2IURA

Crystal structure of n-quinol form of aromatic amine dehydrogenase (aadh) from alcaligenes faecalis, form a cocrystal
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
360
structure length
360
Chain Sequence
b'REVLTGGHSVSAPQENRIYVMDSVFMHLTESRVHVYDYTNGKFLGMVPTAFNGHVQVSNDGKKIYTMTTYHERITRGKRSDVVEVWDADKLTFEKEISLPPKRVQGLNYDGLFRQTTDGKFIVLQNASPATSIGIVDVAKGDYVEDVTAAAGCWSVIPQPNRPRSFMTICGDGGLLTINLGEDGKVASQSRSKQMFSVKDDPIFIAPALDKDKAHFVSYYGNVYSADFSGDEVKVDGPWSLLNDEDKAKNWVPGGYNLVGLHRASGRMYVFMHPDGKEGTHKFPAAEIWVMDTKTKQRVARIPGRDALSMTIDQQRNLMLTLDGGNVNVYDISQPEPKLLRTIEGAAEASLQVQFHPVGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AROMATIC AMINE DEHYDROGENASE ALPHA SUBUNIT
publication title Atomic Level Insight Into the Oxidative Half-Reaction of Aromatic Amine Dehydrogenase.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 96
structure length 360
sequence length 360
chains with identical sequence B
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2006-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2iurA01
2IUVA 1K32A 3OL2A 3EMHA 2P9SC 3K26A 1SQJA 3DXMC 2HKMA 5H14A 1QNIA 3OL2B 4UI9R 4CY1A 2AGZA 4D6VA 4A0AA 3UR4A 4CY3A 1N6EA 3V5WB 2H9NA 3EI2B 2OJYA 4PBZA 4Y7RA 4GZ8A 3IIYA 4A0AB 1PEVA 2HKRA 3SBRA 1MG2A 3I8CA 2BBKH 3PVWB 4IMMA 4O9DA 1TYQC 5CXBA 2OIZA 4O3TB 3SCYA 4A2MA 4H5JA 3RN0D 4ZOXA 3RLMD 1U4CA 4JSPC 4XYHA 4ERYA 5CXBB 4X3EA 3RFGA 3PE7A 5EM2A 1K8KC 3CFVA 3RFHA 2GNQA 4A7JA 3MZKA 3AL9A 3P4FA 4FAVD 2IWKA 2XL2A 2OVQB 3JZGA 5HQGA 5EM2B 4JSVC 3UKUC 2CO0C 4CI2A 2H6NA 2H9LA 2UZXB 4ERQA 3IIWA 5C9ZB 2EBSA 4ERZA 3C9CA 4JSXC 1PGUA 2GC7A 2CO0A 4O1QD 4YVDA 4Y5RD 2YNNA 4K3ID 2OK6A 2P9LC 3I7PA 4A09A 4GMBA 4ESGA 3SVWD 3EG6A 5FLXg 3AL8A 3OKTA 4IA9A 2HJBA 3ULEC 2QC5A 2J56H 5H17A 2TRCB 4J79A 4ES0A 1TBGA 4A09B 4L9OA 2PBIB 5HE3B 3F3PA 4N14A 3AL8B 1JOFA 4XYIA 3IJCA 2PM7B 2IWFA 3W15A 2OVPB 1PBYB 4QL1A 3SXTD 4A08A 3DWLC 5FKRA 4FAND 5I5JA 2XL3A 5CXCA 3L4OD 4GM9A 4A08B 2G9AA 5TF2A 3GREA 3JZHA 3RRMC 3UVOA 2J55H 4A11B 2Z2OA 3C75H 1FWXA 1Q47A 5EAPA 4J8BA 4J73A 3N0DA 1A0RB 5HE1B 1MG3A 3A0FA 2IUPA 4JSNC 5TEFA 1GP2B 4QT8A 3RN1D 4J82A 1N6DA 5HYNB 5FKSA 2YBAA 2P9KC 3PSLA 4J81A 4L3HD 1P22A 4EWRA 3PXSD 5KDOB 2IUQA 5HE2B 1SQ9A 3CFSB 4X63B 3UVKA 3EI2A 2J57G 4PC0A 4U7AA 3SWSD 3C99A 1RI6A 5CYKA 3EI1B 3EWEA 5FKTA 2YMUA 3UVMA 4BH6A 2XU7A 4GGAA 4GGDA 5FQDA 5CYKB 3J80g 3ODTA 5EARA 2AH1A 3SFZA 2H13A 4CY5A 2G99A 4O45A 2I3TA 3OKWA 1OMWB 4CZYA 4JT5C 4PNKB 5K1CC 3I7KA 3JROA 1JMXB 4J84A 4CZXA 2I0SA 3V7DB 2P9UC 2W18A 3SBQA 3HFQA 2HESX 4GM8A 2YB8B 1SHYB 4R7AB 2B5LA 4O3UB 1GXRA 4U1EI 4TZ4A 3MXXA 4XEIC 4Z8LA 5AFU3 5IT9g 5TEEA 3I7LA 2HXCA 3BG1A 3JAMg 2P9IC 2P9NC 3MZLA 1GOTB 5IJ7E 4E5ZA 3DSMA 5EAMA 4PSXB 4AOWA 2YNOA 2CNXA 3EI4A 3F3FA 4OZUA 2B5MA 4LG8A 4E5ZB 4J86A 3AH8B 3OKYB 2AGWA 3I2NA 3PXWD 4PBYA 3EI4B 1XIPA 3F3GA 5AMSA 3J81g 2GC4A 4CC9A 5HE0B 2Z2NA 2I0TA 5SXMA 2CE9A 4J0XA 2Z2PA 4E54B 3IJ0A 1JMZB 2UZYB 3SMRA 5EMJB 2Q7QA 3OW8A 5B4WA 4BL0A 4A11A 2PM9B 1XKSA 3RSEC 3BG0A 3I8EA 3N0EA 4X60B 4LG9A 2H3XA 3FRXA 3E0CA 3ZWLB 3GFCA 4BUJC 3EU7A 3K27A 4ZOZA 4FA5D 1B9XA 5C2WB 5IJ8E 5GXHA 5A2Qg 2CE8A 2QXVA 4GQ2P 5GXIA 3SHFA 3VGZA 3IKOA 2CN2A 4J87A 2AGLA 4GQBB 2B5NA 3IJ1A 4FWWA 3EI1A 3FGBA 1N6FA 2BCJB 3NVNA 5FXYA 3I7OA 4ZOVA 4A2LA 3PSCB 3EI3A 2H14A 3UVLA 5GMKn 4GM3A 4ZOYA 5JWZA 4L3GD 3V9FA 4NSXA 4G56B 3CIKB 3AFCA 4J8GA 3UKRC 2HJ4A 5GSAA 5FKQA 2I0RA 4CI8A 3EI3B 4H5IA 4FHLA 4FA1D 4CI1A 3C5MA 1OLZA 