2IURA

Crystal structure of n-quinol form of aromatic amine dehydrogenase (aadh) from alcaligenes faecalis, form a cocrystal
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
360
structure length
360
Chain Sequence
REVLTGGHSVSAPQENRIYVMDSVFMHLTESRVHVYDYTNGKFLGMVPTAFNGHVQVSNDGKKIYTMTTYHERITRGKRSDVVEVWDADKLTFEKEISLPPKRVQGLNYDGLFRQTTDGKFIVLQNASPATSIGIVDVAKGDYVEDVTAAAGCWSVIPQPNRPRSFMTICGDGGLLTINLGEDGKVASQSRSKQMFSVKDDPIFIAPALDKDKAHFVSYYGNVYSADFSGDEVKVDGPWSLLNDEDKAKNWVPGGYNLVGLHRASGRMYVFMHPDGKEGTHKFPAAEIWVMDTKTKQRVARIPGRDALSMTIDQQRNLMLTLDGGNVNVYDISQPEPKLLRTIEGAAEASLQVQFHPVGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic Level Insight Into the Oxidative Half-Reaction of Aromatic Amine Dehydrogenase.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords AROMATIC AMINE DEHYDROGENASE ALPHA SUBUNIT
total genus 96
structure length 360
sequence length 360
chains with identical sequence B
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2006-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2iurA01
1FWXA 2Z2OA 2B5LA 2IWFA 3JPXA 5FKTA 5KDOB 3RFHA 1NEXB 5EAPA 4A08B 3BG0A 4J8BA 4EWRA 1QNIA 3DM0A 2H3XA 4X63B 5TEEA 5EALA 3MXXA 4J87A 1TYQC 4E54A 4E5ZA 3DWLC 4QL1A 2G9AA 1K32A 3PSCB 1N6DA 3CFVA 5K1CC 5CXBB 2IWKA 1GG2B 2YNPA 4GQBB 3VA6A 2YB8B 3JRPA 3RRMC 4I79A 2H9MA 1GOTB 1OMWB 2CN3A 4A0AB 3OL2B 4CZXA 3IIWA 4QQEA 5C9ZB 2UZXB 3AL8B 4GGCA 3JROA 5EARA 2H9LA 5B4WA 2B5MA 4GM9A 3IJCA 2BCJB 1GP2B 3SCYA 4FA1D 5JWZA 4Y5RD 5CYKA 2IUQA 3BG1A 1U2VC 4JT5C 3EI1A 4JXMA 2PM9A 3UVKA 4D6VA 3EWEA 1OLZA 3U4YA 1K8KC 3CIKB 4UI9R 2PM6B 3PXTD 4J0XA 5A2Qg 4FAND 2P9KC 3CFSB 4X3EA 3C9CA 4FHLA 3OKTA 2XYIA 4LGNA 3KRWB 5IGQA 5FLXg 4MK0B 3OKWA 1B9YA 4A11B 1SQ9A 3F3FA 3SWSD 3AH8B 5FQDA 4CY2A 1TBGA 1N6FA 3JZNA 3ODTA 3AL9A 4CI2A 4ZOXA 4IA9A 4CI3A 5IJ7E 4CY3A 4CZVA 4PNKB 3I7HA 3DXKC 4U1EI 3SVWD 3W15A 2H6QA 5GSAA 4ZOZA 4G56B 2IUPA 1MDAH 5I5MA 3JAMg 4TZ4A 5K19A 4H5IA 2H9PA 2HKRA 3GREA 3JB9L 3B7FA 1JOFA 3SXTD 4O1QD 4CY5A 4A7JA 4J78A 4X60B 4ESGA 5IJ8E 2PM7B 4FB1D 3I7OA 1PGUA 2Z2NA 4CI1A 2I0SA 5GXHA 2PM9B 3SMRA 3EI1B 3J81g 3UVMA 5CYKB 2Z2PA 1A0RB 4H5JA 5FKRA 3NVXA 3RSEC 4O3TB 3GFCA 2YNNA 2AGWA 2H9NA 2J56H 5TDHB 3PE7A 4O9DA 2CE8A 1ERJA 2CNXA 3I8CA 3SLED 3SBRA 3MZLA 4X61B 5IC7A 3SFZA 4Y7RA 5CXBA 2PBIB 4GQ1A 3FRXA 3FM0A 3PVUB 2XL2A 4FWWA 4HDJA 4E54B 5EM2B 5C2VB 2HJ4A 3UKUC 3V9FA 4CC9A 2QXVA 4O3UB 3I89A 3V7DB 3A0FA 3MZKA 3DSMA 4A0BA 3IJ0A 1XKSA 3UR4A 5EMMB 3MKSB 4JSNC 2BBKH 4A0BB 3MMYA 4A2MA 3EG6A 3OKYB 2OVRB 2OVQB 1JMXB 4FA9D 4J73A 3IJ1A 2P9LC 3N0EA 2CN2A 5GMKn 2H68A 3EI2A 2I3SA 2OK4A 1U4CA 4L3HD 5H17A 5EM2A 4PXWA 1JJUB 5HE2B 2J55H 4PBZA 4ERYA 3NVNA 4XEIC 4JSPC 5AJAA 2AGXA 1GXRA 5EMKB 2G99A 3RMZD 4JSVC 1P22A 4J82A 3V5WB 3EI4A 2OVPB 3IKOA 1Q47A 3AFCA 4ERZA 2OK6A 3FGBA 3EU7A 1NR0A 4NSXA 4U7AA 2HYEA 4FA5D 5HE1B 4L3GD 2P9NC 4GM8A 3UKRC 4OWRA 5FXYA 5TF2A 2HXCA 4QT8A 4GZ8A 3E0CA 4K3ID 2Q7QA 2AGYA 2J57G 4XYIA 2B5NA 2O9KA 2YBAA 4LG8A 1XIPA 5H14A 3JZHA 3RN1D 5AFU3 5EAMA 4N14A 3SBPA 4D0KA 4PSWB 3C99A 1XHMA 2P9UC 2OIZA 3PSLA 4PC0A 5HE3B 3EI3B 2HJBA 4ES0A 5IGOA 4GM3A 3SJLD 3OW8A 2HESX 3I7KA 2W18A 2P9PC 2I0RA 4KFMB 4XYHA 1S4UX 5THAA 1R5MA 3I7LA 1YFQA 2B4EA 3N0DA 3L4MD 5HYNB 3VH0A 2H6NA 4J86A 2I0TA 2QC5A 2CO0A 4CY1A 4A11A 2H13A 5HE0B 3SHFA 3VGZA 4QRJA 3UVOA 4R7AB 3UVLA 1PEVA 3KRXB 3J80g 1MG3A 1RI6A 3SBQA 3PXSD 3K27A 2IAAA 3F3GA 4J8GA 4J79A 4BH6A 4GGDA 2OJYA 5FA5B 4BUJC 3RN0D 2YNOA 2P9IC 