;  5EAM A;  3CIK B;  3JZN A;  2B4E A;  2YNO A;  1K32 A;  1MG3 A;  2H6K A;  4X3E A;  5IGQ A;  4A09 A;  3I7N A;  3UVN A;  3SBR A;  3VH0 A;  2PM6 B;  5CXC B;  3PSL A;  2YNP A;  4FWW A;  2CO0 A;  5K1C C;  3FGB A;  2EBS A;  4ZOZ A;  3RSE C;  2HXC A;  4D0K A;  3RRM C;  5EAL A;  5THA A;  5JWZ A;  2AGY A;  5FKS A;  3OKT A;  4A09 B;  2BCJ B;  3CFS B;  4I79 A;  3C5M A;  2IAA A;  3P4F A;  2HKR A;  2P9L C;  4L9O A;  3SCY A;  2PM7 B;  5EAP A;  5HE3 B;  1K8K C;  4GQ2 P;  4IA9 A;  4QL1 A;  3GRE A;  4GGA A;  4GM3 A;  2Z2O A; 
#chains in the Genus database with same CATH topology
 3IKO A;  2QZP A;  1GOH A;  5GXH A;  1E8N A;  1TYE A;  2IUV A;  3JPX A;  4GM9 A;  4E54 A;  2YNN A;  3I8E A;  4A11 B;  1H2Y A;  2VC2 A;  3EI2 A;  4K3I D;  3RMZ D;  1UTC A;  2YBA A;  2QXV A;  5H1M A;  2P9K C;  3I2N A;  4L3G D;  2H6Q A;  1QFM A;  2CE9 A;  3C99 A;  3HFQ A;  4L3H D;  5CXB A;  4GM8 A;  4JSN C;  3L4O D;  3IJ0 A;  1TBG A;  1PGU A;  2XE4 A;  3MVD K;  5I5M A;  5FXY A;  4N14 A;  3IUM A;  2HKM A;  3MZL A;  1VYH C;  3DWL C;  2AGX A;  1FWX A;  5HQG A;  4G55 A;  4Z7O A;  4BH6 A;  1GOT B;  3OF7 A;  2P9S C;  4CZX A;  4CZV A;  2P9N C;  2HJB A;  4O1Q D;  4PNK B;  5EML B;  2VDP A;  3K72 A;  5IGO A;  2J56 H;  3PVW B;  3EI3 B;  5M61 A;  5TEF A;  3UVO A;  3ZE0 A;  5I5I A;  3ZE2 A;  3SMR A;  4DNU A;  2UZX B;  5IC7 A;  1H2W A;  4PC0 A;  3EQ8 A;  2H9P A;  3SJL D;  5EM2 A;  3PXS D;  4PSX B;  4QAM A;  4CI2 A;  5C2W B;  5C9Z B;  5HE0 B;  5IJ8 E;  4QT8 A;  4JHN A;  5H17 A;  4FAN D;  4MK0 B;  4E5Z A;  4J8G A;  4PBZ A;  2I0R A;  3PE7 A;  3I7L A;  1NR0 A;  2XYI A;  4CY1 A;  1NEX B;  4XYH A;  4A08 B;  4O3U B;  4L1M A;  1QNI A;  5EM2 B;  4H5I A;  4J79 A;  3E0C A;  4A2M A;  2BBK H;  5AJA A;  5HE1 B;  4E5Z B;  3AL9 A;  1SQ9 A;  3O4J A;  1U8C A;  4AMZ A;  3N0E A;  2QR5 A;  4AX4 A;  2P9I C;  4LGN A;  2WQ8 A;  4JSV C;  2Z2P A;  4UM9 A;  3V4P A;  3NIF A;  5HDB A;  3NIG A;  3IUR A;  4X60 B;  4ES0 A;  5GSA A;  3SFZ A;  3ZDX A;  3SHF A;  3T3P A;  3ZE1 A;  4ZOV A;  2H6N A;  5GMK n;  2JKX A;  3OTT A;  3SBQ A;  4J73 A;  2OVR B;  2B5L A;  4J82 A;  2Z2N A;  3UVM A;  2BKL A;  1MG2 A;  3ZDY A;  5CYK A;  3T3M A;  1BPO A;  2CN3 A;  3UVK A;  3QHY B;  1K3I A;  1JMZ B;  4GGC A;  2HES X;  4AMY A;  2EIC A;  4QQE A;  4IRZ A;  3EU7 A;  3JRO A;  4A0B A;  2VDN A;  1H2X A;  4ZOX