3OKYB

Plexin a2 in complex with semaphorin 6a
Total Genus 133
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
133
sequence length
549
structure length
540
Chain Sequence
FPEDSEPISISHGNYTKQYPVFVGHKPGRTQRHRLDIQMIMIMNRTLYVAARDHIYTVDIDTSHTEEIYCSKKLTWKSRQADVDTCRMKGKHKDECHNFIKVLLKKNDDTLFVCGTNAFNPSCRNYRVDTLETFGDEFSGMARCPYDAKHANIALFADGKLYSATVTDFLAIDAVIYRSLGDSPTLRTVKHDSKWLKEPYFVQAVDYGDYIYFFFREIAVEYNTMGKVVFPRVAQVCKNDMGGSQRVLEKQWTSFLKARLNCSVPGDSHFYFNILQAVTDVIRINGRDVVLATFSTPYNSIPGSAVCAYDMLDIANVFTGRFKEQKSPDSTWTPVPDERVPKPRPGCCAGSSSLEKYATSNEFPDDTLNFIKTHPLMDEAVPSIINRPWFLRTMVRYRLTKIAVDNAAGPYQNHTVVFLGSEKGIILKFLARILNGSLFLEEMNVYNPEKCSYDGVEDKRIMGMQLDRASGSLYVAFSTCVIKVPLGRCERHGKCKKTCIASRDPYCGWVRESGSCAHLSPLSRLTFEQDIERGNTDGDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Plexin-A2
publication title Structural basis of semaphorin-plexin signalling.
pubmed doi rcsb
source organism Mus musculus
total genus 133
structure length 540
sequence length 549
ec nomenclature
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01403 Sema Sema domain
B PF01437 PSI Plexin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3okyB01
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 3okyB02
4J77A 2CE8A 3RN0D 4GQBB 3IJCA 4JSVC 2VDNB 1JMZB 5I5IA 4NSXA 4QRJA 3RRMC 2PM9B 3AFCA 2EBSA 4X60B 5EMMB 1SSLA 1U8CB 3FM0A 4D0KA 2P9SC 4A0BA 5H17A 2Z2NA 4E54A 2H9PA 3MZLA 2I0TA 5E6SB 1N6DA 4H5JA 2OVQB 3EMHA 1FWXA 1U2VC 3NVQA 5CYKB 3RFHA 3U4YA 2UZYB 5GMKn 3OKWA 2P26A 2W18A 1B9XA 5EMJB 4JD2C 1K32A 2P28A 3PVWB 2XU7A 3K27A 3MMYA 1JMXB 4JSNC 3ZDXB 4LG8A 4QL1A 4Z8LA 4L1QD 1GOTB 4A0BB 2OVRB 2PM6B 1PGUA 5TEEA 4CI8A 5CXCA 4ZN4A 4J78A 5EARA 4XEIC 3SXTD 3I8CA 4J8GA 3JZGA 4L3GD 4ZOYA 5GXHA 1VYHC 5JWZA 3SBRA 4A2MA 5C2VB 5IJ8E 2H47A 1A0RB 3J80g 3ORVD 3DXMC 5TDHB 3JZNA 4FHLA 1PI6A 4L3HD 3I7PA 3NIFB 2BBKH 5CXCB 2H6KA 2VDOB 3FRXA 2P9UC 3ZE1B 2B5NA 4XYIA 2MTAH 3SVWD 3SHFA 5EAPA 2GC7A 3J81g 3I8EA 2P9IC 3I7OA 3ZWLB 3UVLA 4GGCA 3PSCB 4BH6A 4GM3A 5HE0B 5K1CC 3NVXA 4O1QD 4A09A 2H13A 4CY3A 4GGAA 2OIZA 1TYQC 4A2LA 4IA9A 5HDBB 5H14A 1L0QA 3BG0A 5HE1B 4J8BA 3UVOA 5AFU3 5TF2A 4UM8B 2CE9A 5H1MA 2AQ5A 4N14A 3MKSB 2H68A 1PEVA 3HFQA 3K26A 4JSPC 4A09B 3PE7A 3SMRA 2VC2B 3UR4A 3I7NA 4GQ1A 3N0EA 5FKRA 4PSXB 2IUPA 3C99A 4GGDA 4GZ8A 3ZDZB 1MG3A 4XYHA 3I89A 1OMWB 5EM2A 2G99A 1XHMA 3L4MD 2GC4A 4J79A 3UVMA 5CXBA 4PC0A 2HJBA 2YBAA 4CY5A 2O9KA 3F3PA 2CN3A 2YNOA 3IJ0A 1S4UX 2Q7QA 3RLMD 2VDQB 2AGYA 3AL9A 1MDAH 2AGZA 3SFZA 2CNXA 2OK4A 4ZOXA 1RI6A 4ERQA 3JROA 2XL2A 5EM2B 5C9ZB 5GXIA 2YB8B 1XKSA 3AH8B 2AH0A 3EI3B 3DWLC 3SBPA 3ZE2B 4O3TB 5HE3B 2HXCA 1GXRA 4ZOZA 3VI4B 4E5ZB 1PBYB 3KRXB 3F3GA 4KFMB 5CXBB 3OL2B 3AL8A 4GMBA 4CC9A 2UZXB 2AH1A 4HDJA 2I3SA 5B4WA 4WK2B 3OKYA 3ZE0B 4QQEA 5I5MA 2CN2A 4FA1D 4PBYA 4UM9D 4X61B 4CZVA 5EAMA 4A0AA 4J0XA 4O3UB 4J84A 2QC5A 4L9OA 3V5WB 3C9CA 5HQGA 3ODTA 1MG2A 3UVKA 4FAVD 3SLED 3PVUB 1SQJA 2PM7B 3AL8B 1N6FA 2CO0C 4OZUA 1YUKA 3OKYB 4FB1D 4LGNA 4J86A 2H14A 4JT6C 3DM0A 3RSEC 4A0AB 2OJYA 2H9NA 4LG9A 3IKOA 3V7DB 2OK6A 3PXTD 3JZHA 4ERYA 2YNPA 2H3XA 4Y7RA 1SQ9A 3BWSA 4J87A 5FQDA 2Z2OA 5FXYA 5THAA 3EWEA 3OTTA 5GSAA 4FWWA 2B4EA 3PSLA 5I5JA 4AOWA 3GFCA 2G9AA 2YNNA 5IJ7E 1K8KC 2P9KC 3CFVA 4JT5C 4I79A 5HE2B 3RN1D 2P9PC 4O45A 2VDRB 1XIPA 1GP2B 2IWFA 1JOFA 3C75H 2H6QA 2VDMB 2CO0A 3DSMA 3I7KA 4CY2A 4UI9R 3EI3A 5AJAA 4J82A 1U4CA 5HYNB 3VH0A 4E5ZA 3ULEC 2XYIA 3JPXA 1R5MA 4R7AB 4WK0B 2I0RA 4YVDA 3OL2A 4BL0A 4J73A 2HJ4A 4X63B 3L4OD 4A08B 4D6VA 5K19A 4PSWB 4EWRA 4Z7QB 4PBZA 5EMLB 4PXWA 4MK0B 3W15A 3V9FA 4JXMA 1GG2B 2HESX 3E0CA 1YFQA 3EI4A 5FKSA 4U1EI 3JAMg 3UKUC 2H6NA 1P22A 2I3TA 3EI2A 4A11B 3MZKA 2Z2PA 4U7AA 3VGZA 3IJ1A 3P4FA 3UVNA 4J81A 4G56B 4ESGA 4TZ4A 3SJLD 4Z7OB 5A2Qg 