4ZOVA 3C75H 1SHYB 3ORVD 5SXMA 4CI8A 1PBYB 2YMUA 3MKQA 5EMLB 3ULEC 3BWSA 1JMZB 4J0WA 3EI3A 4JD2C 3PXWD 3K26A 2MTAH 3AL8A 4OZUA 3I8EA 5HQGA 3NVQA 3L4OD 2GNQA 1SQJA 2UZYB 3OL2A 4YVDA 3PVWB 2AQ5A 4JSXC 4A0AA 2IUVA 4AEZA 2CE9A 2TRCB 4GMBA 5GXIA 2I3TA 3C5MA 4K3JB 5I5JA 4LG9A 2P9SC 5FKQA 2IURA 5FKSA 4E5ZB 2XU7A 3SN6B 4J77A 4JT6C 2GC4A 4J81A 1MG2A 2H14A 4ZN4A 2GC7A 1VYHC 2XL3A 4A08A 2AH1A 4Z8LA 4FA4D 3JZGA 4L9OA 4GGAA 4O45A 4PSXB 5AMSA 4ZOYA 5C2WB 3DXMC 4FAVD 4J84A 3HFQA 1N6EA 4CZYA 3OTTA 4PBYA 5CXCA 3RLMD 3ZWLB 2HKMA 3EI4B 5TEFA 3EMHA 3I7NA 3IIYA 2H6KA 4A09A 3P4FA 2CO0C 5EMJB 1PI6A 4A2LA 3I7PA 1B9XA 1L0QA 2H47A 4GQ2P 2EBSA 4L1QD 4AOWA 2AH0A 5IT9g 3EI2B 3RFGA 4A09B 2AGLA 5H1MA 4BL0A 3OKYA 4ERQA 3I2NA 5I5IA 4IMMA 5CXCB 3UVNA 3F3PA 2AGZA
chains in the Genus database with same CATH superfamily
3ZDZA 1FWXA 2Z2OA 2B5LA 2IWFA 3IJEA 3JPXA 5FKTA 5KDOB 3RFHA 1NEXB 5EAPA 4A08B 3BG0A 4J8BA 4EWRA 1QNIA 3DM0A 5FFOA 2H3XA 4X63B 5TEEA 2EIBA 5EALA 3MXXA 4J87A 1TYQC 4E54A 4AMZA 4E5ZA 3QI0A 3DWLC 1YR2A 4QL1A 2G9AA 1K32A 3PSCB 1N6DA 3CFVA 5K1CC 2QR5A 4NBMA 2IWKA 5CXBB 1GG2B 2YNPA 4GQBB 3VA6A 2YB8B 4MMYA 3JRPA 3RRMC 4I79A 2H9MA 1GOTB 1BPOA 1OMWB 1TYEA 2CN3A 2VDNA 4A0AB 3OL2B 3KCIA 4CZXA 3V4VA 3IIWA 4QQEA 3IUMA 5C9ZB 2UZXB 3AL8B 4GGCA 3JROA 4MMXA 2H9LA 5EARA 1O6GA 2VDPA 5B4WA 2B5MA 4GM9A 3IJCA 2BCJB 1GP2B 3SCYA 4FA1D 5JWZA 4Y5RD 5CYKA 2IUQA 3BG1A 1U2VC 4JT5C 3EI1A 1JTDB 3VI4A 4JXMA 3MVDK 5HDBA 2PM9A 3IUJA 3UVKA 4D6VA 3EWEA 1OLZA 3U4YA 1K8KC 3CIKB 4UI9R 2PM6B 3PXTD 4J0XA 5A2Qg 3MUOA 4FAND 2P9KC 3CFSB 4X3EA 3C9CA 4FHLA 3OKTA 2XYIA 3ZDXA 4LGNA 3KRWB 5IGQA 5FLXg 2EIDA 4MK0B 3OKWA 5M5UA 1B9YA 1GOGA 4WJKA 4A11B 1SQ9A 3F3FA 3SWSD 3AH8B 5FQDA 4CY2A 5C86A 3IVMA 1TBGA 1N6FA 3JZNA 3ODTA 5E6UA 3AL9A 5M5RA 4CI2A 4ZOXA 4IA9A 2VDRA 4CI3A 5IJ7E 4CY3A 3VI3A 4CZVA 4PNKB 3FCUA 3O4GA 3I7HA 3DXKC 4U1EI 4AX4A 3SVWD 3W15A 2H6QA 5GSAA 4ZOZA 4G56B 2IUPA 1MDAH 4O02A 5I5MA 3JAMg 4TZ4A 5K19A 4H5IA 2H9PA 2HKRA 1QFSA 3GREA 3JB9L 2VC2A 1O6FA 3IULA 3B7FA 1JOFA 3SXTD 4O1QD 4CY5A 3NIGA 4A7JA 4J78A 4X60B 4ESGA 3MUNA 3K71A 5IJ8E 2PM7B 4FB1D 1UOPA 3I7OA 1PGUA 2Z2NA 4CI1A 2I0SA 5GXHA 2PM9B 3T3MA 1E5TA 3V4PA 3SMRA 3EI1B 3J81g 3UVMA 5CYKB 4IRZA 2Z2PA 4RE5A 5M61A 1A0RB 4DNVA 4H5JA 5FKRA 3NVXA 3RSEC 4O3TB 3GFCA 2YNNA 2AGWA 2VDLA 2H9NA 2J56H 5TDHB 3PE7A 4O9DA 2CE8A 1ERJA 2CNXA 3NIDA 1H2ZA 2XDWA 3O4IA 3I8CA 3SLED 3SBRA 3MZLA 4WK2A 4X61B 3QHYB 5IC7A 3SFZA 4Y7RA 1GOHA 5CXBA 1H2WA 4Z7NA 2PBIB 4GQ1A 3EQ9A 3FRXA 3FM0A 3PVUB 2XL2A 4FWWA 4HDJA 4E54B 4G1MA 5C2VB 5EM2B 2HJ4A 3UKUC 3V9FA 2EIEA 4CC9A 2QXVA 1M1XA 4O3UB 2VDKA 3I89A 3V7DB 3A0FA 3MZKA 5M5VA 3K72A 3IUQA 2BKLA 3DSMA 4A0BA 2QZPA 3IJ0A 1XKSA 4MMZA 3UR4A 5EMMB 3MKSB 4JSNC 2BBKH 4A0BB 3MMYA 4A2MA 3O4JA 3EG6A 3NIFA 3OKYB 2OVRB 2OVQB 1JMXB 4FA9D 4J73A 3IJ1A 2P9LC 3N0EA 2CN2A 5GMKn 3FCSA 2H68A 4NENA 3EI2A 5FFGA 2I3SA 1E8MA 2OK4A 1U4CA 4L3HD 5H17A 5EM2A 4PXWA 1JJUB 5HE2B 2J55H 4PBZA 3GC3B 3NVNA 4ERYA 4JSPC 4XEIC 5AJAA 2AGXA 1GXRA 4NC4A 5EMKB 2G99A 3GD1I 3RMZD 1VE6A 4JSVC 4L1MA 1P22A 4DNUA 4J82A 3V5WB 3EI4A 2OVPB 3IKOA 1Q47A 3AFCA 4ERZA 5M5SA 2OK6A 3FGBA 3EU7A 1NR0A 4NSXA 1VE7A 4U7AA 2HYEA 4FA5D 5M5TA 3K6SA 5HE1B 4L3GD 1L5GA 2P9NC 4GM8A 2WQ8A 4AN0A 2XE4A 3UKRC 4OWRA 5FXYA 3ZDYA 1E8NA 5TF2A 2HXCA 4QT8A 1UOQA 4GZ8A 3E0CA 4K3ID 2Q7QA 2AGYA 2J57G 2EICA 4XYIA 2B5NA 4Z7OA 2XZGA 2O9KA 2VDMA 2YBAA 4LG8A 1XIPA 3ZE2A 5H14A 3JZHA 3RN1D 5AFU3 4G1EA 5EAMA 4N14A 3SBPA 4D0KA 