A;  3A0F A;  2J57 G;  2XL2 A;  4O9D A;  5EMM B;  3EMH A;  4DNW A;  4WK0 A;  4PXW A;  3IIY A;  1PI6 A;  4AN1 A;  4O2W A;  3UKR C;  4CI3 A;  4OZU A;  1UOP A;  2H13 A;  1UOQ A;  3OL2 A;  4GZ8 A;  1C9L A;  4BP8 A;  2O9K A;  4FA1 D;  2B5N A;  4HDJ A;  2VDQ A;  1VE7 A;  4FB1 D;  3SLE D;  5A2Q g;  1XHM A;  2IWK A;  4YVD A;  3FCS A;  4O45 A;  2H9N A;  5FA5 B;  3F3P A;  3DXK C;  4JT5 C;  3AL8 A;  4K3J B;  1YR2 A;  3B7F A;  3OKY A;  2EIB A;  2OK4 A;  4E54 B;  3EG6 A;  5M5U A;  3EI2 B;  4NEN A;  4A0A A;  3UVL A;  3K27 A;  2AGW A;  2AH1 A;  3BWS A;  5M5V A;  2XU7 A;  4JHP C;  4FA4 D;  3CFV A;  4ERQ A;  4AN0 A;  4H5J A;  1GG2 B;  4GGD A;  1B9X A;  1A12 A;  3V5W B;  5CXB B;  3AH8 B;  3PXW D;  2XZG A;  2YMU A;  3O4G A;  2PM9 A;  4AEZ A;  3DXM C;  3SWS D;  3IUQ A;  1GXR A;  2EID A;  1N6F A;  5M5S A;  3I8C A;  3JAM g;  2VZ3 A;  4D9S A;  4TZ4 A;  1JTD B;  1GP2 B;  1L0Q A;  2I3T A;  2J55 H;  3PVU B;  3BG1 A;  4U1E I;  4CY2 A;  4CC9 A;  1N6D A;  3MXX A;  3PXT D;  1QFS A;  5FKR A;  3DSM A;  2CNX A;  4A7J A;  5AFU 3;  4WK4 A;  2IUQ A;  5FQD A;  1XIP A;  4Y7R A;  3MUN A;  3C75 H;  4LG9 A;  2I0T A;  3EI1 A;  2H9L A;  3FRX A;  4MMZ A;  1VE6 A;  4QRJ A;  4ZN4 A;  5FKQ A;  2H47 A;  4J0W A;  5EMJ B;  3IJ1 A;  4G56 B;  4WK2 A;  2I0S A;  4O02 A;  1TYQ C;  3OW8 A;  4O3T B;  2YB8 B;  2VZ1 A;  4JT6 C;  4FA9 D;  4GMB A;  1PEV A;  2OIZ A;  1ERJ A;  3ZDZ A;  2AH0 A;  4NC4 A;  3EI4 A;  4X63 B;  3K6S A;  4CI8 A;  3QI0 A;  3UKU C;  2TRC B;  4XYI A;  4ZOY A;  3MKS B;  5KDO B;  3PSC B;  1SHY B;  3SXT D;  3JB9 L;  4ESG A;  5IJ7 E;  4RE6 A;  1I2M B;  4NBM A;  4J8B A;  1H2Z A;  2GC4 A;  3U4Y A;  1UOO A;  3OKW A;  4NSX A;  5C86 A;  5AMS A;  3I7H A;  3V9F A;  3GFC A;  4DNV A;  5M5T A;  2IWF A;  3RN0 D;  4KFM B;  3K71 A;  1JV2 A;  1VZ2 A;  3FM0 A;  5FFO A;  2GNQ A;  1MDA H;  1T2X A;  5SXM A;  3IUN A;  4IMM A;  5CYK B;  2QC5 A;  3MZK A;  5E6U A;  4BL0 A;  3F3F A;  3DDU A;  2VDR A;  2P9U C;  3FCU A;  5FLX g;  4X61 B;  1SQJ A;  4A0B B;  4Z7N A;  3I7O A;  2HYE A;  4L1Q D;  2B5M A;  4JSX C;  2H3X A;  3I7K A;  5FKT A;  3ULE C;  4Z8L A;  4JSP C;  2IUP A;  4J78 A;  3V7D B;  4A11 A;  3ORV D;  1YFQ A;  4CY5 A;  1M1X A;  3OL2 B;  2XDW A;  3SN6 B;  4CZY A;  5EMK B;  3I7P A;  3VI4 A;  3SVW D;  2CE8 A;  4CY3 A;  3N0D A;  4LG8 A;  4PBY A;  1JJU B;  3IJC