1B9YA 2GNQA 3VI3B 1TBGA 2J56H 4CZXA 5TEFA 4AEZA 5FKTA 5EALA 4IMMA 5C2WB 2AGWA 2AGXA 3BG1A 3PXWD 3EI4B 3JB9L 3OW8A 2IWKA 4GM9A 4A7JA 2XL3A 3EI2B 5IT9g 3A0FA 4QT8A 3JRPA 2HKRA 4GQ2P 4E54B 3DXKC 1ERJA 3EU7A 3ZDYB 3GREA 4OWRA 5IGOA 1Q47A 4CI2A 5FKQA 3RFGA 4BUJC 2IUVA 2VDLB 4CI3A 2HYEA 4O9DA 2VDPB 3F3FA 3OKTA 4FAND 3I7HA 4UM9B 4ZOVA 1NEXB 2OVPB 4FA5D 3IIWA 3CIKB 3I7LA 5E6RB 5EMKB 2IURA 4JSXC 3N0DA 1SHYB 2YMUA 4CY1A 2HKMA 3EG6A 2TRCB 3RMZD 1N6EA 4WJKB 3I2NA 3IIYA 4K3ID 3FGBA 1OLZA 4CZYA 3FCUB 2H9MA 3VA6A 3NIGB 3PXSD 2IAAA 3MXXA 2B5LA 2QXVA 2I0SA 4WK4B 3UKRC 3SCYA 4GM8A 3SWSD 2H9LA 2J57G 3T3PB 3NVNA 5SXMA 5AMSA 3MKQA 5IC7A 4A08A 3T3MB 4Y5RD 4CI1A 3EI1A 4ES0A 3SBQA 2J55H 3NIDB 2B5MA 4H5IA 5FA5B 4PNKB 1TYEB 4Z7NB 1JJUB 2PBIB 4X3EA 2BCJB 5E6UB 2P9LC 3B7FA 3SN6B 1QNIA 3C5MA 2P9NC 4J0WA 4FA9D 3CFSB 2PM9A 2AGLA 5IGQA 4A11A 4ERZA 5KDOB 4K3JB 2VDKB 4FA4D 2IUQA 3KRWB 3EI1B 5FLXg 1NR0A 5CYKA
chains in the Genus database with same CATH superfamily
4J77A 2CE8A 3RN0D 4GQBB 3IJCA 4JSVC 2VDNB 1JMZB 5I5IA 3IJEA 4NSXA 4QRJA 2BKLA 4DNWA 3RRMC 2PM9B 3AFCA 2EBSA 4X60B 5EMMB 1SSLA 1U8CB 3FM0A 4D0KA 2EICA 2P9SC 4A0BA 5H17A 2Z2NA 4E54A 2H9PA 3MZLA 2I0TA 5E6SB 1N6DA 3ZDYA 4H5JA 2OVQB 3EMHA 1FWXA 1U2VC 3NVQA 5CYKB 3RFHA 3U4YA 2UZYB 2XDWA 5GMKn 3OKWA 1BPOA 2VDLA 2P26A 2W18A 3O4IA 1B9XA 1JTDB 5EMJB 4JD2C 1K32A 2P28A 3PVWB 2XU7A 3EQ7A 1I2MB 3K27A 3MMYA 1JMXB 4JSNC 3ZDXB 5E6RA 4LG8A 4QL1A 3EQ9A 4Z8LA 4L1QD 1GOTB 4A0BB 2OVRB 2PM6B 1PGUA 1QFSA 5TEEA 5FFGA 4CI8A 5CXCA 4ZN4A 2JWHA 4J78A 4AMYA 4WJKA 5EARA 1UTCA 1GOFA 3IVMA 3ZE1A 4XEIC 2VZ1A 3FCUA 3SXTD 3I8CA 4J8GA 1K3IA 1UOOA 2EIDA 3JZGA 4L3GD 4ZOYA 5GXHA 1VYHC 5JWZA 3SBRA 4A2MA 5C2VB 4G1MA 5IJ8E 2H47A 1A0RB 3J80g 3ORVD 3DXMC 4O02A 3JZNA 5TDHB 4FHLA 1PI6A 4L3HD 3I7PA 3NIFB 5HDBA 2BBKH 5CXCB 2H6KA 2VDOB 3FRXA 2P9UC 3ZE1B 2B5NA 4XYIA 2MTAH 3SVWD 3SHFA 5EAPA 3NIDA 2GC7A 4DNUA 3J81g 4MMZA 3I8EA 4UM8A 5FFOA 2P9IC 3I7OA 3ZWLB 3UVLA 4GGCA 3PSCB 5E6UA 2QR5A 4GM3A 4BH6A 4BCCA 5HE0B 1L5GA 5K1CC 3NVXA 4O1QD 4A09A 2H13A 4CY3A 2VC2A 3MUOA 4GGAA 2OIZA 2VDKA 1TYQC 3K71A 4A2LA 4IA9A 5HDBB 5H14A 1L0QA 1H2YA 3BG0A 5HE1B 1E8NA 4J8BA 3IUQA 3UVOA 5M5VA 5AFU3 1QFMA 5TF2A 4UM8B 2CE9A 4BP8A 5H1MA 2AQ5A 4N14A 3IUJA 3MKSB 2H68A 1PEVA 3HFQA 3K26A 4JSPC 3MVDK 4A09B 3PE7A 3SMRA 2VC2B 4QAMA 3UR4A 3I7NA 4GQ1A 1U8CA 3N0EA 5FKRA 4PSXB 2IUPA 3C99A 1O6GA 1UOPA 4GGDA 4GZ8A 2XE4A 3ZDZB 1MG3A 1T2XA 4XYHA 4BP9A 3I89A 1OMWB 5EM2A 5M5TA 1YR2A 2G99A 1XHMA 3L4MD 4AN1A 2GC4A 3ZE2A 4J79A 3GD1I 3VI4A 3UVMA 4RE6A 5CXBA 4PC0A 2HJBA 2YBAA 4CY5A 3ZDXA 2O9KA 3F3PA 2CN3A 2YNOA 3IJ0A 1S4UX 2Q7QA 5M61A 3RLMD 2VDQB 2AGYA 1E8MA 3AL9A 4WK2A 1MDAH 2AGZA 3SFZA 3ZE0A 2CNXA 2OK4A 4ZOXA 1RI6A 4ERQA 3JROA 4IRZA 2XL2A 5EM2B 5C9ZB 5GXIA 2YB8B 1XKSA 3AH8B 2AH0A 3EI3B 3FCSA 3EQ8A 3DWLC 3SBPA 3ZE2B 4O3TB 5HE3B 2HXCA 1GXRA 4ZOZA 3VI4B 4E5ZB 1PBYB 3KRXB 3F3GA 4KFMB 5CXBB 3OL2B 1E5TA 3AL8A 4GMBA 4CC9A 2UZXB 2AH1A 3NIFA 4HDJA 2I3SA 5B4WA 4O2WA 4WK2B 2VDOA 3OKYA 3ZE0B 4QQEA 5I5MA 2CN2A 4FA1D 4PBYA 4UM9D 4X61B 3O4HA 4CZVA 1H2XA 2QZPA 5EAMA 4J0XA 4A0AA 4O3UB 4J84A 2QC5A 4L9OA 3V5WB 3C9CA 5HQGA 3ODTA 1MG2A 3UVKA 4FAVD 3SLED 3PVUB 1SQJA 2PM7B 4G55A 3AL8B 1N6FA 4RE5A 2CO0C 4OZUA 1YUKA 3OKYB 4FB1D 1H2ZA 2XZGA 4LGNA 4J86A 2H14A 4JT6C 3DM0A 3RSEC 4A0AB 2OJYA 2H9NA 4LG9A 3IKOA 3V4PA 3V7DB 3GC3B 2OK6A 5M5RA 3PXTD 3JZHA 4ERYA 4AX4A 4NENA 5C86A 2EIBA 2YNPA 2H3XA 4Y7RA 1SQ9A 3BWSA 4J87A 2VDRA 5FQDA 2Z2OA 5FXYA 5THAA 3EWEA 3OTTA 2VDMA 5GSAA 5C92A 3O4JA 4FWWA 2B4EA 3PSLA 3ZDZA 5I5JA 4AOWA 3KCIA 3GFCA 1VE7A 2G9AA 2JKXA 4AMZA 3QHYB 1VE6A 2YNNA 5IJ7E 1K8KC 2P9KC 3CFVA 1C9LA 4JT5C 4I79A 5HE2B 3RN1D 4WK0A 2P9PC 3O4GA 4O45A 2VDRB 1XIPA 1GP2B 2IWFA 1JOFA 2VDQA 3C75H 2H6QA 2VDMB 