4FB1D 3SLED 3VH0A 4QRJA 3I7HA 1NEXB 5I5MA 4L1QD 4FA9D 5FA5B 3B7FA 4PSWB 4X61B 3NVXA 3JZNA 3SBPA 2HYEA 2AGYA 5AJAA 2O9KA 4ZN4A 2H6KA 5EMLB 3I7NA 3MKSB 4AEZA 1L0QA 4KFMB 4FA4D 4CI3A 3I89A 4J78A 3SN6B 3RMZD 2B4EA 4JD2C 1ERJA 1XHMA 5THAA 3PVUB 5IGQA 3NVQA 3MKQA 2H9MA 5TDHB 4CY2A 2P9PC 4J0WA 2H9PA 2PM6B 1JJUB 3OTTA 2AQ5A 3OKYA 4D0KA 3SJLD 2CN3A 5C2VB 4JXMA 2XYIA 3JRPA 3ORVD 2OK4A 4E54A 2H47A 3PXTD 5K19A 2PM9A 5EMMB 3FM0A 1S4UX 2H68A 2I3SA 2MTAH 4HDJA 3DXKC 4A0BA 3VA6A 3DM0A 1NR0A 5IGOA 2IAAA 4A0BB 2H6QA 4J77A 4CZVA 4QQEA 1MDAH 3U4YA 4GQ1A 1U2VC 3KRXB 3KRWB 4K3JB 5IC7A 4LGNA 1B9YA 3JB9L 5EMKB 5I5IA 4I79A 1GG2B 2YNPA 4OWRA 2OVRB 2AH0A 4PXWA 3MMYA 4JT6C 1YFQA 3L4MD 3BWSA 1VYHC 5CXCB 2IURA 4MK0B 5EALA 1R5MA 5H1MA 1PI6A 4GGCA 2AGXA 3UVNA 3JPXA
chains in the Genus database with same CATH superfamily
2IUVA 1K32A 1K3IA 3EMHA 2P9SC 3OL2A 4WK2A 4DNVA 3K26A 1I2MB 1SQJA 3DXMC 2HKMA 5H14A 1QNIA 4NBMA 3OL2B 4AN0A 4UI9R 5FFOA 4CY1A 2AGZA 4D6VA 4A0AA 3UR4A 3IULA 3V4VA 4CY3A 1N6EA 3V5WB 2H9NA 3EI2B 2OJYA 4PBZA 4Y7RA 4GZ8A 3IIYA 4JHPC 4A0AB 1VE6A 3O4IA 1PEVA 2HKRA 3SBRA 1MG2A 4UM8A 3I8CA 1YR2A 2BBKH 3PVWB 4IMMA 4O9DA 1TYQC 5CXBA 1E5TA 2OIZA 4O3TB 3SCYA 4A2MA 4H5JA 3RN0D 3ZDZA 4ZOXA 1O6FA 3RLMD 1U4CA 4JSPC 4XYHA 3MUOA 2XDWA 4ERYA 5CXBB 4X3EA 3RFGA 3PE7A 1E8MA 5EM2A 1K8KC 3CFVA 3RFHA 2GNQA 4A7JA 3MZKA 3AL9A 4WK4A 3P4FA 4FAVD 2IWKA 2XL2A 1H2WA 2OVQB 3JZGA 5HQGA 5EM2B 4JSVC 3UKUC 4DNWA 3ZE1A 2CO0C 4CI2A 2H6NA 2H9LA 2UZXB 1E8NA 4ERQA 3IIWA 5HDBA 5C9ZB 2EBSA 4DNUA 4ERZA 3C9CA 4JSXC 1PGUA 2WQ8A 4Z7QA 2GC7A 4G1MA 2CO0A 4O1QD 4YVDA 4Y5RD 2YNNA 4K3ID 2OK6A 2VDRA 2P9LC 3I7PA 4A09A 4GMBA 4ESGA 3SVWD 3EG6A 5FLXg 1C9IA 3DDUA 3IUJA 3AL8A 2VDPA 3OKTA 4IA9A 2HJBA 1A12A 3ULEC 2QC5A 3K71A 2J56H 5H17A 2TRCB 4J79A 4ES0A 1TBGA 4A09B 4L9OA 1TYEA 2PBIB 5HE3B 3F3PA 1UOQA 1L5GA 2VDLA 4N14A 3AL8B 1JOFA 4XYIA 3IJCA 4MMZA 2PM7B 2IWFA 3W15A 2OVPB 1PBYB 4QL1A 3SXTD 4A08A 5M5UA 3DWLC 5FKRA 4D9SA 4FAND 3O4GA 5I5JA 4AN1A 5M5TA 2XL3A 5CXCA 3L4OD 4GM9A 4A08B 2G9AA 5TF2A 3GREA 3JZHA 3RRMC 3UVOA 2J55H 4A11B 2Z2OA 3C75H 1FWXA 1Q47A 5EAPA 4J8BA 2HU7A 4J73A 3N0DA 1A0RB 5HE1B 1MG3A 1UTCA 4G55A 3A0FA 2IUPA 4JSNC 5TEFA 1GP2B 4QT8A 3RN1D 4J82A 1N6DA 5HYNB 5FKSA 2YBAA 4UM9A 2P9KC 1GOGA 1QFSA 3EQ7A 3PSLA 4J81A 3MVDK 4L3HD 1P22A 4EWRA 3PXSD 5KDOB 3V4PA 2IUQA 5HE2B 1JTDB 1SQ9A 3CFSB 4X63B 3UVKA 3EI2A 3FCSA 5M61A 2J57G 4PC0A 4U7AA 3SWSD 3C99A 1VE7A 1RI6A 5CYKA 4BP9A 3EI1B 3EWEA 5FKTA 2YMUA 3UVMA 4BH6A 3VI4A 2XU7A 4GGAA 4GGDA 1O6GA 5FQDA 4L1MA 5CYKB 3J80g 3ODTA 5EARA 2AH1A 3IURA 3SFZA 2H13A 4CY5A 2G99A 2JKXA 2I3TA 4O45A 3OKWA 1OMWB 3QI0A 4CZYA 4AMZA 4JT5C 4PNKB 4O2WA 5K1CC 3I7KA 3JROA 1JMXB 4J84A 4CZXA 2EIEA 2I0SA 3V7DB 2P9UC 5M5VA 2VDNA 2W18A 3SBQA 3HFQA 2HESX 4GM8A 2YB8B 1SHYB 4R7AB 1T2XA 2B5LA 4AX4A 4O3UB 1GXRA 4U1EI 4TZ4A 3MXXA 4XEIC 4Z8LA 5AFU3 3O4HA 5IT9g 4WJKA 5TEEA 3I7LA 2HXCA 3BG1A 3JAMg 2P9IC 2P9NC 3IUQA 3MZLA 4BCBA 1VZ2A 3NIFA 3ZE2A 1GOTB 5IJ7E 5FFGA 5C92A 4E5ZA 3DSMA 5EAMA 4PSXB 4AOWA 1QFMA 2YNOA 2CNXA 3EI4A 4NAAA 3F3FA 3NIGA 4OZUA 3T3PA 2B5MA 4LG8A 4E5ZB 4J86A 2VZ3A 3FCUA 3AH8B 3OKYB 2AGWA 1GOFA 3I2NA 3PXWD 4PBYA 2HU5A 3EI4B 1VZ3A 1XIPA 3F3GA 5AMSA 3J81g 2GC4A 4O02A 4CC9A 5HE0B 2QZPA 5E6UA 2Z2NA 2I0TA 4NC4A 5SXMA 2CE9A 4Z7OA 4J0XA 2Z2PA 4E54B 3IJ0A 1JMZB 2UZYB 3SMRA 5EMJB 2Q7QA 3OW8A 5B4WA 4BL0A 4A11A 2PM9B 1XKSA 3RSEC 3BG0A 4MMYA 3I8EA 3N0EA 4X60B 4LG9A 2H3XA 3FRXA 3E0CA 3ZDYA 1GOHA 3ZWLB 