3C99A 1XHMA 2P9UC 4PSWB 3T3PA 2OIZA 3PSLA 4PC0A 4O2WA 5HE3B 1C9IA 3O4HA 1A12A 3EI3B 4UM9A 2HJBA 4BP8A 4BP9A 4ES0A 5IGOA 4GM3A 3OF7A 3SJLD 3OW8A 2HESX 3I7KA 2W18A 2P9PC 2I0RA 3EQ7A 4KFMB 4XYHA 1S4UX 5THAA 2HU5A 1R5MA 3I7LA 1YFQA 2B4EA 3N0DA 3L4MD 5HYNB 3VH0A 4AN1A 2H6NA 4J86A 2I0TA 3ZE0A 2QC5A 2CO0A 4CY1A 2JKXA 1UTCA 1H2YA 4A11A 2H13A 5HE0B 4UM8A 3SHFA 3VGZA 4NAAA 4QRJA 3UVOA 4R7AB 3UVLA 1PEVA 3KRXB 3J80g 1MG3A 1RI6A 3SBQA 3PXSD 3K27A 2IAAA 3F3GA 4J8GA 4JHPC 4J79A 4BH6A 4GGDA 2OJYA 5FA5B 4BUJC 3RN0D 2YNOA 2P9IC 4ZOVA 3C75H 1SHYB 3ORVD 5SXMA 4CI8A 1PBYB 2YMUA 3MKQA 4G55A 5EMLB 3ULEC 3BWSA 4AMYA 1JMZB 1VZ2A 4J0WA 3EI3A 4JD2C 3PXWD 3EQ8A 3K26A 2MTAH 4RE6A 3AL8A 4D9SA 4OZUA 1I2MB 3I8EA 3NVQA 5HQGA 1C9LA 4BCBA 3L4OD 2GNQA 1SQJA 2UZYB 3OL2A 4YVDA 3PVWB 2AQ5A 4JSXC 4A0AA 1T2XA 2IUVA 4AEZA 2CE9A 2TRCB 4GMBA 4BCCA 5GXIA 1U8CA 2I3TA 4Z7QA 3C5MA 4K3JB 5I5JA 4LG9A 3ZE1A 2P9SC 4JHNA 5FKQA 2IURA 5FKSA 4E5ZB 2XU7A 4BCDA 1K3IA 3SN6B 4J77A 4JT6C 1H2XA 2GC4A 4J81A 2VDOA 1MG2A 2H14A 4ZN4A 2GC7A 1VYHC 2XL3A 4A08A 2AH1A 4Z8LA 4FA4D 3JZGA 4L9OA 5E6SA 4GGAA 2VZ3A 4O45A 4PSXB 5AMSA 4ZOYA 5C2WB 3DXMC 2HU8A 4FAVD 5C92A 4J84A 3HFQA 1N6EA 4CZYA 5E6RA 3OTTA 4PBYA 5CXCA 3RLMD 3ZWLB 2HKMA 3EI4B 4QAMA 5TEFA 1GOFA 3EMHA 3I7NA 4WK0A 3IIYA 2H6KA 4A09A 3P4FA 2CO0C 5EMJB 1VZ3A 1PI6A 4A2LA 3I7PA 1B9XA 1L0QA 2H47A 4GQ2P 3IUNA 2EBSA 4L1QD 4AOWA 2AH0A 5IT9g 4WK4A 3EI2B 2VDQA 3RFGA 4A09B 4DNWA 2VZ1A 1JV2A 3IURA 2AGLA 5H1MA 2HU7A 3DDUA 4BL0A 1QFMA 3OKYA 4ERQA 3I2NA 5I5IA 4IMMA 5CXCB 3UVNA 3F3PA 1UOOA 2AGZA
chains in the Genus database with same CATH topology
1FWXA 2Z2OA 2B5LA 2IWFA 3JPXA 5FKTA 5KDOB 3RFHA 1NEXB 5EAPA 4A08B 3BG0A 4J8BA 4EWRA 1QNIA 3DM0A 2H3XA 4X63B 5TEEA 5EALA 3MXXA 4J87A 1TYQC 4E54A 4E5ZA 3DWLC 4QL1A 2G9AA 1K32A 3PSCB 1N6DA 3CFVA 5K1CC 5CXBB 2IWKA 1GG2B 2YNPA 4GQBB 3VA6A 2YB8B 3JRPA 3RRMC 4I79A 2H9MA 1GOTB 1OMWB 2CN3A 4A0AB 3OL2B 4CZXA 3IIWA 4QQEA 5C9ZB 2UZXB 3AL8B 4GGCA 3JROA 5EARA 2H9LA 5B4WA 2B5MA 4GM9A 3IJCA 2BCJB 1GP2B 3SCYA 4FA1D 5JWZA 4Y5RD 5CYKA 2IUQA 3BG1A 1U2VC 4JT5C 3EI1A 4JXMA 2PM9A 3UVKA 4D6VA 3EWEA 1OLZA 3U4YA 1K8KC 3CIKB 4UI9R 2PM6B 3PXTD 4J0XA 5A2Qg 4FAND 2P9KC 3CFSB 4X3EA 3C9CA 4FHLA 3OKTA 2XYIA 4LGNA 3KRWB 5IGQA 5FLXg 4MK0B 3OKWA 1B9YA 4A11B 1SQ9A 3F3FA 3SWSD 3AH8B 5FQDA 4CY2A 1TBGA 1N6FA 3JZNA 3ODTA 3AL9A 4CI2A 4ZOXA 4IA9A 4CI3A 5IJ7E 4CY3A 4CZVA 4PNKB 3I7HA 3DXKC 4U1EI 3SVWD 3W15A 2H6QA 5GSAA 4ZOZA 4G56B 2IUPA 1MDAH 5I5MA 3JAMg 4TZ4A 5K19A 4H5IA 2H9PA 2HKRA 3GREA 3JB9L 3B7FA 1JOFA 3SXTD 4O1QD 4CY5A 4A7JA 4J78A 4X60B 4ESGA 5IJ8E 2PM7B 4FB1D 3I7OA 1PGUA 2Z2NA 4CI1A 2I0SA 5GXHA 2PM9B 3SMRA 3EI1B 3J81g 3UVMA 5CYKB 2Z2PA 1A0RB 4H5JA 5FKRA 3NVXA 3RSEC 4O3TB 3GFCA 2YNNA 2AGWA 2H9NA 2J56H 5TDHB 3PE7A 4O9DA 2CE8A 1ERJA 2CNXA 3I8CA 3SLED 3SBRA 3MZLA 4X61B 5IC7A 3SFZA 4Y7RA 5CXBA 2PBIB 4GQ1A 3FRXA 3FM0A 3PVUB 2XL2A 4FWWA 4HDJA 4E54B 5EM2B 5C2VB 2HJ4A 3UKUC 3V9FA 4CC9A 2QXVA 4O3UB 3I89A 3V7DB 3A0FA 3MZKA 3DSMA 4A0BA 3IJ0A 1XKSA 3UR4A 5EMMB 3MKSB 4JSNC 2BBKH 4A0BB 3MMYA 4A2MA 3EG6A 3OKYB 2OVRB 2OVQB 1JMXB 4FA9D 4J73A 3IJ1A 2P9LC 3N0EA 2CN2A 5GMKn 2H68A 3EI2A 2I3SA 2OK4A 1U4CA 4L3HD 5H17A 5EM2A 4PXWA 1JJUB 5HE2B 2J55H 4PBZA 4ERYA 3NVNA 4XEIC 4JSPC 5AJAA 2AGXA 1GXRA 5EMKB 2G99A 3RMZD 4JSVC 1P22A 4J82A 3V5WB 3EI4A 2OVPB 3IKOA 1Q47A 3AFCA 4ERZA 2OK6A 3FGBA 3EU7A 1NR0A 4NSXA 4U7AA 2HYEA 4FA5D 5HE1B 4L3GD 2P9NC 4GM8A 3UKRC 4OWRA 5FXYA 5TF2A 2HXCA 4QT8A 4GZ8A 