2CO0A 3DSMA 2VZ3A 3I7KA 3QI0A 4NBMA 1O6FA 4CY2A 4DNVA 4UI9R 3EI3A 5AJAA 3IUMA 4J82A 1U4CA 4JHPC 5HYNB 3VH0A 4E5ZA 3ULEC 2XYIA 3JPXA 1R5MA 4R7AB 4WK0B 2I0RA 4YVDA 3OL2A 4BL0A 4J73A 4NAAA 2HU8A 2HJ4A 4X63B 3L4OD 4A08B 4D6VA 5K19A 4PSWB 4EWRA 4Z7QB 4PBZA 5EMLB 4PXWA 3K6SA 4MK0B 3W15A 3V9FA 4JXMA 1GG2B 5M5UA 2HESX 3E0CA 4MMXA 1H2WA 1YFQA 3EI4A 5FKSA 4U1EI 3IURA 3JAMg 1GOHA 3UKUC 2H6NA 1P22A 2I3TA 3EI2A 1M1XA 4A11B 4BCDA 3MZKA 2Z2PA 4U7AA 3VGZA 3IJ1A 3P4FA 3UVNA 4J81A 4G56B 4ESGA 4TZ4A 4AN0A 3SJLD 2HU7A 5A2Qg 4Z7OB 1B9YA 2GNQA 3VI3B 1TBGA 2J56H 4CZXA 5TEFA 4AEZA 5FKTA 5EALA 4IMMA 2HU5A 5C2WB 2VDPA 1C9IA 3IULA 2AGWA 2AGXA 4D9SA 4UM9A 3BG1A 3PXWD 3EI4B 3JB9L 3OW8A 2IWKA 4GM9A 4A7JA 2XL3A 3EI2B 5IT9g 3A0FA 4QT8A 3JRPA 2HKRA 4GQ2P 4E54B 4BCBA 3DXKC 1ERJA 3EU7A 1A12A 3GREA 4OWRA 5IGOA 3ZDYB 1Q47A 4CI2A 5FKQA 1JV2A 3RFGA 4BUJC 2IUVA 1VZ3A 3NIGA 4CI3A 2VDLB 2EIEA 4O9DA 2HYEA 3F3FA 2VDPB 4NC4A 1VZ2A 3OKTA 4MMYA 4FAND 3I7HA 4UM9B 4ZOVA 1UOQA 1NEXB 4WK4A 2OVPB 3V4VA 4FA5D 3IIWA 3CIKB 3I7LA 5E6RB 3T3PA 5EMKB 4L1MA 2IURA 4JSXC 3N0DA 1SHYB 2YMUA 4CY1A 2HKMA 3EG6A 2TRCB 3RMZD 3T3MA 1N6EA 4WJKB 3I2NA 3IIYA 4K3ID 3FGBA 3MUNA 1OLZA 4CZYA 3FCUB 2H9MA 3VA6A 3NIGB 3PXSD 2JWGA 2IAAA 1TYEA 3MXXA 4Z7NA 2B5LA 2QXVA 2I0SA 4WK4B 3UKRC 1GOGA 3SCYA 4GM8A 3SWSD 2H9LA 2J57G 3T3PB 3NVNA 5SXMA 5AMSA 3MKQA 5IC7A 3IUNA 4JHNA 4A08A 3T3MB 4Y5RD 4CI1A 3EI1A 4ES0A 3K72A 3SBQA 4Z7QA 2J55H 4G1EA 3NIDB 2B5MA 4H5IA 5FA5B 4PNKB 5M5SA 1TYEB 4Z7NB 2WQ8A 1JJUB 2PBIB 4X3EA 2BCJB 2VDNA 5E6UB 2P9LC 3B7FA 3DDUA 3SN6B 1QNIA 3C5MA 2P9NC 4J0WA 4FA9D 3CFSB 2PM9A 2AGLA 5IGQA 3OF7A 4A11A 4ERZA 5KDOB 4K3JB 2VDKB 5E6SA 4Z7OA 4FA4D 2IUQA 3KRWB 3EI1B 3VI3A 5FLXg 1NR0A 5CYKA
chains in the Genus database with same CATH topology
4J77A 2CE8A 3RN0D 4GQBB 3IJCA 4JSVC 2VDNB 1JMZB 5I5IA 4NSXA 4QRJA 3RRMC 2PM9B 3AFCA 2EBSA 4X60B 5EMMB 1SSLA 1U8CB 3FM0A 4D0KA 2P9SC 4A0BA 5H17A 2Z2NA 4E54A 2H9PA 3MZLA 2I0TA 5E6SB 1N6DA 4H5JA 2OVQB 3EMHA 1FWXA 1U2VC 3NVQA 5CYKB 3RFHA 3U4YA 2UZYB 5GMKn 3OKWA 2P26A 2W18A 1B9XA 5EMJB 4JD2C 1K32A 2P28A 3PVWB 2XU7A 3K27A 3MMYA 1JMXB 4JSNC 3ZDXB 4LG8A 4QL1A 4Z8LA 4L1QD 1GOTB 4A0BB 2OVRB 2PM6B 1PGUA 5TEEA 4CI8A 5CXCA 4ZN4A 2JWHA 4J78A 5EARA 4XEIC 3SXTD 3I8CA 4J8GA 3JZGA 4L3GD 4ZOYA 5GXHA 1VYHC 5JWZA 3SBRA 4A2MA 5C2VB 5IJ8E 2H47A 1A0RB 3J80g 3ORVD 3DXMC 5TDHB 3JZNA 4FHLA 1PI6A 4L3HD 3I7PA 3NIFB 2BBKH 5CXCB 2H6KA 2VDOB 3FRXA 2P9UC 3ZE1B 2B5NA 4XYIA 2MTAH 3SVWD 3SHFA 5EAPA 2GC7A 3J81g 3I8EA 2P9IC 3I7OA 3ZWLB 3UVLA 4GGCA 3PSCB 4BH6A 4GM3A 5HE0B 5K1CC 3NVXA 4O1QD 4A09A 2H13A 4CY3A 4GGAA 2OIZA 1TYQC 4A2LA 4IA9A 5HDBB 5H14A 1L0QA 3BG0A 5HE1B 4J8BA 3UVOA 5AFU3 5TF2A 4UM8B 2CE9A 5H1MA 2AQ5A 4N14A 3MKSB 2H68A 1PEVA 3HFQA 3K26A 4JSPC 4A09B 3PE7A 3SMRA 2VC2B 3UR4A 3I7NA 4GQ1A 3N0EA 5FKRA 4PSXB 2IUPA 3C99A 4GGDA 4GZ8A 3ZDZB 1MG3A 4XYHA 3I89A 1OMWB 5EM2A 2G99A 1XHMA 3L4MD 2GC4A 4J79A 3UVMA 5CXBA 4PC0A 2HJBA 2YBAA 4CY5A 2O9KA 3F3PA 2CN3A 2YNOA 3IJ0A 1S4UX 2Q7QA 3RLMD 2VDQB 2AGYA 3AL9A 1MDAH 2AGZA 3SFZA 2CNXA 2OK4A 4ZOXA 1RI6A 4ERQA 3JROA 2XL2A 5EM2B 5C9ZB 5GXIA 2YB8B 1XKSA 3AH8B 2AH0A 3EI3B 3DWLC 3SBPA 3ZE2B 4O3TB 5HE3B 2HXCA 1GXRA 4ZOZA 3VI4B 4E5ZB 1PBYB 3KRXB 3F3GA 4KFMB 5CXBB 3OL2B 3AL8A 4GMBA 4CC9A 2UZXB 2AH1A 4HDJA 2I3SA 5B4WA 4WK2B 3OKYA 3ZE0B 4QQEA 5I5MA 2CN2A 4FA1D 4PBYA 4UM9D 4X61B 4CZVA 5EAMA 4A0AA 4J0XA 4O3UB 4J84A 2QC5A 4L9OA 3V5WB 3C9CA 5HQGA 3ODTA 1MG2A 3UVKA 4FAVD 3SLED 3PVUB 1SQJA 2PM7B 3AL8B 1N6FA 2CO0C 4OZUA 1YUKA 3OKYB 4FB1D 4LGNA 4J86A 2H14A 4JT6C 3DM0A 3RSEC 4A0AB 2OJYA 2H9NA 4LG9A 3IKOA 3V7DB 2OK6A 3PXTD 3JZHA 4ERYA 2YNPA 2H3XA 4Y7RA 1SQ9A 3BWSA 4J87A 5FQDA 2Z2OA 5FXYA 5THAA 3EWEA 3OTTA 5GSAA 4FWWA 2B4EA 3PSLA 5I5JA 4AOWA 3GFCA 2G9AA 2YNNA 