3GFCA 4BUJC 4RE6A 3EU7A 3K27A 2EICA 3VI3A 4BCCA 4ZOZA 4FA5D 1B9XA 1H2YA 5C2WB 4RE5A 5IJ8E 3GD1I 5A2Qg 5GXHA 3QHYB 2CE8A 2QXVA 1U8CA 4GQ2P 5GXIA 5M5RA 5E6RA 3SHFA 3VGZA 2XE4A 3IKOA 2CN2A 4J87A 2AGLA 4GQBB 2B5NA 3IJ1A 4FWWA 1H2ZA 3EI1A 3FGBA 1N6FA 2BCJB 3NVNA 5FXYA 2QR5A 3I7OA 4ZOVA 4A2LA 3PSCB 3EI3A 2H14A 1BPOA 2XZGA 3UVLA 1M1XA 4GM3A 4ZOYA 5GMKn 5JWZA 4L3GD 3V9FA 4NSXA 4G56B 3CIKB 2VDQA 3AFCA 4J8GA 2HJ4A 3UKRC 5GSAA 5FKQA 2I0RA 4CI8A 3EI3B 4H5IA 4FHLA 4FA1D 4CI1A 3C5MA 1OLZA 4FB1D 3SLED 3VH0A 4QRJA 3I7HA 1NEXB 5I5MA 2VDKA 3NIDA 3ZE0A 1H2XA 1JV2A 5C86A 4L1QD 4FA9D 5FA5B 3B7FA 4PSWB 4X61B 3NVXA 3JZNA 3O4JA 3SBPA 2HYEA 2AGYA 4QAMA 5AJAA 2O9KA 4ZN4A 2H6KA 5EMLB 3I7NA 3MKSB 4AEZA 1L0QA 4KFMB 4FA4D 4CI3A 3I89A 4J78A 3SN6B 3RMZD 3IUNA 2B4EA 4JD2C 1ERJA 4BP8A 2EIBA 1XHMA 5THAA 3PVUB 2HU8A 5IGQA 3K72A 3MKQA 3NVQA 3T3MA 4AMYA 2H9MA 5TDHB 4CY2A 2P9PC 3ZDXA 1UOOA 4J0WA 2H9PA 2PM6B 1JJUB 3OTTA 2AQ5A 3OKYA 4D0KA 3SJLD 2CN3A 5C2VB 4JXMA 2XYIA 3JRPA 3ORVD 2OK4A 4E54A 1UOPA 2H47A 4NENA 3IUMA 3PXTD 5K19A 2PM9A 5EMMB 3FM0A 1S4UX 2H68A 3KCIA 2I3SA 2MTAH 4HDJA 3DXKC 4A0BA 3GC3B 3MUNA 3VA6A 3DM0A 2BKLA 1NR0A 3IJEA 2VDMA 5IGOA 2IAAA 4JHNA 4A0BB 2H6QA 4J77A 4CZVA 4QQEA 2VDOA 1C9LA 1MDAH 3U4YA 4GQ1A 1U2VC 2VZ1A 3KRXB 4IRZA 3KRWB 3IVMA 4K3JB 5IC7A 5M5SA 4G1EA 4LGNA 5E6SA 3EQ8A 1B9YA 3JB9L 5EMKB 5I5IA 4I79A 1GG2B 2YNPA 4MMXA 4BCDA 4OWRA 2OVRB 4WK0A 2AH0A 4PXWA 4Z7NA 3MMYA 4JT6C 3K6SA 1YFQA 3L4MD 3BWSA 3OF7A 1VYHC 5CXCB 2IURA 3EQ9A 4MK0B 5EALA 1R5MA 5H1MA 1PI6A 4GGCA 2VC2A 2AGXA 2EIDA 3UVNA 3JPXA
chains in the Genus database with same CATH topology
2IUVA 1K32A 3OL2A 3EMHA 2P9SC 3K26A 1SQJA 3DXMC 2HKMA 5H14A 1QNIA 3OL2B 4UI9R 4CY1A 2AGZA 4D6VA 4A0AA 3UR4A 4CY3A 1N6EA 3V5WB 2H9NA 3EI2B 2OJYA 4PBZA 4Y7RA 4GZ8A 3IIYA 4A0AB 1PEVA 2HKRA 3SBRA 1MG2A 3I8CA 2BBKH 3PVWB 4IMMA 4O9DA 1TYQC 5CXBA 2OIZA 4O3TB 3SCYA 4A2MA 4H5JA 3RN0D 4ZOXA 3RLMD 1U4CA 4JSPC 4XYHA 4ERYA 5CXBB 4X3EA 3RFGA 3PE7A 5EM2A 1K8KC 3CFVA 3RFHA 2GNQA 4A7JA 3MZKA 3AL9A 3P4FA 4FAVD 2IWKA 2XL2A 2OVQB 3JZGA 5HQGA 5EM2B 4JSVC 3UKUC 2CO0C 4CI2A 2H6NA 2H9LA 2UZXB 4ERQA 3IIWA 5C9ZB 2EBSA 4ERZA 3C9CA 4JSXC 1PGUA 2GC7A 2CO0A 4O1QD 4YVDA 4Y5RD 2YNNA 4K3ID 2OK6A 2P9LC 3I7PA 4A09A 4GMBA 4ESGA 3SVWD 3EG6A 5FLXg 3AL8A 3OKTA 4IA9A 2HJBA 3ULEC 2QC5A 2J56H 5H17A 2TRCB 4J79A 4ES0A 1TBGA 4A09B 4L9OA 2PBIB 5HE3B 3F3PA 4N14A 3AL8B 1JOFA 4XYIA 3IJCA 2PM7B 2IWFA 3W15A 2OVPB 1PBYB 4QL1A 3SXTD 4A08A 3DWLC 5FKRA 4FAND 5I5JA 2XL3A 5CXCA 3L4OD 4GM9A 4A08B 2G9AA 5TF2A 3GREA 3JZHA 3RRMC 3UVOA 2J55H 4A11B 2Z2OA 3C75H 1FWXA 1Q47A 5EAPA 4J8BA 4J73A 3N0DA 1A0RB 5HE1B 1MG3A 3A0FA 2IUPA 4JSNC 5TEFA 1GP2B 4QT8A 3RN1D 4J82A 1N6DA 5HYNB 5FKSA 2YBAA 2P9KC 3PSLA 4J81A 4L3HD 1P22A 4EWRA 3PXSD 5KDOB 2IUQA 5HE2B 1SQ9A 3CFSB 4X63B 3UVKA 3EI2A 2J57G 4PC0A 4U7AA 3SWSD 3C99A 1RI6A 5CYKA 3EI1B 3EWEA 5FKTA 2YMUA 3UVMA 4BH6A 2XU7A 4GGAA 4GGDA 5FQDA 5CYKB 3J80g 3ODTA 5EARA 2AH1A 3SFZA 2H13A 4CY5A 2G99A 4O45A 2I3TA 3OKWA 1OMWB 4CZYA 4JT5C 4PNKB 5K1CC 3I7KA 3JROA 1JMXB 4J84A 4CZXA 2I0SA 3V7DB 2P9UC 2W18A 3SBQA 3HFQA 2HESX 4GM8A 2YB8B 1SHYB 4R7AB 2B5LA 4O3UB 1GXRA 4U1EI 4TZ4A 3MXXA 4XEIC 4Z8LA 5AFU3 5IT9g 5TEEA 3I7LA 2HXCA 3BG1A 3JAMg 2P9IC 2P9NC 3MZLA 1GOTB 5IJ7E 4E5ZA 3DSMA 5EAMA 4PSXB 4AOWA 2YNOA 2CNXA 3EI4A 3F3FA 4OZUA 2B5MA 4LG8A 4E5ZB 4J86A 3AH8B 3OKYB 2AGWA 3I2NA 3PXWD 4PBYA 3EI4B 1XIPA 3F3GA 5AMSA 3J81g 2GC4A 4CC9A 5HE0B 2Z2NA 2I0TA 5SXMA 2CE9A 4J0XA 