A;  3UR4 A;  4WJK A;  1VZ3 A;  3RFH A;  1L5G A;  2OVP B;  3ZWL B;  3RN1 D;  4PSW B;  1O6G A;  2AQ5 A;  3C9C A;  4A2L A;  3AL8 B;  5K19 A;  3OKY B;  5I5J A;  2PBI B;  4J77 A;  1N6E A;  3AFC A;  2W18 A;  2HU5 A;  4G1M A;  5FFG A;  4J81 A;  1S4U X;  3F3G A;  3MKQ A;  3J81 g;  3MUO A;  4J0X A;  4A0A B;  3W15 A;  4ERZ A;  2P9P C;  1JMX B;  3IIW A;  5HE2 B;  4BUJ C;  2OJY A;  2H9M A;  2CN2 A;  5TF2 A;  4JXM A;  4FHL A;  4BCD A;  2H68 A;  3JZH A;  3KRW B;  2OVQ B;  5C2V B;  4GQ1 A;  2PM9 B;  5GXI A;  3NVN A;  4XEI C;  4EWR A;  2HJ4 A;  1U4C A;  3MMY A;  3O4H A;  3BG0 A;  3EI3 A;  3I89 A;  3NID A;  4RE5 A;  1OLZ A;  4JD2 C;  3IJE A;  5B4W A;  2G99 A;  4NAA A;  1XKS A;  2H14 A;  2XL3 A;  5E6S A;  1Q47 A;  2OK6 A;  2G9A A;  5HYN B;  5TDH B;  4FAV D;  4CI1 A;  5IT9 g;  4Y5R D;  4MMX A;  1O6F A;  3O4I A;  1RI6 A;  3VGZ A;  2HU8 A;  4D6V A;  4BCB A;  3NVQ A;  4A08 A;  1C9I A;  2CO0 C;  3J80 g;  3JRP A;  3EI1 B;  4GQB B;  2I3S A;  4U7A A;  2VDL A;  3RFG A;  2Q7Q A;  3NVX A;  1JOF A;  3DM0 A;  5TEE A;  4UI9 R;  4BCC A;  4FA5 D;  3VI3 A;  4ERY A;  3IVM A;  1E5T A;  1OMW B;  2AGZ A;  3RLM D;  1A0R B;  1P22 A;  1PBY B;  3K26 A;  4AOW A;  4OWR A;  5M5R A;  3IUL A;  3V4V A;  2GC7 A;  2MTA H;  3L4M D;  5EAR A;  1R5M A;  2UZY B;  3EI4 B;  3SBP A;  4J84 A;  1U2V C;  2AGL A;  2VDM A;  3VA6 A;  3JZG A;  5H14 A;  3ODT A;  2HU7 A;  3EWE A;  3GD1 I;  3KRX B;  1B9Y A;  4R7A B;  2IUR A;  5CXC A;  3EQ7 A;  4J86 A;  4J87 A;  5EAM A;  3CIK B;  1E8M A;  2VDK A;  3JZN A;  2B4E A;  3KCI A;  3GC3 B;  2YNO A;  1GOG A;  1K32 A;  1MG3 A;  2EIE A;  2H6K A;  4X3E A;  5IGQ A;  4A09 A;  3I7N A;  3UVN A;  3SBR A;  5C92 A;  3VH0 A;  2PM6 B;  4BP9 A;  5CXC B;  4UM8 A;  3PSL A;  2YNP A;  4FWW A;  2CO0 A;  5K1C C;  3FGB A;  2EBS A;  4MMY A;  4ZOZ A;  5E6R A;  3RSE C;  2HXC A;  4D0K A;  3RRM C;  5EAL A;  5THA A;  5JWZ A;  2AGY A;  5FKS A;  3OKT A;  4Z7Q A;  4A09 B;  2BCJ B;  2VDO A;  3CFS B;  4I79 A;  3C5M A;  2IAA A;  1GOF A;  3P4F A;  4G1E A;  2HKR A;  2P9L C;  4L9O A;  3SCY A;  2PM7 B;  3IUJ A;  5EAP A;  5HE3 B;  1K8K C;  4GQ2 P;  4IA9 A;  4QL1 A;  3GRE A;  4GGA A;  4GM3 A;  2Z2O A;  3EQ9 A; 
#chains in the Genus database with same CATH homology