5IJ7E 1K8KC 2P9KC 3CFVA 4JT5C 4I79A 5HE2B 3RN1D 2P9PC 4O45A 2VDRB 1XIPA 1GP2B 2IWFA 1JOFA 3C75H 2H6QA 2VDMB 2CO0A 3DSMA 3I7KA 4CY2A 4UI9R 3EI3A 5AJAA 4J82A 1U4CA 5HYNB 3VH0A 4E5ZA 3ULEC 2XYIA 3JPXA 1R5MA 4R7AB 4WK0B 2I0RA 4YVDA 3OL2A 4BL0A 4J73A 2HJ4A 4X63B 3L4OD 4A08B 4D6VA 5K19A 4PSWB 4EWRA 4Z7QB 4PBZA 5EMLB 4PXWA 4MK0B 3W15A 3V9FA 4JXMA 1GG2B 2HESX 3E0CA 1YFQA 3EI4A 5FKSA 4U1EI 3JAMg 3UKUC 2H6NA 1P22A 2I3TA 3EI2A 4A11B 3MZKA 2Z2PA 4U7AA 3VGZA 3IJ1A 3P4FA 3UVNA 4J81A 4G56B 4ESGA 4TZ4A 3SJLD 4Z7OB 5A2Qg 1B9YA 2GNQA 3VI3B 1TBGA 2J56H 4CZXA 5TEFA 4AEZA 5FKTA 5EALA 4IMMA 5C2WB 2AGWA 2AGXA 3BG1A 3PXWD 3EI4B 3JB9L 3OW8A 2IWKA 4GM9A 4A7JA 2XL3A 3EI2B 5IT9g 3A0FA 4QT8A 3JRPA 2HKRA 4GQ2P 4E54B 3DXKC 1ERJA 3EU7A 3ZDYB 3GREA 4OWRA 5IGOA 1Q47A 4CI2A 5FKQA 3RFGA 4BUJC 2IUVA 2VDLB 4CI3A 2HYEA 4O9DA 2VDPB 3F3FA 3OKTA 4FAND 3I7HA 4UM9B 4ZOVA 1NEXB 2OVPB 4FA5D 3IIWA 3CIKB 3I7LA 5E6RB 5EMKB 2IURA 4JSXC 3N0DA 1SHYB 2YMUA 4CY1A 2HKMA 3EG6A 2TRCB 3RMZD 1N6EA 4WJKB 3I2NA 3IIYA 4K3ID 3FGBA 1OLZA 4CZYA 3FCUB 2H9MA 3VA6A 3NIGB 3PXSD 2JWGA 2IAAA 3MXXA 2B5LA 2QXVA 2I0SA 4WK4B 3UKRC 3SCYA 4GM8A 3SWSD 2H9LA 2J57G 3T3PB 3NVNA 5SXMA 5AMSA 3MKQA 5IC7A 4A08A 3T3MB 4Y5RD 4CI1A 3EI1A 4ES0A 3SBQA 2J55H 3NIDB 2B5MA 4H5IA 5FA5B 4PNKB 1TYEB 4Z7NB 1JJUB 2PBIB 4X3EA 2BCJB 5E6UB 2P9LC 3B7FA 3SN6B 1QNIA 3C5MA 2P9NC 4J0WA 4FA9D 3CFSB 2PM9A 2AGLA 5IGQA 4A11A 4ERZA 5KDOB 4K3JB 2VDKB 4FA4D 2IUQA 3KRWB 3EI1B 5FLXg 1NR0A 5CYKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J77 A;  2CE8 A;  3RN0 D;  4GQB B;  3IJC A;  4JSV C;  2VDN B;  1JMZ B;  5I5I A;  4NSX A;  4QRJ A;  3RRM C;  2PM9 B;  3AFC A;  2EBS A;  4X60 B;  5EMM B;  1SSL A;  1U8C B;  3FM0 A;  4D0K A;  2P9S C;  4A0B A;  5H17 A;  2Z2N A;  4E54 A;  2H9P A;  3MZL A;  2I0T A;  5E6S B;  1N6D A;  4H5J A;  2OVQ B;  3EMH A;  1FWX A;  1U2V C;  3NVQ A;  5CYK B;  3RFH A;  3U4Y A;  2UZY B;  5GMK n;  3OKW A;  2P26 A;  2W18 A;  1B9X A;  5EMJ B;  4JD2 C;  1K32 A;  2P28 A;  3PVW B;  2XU7 A;  3K27 A;  3MMY A;  1JMX B;  4JSN C;  3ZDX B;  4LG8 A;  4QL1 A;  4Z8L A;  4L1Q D;  1GOT B;  4A0B B;  2OVR B;  2PM6 B;  1PGU A;  5TEE A;  4CI8 A;  5CXC A;  4ZN4 A;  4J78 A;  5EAR A;  4XEI C;  3SXT D;  3I8C A;  4J8G A;  3JZG A;  4L3G D;  4ZOY A;  5GXH A;  1VYH C;  5JWZ A;  3SBR A;  4A2M A;  5C2V B;  5IJ8 E;  2H47 A;  1A0R B;  3J80 g;  3ORV D;  3DXM C;  5TDH B;  3JZN A;  4FHL A;  1PI6 A;  4L3H D;  3I7P A;  3NIF B;  2BBK H;  5CXC B;  2H6K A;  2VDO B;  3FRX A;  2P9U C;  3ZE1 B;  2B5N A;  4XYI A;  2MTA H;  3SVW D;  3SHF A;  5EAP A;  2GC7 A;  3J81 g;  3I8E A;  2P9I C;  3I7O A;  3ZWL B;  3UVL A;  4GGC A;  3PSC B;  4BH6 A;  4GM3 A;  5HE0 B;  5K1C C;  3NVX A;  4O1Q D;  4A09 A;  2H13 A;  4CY3 A;  4GGA A;  2OIZ A;  1TYQ C;  4A2L A;  4IA9 A;  5HDB B;  5H14 A;  1L0Q A;  3BG0 A;  5HE1 B;  4J8B A;  3UVO A;  5AFU 3;  5TF2 A;  4UM8 B;  2CE9 A;  5H1M A;  2AQ5 A;  4N14 A;  3MKS B;  2H68 A;  1PEV A;  3HFQ A;  3K26 A;  4JSP C;  4A09 B;  3PE7 A;  3SMR A;  2VC2 B;  3UR4 A;  3I7N A;  4GQ1 A;  3N0E A;  5FKR A;  4PSX B;  2IUP A;  3C99 A;  4GGD A;  4GZ8 A;  3ZDZ B;  1MG3 A;  4XYH A;  3I89 A;  1OMW B;  5EM2 A;  2G99 A;  1XHM A;  3L4M D;  2GC4 A;  4J79 A;  3UVM A;  5CXB A;  4PC0 A;  2HJB A;  2YBA A;  4CY5 A;  2O9K A;  3F3P A;  2CN3 A;  2YNO A;  3IJ0 A;  1S4U X;  2Q7Q A;  3RLM D;  2VDQ B;  2AGY A;  3AL9 A;  1MDA H;  2AGZ A;  3SFZ A;  2CNX A;  2OK4 A;  4ZOX A;  1RI6 A;  4ERQ A;  3JRO A;  2XL2 A;  5EM2 B;  5C9Z B;  5GXI A;  2YB8 B;  1XKS A;  3AH8 B;  2AH0 A;  3EI3 B;  3DWL C;  3SBP A;  3ZE2 B;  4O3T B;  5HE3 B;  2HXC A;  1GXR A;  4ZOZ A;  3VI4 B;  4E5Z B;  1PBY B;  3KRX B;  3F3G A;  4KFM B;  5CXB B;  3OL2 B;  3AL8 A;  4GMB A;  4CC9 A;  2UZX B;  