2Z2PA 4E54B 3IJ0A 1JMZB 2UZYB 3SMRA 5EMJB 2Q7QA 3OW8A 5B4WA 4BL0A 4A11A 2PM9B 1XKSA 3RSEC 3BG0A 3I8EA 3N0EA 4X60B 4LG9A 2H3XA 3FRXA 3E0CA 3ZWLB 3GFCA 4BUJC 3EU7A 3K27A 4ZOZA 4FA5D 1B9XA 5C2WB 5IJ8E 5GXHA 5A2Qg 2CE8A 2QXVA 4GQ2P 5GXIA 3SHFA 3VGZA 3IKOA 2CN2A 4J87A 2AGLA 4GQBB 2B5NA 3IJ1A 4FWWA 3EI1A 3FGBA 1N6FA 2BCJB 3NVNA 5FXYA 3I7OA 4ZOVA 4A2LA 3PSCB 3EI3A 2H14A 3UVLA 5GMKn 4GM3A 4ZOYA 5JWZA 4L3GD 3V9FA 4NSXA 4G56B 3CIKB 3AFCA 4J8GA 3UKRC 2HJ4A 5GSAA 5FKQA 2I0RA 4CI8A 3EI3B 4H5IA 4FHLA 4FA1D 4CI1A 3C5MA 1OLZA 4FB1D 3SLED 3VH0A 4QRJA 3I7HA 1NEXB 5I5MA 4L1QD 4FA9D 5FA5B 3B7FA 4PSWB 4X61B 3NVXA 3JZNA 3SBPA 2HYEA 2AGYA 5AJAA 2O9KA 4ZN4A 2H6KA 5EMLB 3I7NA 3MKSB 4AEZA 1L0QA 4KFMB 4FA4D 4CI3A 3I89A 4J78A 3SN6B 3RMZD 2B4EA 4JD2C 1ERJA 1XHMA 5THAA 3PVUB 5IGQA 3NVQA 3MKQA 2H9MA 5TDHB 4CY2A 2P9PC 4J0WA 2H9PA 2PM6B 1JJUB 3OTTA 2AQ5A 3OKYA 4D0KA 3SJLD 2CN3A 5C2VB 4JXMA 2XYIA 3JRPA 3ORVD 2OK4A 4E54A 2H47A 3PXTD 5K19A 2PM9A 5EMMB 3FM0A 1S4UX 2H68A 2I3SA 2MTAH 4HDJA 3DXKC 4A0BA 3VA6A 3DM0A 1NR0A 5IGOA 2IAAA 4A0BB 2H6QA 4J77A 4CZVA 4QQEA 1MDAH 3U4YA 4GQ1A 1U2VC 3KRXB 3KRWB 4K3JB 5IC7A 4LGNA 1B9YA 3JB9L 5EMKB 5I5IA 4I79A 1GG2B 2YNPA 4OWRA 2OVRB 2AH0A 4PXWA 3MMYA 4JT6C 1YFQA 3L4MD 3BWSA 1VYHC 5CXCB 2IURA 4MK0B 5EALA 1R5MA 5H1MA 1PI6A 4GGCA 2AGXA 3UVNA 3JPXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IUV A;  1K32 A;  3OL2 A;  3EMH A;  2P9S C;  3K26 A;  1SQJ A;  3DXM C;  2HKM A;  5H14 A;  1QNI A;  3OL2 B;  4UI9 R;  4CY1 A;  2AGZ A;  4D6V A;  4A0A A;  3UR4 A;  4CY3 A;  1N6E A;  3V5W B;  2H9N A;  3EI2 B;  2OJY A;  4PBZ A;  4Y7R A;  4GZ8 A;  3IIY A;  4A0A B;  1PEV A;  2HKR A;  3SBR A;  1MG2 A;  3I8C A;  2BBK H;  3PVW B;  4IMM A;  4O9D A;  1TYQ C;  5CXB A;  2OIZ A;  4O3T B;  3SCY A;  4A2M A;  4H5J A;  3RN0 D;  4ZOX A;  3RLM D;  1U4C A;  4JSP C;  4XYH A;  4ERY A;  5CXB B;  4X3E A;  3RFG A;  3PE7 A;  5EM2 A;  1K8K C;  3CFV A;  3RFH A;  2GNQ A;  4A7J A;  3MZK A;  3AL9 A;  3P4F A;  4FAV D;  2IWK A;  2XL2 A;  2OVQ B;  3JZG A;  5HQG A;  5EM2 B;  4JSV C;  3UKU C;  2CO0 C;  4CI2 A;  2H6N A;  2H9L A;  2UZX B;  4ERQ A;  3IIW A;  5C9Z B;  2EBS A;  4ERZ A;  3C9C A;  4JSX C;  1PGU A;  2GC7 A;  2CO0 A;  4O1Q D;  4YVD A;  4Y5R D;  2YNN A;  4K3I D;  2OK6 A;  2P9L C;  3I7P A;  4A09 A;  4GMB A;  4ESG A;  3SVW D;  3EG6 A;  5FLX g;  3AL8 A;  3OKT A;  4IA9 A;  2HJB A;  3ULE C;  2QC5 A;  2J56 H;  5H17 A;  2TRC B;  4J79 A;  4ES0 A;  1TBG A;  4A09 B;  4L9O A;  2PBI B;  5HE3 B;  3F3P A;  4N14 A;  3AL8 B;  1JOF A;  4XYI A;  3IJC A;  2PM7 B;  2IWF A;  3W15 A;  2OVP B;  1PBY B;  4QL1 A;  3SXT D;  4A08 A;  3DWL C;  5FKR A;  4FAN D;  5I5J A;  2XL3 A;  5CXC A;  3L4O D;  4GM9 A;  4A08 B;  2G9A A;  5TF2 A;  3GRE A;  3JZH A;  3RRM C;  3UVO A;  2J55 H;  4A11 B;  2Z2O A;  3C75 H;  1FWX A;  1Q47 A;  5EAP A;  4J8B A;  4J73 A;  3N0D A;  1A0R B;  5HE1 B;  1MG3 A;  3A0F A;  2IUP A;  4JSN C;  5TEF A;  1GP2 B;  4QT8 A;  3RN1 D;  4J82 A;  1N6D A;  5HYN B;  5FKS A;  2YBA A;  2P9K C;  3PSL A;  4J81 A;  4L3H D;  1P22 A;  4EWR A;  3PXS D;  5KDO B;  2IUQ A;  5HE2 B;  1SQ9 A;  3CFS B;  4X63 B;  3UVK A;  3EI2 A;  2J57 G;  4PC0 A;  4U7A A;  3SWS D;  3C99 A;  1RI6 A;  5CYK A;  3EI1 B;  3EWE A;  5FKT A;  2YMU A;  3UVM A;  4BH6 A;  2XU7 A;  4GGA A;  4GGD A;  5FQD A;  5CYK B;  3J80 g;  3ODT A;  5EAR A;  2AH1 A;  3SFZ A;  2H13 A;  4CY5 A;  2G99 A;  4O45 A;  2I3T A;  3OKW A;  1OMW B;  4CZY A;  4JT5 C;  4PNK