 3IKO A;  5GXH A;  2IUV A;  3JPX A;  4GM9 A;  4E54 A;  2YNN A;  3I8E A;  4A11 B;  3EI2 A;  4K3I D;  3RMZ D;  2YBA A;  2QXV A;  5H1M A;  2P9K C;  3I2N A;  4L3G D;  2H6Q A;  3C99 A;  4L3H D;  2CE9 A;  3HFQ A;  5CXB A;  4GM8 A;  4JSN C;  3L4O D;  3IJ0 A;  1TBG A;  1PGU A;  5I5M A;  5FXY A;  4N14 A;  3MZL A;  2HKM A;  1VYH C;  3DWL C;  2AGX A;  1FWX A;  5HQG A;  4BH6 A;  1GOT B;  2P9S C;  4CZX A;  4CZV A;  2P9N C;  2HJB A;  4O1Q D;  4PNK B;  5EML B;  5IGO A;  2J56 H;  3PVW B;  3EI3 B;  5TEF A;  3UVO A;  5I5I A;  3SMR A;  2UZX B;  5IC7 A;  4PC0 A;  2H9P A;  3SJL D;  5EM2 A;  3PXS D;  4PSX B;  4CI2 A;  5C2W B;  5C9Z B;  5HE0 B;  5IJ8 E;  4QT8 A;  5H17 A;  4E5Z A;  4FAN D;  4MK0 B;  4J8G A;  4PBZ A;  2I0R A;  3PE7 A;  3I7L A;  1NR0 A;  2XYI A;  4CY1 A;  1NEX B;  4XYH A;  4A08 B;  4O3U B;  1QNI A;  5EM2 B;  4H5I A;  4J79 A;  3E0C A;  4A2M A;  2BBK H;  5AJA A;  5HE1 B;  4E5Z B;  3AL9 A;  1SQ9 A;  3N0E A;  2P9I C;  4LGN A;  4JSV C;  2Z2P A;  4X60 B;  4ES0 A;  5GSA A;  3SFZ A;  3SHF A;  4ZOV A;  2H6N A;  5GMK n;  3OTT A;  3SBQ A;  4J73 A;  2OVR B;  2B5L A;  4J82 A;  2Z2N A;  3UVM A;  1MG2 A;  5CYK A;  2CN3 A;  3UVK A;  4GGC A;  1JMZ B;  2HES X;  4QQE A;  3EU7 A;  3JRO A;  4A0B A;  4ZOX A;  3A0F A;  2J57 G;  2XL2 A;  4O9D A;  5EMM B;  3EMH A;  4PXW A;  3IIY A;  1PI6 A;  3UKR C;  4CI3 A;  4OZU A;  2H13 A;  3OL2 A;  4GZ8 A;  2O9K A;  4FA1 D;  2B5N A;  4HDJ A;  4FB1 D;  3SLE D;  5A2Q g;  1XHM A;  2IWK A;  4YVD A;  4O45 A;  2H9N A;  5FA5 B;  3F3P A;  3DXK C;  4JT5 C;  3AL8 A;  4K3J B;  3B7F A;  3OKY A;  2OK4 A;  4E54 B;  3EG6 A;  3EI2 B;  4A0A A;  3UVL A;  2AGW A;  2AH1 A;  3BWS A;  3K27 A;  2XU7 A;  4FA4 D;  3CFV A;  4ERQ A;  4H5J A;  1GG2 B;  4GGD A;  1B9X A;  3V5W B;  5CXB B;  3AH8 B;  3PXW D;  2YMU A;  2PM9 A;  4AEZ A;  3DXM C;  3SWS D;  1GXR A;  1N6F A;  3I8C A;  3JAM g;  4TZ4 A;  1GP2 B;  1L0Q A;  2I3T A;  2J55 H;  3PVU B;  3BG1 A;  4U1E I;  4CY2 A;  4CC9 A;  1N6D A;  3MXX A;  3PXT D;  5FKR A;  3DSM A;  2CNX A;  4A7J A;  5AFU 3;  2IUQ A;  5FQD A;  1XIP A;  4Y7R A;  4LG9 A;  3C75 H;  2I0T A;  3EI1 A;  2H9L A;  3FRX A;  4QRJ A;  4ZN4 A;  5FKQ A;  2H47 A;  4J0W A;  5EMJ B;  3IJ1 A;  4G56 B;  2I0S A;  1TYQ C;  3OW8 A;  4O3T B;  2YB8 B;  4JT6 C;  4FA9 D;  4GMB A;  1PEV A;  2OIZ A;  1ERJ A;  2AH0 A;  3EI4 A;  4X63 B;  4CI8 A;  3UKU C;  2TRC B;  4XYI A;  4ZOY A;  3MKS B;  5KDO B;  3PSC B;  1SHY B;  3SXT