2AH1 A;  4HDJ A;  2I3S A;  5B4W A;  4WK2 B;  3OKY A;  3ZE0 B;  4QQE A;  5I5M A;  2CN2 A;  4FA1 D;  4PBY A;  4UM9 D;  4X61 B;  4CZV A;  5EAM A;  4A0A A;  4J0X A;  4O3U B;  4J84 A;  2QC5 A;  4L9O A;  3V5W B;  3C9C A;  5HQG A;  3ODT A;  1MG2 A;  3UVK A;  4FAV D;  3SLE D;  3PVU B;  1SQJ A;  2PM7 B;  3AL8 B;  1N6F A;  2CO0 C;  4OZU A;  1YUK A;  3OKY B;  4FB1 D;  4LGN A;  4J86 A;  2H14 A;  4JT6 C;  3DM0 A;  3RSE C;  4A0A B;  2OJY A;  2H9N A;  4LG9 A;  3IKO A;  3V7D B;  2OK6 A;  3PXT D;  3JZH A;  4ERY A;  2YNP A;  2H3X A;  4Y7R A;  1SQ9 A;  3BWS A;  4J87 A;  5FQD A;  2Z2O A;  5FXY A;  5THA A;  3EWE A;  3OTT A;  5GSA A;  4FWW A;  2B4E A;  3PSL A;  5I5J A;  4AOW A;  3GFC A;  2G9A A;  2YNN A;  5IJ7 E;  1K8K C;  2P9K C;  3CFV A;  4JT5 C;  4I79 A;  5HE2 B;  3RN1 D;  2P9P C;  4O45 A;  2VDR B;  1XIP A;  1GP2 B;  2IWF A;  1JOF A;  3C75 H;  2H6Q A;  2VDM B;  2CO0 A;  3DSM A;  3I7K A;  4CY2 A;  4UI9 R;  3EI3 A;  5AJA A;  4J82 A;  1U4C A;  5HYN B;  3VH0 A;  4E5Z A;  3ULE C;  2XYI A;  3JPX A;  1R5M A;  4R7A B;  4WK0 B;  2I0R A;  4YVD A;  3OL2 A;  4BL0 A;  4J73 A;  2HJ4 A;  4X63 B;  3L4O D;  4A08 B;  4D6V A;  5K19 A;  4PSW B;  4EWR A;  4Z7Q B;  4PBZ A;  5EML B;  4PXW A;  4MK0 B;  3W15 A;  3V9F A;  4JXM A;  1GG2 B;  2HES X;  3E0C A;  1YFQ A;  3EI4 A;  5FKS A;  4U1E I;  3JAM g;  3UKU C;  2H6N A;  1P22 A;  2I3T A;  3EI2 A;  4A11 B;  3MZK A;  2Z2P A;  4U7A A;  3VGZ A;  3IJ1 A;  3P4F A;  3UVN A;  4J81 A;  4G56 B;  4ESG A;  4TZ4 A;  3SJL D;  4Z7O B;  5A2Q g;  1B9Y A;  2GNQ A;  3VI3 B;  1TBG A;  2J56 H;  4CZX A;  5TEF A;  4AEZ A;  5FKT A;  5EAL A;  4IMM A;  5C2W B;  2AGW A;  2AGX A;  3BG1 A;  3PXW D;  3EI4 B;  3JB9 L;  3OW8 A;  2IWK A;  4GM9 A;  4A7J A;  2XL3 A;  3EI2 B;  5IT9 g;  3A0F A;  4QT8 A;  3JRP A;  2HKR A;  4GQ2 P;  4E54 B;  3DXK C;  1ERJ A;  3EU7 A;  3ZDY B;  3GRE A;  4OWR A;  5IGO A;  1Q47 A;  4CI2 A;  5FKQ A;  3RFG A;  4BUJ C;  2IUV A;  2VDL B;  4CI3 A;  2HYE A;  4O9D A;  2VDP B;  3F3F A;  3OKT A;  4FAN D;  3I7H A;  4UM9 B;  4ZOV A;  1NEX B;  2OVP B;  4FA5 D;  3IIW A;  3CIK B;  3I7L A;  5E6R B;  5EMK B;  2IUR A;  4JSX C;  3N0D A;  1SHY B;  2YMU A;  4CY1 A;  2HKM A;  3EG6 A;  2TRC B;  3RMZ D;  1N6E A;  4WJK B;  3I2N A;  3IIY A;  4K3I D;  3FGB A;  1OLZ A;  4CZY A;  3FCU B;  2H9M A;  3VA6 A;  3NIG B;  3PXS D;  2IAA A;  3MXX A;  2B5L A;  2QXV A;  2I0S A;  4WK4 B;  3UKR C;  3SCY A;  4GM8 A;  3SWS D;  2H9L A;  2J57 G;  3T3P B;  3NVN A;  5SXM A;  5AMS A;  3MKQ A;  5IC7 A;  4A08 A;  3T3M B;  4Y5R D;  4CI1 A;  3EI1 A;  4ES0 A;  3SBQ A;  2J55 H;  3NID B;  2B5M A;  4H5I A;  5FA5 B;  4PNK B;  1TYE B;  4Z7N B;  1JJU B;  2PBI B;  4X3E A;  2BCJ B;  5E6U B;  2P9L C;  3B7F A;  3SN6 B;  1QNI A;  3C5M A;  2P9N C;  4J0W A;  4FA9 D;  3CFS B;  2PM9 A;  2AGL A;  5IGQ A;  4A11 A;  4ERZ A;  5KDO B;  4K3J B;  2VDK B;  4FA4 D;  2IUQ A;  3KRW B;  3EI1 B;  5FLX g;  1NR0 A;  5CYK A; 
#chains in the Genus database with same CATH topology
 4J77 A;  2CE8 A;  3RN0 D;  4GQB B;  3IJC A;  4JSV C;  2VDN B;  1JMZ B;  5I5I A;  3IJE A;  4NSX A;  4QRJ A;  2BKL A;  4DNW A;  3RRM C;  2PM9 B;  3AFC A;  2EBS A;  4X60 B;  5EMM B;  1SSL A;  1U8C B;  3FM0 A;  4D0K A;  2EIC A;  2P9S C;  4A0B A;  5H17 A;  2Z2N A;  4E54 A;  2H9P A;  3MZL A;  2I0T A;  5E6S B;  1N6D A;  3ZDY A;  4H5J A;  2OVQ B;  3EMH A;  1FWX A;  1U2V C;  3NVQ A;  5CYK B;  3RFH A;  3U4Y A;  2UZY B;  2XDW A;  5GMK n;  3OKW A;  1BPO A;  2VDL A;  2P26 A;  2W18 A;  3O4I A;  1B9X A;  1JTD B;  5EMJ B;  4JD2 C;  1K32 A;  2P28 A;  3PVW B;  2XU7 A;  3EQ7 A;  1I2M B;  3K27 A;  3MMY A;  1JMX B;  4JSN C;  3ZDX B;  5E6R A;  4LG8 A;  4QL1 A;  3EQ9 A;  4Z8L A;  4L1Q D;  1GOT B;  4A0B B;  2OVR B;  2PM6 B;  1PGU