B;  5K1C C;  3I7K A;  3JRO A;  1JMX B;  4J84 A;  4CZX A;  2I0S A;  3V7D B;  2P9U C;  2W18 A;  3SBQ A;  3HFQ A;  2HES X;  4GM8 A;  2YB8 B;  1SHY B;  4R7A B;  2B5L A;  4O3U B;  1GXR A;  4U1E I;  4TZ4 A;  3MXX A;  4XEI C;  4Z8L A;  5AFU 3;  5IT9 g;  5TEE A;  3I7L A;  2HXC A;  3BG1 A;  3JAM g;  2P9I C;  2P9N C;  3MZL A;  1GOT B;  5IJ7 E;  4E5Z A;  3DSM A;  5EAM A;  4PSX B;  4AOW A;  2YNO A;  2CNX A;  3EI4 A;  3F3F A;  4OZU A;  2B5M A;  4LG8 A;  4E5Z B;  4J86 A;  3AH8 B;  3OKY B;  2AGW A;  3I2N A;  3PXW D;  4PBY A;  3EI4 B;  1XIP A;  3F3G A;  5AMS A;  3J81 g;  2GC4 A;  4CC9 A;  5HE0 B;  2Z2N A;  2I0T A;  5SXM A;  2CE9 A;  4J0X A;  2Z2P A;  4E54 B;  3IJ0 A;  1JMZ B;  2UZY B;  3SMR A;  5EMJ B;  2Q7Q A;  3OW8 A;  5B4W A;  4BL0 A;  4A11 A;  2PM9 B;  1XKS A;  3RSE C;  3BG0 A;  3I8E A;  3N0E A;  4X60 B;  4LG9 A;  2H3X A;  3FRX A;  3E0C A;  3ZWL B;  3GFC A;  4BUJ C;  3EU7 A;  3K27 A;  4ZOZ A;  4FA5 D;  1B9X A;  5C2W B;  5IJ8 E;  5GXH A;  5A2Q g;  2CE8 A;  2QXV A;  4GQ2 P;  5GXI A;  3SHF A;  3VGZ A;  3IKO A;  2CN2 A;  4J87 A;  2AGL A;  4GQB B;  2B5N A;  3IJ1 A;  4FWW A;  3EI1 A;  3FGB A;  1N6F A;  2BCJ B;  3NVN A;  5FXY A;  3I7O A;  4ZOV A;  4A2L A;  3PSC B;  3EI3 A;  2H14 A;  3UVL A;  5GMK n;  4GM3 A;  4ZOY A;  5JWZ A;  4L3G D;  3V9F A;  4NSX A;  4G56 B;  3CIK B;  3AFC A;  4J8G A;  3UKR C;  2HJ4 A;  5GSA A;  5FKQ A;  2I0R A;  4CI8 A;  3EI3 B;  4H5I A;  4FHL A;  4FA1 D;  4CI1 A;  3C5M A;  1OLZ A;  4FB1 D;  3SLE D;  3VH0 A;  4QRJ A;  3I7H A;  1NEX B;  5I5M A;  4L1Q D;  4FA9 D;  5FA5 B;  3B7F A;  4PSW B;  4X61 B;  3NVX A;  3JZN A;  3SBP A;  2HYE A;  2AGY A;  5AJA A;  2O9K A;  4ZN4 A;  2H6K A;  5EML B;  3I7N A;  3MKS B;  4AEZ A;  1L0Q A;  4KFM B;  4FA4 D;  4CI3 A;  3I89 A;  4J78 A;  3SN6 B;  3RMZ D;  2B4E A;  4JD2 C;  1ERJ A;  1XHM A;  5THA A;  3PVU B;  5IGQ A;  3NVQ A;  3MKQ A;  2H9M A;  5TDH B;  4CY2 A;  2P9P C;  4J0W A;  2H9P A;  2PM6 B;  1JJU B;  3OTT A;  2AQ5 A;  3OKY A;  4D0K A;  3SJL D;  2CN3 A;  5C2V B;  4JXM A;  2XYI A;  3JRP A;  3ORV D;  2OK4 A;  4E54 A;  2H47 A;  3PXT D;  5K19 A;  2PM9 A;  5EMM B;  3FM0 A;  1S4U X;  2H68 A;  2I3S A;  2MTA H;  4HDJ A;  3DXK C;  4A0B A;  3VA6 A;  3DM0 A;  1NR0 A;  5IGO A;  2IAA A;  4A0B B;  2H6Q A;  4J77 A;  4CZV A;  4QQE A;  1MDA H;  3U4Y A;  4GQ1 A;  1U2V C;  3KRX B;  3KRW B;  4K3J B;  5IC7 A;  4LGN A;  1B9Y A;  3JB9 L;  5EMK B;  5I5I A;  4I79 A;  1GG2 B;  2YNP A;  4OWR A;  2OVR B;  2AH0 A;  4PXW A;  3MMY A;  4JT6 C;  1YFQ A;  3L4M D;  3BWS A;  1VYH C;  5CXC B;  2IUR A;  4MK0 B;  5EAL A;  1R5M A;  5H1M A;  1PI6 A;  4GGC A;  2AGX A;  3UVN A;  3JPX A; 
#chains in the Genus database with same CATH topology
 2IUV A;  1K32 A;  1K3I A;  3EMH A;  2P9S C;  3OL2 A;  4WK2 A;  4DNV A;  3K26 A;  1I2M B;  1SQJ A;  3DXM C;  2HKM A;  5H14 A;  1QNI A;  4NBM A;  3OL2 B;  4AN0 A;  4UI9 R;  5FFO A;  4CY1 A;  2AGZ A;  4D6V A;  4A0A A;  3UR4 A;  3IUL A;  3V4V A;  4CY3 A;  1N6E A;  3V5W B;  2H9N A;  3EI2 B;  2OJY A;  4PBZ A;  4Y7R A;  4GZ8 A;  3IIY A;  4JHP C;  4A0A B;  1VE6 A;  3O4I A;  1PEV A;  2HKR A;  3SBR A;  1MG2 A;  4UM8 A;  3I8C A;  1YR2 A;  2BBK H;  3PVW B;  4IMM A;  4O9D A;  1TYQ C;  5CXB A;  1E5T A;  2OIZ A;  4O3T B;  3SCY A;  4A2M A;  4H5J A;  3RN0 D;  3ZDZ A;  4ZOX A;  1O6F A;  3RLM D;  1U4C A;  4JSP C;  4XYH A;  3MUO A;  2XDW A;  4ERY A;  5CXB B;  4X3E A;  3RFG A;  3PE7 A;  1E8M A;  5EM2 A;  1K8K C;  3CFV A;  