3E0CA 4K3ID 2Q7QA 2AGYA 2J57G 4XYIA 2B5NA 2O9KA 2YBAA 4LG8A 1XIPA 5H14A 3JZHA 3RN1D 5AFU3 5EAMA 4N14A 3SBPA 4D0KA 4PSWB 3C99A 1XHMA 2P9UC 2OIZA 3PSLA 4PC0A 5HE3B 3EI3B 2HJBA 4ES0A 5IGOA 4GM3A 3SJLD 3OW8A 2HESX 3I7KA 2W18A 2P9PC 2I0RA 4KFMB 4XYHA 1S4UX 5THAA 1R5MA 3I7LA 1YFQA 2B4EA 3N0DA 3L4MD 5HYNB 3VH0A 2H6NA 4J86A 2I0TA 2QC5A 2CO0A 4CY1A 4A11A 2H13A 5HE0B 3SHFA 3VGZA 4QRJA 3UVOA 4R7AB 3UVLA 1PEVA 3KRXB 3J80g 1MG3A 1RI6A 3SBQA 3PXSD 3K27A 2IAAA 3F3GA 4J8GA 4J79A 4BH6A 4GGDA 2OJYA 5FA5B 4BUJC 3RN0D 2YNOA 2P9IC 4ZOVA 3C75H 1SHYB 3ORVD 5SXMA 4CI8A 1PBYB 2YMUA 3MKQA 5EMLB 3ULEC 3BWSA 1JMZB 4J0WA 3EI3A 4JD2C 3PXWD 3K26A 2MTAH 3AL8A 4OZUA 3I8EA 5HQGA 3NVQA 3L4OD 2GNQA 1SQJA 2UZYB 3OL2A 4YVDA 3PVWB 2AQ5A 4JSXC 4A0AA 2IUVA 4AEZA 2CE9A 2TRCB 4GMBA 5GXIA 2I3TA 3C5MA 4K3JB 5I5JA 4LG9A 2P9SC 5FKQA 2IURA 5FKSA 4E5ZB 2XU7A 3SN6B 4J77A 4JT6C 2GC4A 4J81A 1MG2A 2H14A 4ZN4A 2GC7A 1VYHC 2XL3A 4A08A 2AH1A 4Z8LA 4FA4D 3JZGA 4L9OA 4GGAA 4O45A 4PSXB 5AMSA 4ZOYA 5C2WB 3DXMC 4FAVD 4J84A 3HFQA 1N6EA 4CZYA 3OTTA 4PBYA 5CXCA 3RLMD 3ZWLB 2HKMA 3EI4B 5TEFA 3EMHA 3I7NA 3IIYA 2H6KA 4A09A 3P4FA 2CO0C 5EMJB 1PI6A 4A2LA 3I7PA 1B9XA 1L0QA 2H47A 4GQ2P 2EBSA 4L1QD 4AOWA 2AH0A 5IT9g 3EI2B 3RFGA 4A09B 2AGLA 5H1MA 4BL0A 3OKYA 4ERQA 3I2NA 5I5IA 4IMMA 5CXCB 3UVNA 3F3PA 2AGZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FWX A;  2Z2O A;  2B5L A;  2IWF A;  3JPX A;  5FKT A;  5KDO B;  3RFH A;  1NEX B;  5EAP A;  4A08 B;  3BG0 A;  4J8B A;  4EWR A;  1QNI A;  3DM0 A;  2H3X A;  4X63 B;  5TEE A;  5EAL A;  3MXX A;  4J87 A;  1TYQ C;  4E54 A;  4E5Z A;  3DWL C;  4QL1 A;  2G9A A;  1K32 A;  3PSC B;  1N6D A;  3CFV A;  5K1C C;  5CXB B;  2IWK A;  1GG2 B;  2YNP A;  4GQB B;  3VA6 A;  2YB8 B;  3JRP A;  3RRM C;  4I79 A;  2H9M A;  1GOT B;  1OMW B;  2CN3 A;  4A0A B;  3OL2 B;  4CZX A;  3IIW A;  4QQE A;  5C9Z B;  2UZX B;  3AL8 B;  4GGC A;  3JRO A;  5EAR A;  2H9L A;  5B4W A;  2B5M A;  4GM9 A;  3IJC A;  2BCJ B;  1GP2 B;  3SCY A;  4FA1 D;  5JWZ A;  4Y5R D;  5CYK A;  2IUQ A;  3BG1 A;  1U2V C;  4JT5 C;  3EI1 A;  4JXM A;  2PM9 A;  3UVK A;  4D6V A;  3EWE A;  1OLZ A;  3U4Y A;  1K8K C;  3CIK B;  4UI9 R;  2PM6 B;  3PXT D;  4J0X A;  5A2Q g;  4FAN D;  2P9K C;  3CFS B;  4X3E A;  3C9C A;  4FHL A;  3OKT A;  2XYI A;  4LGN A;  3KRW B;  5IGQ A;  5FLX g;  4MK0 B;  3OKW A;  1B9Y A;  4A11 B;  1SQ9 A;  3F3F A;  3SWS D;  3AH8 B;  5FQD A;  4CY2 A;  1TBG A;  1N6F A;  3JZN A;  3ODT A;  3AL9 A;  4CI2 A;  4ZOX A;  4IA9 A;  4CI3 A;  5IJ7 E;  4CY3 A;  4CZV A;  4PNK B;  3I7H A;  3DXK C;  4U1E I;  3SVW D;  3W15 A;  2H6Q A;  5GSA A;  4ZOZ A;  4G56 B;  2IUP A;  1MDA H;  5I5M A;  3JAM g;  4TZ4 A;  5K19 A;  4H5I A;  2H9P A;  2HKR A;  3GRE A;  3JB9 L;  3B7F A;  1JOF A;  3SXT D;  4O1Q D;  4CY5 A;  4A7J A;  4J78 A;  4X60 B;  4ESG A;  5IJ8 E;  2PM7 B;  4FB1 D;  3I7O A;  1PGU A;  2Z2N A;  4CI1 A;  2I0S A;  5GXH A;  2PM9 B;  3SMR A;  3EI1 B;  3J81 g;  3UVM A;  5CYK B;  2Z2P A;  1A0R B;  4H5J A;  5FKR A;  3NVX A;  3RSE C;  4O3T B;  3GFC A;  2YNN A;  2AGW A;  2H9N A;  2J56 H;  5TDH B;  3PE7 A;  4O9D A;  2CE8 A;  1ERJ A;  2CNX A;  3I8C A;  3SLE D;  3SBR A;  3MZL A;  4X61 B;  5IC7 A;  3SFZ A;  4Y7R A;  5CXB A;  2PBI B;  4GQ1 A;  3FRX A;  3FM0 A;  3PVU B;  2XL2 A;  4FWW A;  4HDJ A;  4E54 B;  5EM2 B;  5C2V B;  2HJ4 A;  3UKU C;  3V9F A;  4CC9 A;  2QXV A;  4O3U B;  3I89 A;  3V7D B;  3A0F A;  3MZK A;  3DSM A;  4A0B A;  3IJ0 A;  1XKS A;  3UR4 A;  