A;  1QFS A;  5TEE A;  5FFG A;  4CI8 A;  5CXC A;  4ZN4 A;  2JWH A;  4J78 A;  4AMY A;  4WJK A;  5EAR A;  1UTC A;  1GOF A;  3IVM A;  3ZE1 A;  4XEI C;  2VZ1 A;  3FCU A;  3SXT D;  3I8C A;  4J8G A;  1K3I A;  1UOO A;  2EID A;  3JZG A;  4L3G D;  4ZOY A;  5GXH A;  1VYH C;  5JWZ A;  3SBR A;  4A2M A;  5C2V B;  4G1M A;  5IJ8 E;  2H47 A;  1A0R B;  3J80 g;  3ORV D;  3DXM C;  4O02 A;  3JZN A;  5TDH B;  4FHL A;  1PI6 A;  4L3H D;  3I7P A;  3NIF B;  5HDB A;  2BBK H;  5CXC B;  2H6K A;  2VDO B;  3FRX A;  2P9U C;  3ZE1 B;  2B5N A;  4XYI A;  2MTA H;  3SVW D;  3SHF A;  5EAP A;  3NID A;  2GC7 A;  4DNU A;  3J81 g;  4MMZ A;  3I8E A;  4UM8 A;  5FFO A;  2P9I C;  3I7O A;  3ZWL B;  3UVL A;  4GGC A;  3PSC B;  5E6U A;  2QR5 A;  4GM3 A;  4BH6 A;  4BCC A;  5HE0 B;  1L5G A;  5K1C C;  3NVX A;  4O1Q D;  4A09 A;  2H13 A;  4CY3 A;  2VC2 A;  3MUO A;  4GGA A;  2OIZ A;  2VDK A;  1TYQ C;  3K71 A;  4A2L A;  4IA9 A;  5HDB B;  5H14 A;  1L0Q A;  1H2Y A;  3BG0 A;  5HE1 B;  1E8N A;  4J8B A;  3IUQ A;  3UVO A;  5M5V A;  5AFU 3;  1QFM A;  5TF2 A;  4UM8 B;  2CE9 A;  4BP8 A;  5H1M A;  2AQ5 A;  4N14 A;  3IUJ A;  3MKS B;  2H68 A;  1PEV A;  3HFQ A;  3K26 A;  4JSP C;  3MVD K;  4A09 B;  3PE7 A;  3SMR A;  2VC2 B;  4QAM A;  3UR4 A;  3I7N A;  4GQ1 A;  1U8C A;  3N0E A;  5FKR A;  4PSX B;  2IUP A;  3C99 A;  1O6G A;  1UOP A;  4GGD A;  4GZ8 A;  2XE4 A;  3ZDZ B;  1MG3 A;  1T2X A;  4XYH A;  4BP9 A;  3I89 A;  1OMW B;  5EM2 A;  5M5T A;  1YR2 A;  2G99 A;  1XHM A;  3L4M D;  4AN1 A;  2GC4 A;  3ZE2 A;  4J79 A;  3GD1 I;  3VI4 A;  3UVM A;  4RE6 A;  5CXB A;  4PC0 A;  2HJB A;  2YBA A;  4CY5 A;  3ZDX A;  2O9K A;  3F3P A;  2CN3 A;  2YNO A;  3IJ0 A;  1S4U X;  2Q7Q A;  5M61 A;  3RLM D;  2VDQ B;  2AGY A;  1E8M A;  3AL9 A;  4WK2 A;  1MDA H;  2AGZ A;  3SFZ A;  3ZE0 A;  2CNX A;  2OK4 A;  4ZOX A;  1RI6 A;  4ERQ A;  3JRO A;  4IRZ A;  2XL2 A;  5EM2 B;  5C9Z B;  5GXI A;  2YB8 B;  1XKS A;  3AH8 B;  2AH0 A;  3EI3 B;  3FCS A;  3EQ8 A;  3DWL C;  3SBP A;  3ZE2 B;  4O3T B;  5HE3 B;  2HXC A;  1GXR A;  4ZOZ A;  3VI4 B;  4E5Z B;  1PBY B;  3KRX B;  3F3G A;  4KFM B;  5CXB B;  3OL2 B;  1E5T A;  3AL8 A;  4GMB A;  4CC9 A;  2UZX B;  2AH1 A;  3NIF A;  4HDJ A;  2I3S A;  5B4W A;  4O2W A;  4WK2 B;  2VDO A;  3OKY A;  3ZE0 B;  4QQE A;  5I5M A;  2CN2 A;  4FA1 D;  4PBY A;  4UM9 D;  4X61 B;  3O4H A;  4CZV A;  1H2X A;  2QZP A;  5EAM A;  4J0X A;  4A0A A;  4O3U B;  4J84 A;  2QC5 A;  4L9O A;  3V5W B;  3C9C A;  5HQG A;  3ODT A;  1MG2 A;  3UVK A;  4FAV D;  3SLE D;  3PVU B;  1SQJ A;  2PM7 B;  4G55 A;  3AL8 B;  1N6F A;  4RE5 A;  2CO0 C;  4OZU A;  1YUK A;  3OKY B;  4FB1 D;  1H2Z A;  2XZG A;  4LGN A;  4J86 A;  2H14 A;  4JT6 C;  3DM0 A;  3RSE C;  4A0A B;  2OJY A;  2H9N A;  4LG9 A;  3IKO A;  3V4P A;  3V7D B;  3GC3 B;  2OK6 A;  5M5R A;  3PXT D;  3JZH A;  4ERY A;  4AX4 A;  4NEN A;  5C86 A;  2EIB A;  2YNP A;  2H3X A;  4Y7R A;  1SQ9 A;  3BWS A;  4J87 A;  2VDR A;  5FQD A;  2Z2O A;  5FXY A;  5THA A;  3EWE A;  3OTT A;  2VDM A;  5GSA A;  5C92 A;  3O4J A;  4FWW A;  2B4E A;  3PSL A;  3ZDZ A;  5I5J A;  4AOW A;  3KCI A;  3GFC A;  1VE7 A;  2G9A A;  2JKX A;  4AMZ A;  3QHY B;  1VE6 A;  2YNN A;  5IJ7 E;  1K8K C;  2P9K C;  3CFV A;  1C9L A;  4JT5 C;  4I79 A;  5HE2 B;  3RN1 D;  4WK0 A;  2P9P C;  3O4G A;  4O45 A;  2VDR B;  1XIP A;  1GP2 B;  2IWF A;  1JOF A;  2VDQ A;  3C75 H;  2H6Q A;  2VDM B;  2CO0 A;  3DSM A;  2VZ3 A;  3I7K A;  3QI0 A;  4NBM A;  1O6F A;  4CY2 A;  4DNV A;  4UI9 R;  3EI3 A;  5AJA A;  3IUM A;  4J82 A;  1U4C A;  4JHP C;  5HYN B;  3VH0 A;  4E5Z A;  3ULE C;  2XYI A;  3JPX A;  1R5M A;  4R7A B;  4WK0 B;  2I0R A;  4YVD A;  3OL2 A;  4BL0 A;  4J73 A;  4NAA A;  2HU8 A;  2HJ4 A;  4X63 B;  3L4O D;  4A08 B;  4D6V A;  5K19 A;  4PSW B;  4EWR