3RFH A;  2GNQ A;  4A7J A;  3MZK A;  3AL9 A;  4WK4 A;  3P4F A;  4FAV D;  2IWK A;  2XL2 A;  1H2W A;  2OVQ B;  3JZG A;  5HQG A;  5EM2 B;  4JSV C;  3UKU C;  4DNW A;  3ZE1 A;  2CO0 C;  4CI2 A;  2H6N A;  2H9L A;  2UZX B;  1E8N A;  4ERQ A;  3IIW A;  5HDB A;  5C9Z B;  2EBS A;  4DNU A;  4ERZ A;  3C9C A;  4JSX C;  1PGU A;  2WQ8 A;  4Z7Q A;  2GC7 A;  4G1M A;  2CO0 A;  4O1Q D;  4YVD A;  4Y5R D;  2YNN A;  4K3I D;  2OK6 A;  2VDR A;  2P9L C;  3I7P A;  4A09 A;  4GMB A;  4ESG A;  3SVW D;  3EG6 A;  5FLX g;  1C9I A;  3DDU A;  3IUJ A;  3AL8 A;  2VDP A;  3OKT A;  4IA9 A;  2HJB A;  1A12 A;  3ULE C;  2QC5 A;  3K71 A;  2J56 H;  5H17 A;  2TRC B;  4J79 A;  4ES0 A;  1TBG A;  4A09 B;  4L9O A;  1TYE A;  2PBI B;  5HE3 B;  3F3P A;  1UOQ A;  1L5G A;  2VDL A;  4N14 A;  3AL8 B;  1JOF A;  4XYI A;  3IJC A;  4MMZ A;  2PM7 B;  2IWF A;  3W15 A;  2OVP B;  1PBY B;  4QL1 A;  3SXT D;  4A08 A;  5M5U A;  3DWL C;  5FKR A;  4D9S A;  4FAN D;  3O4G A;  5I5J A;  4AN1 A;  5M5T A;  2XL3 A;  5CXC A;  3L4O D;  4GM9 A;  4A08 B;  2G9A A;  5TF2 A;  3GRE A;  3JZH A;  3RRM C;  3UVO A;  2J55 H;  4A11 B;  2Z2O A;  3C75 H;  1FWX A;  1Q47 A;  5EAP A;  4J8B A;  2HU7 A;  4J73 A;  3N0D A;  1A0R B;  5HE1 B;  1MG3 A;  1UTC A;  4G55 A;  3A0F A;  2IUP A;  4JSN C;  5TEF A;  1GP2 B;  4QT8 A;  3RN1 D;  4J82 A;  1N6D A;  5HYN B;  5FKS A;  2YBA A;  4UM9 A;  2P9K C;  1GOG A;  1QFS A;  3EQ7 A;  3PSL A;  4J81 A;  3MVD K;  4L3H D;  1P22 A;  4EWR A;  3PXS D;  5KDO B;  3V4P A;  2IUQ A;  5HE2 B;  1JTD B;  1SQ9 A;  3CFS B;  4X63 B;  3UVK A;  3EI2 A;  3FCS A;  5M61 A;  2J57 G;  4PC0 A;  4U7A A;  3SWS D;  3C99 A;  1VE7 A;  1RI6 A;  5CYK A;  4BP9 A;  3EI1 B;  3EWE A;  5FKT A;  2YMU A;  3UVM A;  4BH6 A;  3VI4 A;  2XU7 A;  4GGA A;  4GGD A;  1O6G A;  5FQD A;  4L1M A;  5CYK B;  3J80 g;  3ODT A;  5EAR A;  2AH1 A;  3IUR A;  3SFZ A;  2H13 A;  4CY5 A;  2G99 A;  2JKX A;  2I3T A;  4O45 A;  3OKW A;  1OMW B;  3QI0 A;  4CZY A;  4AMZ A;  4JT5 C;  4PNK B;  4O2W A;  5K1C C;  3I7K A;  3JRO A;  1JMX B;  4J84 A;  4CZX A;  2EIE A;  2I0S A;  3V7D B;  2P9U C;  5M5V A;  2VDN A;  2W18 A;  3SBQ A;  3HFQ A;  2HES X;  4GM8 A;  2YB8 B;  1SHY B;  4R7A B;  1T2X A;  2B5L A;  4AX4 A;  4O3U B;  1GXR A;  4U1E I;  4TZ4 A;  3MXX A;  4XEI C;  4Z8L A;  5AFU 3;  3O4H A;  5IT9 g;  4WJK A;  5TEE A;  3I7L A;  2HXC A;  3BG1 A;  3JAM g;  2P9I C;  2P9N C;  3IUQ A;  3MZL A;  4BCB A;  1VZ2 A;  3NIF A;  3ZE2 A;  1GOT B;  5IJ7 E;  5FFG A;  5C92 A;  4E5Z A;  3DSM A;  5EAM A;  4PSX B;  4AOW A;  1QFM A;  2YNO A;  2CNX A;  3EI4 A;  4NAA A;  3F3F A;  3NIG A;  4OZU A;  3T3P A;  2B5M A;  4LG8 A;  4E5Z B;  4J86 A;  2VZ3 A;  3FCU A;  3AH8 B;  3OKY B;  2AGW A;  1GOF A;  3I2N A;  3PXW D;  4PBY A;  2HU5 A;  3EI4 B;  1VZ3 A;  1XIP A;  3F3G A;  5AMS A;  3J81 g;  2GC4 A;  4O02 A;  4CC9 A;  5HE0 B;  2QZP A;  5E6U A;  2Z2N A;  2I0T A;  4NC4 A;  5SXM A;  2CE9 A;  4Z7O A;  4J0X A;  2Z2P A;  4E54 B;  3IJ0 A;  1JMZ B;  2UZY B;  3SMR A;  5EMJ B;  2Q7Q A;  3OW8 A;  5B4W A;  4BL0 A;  4A11 A;  2PM9 B;  1XKS A;  3RSE C;  3BG0 A;  4MMY A;  3I8E A;  3N0E A;  4X60 B;  4LG9 A;  2H3X A;  3FRX A;  3E0C A;  3ZDY A;  1GOH A;  3ZWL B;  3GFC A;  4BUJ C;  4RE6 A;  3EU7 A;  3K27 A;  2EIC A;  3VI3 A;  4BCC A;  4ZOZ A;  4FA5 D;  1B9X A;  1H2Y A;  5C2W B;  4RE5 A;  5IJ8 E;  3GD1 I;  5A2Q g;  5GXH A;  3QHY B;  2CE8 A;  2QXV A;  1U8C A;  4GQ2 P;  5GXI A;  5M5R A;  5E6R A;  3SHF A;  3VGZ A;  2XE4 A;  3IKO A;  