D;  3JB9 L;  4ESG A;  5IJ7 E;  4J8B A;  2GC4 A;  3U4Y A;  3OKW A;  4NSX A;  5AMS A;  3I7H A;  3V9F A;  3GFC A;  2IWF A;  3RN0 D;  4KFM B;  3FM0 A;  2GNQ A;  1MDA H;  5SXM A;  4IMM A;  5CYK B;  2QC5 A;  3MZK A;  4BL0 A;  3F3F A;  2P9U C;  5FLX g;  4X61 B;  1SQJ A;  4A0B B;  3I7O A;  2HYE A;  4L1Q D;  2B5M A;  4JSX C;  2H3X A;  3I7K A;  5FKT A;  3ULE C;  4Z8L A;  4JSP C;  2IUP A;  4J78 A;  3V7D B;  4A11 A;  3ORV D;  1YFQ A;  4CY5 A;  3OL2 B;  3SN6 B;  4CZY A;  5EMK B;  3I7P A;  3SVW D;  2CE8 A;  4CY3 A;  3N0D A;  4LG8 A;  4PBY A;  1JJU B;  3IJC A;  3UR4 A;  3RFH A;  2OVP B;  3ZWL B;  3RN1 D;  4PSW B;  2AQ5 A;  3C9C A;  4A2L A;  3AL8 B;  5K19 A;  3OKY B;  5I5J A;  2PBI B;  4J77 A;  1N6E A;  3AFC A;  2W18 A;  4J81 A;  1S4U X;  3F3G A;  3MKQ A;  3J81 g;  4J0X A;  4A0A B;  3W15 A;  4ERZ A;  2P9P C;  1JMX B;  3IIW A;  5HE2 B;  4BUJ C;  2OJY A;  2H9M A;  2CN2 A;  5TF2 A;  4JXM A;  4FHL A;  2H68 A;  3JZH A;  3KRW B;  2OVQ B;  5C2V B;  4GQ1 A;  2PM9 B;  5GXI A;  3NVN A;  4XEI C;  4EWR A;  2HJ4 A;  1U4C A;  3MMY A;  3BG0 A;  3EI3 A;  3I89 A;  1OLZ A;  4JD2 C;  5B4W A;  2G99 A;  1XKS A;  2H14 A;  2XL3 A;  1Q47 A;  2OK6 A;  2G9A A;  5HYN B;  5TDH B;  4FAV D;  4CI1 A;  5IT9 g;  4Y5R D;  1RI6 A;  3VGZ A;  4D6V A;  3NVQ A;  4A08 A;  2CO0 C;  3J80 g;  3JRP A;  3EI1 B;  4GQB B;  2I3S A;  4U7A A;  3RFG A;  2Q7Q A;  3NVX A;  1JOF A;  3DM0 A;  5TEE A;  4UI9 R;  4FA5 D;  4ERY A;  1OMW B;  2AGZ A;  3RLM D;  1A0R B;  1P22 A;  1PBY B;  3K26 A;  4AOW A;  4OWR A;  2GC7 A;  2MTA H;  3L4M D;  5EAR A;  1R5M A;  2UZY B;  3EI4 B;  3SBP A;  4J84 A;  1U2V C;  2AGL A;  3VA6 A;  3JZG A;  5H14 A;  3ODT A;  3EWE A;  3KRX B;  1B9Y A;  4R7A B;  2IUR A;  5CXC A;  4J86 A;  4J87 A;  5EAM A;  3CIK B;  3JZN A;  2B4E A;  2YNO A;  1K32 A;  1MG3 A;  2H6K A;  4X3E A;  5IGQ A;  4A09 A;  3I7N A;  3UVN A;  3SBR A;  3VH0 A;  2PM6 B;  5CXC B;  3PSL A;  2YNP A;  4FWW A;  2CO0 A;  5K1C C;  3FGB A;  2EBS A;  4ZOZ A;  3RSE C;  2HXC A;  4D0K A;  3RRM C;  5EAL A;  5THA A;  5JWZ A;  2AGY A;  5FKS A;  3OKT A;  4A09 B;  2BCJ B;  3CFS B;  4I79 A;  3C5M A;  2IAA A;  3P4F A;  2HKR A;  2P9L C;  4L9O A;  3SCY A;  2PM7 B;  5EAP A;  5HE3 B;  1K8K C;  4GQ2 P;  4IA9 A;  4QL1 A;  3GRE A;  4GGA A;  4GM3 A;  2Z2O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...