A;  4Z7Q B;  4PBZ A;  5EML B;  4PXW A;  3K6S A;  4MK0 B;  3W15 A;  3V9F A;  4JXM A;  1GG2 B;  5M5U A;  2HES X;  3E0C A;  4MMX A;  1H2W A;  1YFQ A;  3EI4 A;  5FKS A;  4U1E I;  3IUR A;  3JAM g;  1GOH A;  3UKU C;  2H6N A;  1P22 A;  2I3T A;  3EI2 A;  1M1X A;  4A11 B;  4BCD A;  3MZK A;  2Z2P A;  4U7A A;  3VGZ A;  3IJ1 A;  3P4F A;  3UVN A;  4J81 A;  4G56 B;  4ESG A;  4TZ4 A;  4AN0 A;  3SJL D;  2HU7 A;  5A2Q g;  4Z7O B;  1B9Y A;  2GNQ A;  3VI3 B;  1TBG A;  2J56 H;  4CZX A;  5TEF A;  4AEZ A;  5FKT A;  5EAL A;  4IMM A;  2HU5 A;  5C2W B;  2VDP A;  1C9I A;  3IUL A;  2AGW A;  2AGX A;  4D9S A;  4UM9 A;  3BG1 A;  3PXW D;  3EI4 B;  3JB9 L;  3OW8 A;  2IWK A;  4GM9 A;  4A7J A;  2XL3 A;  3EI2 B;  5IT9 g;  3A0F A;  4QT8 A;  3JRP A;  2HKR A;  4GQ2 P;  4E54 B;  4BCB A;  3DXK C;  1ERJ A;  3EU7 A;  1A12 A;  3GRE A;  4OWR A;  5IGO A;  3ZDY B;  1Q47 A;  4CI2 A;  5FKQ A;  1JV2 A;  3RFG A;  4BUJ C;  2IUV A;  1VZ3 A;  3NIG A;  4CI3 A;  2VDL B;  2EIE A;  4O9D A;  2HYE A;  3F3F A;  2VDP B;  4NC4 A;  1VZ2 A;  3OKT A;  4MMY A;  4FAN D;  3I7H A;  4UM9 B;  4ZOV A;  1UOQ A;  1NEX B;  4WK4 A;  2OVP B;  3V4V A;  4FA5 D;  3IIW A;  3CIK B;  3I7L A;  5E6R B;  3T3P A;  5EMK B;  4L1M A;  2IUR A;  4JSX C;  3N0D A;  1SHY B;  2YMU A;  4CY1 A;  2HKM A;  3EG6 A;  2TRC B;  3RMZ D;  3T3M A;  1N6E A;  4WJK B;  3I2N A;  3IIY A;  4K3I D;  3FGB A;  3MUN A;  1OLZ A;  4CZY A;  3FCU B;  2H9M A;  3VA6 A;  3NIG B;  3PXS D;  2JWG A;  2IAA A;  1TYE A;  3MXX A;  4Z7N A;  2B5L A;  2QXV A;  2I0S A;  4WK4 B;  3UKR C;  1GOG A;  3SCY A;  4GM8 A;  3SWS D;  2H9L A;  2J57 G;  3T3P B;  3NVN A;  5SXM A;  5AMS A;  3MKQ A;  5IC7 A;  3IUN A;  4JHN A;  4A08 A;  3T3M B;  4Y5R D;  4CI1 A;  3EI1 A;  4ES0 A;  3K72 A;  3SBQ A;  4Z7Q A;  2J55 H;  4G1E A;  3NID B;  2B5M A;  4H5I A;  5FA5 B;  4PNK B;  5M5S A;  1TYE B;  4Z7N B;  2WQ8 A;  1JJU B;  2PBI B;  4X3E A;  2BCJ B;  2VDN A;  5E6U B;  2P9L C;  3B7F A;  3DDU A;  3SN6 B;  1QNI A;  3C5M A;  2P9N C;  4J0W A;  4FA9 D;  3CFS B;  2PM9 A;  2AGL A;  5IGQ A;  3OF7 A;  4A11 A;  4ERZ A;  5KDO B;  4K3J B;  2VDK B;  5E6S A;  4Z7O A;  4FA4 D;  2IUQ A;  3KRW B;  3EI1 B;  3VI3 A;  5FLX g;  1NR0 A;  5CYK A; 
#chains in the Genus database with same CATH homology
 4J77 A;  2CE8 A;  3RN0 D;  4GQB B;  3IJC A;  4JSV C;  2VDN B;  1JMZ B;  5I5I A;  4NSX A;  4QRJ A;  3RRM C;  2PM9 B;  3AFC A;  2EBS A;  4X60 B;  5EMM B;  1SSL A;  1U8C B;  3FM0 A;  4D0K A;  2P9S C;  4A0B A;  5H17 A;  2Z2N A;  4E54 A;  2H9P A;  3MZL A;  2I0T A;  5E6S B;  1N6D A;  4H5J A;  2OVQ B;  3EMH A;  1FWX A;  1U2V C;  3NVQ A;  5CYK B;  3RFH A;  3U4Y A;  2UZY B;  5GMK n;  3OKW A;  2P26 A;  2W18 A;  1B9X A;  5EMJ B;  4JD2 C;  1K32 A;  2P28 A;  3PVW B;  2XU7 A;  3K27 A;  3MMY A;  1JMX B;  4JSN C;  3ZDX B;  4LG8 A;  4QL1 A;  4Z8L A;  4L1Q D;  1GOT B;  4A0B B;  2OVR B;  2PM6 B;  1PGU A;  5TEE A;  4CI8 A;  5CXC A;  4ZN4 A;  2JWH A;  4J78 A;  5EAR A;  4XEI C;  3SXT D;  3I8C A;  4J8G A;  3JZG A;  4L3G D;  4ZOY A;  5GXH A;  1VYH C;  5JWZ A;  3SBR A;  4A2M A;  5C2V B;  5IJ8 E;  2H47 A;  1A0R B;  3J80 g;  3ORV D;  3DXM C;  5TDH B;  3JZN A;  4FHL A;  1PI6 A;  4L3H D;  3I7P A;  3NIF B;  2BBK H;  5CXC B;  2H6K A;  2VDO B;  3FRX A;  2P9U C;  3ZE1 B;  2B5N A;  4XYI A;  2MTA H;  3SVW D;  3SHF A;  5EAP A;  2GC7 A;  3J81 g;  3I8E A;  2P9I C;  3I7O A;  3ZWL B;  3UVL A;  4GGC A;  3PSC B;  4BH6 A;  4GM3 A;  5HE0 B;  5K1C C;  3NVX A;  4O1Q D;  4A09 A;  2H13 A;  4CY3 A;  4GGA A;  2OIZ A;  1TYQ C;  4A2L A;  4IA9 A;  5HDB B;  5H14 A;  1L0Q A;  3BG0 A;  5HE1 B;  4J8B A;  3UVO A;  5AFU 3;  5TF2 A;  4UM8 B;  2CE9 A;  5H1M A;  2AQ5 A;  4N14 A;  3MKS B;  2H68 A;  1PEV A;  3HFQ A;  3K26 A;  4JSP C;  4A09 B;  