2CN2 A;  4J87 A;  2AGL A;  4GQB B;  2B5N A;  3IJ1 A;  4FWW A;  1H2Z A;  3EI1 A;  3FGB A;  1N6F A;  2BCJ B;  3NVN A;  5FXY A;  2QR5 A;  3I7O A;  4ZOV A;  4A2L A;  3PSC B;  3EI3 A;  2H14 A;  1BPO A;  2XZG A;  3UVL A;  1M1X A;  4GM3 A;  4ZOY A;  5GMK n;  5JWZ A;  4L3G D;  3V9F A;  4NSX A;  4G56 B;  3CIK B;  2VDQ A;  3AFC A;  4J8G A;  2HJ4 A;  3UKR C;  5GSA A;  5FKQ A;  2I0R A;  4CI8 A;  3EI3 B;  4H5I A;  4FHL A;  4FA1 D;  4CI1 A;  3C5M A;  1OLZ A;  4FB1 D;  3SLE D;  3VH0 A;  4QRJ A;  3I7H A;  1NEX B;  5I5M A;  2VDK A;  3NID A;  3ZE0 A;  1H2X A;  1JV2 A;  5C86 A;  4L1Q D;  4FA9 D;  5FA5 B;  3B7F A;  4PSW B;  4X61 B;  3NVX A;  3JZN A;  3O4J A;  3SBP A;  2HYE A;  2AGY A;  4QAM A;  5AJA A;  2O9K A;  4ZN4 A;  2H6K A;  5EML B;  3I7N A;  3MKS B;  4AEZ A;  1L0Q A;  4KFM B;  4FA4 D;  4CI3 A;  3I89 A;  4J78 A;  3SN6 B;  3RMZ D;  3IUN A;  2B4E A;  4JD2 C;  1ERJ A;  4BP8 A;  2EIB A;  1XHM A;  5THA A;  3PVU B;  2HU8 A;  5IGQ A;  3K72 A;  3MKQ A;  3NVQ A;  3T3M A;  4AMY A;  2H9M A;  5TDH B;  4CY2 A;  2P9P C;  3ZDX A;  1UOO A;  4J0W A;  2H9P A;  2PM6 B;  1JJU B;  3OTT A;  2AQ5 A;  3OKY A;  4D0K A;  3SJL D;  2CN3 A;  5C2V B;  4JXM A;  2XYI A;  3JRP A;  3ORV D;  2OK4 A;  4E54 A;  1UOP A;  2H47 A;  4NEN A;  3IUM A;  3PXT D;  5K19 A;  2PM9 A;  5EMM B;  3FM0 A;  1S4U X;  2H68 A;  3KCI A;  2I3S A;  2MTA H;  4HDJ A;  3DXK C;  4A0B A;  3GC3 B;  3MUN A;  3VA6 A;  3DM0 A;  2BKL A;  1NR0 A;  3IJE A;  2VDM A;  5IGO A;  2IAA A;  4JHN A;  4A0B B;  2H6Q A;  4J77 A;  4CZV A;  4QQE A;  2VDO A;  1C9L A;  1MDA H;  3U4Y A;  4GQ1 A;  1U2V C;  2VZ1 A;  3KRX B;  4IRZ A;  3KRW B;  3IVM A;  4K3J B;  5IC7 A;  5M5S A;  4G1E A;  4LGN A;  5E6S A;  3EQ8 A;  1B9Y A;  3JB9 L;  5EMK B;  5I5I A;  4I79 A;  1GG2 B;  2YNP A;  4MMX A;  4BCD A;  4OWR A;  2OVR B;  4WK0 A;  2AH0 A;  4PXW A;  4Z7N A;  3MMY A;  4JT6 C;  3K6S A;  1YFQ A;  3L4M D;  3BWS A;  3OF7 A;  1VYH C;  5CXC B;  2IUR A;  3EQ9 A;  4MK0 B;  5EAL A;  1R5M A;  5H1M A;  1PI6 A;  4GGC A;  2VC2 A;  2AGX A;  2EID A;  3UVN A;  3JPX A; 
#chains in the Genus database with same CATH homology
 2IUV A;  1K32 A;  3OL2 A;  3EMH A;  2P9S C;  3K26 A;  1SQJ A;  3DXM C;  2HKM A;  5H14 A;  1QNI A;  3OL2 B;  4UI9 R;  4CY1 A;  2AGZ A;  4D6V A;  4A0A A;  3UR4 A;  4CY3 A;  1N6E A;  3V5W B;  2H9N A;  3EI2 B;  2OJY A;  4PBZ A;  4Y7R A;  4GZ8 A;  3IIY A;  4A0A B;  1PEV A;  2HKR A;  3SBR A;  1MG2 A;  3I8C A;  2BBK H;  3PVW B;  4IMM A;  4O9D A;  1TYQ C;  5CXB A;  2OIZ A;  4O3T B;  3SCY A;  4A2M A;  4H5J A;  3RN0 D;  4ZOX A;  3RLM D;  1U4C A;  4JSP C;  4XYH A;  4ERY A;  5CXB B;  4X3E A;  3RFG A;  3PE7 A;  5EM2 A;  1K8K C;  3CFV A;  3RFH A;  2GNQ A;  4A7J A;  3MZK A;  3AL9 A;  3P4F A;  4FAV D;  2IWK A;  2XL2 A;  2OVQ B;  3JZG A;  5HQG A;  5EM2 B;  4JSV C;  3UKU C;  2CO0 C;  4CI2 A;  2H6N A;  2H9L A;  2UZX B;  4ERQ A;  3IIW A;  5C9Z B;  2EBS A;  4ERZ A;  3C9C A;  4JSX C;  1PGU A;  2GC7 A;  2CO0 A;  4O1Q D;  4YVD A;  4Y5R D;  2YNN A;  4K3I D;  2OK6 A;  2P9L C;  3I7P A;  4A09 A;  4GMB A;  4ESG A;  3SVW D;  3EG6 A;  5FLX g;  3AL8 A;  3OKT A;  4IA9 A;  2HJB A;  3ULE C;  2QC5 A;  2J56 H;  5H17 A;  2TRC B;  4J79 A;  4ES0 A;  1TBG A;  4A09 B;  4L9O A;  2PBI B;  5HE3 B;  3F3P A;  4N14 A;  3AL8 B;  1JOF A;  4XYI A;  3IJC A;  2PM7 B;  2IWF A;  3W15 A;  2OVP B;  1PBY B;  4QL1 A;  3SXT D;  4A08 A;  3DWL C;  5FKR A;  4FAN D;  5I5J A;  2XL3 A;  5CXC A;  3L4O D;  4GM9 A;  