5EMM B;  3MKS B;  4JSN C;  2BBK H;  4A0B B;  3MMY A;  4A2M A;  3EG6 A;  3OKY B;  2OVR B;  2OVQ B;  1JMX B;  4FA9 D;  4J73 A;  3IJ1 A;  2P9L C;  3N0E A;  2CN2 A;  5GMK n;  2H68 A;  3EI2 A;  2I3S A;  2OK4 A;  1U4C A;  4L3H D;  5H17 A;  5EM2 A;  4PXW A;  1JJU B;  5HE2 B;  2J55 H;  4PBZ A;  4ERY A;  3NVN A;  4XEI C;  4JSP C;  5AJA A;  2AGX A;  1GXR A;  5EMK B;  2G99 A;  3RMZ D;  4JSV C;  1P22 A;  4J82 A;  3V5W B;  3EI4 A;  2OVP B;  3IKO A;  1Q47 A;  3AFC A;  4ERZ A;  2OK6 A;  3FGB A;  3EU7 A;  1NR0 A;  4NSX A;  4U7A A;  2HYE A;  4FA5 D;  5HE1 B;  4L3G D;  2P9N C;  4GM8 A;  3UKR C;  4OWR A;  5FXY A;  5TF2 A;  2HXC A;  4QT8 A;  4GZ8 A;  3E0C A;  4K3I D;  2Q7Q A;  2AGY A;  2J57 G;  4XYI A;  2B5N A;  2O9K A;  2YBA A;  4LG8 A;  1XIP A;  5H14 A;  3JZH A;  3RN1 D;  5AFU 3;  5EAM A;  4N14 A;  3SBP A;  4D0K A;  4PSW B;  3C99 A;  1XHM A;  2P9U C;  2OIZ A;  3PSL A;  4PC0 A;  5HE3 B;  3EI3 B;  2HJB A;  4ES0 A;  5IGO A;  4GM3 A;  3SJL D;  3OW8 A;  2HES X;  3I7K A;  2W18 A;  2P9P C;  2I0R A;  4KFM B;  4XYH A;  1S4U X;  5THA A;  1R5M A;  3I7L A;  1YFQ A;  2B4E A;  3N0D A;  3L4M D;  5HYN B;  3VH0 A;  2H6N A;  4J86 A;  2I0T A;  2QC5 A;  2CO0 A;  4CY1 A;  4A11 A;  2H13 A;  5HE0 B;  3SHF A;  3VGZ A;  4QRJ A;  3UVO A;  4R7A B;  3UVL A;  1PEV A;  3KRX B;  3J80 g;  1MG3 A;  1RI6 A;  3SBQ A;  3PXS D;  3K27 A;  2IAA A;  3F3G A;  4J8G A;  4J79 A;  4BH6 A;  4GGD A;  2OJY A;  5FA5 B;  4BUJ C;  3RN0 D;  2YNO A;  2P9I C;  4ZOV A;  3C75 H;  1SHY B;  3ORV D;  5SXM A;  4CI8 A;  1PBY B;  2YMU A;  3MKQ A;  5EML B;  3ULE C;  3BWS A;  1JMZ B;  4J0W A;  3EI3 A;  4JD2 C;  3PXW D;  3K26 A;  2MTA H;  3AL8 A;  4OZU A;  3I8E A;  5HQG A;  3NVQ A;  3L4O D;  2GNQ A;  1SQJ A;  2UZY B;  3OL2 A;  4YVD A;  3PVW B;  2AQ5 A;  4JSX C;  4A0A A;  2IUV A;  4AEZ A;  2CE9 A;  2TRC B;  4GMB A;  5GXI A;  2I3T A;  3C5M A;  4K3J B;  5I5J A;  4LG9 A;  2P9S C;  5FKQ A;  2IUR A;  5FKS A;  4E5Z B;  2XU7 A;  3SN6 B;  4J77 A;  4JT6 C;  2GC4 A;  4J81 A;  1MG2 A;  2H14 A;  4ZN4 A;  2GC7 A;  1VYH C;  2XL3 A;  4A08 A;  2AH1 A;  4Z8L A;  4FA4 D;  3JZG A;  4L9O A;  4GGA A;  4O45 A;  4PSX B;  5AMS A;  4ZOY A;  5C2W B;  3DXM C;  4FAV D;  4J84 A;  3HFQ A;  1N6E A;  4CZY A;  3OTT A;  4PBY A;  5CXC A;  3RLM D;  3ZWL B;  2HKM A;  3EI4 B;  5TEF A;  3EMH A;  3I7N A;  3IIY A;  2H6K A;  4A09 A;  3P4F A;  2CO0 C;  5EMJ B;  1PI6 A;  4A2L A;  3I7P A;  1B9X A;  1L0Q A;  2H47 A;  4GQ2 P;  2EBS A;  4L1Q D;  4AOW A;  2AH0 A;  5IT9 g;  3EI2 B;  3RFG A;  4A09 B;  2AGL A;  5H1M A;  4BL0 A;  3OKY A;  4ERQ A;  3I2N A;  5I5I A;  4IMM A;  5CXC B;  3UVN A;  3F3P A;  2AGZ A; 
#chains in the Genus database with same CATH topology
 3ZDZ A;  1FWX A;  2Z2O A;  2B5L A;  2IWF A;  3IJE A;  3JPX A;  5FKT A;  5KDO B;  3RFH A;  1NEX B;  5EAP A;  4A08 B;  3BG0 A;  4J8B A;  4EWR A;  1QNI A;  3DM0 A;  5FFO A;  2H3X A;  4X63 B;  5TEE A;  2EIB A;  5EAL A;  3MXX A;  4J87 A;  1TYQ C;  4E54 A;  4AMZ A;  4E5Z A;  3QI0 A;  3DWL C;  1YR2 A;  4QL1 A;  2G9A A;  1K32 A;  3PSC B;  1N6D A;  3CFV A;  5K1C C;  2QR5 A;  4NBM A;  2IWK A;  5CXB B;  1GG2 B;  2YNP A;  4GQB B;  3VA6 A;  2YB8 B;  4MMY A;  3JRP A;  3RRM C;  4I79 A;  2H9M A;  1GOT B;  1BPO A;  1OMW B;  1TYE A;  2CN3 A;  2VDN A;  4A0A B;  3OL2 B;  3KCI A;  4CZX A;  3V4V A;  3IIW A;  4QQE A;  3IUM A;  5C9Z B;  2UZX B;  3AL8 B;  4GGC A;  3JRO A;  4MMX A;  2H9L A;  5EAR A;  1O6G A;  2VDP A;  5B4W A;  2B5M