3PE7 A;  3SMR A;  2VC2 B;  3UR4 A;  3I7N A;  4GQ1 A;  3N0E A;  5FKR A;  4PSX B;  2IUP A;  3C99 A;  4GGD A;  4GZ8 A;  3ZDZ B;  1MG3 A;  4XYH A;  3I89 A;  1OMW B;  5EM2 A;  2G99 A;  1XHM A;  3L4M D;  2GC4 A;  4J79 A;  3UVM A;  5CXB A;  4PC0 A;  2HJB A;  2YBA A;  4CY5 A;  2O9K A;  3F3P A;  2CN3 A;  2YNO A;  3IJ0 A;  1S4U X;  2Q7Q A;  3RLM D;  2VDQ B;  2AGY A;  3AL9 A;  1MDA H;  2AGZ A;  3SFZ A;  2CNX A;  2OK4 A;  4ZOX A;  1RI6 A;  4ERQ A;  3JRO A;  2XL2 A;  5EM2 B;  5C9Z B;  5GXI A;  2YB8 B;  1XKS A;  3AH8 B;  2AH0 A;  3EI3 B;  3DWL C;  3SBP A;  3ZE2 B;  4O3T B;  5HE3 B;  2HXC A;  1GXR A;  4ZOZ A;  3VI4 B;  4E5Z B;  1PBY B;  3KRX B;  3F3G A;  4KFM B;  5CXB B;  3OL2 B;  3AL8 A;  4GMB A;  4CC9 A;  2UZX B;  2AH1 A;  4HDJ A;  2I3S A;  5B4W A;  4WK2 B;  3OKY A;  3ZE0 B;  4QQE A;  5I5M A;  2CN2 A;  4FA1 D;  4PBY A;  4UM9 D;  4X61 B;  4CZV A;  5EAM A;  4A0A A;  4J0X A;  4O3U B;  4J84 A;  2QC5 A;  4L9O A;  3V5W B;  3C9C A;  5HQG A;  3ODT A;  1MG2 A;  3UVK A;  4FAV D;  3SLE D;  3PVU B;  1SQJ A;  2PM7 B;  3AL8 B;  1N6F A;  2CO0 C;  4OZU A;  1YUK A;  3OKY B;  4FB1 D;  4LGN A;  4J86 A;  2H14 A;  4JT6 C;  3DM0 A;  3RSE C;  4A0A B;  2OJY A;  2H9N A;  4LG9 A;  3IKO A;  3V7D B;  2OK6 A;  3PXT D;  3JZH A;  4ERY A;  2YNP A;  2H3X A;  4Y7R A;  1SQ9 A;  3BWS A;  4J87 A;  5FQD A;  2Z2O A;  5FXY A;  5THA A;  3EWE A;  3OTT A;  5GSA A;  4FWW A;  2B4E A;  3PSL A;  5I5J A;  4AOW A;  3GFC A;  2G9A A;  2YNN A;  5IJ7 E;  1K8K C;  2P9K C;  3CFV A;  4JT5 C;  4I79 A;  5HE2 B;  3RN1 D;  2P9P C;  4O45 A;  2VDR B;  1XIP A;  1GP2 B;  2IWF A;  1JOF A;  3C75 H;  2H6Q A;  2VDM B;  2CO0 A;  3DSM A;  3I7K A;  4CY2 A;  4UI9 R;  3EI3 A;  5AJA A;  4J82 A;  1U4C A;  5HYN B;  3VH0 A;  4E5Z A;  3ULE C;  2XYI A;  3JPX A;  1R5M A;  4R7A B;  4WK0 B;  2I0R A;  4YVD A;  3OL2 A;  4BL0 A;  4J73 A;  2HJ4 A;  4X63 B;  3L4O D;  4A08 B;  4D6V A;  5K19 A;  4PSW B;  4EWR A;  4Z7Q B;  4PBZ A;  5EML B;  4PXW A;  4MK0 B;  3W15 A;  3V9F A;  4JXM A;  1GG2 B;  2HES X;  3E0C A;  1YFQ A;  3EI4 A;  5FKS A;  4U1E I;  3JAM g;  3UKU C;  2H6N A;  1P22 A;  2I3T A;  3EI2 A;  4A11 B;  3MZK A;  2Z2P A;  4U7A A;  3VGZ A;  3IJ1 A;  3P4F A;  3UVN A;  4J81 A;  4G56 B;  4ESG A;  4TZ4 A;  3SJL D;  4Z7O B;  5A2Q g;  1B9Y A;  2GNQ A;  3VI3 B;  1TBG A;  2J56 H;  4CZX A;  5TEF A;  4AEZ A;  5FKT A;  5EAL A;  4IMM A;  5C2W B;  2AGW A;  2AGX A;  3BG1 A;  3PXW D;  3EI4 B;  3JB9 L;  3OW8 A;  2IWK A;  4GM9 A;  4A7J A;  2XL3 A;  3EI2 B;  5IT9 g;  3A0F A;  4QT8 A;  3JRP A;  2HKR A;  4GQ2 P;  4E54 B;  3DXK C;  1ERJ A;  3EU7 A;  3ZDY B;  3GRE A;  4OWR A;  5IGO A;  1Q47 A;  4CI2 A;  5FKQ A;  3RFG A;  4BUJ C;  2IUV A;  2VDL B;  4CI3 A;  2HYE A;  4O9D A;  2VDP B;  3F3F A;  3OKT A;  4FAN D;  3I7H A;  4UM9 B;  4ZOV A;  1NEX B;  2OVP B;  4FA5 D;  3IIW A;  3CIK B;  3I7L A;  5E6R B;  5EMK B;  2IUR A;  4JSX C;  3N0D A;  1SHY B;  2YMU A;  4CY1 A;  2HKM A;  3EG6 A;  2TRC B;  3RMZ D;  1N6E A;  4WJK B;  3I2N A;  3IIY A;  4K3I D;  3FGB A;  1OLZ A;  4CZY A;  3FCU B;  2H9M A;  3VA6 A;  3NIG B;  3PXS D;  2JWG A;  2IAA A;  3MXX A;  2B5L A;  2QXV A;  2I0S A;  4WK4 B;  3UKR C;  3SCY A;  4GM8 A;  3SWS D;  2H9L A;  2J57 G;  3T3P B;  3NVN A;  5SXM A;  5AMS A;  3MKQ A;  5IC7 A;  4A08 A;  3T3M B;  4Y5R D;  4CI1 A;  3EI1 A;  4ES0 A;  3SBQ A;  2J55 H;  3NID B;  2B5M A;  4H5I A;  5FA5 B;  4PNK B;  1TYE B;  4Z7N B;  1JJU B;  2PBI B;  4X3E A;  2BCJ B;  5E6U B;  2P9L C;  3B7F A;  3SN6 B;  1QNI A;  3C5M A;  2P9N C;  4J0W A;  4FA9 D;  3CFS B;  2PM9 A;  2AGL A;  5IGQ A;  4A11 A;  4ERZ A;  5KDO B;  4K3J B;  2VDK B;  4FA4 D;  2IUQ A;  3KRW B;  3EI1 B;  5FLX g;  1NR0 A;  5CYK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...