4A08 B;  2G9A A;  5TF2 A;  3GRE A;  3JZH A;  3RRM C;  3UVO A;  2J55 H;  4A11 B;  2Z2O A;  3C75 H;  1FWX A;  1Q47 A;  5EAP A;  4J8B A;  4J73 A;  3N0D A;  1A0R B;  5HE1 B;  1MG3 A;  3A0F A;  2IUP A;  4JSN C;  5TEF A;  1GP2 B;  4QT8 A;  3RN1 D;  4J82 A;  1N6D A;  5HYN B;  5FKS A;  2YBA A;  2P9K C;  3PSL A;  4J81 A;  4L3H D;  1P22 A;  4EWR A;  3PXS D;  5KDO B;  2IUQ A;  5HE2 B;  1SQ9 A;  3CFS B;  4X63 B;  3UVK A;  3EI2 A;  2J57 G;  4PC0 A;  4U7A A;  3SWS D;  3C99 A;  1RI6 A;  5CYK A;  3EI1 B;  3EWE A;  5FKT A;  2YMU A;  3UVM A;  4BH6 A;  2XU7 A;  4GGA A;  4GGD A;  5FQD A;  5CYK B;  3J80 g;  3ODT A;  5EAR A;  2AH1 A;  3SFZ A;  2H13 A;  4CY5 A;  2G99 A;  4O45 A;  2I3T A;  3OKW A;  1OMW B;  4CZY A;  4JT5 C;  4PNK B;  5K1C C;  3I7K A;  3JRO A;  1JMX B;  4J84 A;  4CZX A;  2I0S A;  3V7D B;  2P9U C;  2W18 A;  3SBQ A;  3HFQ A;  2HES X;  4GM8 A;  2YB8 B;  1SHY B;  4R7A B;  2B5L A;  4O3U B;  1GXR A;  4U1E I;  4TZ4 A;  3MXX A;  4XEI C;  4Z8L A;  5AFU 3;  5IT9 g;  5TEE A;  3I7L A;  2HXC A;  3BG1 A;  3JAM g;  2P9I C;  2P9N C;  3MZL A;  1GOT B;  5IJ7 E;  4E5Z A;  3DSM A;  5EAM A;  4PSX B;  4AOW A;  2YNO A;  2CNX A;  3EI4 A;  3F3F A;  4OZU A;  2B5M A;  4LG8 A;  4E5Z B;  4J86 A;  3AH8 B;  3OKY B;  2AGW A;  3I2N A;  3PXW D;  4PBY A;  3EI4 B;  1XIP A;  3F3G A;  5AMS A;  3J81 g;  2GC4 A;  4CC9 A;  5HE0 B;  2Z2N A;  2I0T A;  5SXM A;  2CE9 A;  4J0X A;  2Z2P A;  4E54 B;  3IJ0 A;  1JMZ B;  2UZY B;  3SMR A;  5EMJ B;  2Q7Q A;  3OW8 A;  5B4W A;  4BL0 A;  4A11 A;  2PM9 B;  1XKS A;  3RSE C;  3BG0 A;  3I8E A;  3N0E A;  4X60 B;  4LG9 A;  2H3X A;  3FRX A;  3E0C A;  3ZWL B;  3GFC A;  4BUJ C;  3EU7 A;  3K27 A;  4ZOZ A;  4FA5 D;  1B9X A;  5C2W B;  5IJ8 E;  5GXH A;  5A2Q g;  2CE8 A;  2QXV A;  4GQ2 P;  5GXI A;  3SHF A;  3VGZ A;  3IKO A;  2CN2 A;  4J87 A;  2AGL A;  4GQB B;  2B5N A;  3IJ1 A;  4FWW A;  3EI1 A;  3FGB A;  1N6F A;  2BCJ B;  3NVN A;  5FXY A;  3I7O A;  4ZOV A;  4A2L A;  3PSC B;  3EI3 A;  2H14 A;  3UVL A;  5GMK n;  4GM3 A;  4ZOY A;  5JWZ A;  4L3G D;  3V9F A;  4NSX A;  4G56 B;  3CIK B;  3AFC A;  4J8G A;  3UKR C;  2HJ4 A;  5GSA A;  5FKQ A;  2I0R A;  4CI8 A;  3EI3 B;  4H5I A;  4FHL A;  4FA1 D;  4CI1 A;  3C5M A;  1OLZ A;  4FB1 D;  3SLE D;  3VH0 A;  4QRJ A;  3I7H A;  1NEX B;  5I5M A;  4L1Q D;  4FA9 D;  5FA5 B;  3B7F A;  4PSW B;  4X61 B;  3NVX A;  3JZN A;  3SBP A;  2HYE A;  2AGY A;  5AJA A;  2O9K A;  4ZN4 A;  2H6K A;  5EML B;  3I7N A;  3MKS B;  4AEZ A;  1L0Q A;  4KFM B;  4FA4 D;  4CI3 A;  3I89 A;  4J78 A;  3SN6 B;  3RMZ D;  2B4E A;  4JD2 C;  1ERJ A;  1XHM A;  5THA A;  3PVU B;  5IGQ A;  3NVQ A;  3MKQ A;  2H9M A;  5TDH B;  4CY2 A;  2P9P C;  4J0W A;  2H9P A;  2PM6 B;  1JJU B;  3OTT A;  2AQ5 A;  3OKY A;  4D0K A;  3SJL D;  2CN3 A;  5C2V B;  4JXM A;  2XYI A;  3JRP A;  3ORV D;  2OK4 A;  4E54 A;  2H47 A;  3PXT D;  5K19 A;  2PM9 A;  5EMM B;  3FM0 A;  1S4U X;  2H68 A;  2I3S A;  2MTA H;  4HDJ A;  3DXK C;  4A0B A;  3VA6 A;  3DM0 A;  1NR0 A;  5IGO A;  2IAA A;  4A0B B;  2H6Q A;  4J77 A;  4CZV A;  4QQE A;  1MDA H;  3U4Y A;  4GQ1 A;  1U2V C;  3KRX B;  3KRW B;  4K3J B;  5IC7 A;  4LGN A;  1B9Y A;  3JB9 L;  5EMK B;  5I5I A;  4I79 A;  1GG2 B;  2YNP A;  4OWR A;  2OVR B;  2AH0 A;  4PXW A;  3MMY A;  4JT6 C;  1YFQ A;  3L4M D;  3BWS A;  1VYH C;  5CXC B;  2IUR A;  4MK0 B;  5EAL A;  1R5M A;  5H1M A;  1PI6 A;  4GGC A;  2AGX A;  3UVN A;  3JPX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...