A;  4GM9 A;  3IJC A;  2BCJ B;  1GP2 B;  3SCY A;  4FA1 D;  5JWZ A;  4Y5R D;  5CYK A;  2IUQ A;  3BG1 A;  1U2V C;  4JT5 C;  3EI1 A;  1JTD B;  3VI4 A;  4JXM A;  3MVD K;  5HDB A;  2PM9 A;  3IUJ A;  3UVK A;  4D6V A;  3EWE A;  1OLZ A;  3U4Y A;  1K8K C;  3CIK B;  4UI9 R;  2PM6 B;  3PXT D;  4J0X A;  5A2Q g;  3MUO A;  4FAN D;  2P9K C;  3CFS B;  4X3E A;  3C9C A;  4FHL A;  3OKT A;  2XYI A;  3ZDX A;  4LGN A;  3KRW B;  5IGQ A;  5FLX g;  2EID A;  4MK0 B;  3OKW A;  5M5U A;  1B9Y A;  1GOG A;  4WJK A;  4A11 B;  1SQ9 A;  3F3F A;  3SWS D;  3AH8 B;  5FQD A;  4CY2 A;  5C86 A;  3IVM A;  1TBG A;  1N6F A;  3JZN A;  3ODT A;  5E6U A;  3AL9 A;  5M5R A;  4CI2 A;  4ZOX A;  4IA9 A;  2VDR A;  4CI3 A;  5IJ7 E;  4CY3 A;  3VI3 A;  4CZV A;  4PNK B;  3FCU A;  3O4G A;  3I7H A;  3DXK C;  4U1E I;  4AX4 A;  3SVW D;  3W15 A;  2H6Q A;  5GSA A;  4ZOZ A;  4G56 B;  2IUP A;  1MDA H;  4O02 A;  5I5M A;  3JAM g;  4TZ4 A;  5K19 A;  4H5I A;  2H9P A;  2HKR A;  1QFS A;  3GRE A;  3JB9 L;  2VC2 A;  1O6F A;  3IUL A;  3B7F A;  1JOF A;  3SXT D;  4O1Q D;  4CY5 A;  3NIG A;  4A7J A;  4J78 A;  4X60 B;  4ESG A;  3MUN A;  3K71 A;  5IJ8 E;  2PM7 B;  4FB1 D;  1UOP A;  3I7O A;  1PGU A;  2Z2N A;  4CI1 A;  2I0S A;  5GXH A;  2PM9 B;  3T3M A;  1E5T A;  3V4P A;  3SMR A;  3EI1 B;  3J81 g;  3UVM A;  5CYK B;  4IRZ A;  2Z2P A;  4RE5 A;  5M61 A;  1A0R B;  4DNV A;  4H5J A;  5FKR A;  3NVX A;  3RSE C;  4O3T B;  3GFC A;  2YNN A;  2AGW A;  2VDL A;  2H9N A;  2J56 H;  5TDH B;  3PE7 A;  4O9D A;  2CE8 A;  1ERJ A;  2CNX A;  3NID A;  1H2Z A;  2XDW A;  3O4I A;  3I8C A;  3SLE D;  3SBR A;  3MZL A;  4WK2 A;  4X61 B;  3QHY B;  5IC7 A;  3SFZ A;  4Y7R A;  1GOH A;  5CXB A;  1H2W A;  4Z7N A;  2PBI B;  4GQ1 A;  3EQ9 A;  3FRX A;  3FM0 A;  3PVU B;  2XL2 A;  4FWW A;  4HDJ A;  4E54 B;  4G1M A;  5C2V B;  5EM2 B;  2HJ4 A;  3UKU C;  3V9F A;  2EIE A;  4CC9 A;  2QXV A;  1M1X A;  4O3U B;  2VDK A;  3I89 A;  3V7D B;  3A0F A;  3MZK A;  5M5V A;  3K72 A;  3IUQ A;  2BKL A;  3DSM A;  4A0B A;  2QZP A;  3IJ0 A;  1XKS A;  4MMZ A;  3UR4 A;  5EMM B;  3MKS B;  4JSN C;  2BBK H;  4A0B B;  3MMY A;  4A2M A;  3O4J A;  3EG6 A;  3NIF A;  3OKY B;  2OVR B;  2OVQ B;  1JMX B;  4FA9 D;  4J73 A;  3IJ1 A;  2P9L C;  3N0E A;  2CN2 A;  5GMK n;  3FCS A;  2H68 A;  4NEN A;  3EI2 A;  5FFG A;  2I3S A;  1E8M A;  2OK4 A;  1U4C A;  4L3H D;  5H17 A;  5EM2 A;  4PXW A;  1JJU B;  5HE2 B;  2J55 H;  4PBZ A;  3GC3 B;  3NVN A;  4ERY A;  4JSP C;  4XEI C;  5AJA A;  2AGX A;  1GXR A;  4NC4 A;  5EMK B;  2G99 A;  3GD1 I;  3RMZ D;  1VE6 A;  4JSV C;  4L1M A;  1P22 A;  4DNU A;  4J82 A;  3V5W B;  3EI4 A;  2OVP B;  3IKO A;  1Q47 A;  3AFC A;  4ERZ A;  5M5S A;  2OK6 A;  3FGB A;  3EU7 A;  1NR0 A;  4NSX A;  1VE7 A;  4U7A A;  2HYE A;  4FA5 D;  5M5T A;  3K6S A;  5HE1 B;  4L3G D;  1L5G A;  2P9N C;  4GM8 A;  2WQ8 A;  4AN0 A;  2XE4 A;  3UKR C;  4OWR A;  5FXY A;  3ZDY A;  1E8N A;  5TF2 A;  2HXC A;  4QT8 A;  1UOQ A;  4GZ8 A;  3E0C A;  4K3I D;  2Q7Q A;  2AGY A;  2J57 G;  2EIC A;  4XYI A;  2B5N A;  4Z7O A;  2XZG A;  2O9K A;  2VDM A;  2YBA A;  4LG8 A;  1XIP A;  3ZE2 A;  5H14 A;  3JZH A;  3RN1 D;  5AFU 3;  4G1E A;  5EAM A;  4N14 A;  3SBP A;  4D0K A;  3C99 A;  1XHM A;  2P9U C;  4PSW B;  3T3P A;  2OIZ A;  3PSL A;  4PC0 A;  4O2W A;  5HE3 B;  1C9I A;  3O4H A;  1A12 A;  3EI3 B;  4UM9 A;  2HJB A;  4BP8 A;  4BP9 A;  4ES0 A;  5IGO A;  4GM3 A;  3OF7 A;  3SJL D;  3OW8 A;  2HES X;  3I7K A;  2W18 A;  2P9P C;  2I0R A;  3EQ7 A;  4KFM B;  4XYH A;  1S4U X;  5THA A;  2HU5 A;  1R5M A;  3I7L A;  1YFQ A;  2B4E A;  3N0D A;  3L4M D;  5HYN B;  3VH0 A;  4AN1 A;  2H6N A;  4J86 A;  2I0T A;  3ZE0 A;  2QC5 A;  2CO0 A;  4CY1 A;  2JKX A;  1UTC A;  1H2Y A;  4A11 A;  2H13 A;  5HE0 B;  4UM8 A;  3SHF A;  3VGZ A;  4NAA A;  4QRJ A;  3UVO A;  4R7A B;  3UVL A;  1PEV A;  3KRX B;  3J80 g;  1MG3 A;  1RI6 A;  3SBQ A;  3PXS D;  3K27 A;  2IAA A;  3F3G A;  4J8G A;  4JHP C;  4J79 A;  4BH6 A;  4GGD A;  2OJY A;  5FA5 B;  4BUJ C;  3RN0 D;  2YNO A;  2P9I C;  4ZOV A;  3C75 H;  1SHY B;  3ORV D;  5SXM A;  4CI8 A;  1PBY B;  2YMU A;  3MKQ A;  4G55 A;  5EML B;  3ULE C;  3BWS A;  4AMY A;  1JMZ B;  1VZ2 A;  4J0W A;  3EI3 A;  4JD2 C;  3PXW D;  3EQ8 A;  3K26 A;  2MTA H;  4RE6 A;  3AL8 A;  4D9S A;  4OZU A;  1I2M B;  3I8E A;  3NVQ A;  5HQG A;  1C9L A;  4BCB A;  3L4O D;  2GNQ A;  1SQJ A;  2UZY B;  3OL2 A;  4YVD A;  3PVW B;  2AQ5 A;  4JSX C;  4A0A A;  1T2X A;  2IUV A;  4AEZ A;  2CE9 A;  2TRC B;  4GMB A;  4BCC A;  5GXI A;  1U8C A;  2I3T A;  4Z7Q A;  3C5M A;  4K3J B;  5I5J A;  4LG9 A;  3ZE1 A;  2P9S C;  4JHN A;  5FKQ A;  2IUR A;  5FKS A;  4E5Z B;  2XU7 A;  4BCD A;  1K3I A;  3SN6 B;  4J77 A;  4JT6 C;  1H2X A;  2GC4 A;  4J81 A;  2VDO A;  1MG2 A;  2H14 A;  4ZN4 A;  2GC7 A;  1VYH C;  2XL3 A;  4A08 A;  2AH1 A;  4Z8L A;  4FA4 D;  3JZG A;  4L9O A;  5E6S A;  4GGA A;  2VZ3 A;  4O45 A;  4PSX B;  5AMS A;  4ZOY A;  5C2W B;  3DXM C;  2HU8 A;  4FAV D;  5C92 A;  4J84 A;  3HFQ A;  1N6E A;  4CZY A;  5E6R A;  3OTT A;  4PBY A;  5CXC A;  3RLM D;  3ZWL B;  2HKM A;  3EI4 B;  4QAM A;  5TEF A;  1GOF A;  3EMH A;  3I7N A;  4WK0 A;  3IIY A;  2H6K A;  4A09 A;  3P4F A;  2CO0 C;  5EMJ B;  1VZ3 A;  1PI6 A;  4A2L A;  3I7P A;  1B9X A;  1L0Q A;  2H47 A;  4GQ2 P;  3IUN A;  2EBS A;  4L1Q D;  4AOW A;  2AH0 A;  5IT9 g;  4WK4 A;  3EI2 B;  2VDQ A;  3RFG A;  4A09 B;  4DNW A;  2VZ1 A;  1JV2 A;  3IUR A;  2AGL A;  5H1M A;  2HU7 A;  3DDU A;  4BL0 A;  1QFM A;  3OKY A;  4ERQ A;  3I2N A;  5I5I A;  4IMM A;  5CXC B;  3UVN A;  3F3P A;  1UOO A;  2AGZ A; 
#chains in the Genus database with same CATH homology
 1FWX A;  2Z2O A;  2B5L A;  2IWF A;  3JPX A;  5FKT A;  5KDO B;  3RFH A;  1NEX B;  5EAP A;  4A08 B;  3BG0 A;  4J8B A;  4EWR A;  1QNI A;  3DM0 A;  2H3X A;  4X63 B;  5TEE A;  5EAL A;  3MXX A;  4J87 A;  1TYQ C;  4E54 A;  4E5Z A;  3DWL C;  4QL1 A;  2G9A A;  1K32 A;  3PSC B;  1N6D A;  3CFV A;  5K1C C;  5CXB B;  2IWK A;  1GG2 B;  2YNP A;  4GQB B;  3VA6 A;  2YB8 B;  3JRP A;  3RRM C;  4I79 A;  2H9M A;  1GOT B;  1OMW B;  2CN3 A;  4A0A B;  3OL2 B;  4CZX A;  3IIW A;  4QQE A;  5C9Z B;  2UZX B;  3AL8 B;  4GGC A;  3JRO A;  5EAR A;  2H9L A;  5B4W A;  2B5M A;  4GM9 A;  3IJC A;  2BCJ B;  1GP2 B;  3SCY A;  4FA1 D;  5JWZ A;  4Y5R D;  5CYK A;  2IUQ A;  3BG1 A;  1U2V C;  4JT5 C;  3EI1 A;  4JXM A;  2PM9 A;  3UVK A;  4D6V A;  3EWE A;  1OLZ A;  3U4Y A;  1K8K C;  3CIK B;  4UI9 R;  2PM6 B;  3PXT D;  4J0X A;  5A2Q g;  4FAN D;  2P9K C;  3CFS B;  4X3E A;  3C9C A;  4FHL A;  3OKT A;  2XYI A;  4LGN A;  3KRW B;  5IGQ A;  5FLX g;  4MK0 B;  3OKW A;  1B9Y A;  4A11 B;  1SQ9 A;  3F3F A;  3SWS D;  3AH8 B;  5FQD A;  4CY2 A;  1TBG A;  1N6F A;  3JZN A;  3ODT A;  3AL9 A;  4CI2 A;  4ZOX A;  4IA9 A;  4CI3 A;  5IJ7 E;  4CY3 A;  4CZV A;  4PNK B;  3I7H A;  3DXK C;  4U1E I;  3SVW D;  3W15 A;  2H6Q A;  5GSA A;  4ZOZ A;  4G56 B;  2IUP A;  1MDA H;  5I5M A;  3JAM g;  4TZ4 A;  5K19 A;  4H5I A;  2H9P A;  2HKR A;  3GRE A;  3JB9 L;  3B7F A;  1JOF A;  3SXT D;  4O1Q D;  4CY5 A;  4A7J A;  4J78 A;  4X60 B;  4ESG A;  5IJ8 E;  2PM7 B;  4FB1 D;  3I7O A;  1PGU A;  2Z2N A;  4CI1 A;  2I0S A;  5GXH A;  2PM9 B;  3SMR A;  3EI1 B;  3J81 g;  3UVM A;  5CYK B;  2Z2P A;  1A0R B;  4H5J A;  5FKR A;  3NVX A;  3RSE C;  4O3T B;  3GFC A;  2YNN A;  2AGW A;  2H9N A;  2J56 H;  5TDH B;  3PE7 A;  4O9D A;  2CE8 A;  1ERJ A;  2CNX A;  3I8C A;  3SLE D;  3SBR A;  3MZL A;  4X61 B;  5IC7 A;  3SFZ A;  4Y7R A;  5CXB A;  2PBI B;  4GQ1 A;  3FRX A;  3FM0 A;  3PVU B;  2XL2 A;  4FWW A;  4HDJ A;  4E54 B;  5EM2 B;  5C2V B;  2HJ4 A;  3UKU C;  3V9F A;  4CC9 A;  2QXV A;  4O3U B;  3I89 A;  3V7D B;  3A0F A;  3MZK A;  3DSM A;  4A0B A;  3IJ0 A;  1XKS A;  3UR4 A;  5EMM B;  3MKS B;  4JSN C;  2BBK H;  4A0B B;  3MMY A;  4A2M A;  3EG6 A;  3OKY B;  2OVR B;  2OVQ B;  1JMX B;  4FA9 D;  4J73 A;  3IJ1 A;  2P9L C;  3N0E A;  2CN2 A;  5GMK n;  2H68 A;  3EI2 A;  2I3S A;  2OK4 A;  1U4C A;  4L3H D;  5H17 A;  5EM2 A;  4PXW A;  1JJU B;  5HE2 B;  2J55 H;  4PBZ A;  4ERY A;  3NVN A;  4XEI C;  4JSP C;  5AJA A;  2AGX A;  1GXR A;  5EMK B;  2G99 A;  3RMZ D;  4JSV C;  1P22 A;  4J82 A;  3V5W B;  3EI4 A;  2OVP B;  3IKO A;  1Q47 A;  3AFC A;  4ERZ A;  2OK6 A;  3FGB A;  3EU7 A;  1NR0 A;  4NSX A;  4U7A A;  2HYE A;  4FA5 D;  5HE1 B;  4L3G D;  2P9N C;  4GM8 A;  3UKR C;  4OWR A;  5FXY A;  5TF2 A;  2HXC A;  4QT8 A;  4GZ8 A;  3E0C A;  4K3I D;  2Q7Q A;  2AGY A;  2J57 G;  4XYI A;  2B5N A;  2O9K A;  2YBA A;  4LG8 A;  1XIP A;  5H14 A;  3JZH A;  3RN1 D;  5AFU 3;  5EAM A;  4N14 A;  3SBP A;  4D0K A;  4PSW B;  3C99 A;  1XHM A;  2P9U C;  2OIZ A;  3PSL A;  4PC0 A;  5HE3 B;  3EI3 B;  2HJB A;  4ES0 A;  5IGO A;  4GM3 A;  3SJL D;  3OW8 A;  2HES X;  3I7K A;  2W18 A;  2P9P C;  2I0R A;  4KFM B;  4XYH A;  1S4U X;  5THA A;  1R5M A;  3I7L A;  1YFQ A;  2B4E A;  3N0D A;  3L4M D;  5HYN B;  3VH0 A;  2H6N A;  4J86 A;  2I0T A;  2QC5 A;  2CO0 A;  4CY1 A;  4A11 A;  2H13 A;  5HE0 B;  3SHF A;  3VGZ A;  4QRJ A;  3UVO A;  4R7A B;  3UVL A;  1PEV A;  3KRX B;  3J80 g;  1MG3 A;  1RI6 A;  3SBQ A;  3PXS D;  3K27 A;  2IAA A;  3F3G A;  4J8G A;  4J79 A;  4BH6 A;  4GGD A;  2OJY A;  5FA5 B;  4BUJ C;  3RN0 D;  2YNO A;  2P9I C;  4ZOV A;  3C75 H;  1SHY B;  3ORV D;  5SXM A;  4CI8 A;  1PBY B;  2YMU A;  3MKQ A;  5EML B;  3ULE C;  3BWS A;  1JMZ B;  4J0W A;  3EI3 A;  4JD2 C;  3PXW D;  3K26 A;  2MTA H;  3AL8 A;  4OZU A;  3I8E A;  5HQG A;  3NVQ A;  3L4O D;  2GNQ A;  1SQJ A;  2UZY B;  3OL2 A;  4YVD A;  3PVW B;  2AQ5 A;  4JSX C;  4A0A A;  2IUV A;  4AEZ A;  2CE9 A;  2TRC B;  4GMB A;  5GXI A;  2I3T A;  3C5M A;  4K3J B;  5I5J A;  4LG9 A;  2P9S C;  5FKQ A;  2IUR A;  5FKS A;  4E5Z B;  2XU7 A;  3SN6 B;  4J77 A;  4JT6 C;  2GC4 A;  4J81 A;  1MG2 A;  2H14 A;  4ZN4 A;  2GC7 A;  1VYH C;  2XL3 A;  4A08 A;  2AH1 A;  4Z8L A;  4FA4 D;  3JZG A;  4L9O A;  4GGA A;  4O45 A;  4PSX B;  5AMS A;  4ZOY A;  5C2W B;  3DXM C;  4FAV D;  4J84 A;  3HFQ A;  1N6E A;  4CZY A;  3OTT A;  4PBY A;  5CXC A;  3RLM D;  3ZWL B;  2HKM A;  3EI4 B;  5TEF A;  3EMH A;  3I7N A;  3IIY A;  2H6K A;  4A09 A;  3P4F A;  2CO0 C;  5EMJ B;  1PI6 A;  4A2L A;  3I7P A;  1B9X A;  1L0Q A;  2H47 A;  4GQ2 P;  2EBS A;  4L1Q D;  4AOW A;  2AH0 A;  5IT9 g;  3EI2 B;  3RFG A;  4A09 B;  2AGL A;  5H1M A;  4BL0 A;  3OKY A;  4ERQ A;  3I2N A;  5I5I A;  4IMM A;  5CXC B;  3UVN A;  3F3P A;  2AGZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...