2IURA

Crystal structure of n-quinol form of aromatic amine dehydrogenase (aadh) from alcaligenes faecalis, form a cocrystal
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
360
structure length
360
Chain Sequence
REVLTGGHSVSAPQENRIYVMDSVFMHLTESRVHVYDYTNGKFLGMVPTAFNGHVQVSNDGKKIYTMTTYHERITRGKRSDVVEVWDADKLTFEKEISLPPKRVQGLNYDGLFRQTTDGKFIVLQNASPATSIGIVDVAKGDYVEDVTAAAGCWSVIPQPNRPRSFMTICGDGGLLTINLGEDGKVASQSRSKQMFSVKDDPIFIAPALDKDKAHFVSYYGNVYSADFSGDEVKVDGPWSLLNDEDKAKNWVPGGYNLVGLHRASGRMYVFMHPDGKEGTHKFPAAEIWVMDTKTKQRVARIPGRDALSMTIDQQRNLMLTLDGGNVNVYDISQPEPKLLRTIEGAAEASLQVQFHPVGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords AROMATIC AMINE DEHYDROGENASE ALPHA SUBUNIT
publication title Atomic Level Insight Into the Oxidative Half-Reaction of Aromatic Amine Dehydrogenase.
pubmed doi rcsb
total genus 96
structure length 360
sequence length 360
chains with identical sequence B
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2006-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2iurA01
4LG8A 2IURA 4H5IA 3A0FA 2XL2A 3SBRA 1SHYB 2AQ5A 4GGCA 3UVLA 3U4YA 2IWKA 2Q7QA 3IJ1A 5IJ8E 3DXKC 3F3FA 3AH8B 4K3JB 2B5NA 2Z2PA 3OTTA 3RN0D 3OKYB 2IAAA 1GOTB 3F3PA 4ZN4A 5EMMB 3MMYA 4GZ8A 5B4WA 4U1EI 4CI1A 2OIZA 3IJCA 1N6DA 4FAVD 3JZGA 3ODTA 3SVWD 5I5JA 4A11B 4IMMA 5HQGA 2YBAA 5CXCA 4A08A 4CZXA 2P9NC 2Z2NA 1PEVA 3EI3A 4ZOZA 4BH6A 2UZYB 3SLED 3MKQA 2CNXA 5CXBB 4J86A 2H6NA 4A0BB 1PGUA 2PM9B 5H14A 2CO0A 1MG2A 2CE8A 3DXMC 3PXTD 4PBYA 4CI3A 5FXYA 3DSMA 3PXSD 4MK0B 4L9OA 2J57G 4A7JA 4GQ2P 4ZOYA 1MDAH 2P9PC 5KDOB 4E54B 2H6KA 1L0QA 4X60B 2B5LA 3P4FA 1OMWB 3PVWB 3RFHA 4TZ4A 3MXXA 4XYIA 4BUJC 1QNIA 3MZKA 5IJ7E 2HKMA 3V9FA 4ZOVA 5EM2B 1R5MA 3I7PA 5EALA 2IUVA 3EI4B 4A09A 4O1QD 5FKQA 1K32A 2H47A 4AOWA 3J81g 4ERQA 1GXRA 3IIWA 3AL8B 2P9LC 1NEXB 1OLZA 3JRPA 2HJ4A 4OWRA 4NSXA 4BL0A 3RN1D 4FHLA 3IIYA 5AFU3 2AH1A 5AJAA 1RI6A 5I5IA 3EI1B 3I8CA 5JWZA 5HE1B 2BBKH 5HE3B 1MG3A 3NVXA 3J80g 3BG0A 2B4EA 2HKRA 3VA6A 3EMHA 4Y5RD 3PSLA 4A0AB 1JMZB 3ORVD 4YVDA 4ZOXA 2W18A 5HYNB 2H3XA 1SQ9A 3RRMC 4FA4D 4CI2A 3EG6A 4GGDA 2XL3A 1XIPA 3JROA 4JSVC 2CE9A 3F3GA 2H68A 4CY5A 3RLMD 1N6EA 5FKTA 2I0RA 3ULEC 2YNNA 5EMJB 2OVRB 3W15A 1N6FA 5C2VB 3EU7A 2YNPA 1PBYB 2P9KC 5FKRA 5A2Qg 2GC4A 2Z2OA 3OKTA 2H6QA 3PXWD 4QT8A 2H9MA 3EI2B 3IKOA 5H1MA 4HDJA 4U7AA 5SXMA 4ERZA 4QRJA 3OL2A 5IT9g 4J8GA 4E5ZB 3KRXB 4D0KA 4FA1D 2GNQA 4JT5C 4L3GD 3JB9L 4O9DA 3GFCA 4L3HD 5FKSA 3C9CA 2UZXB 2PM7B 3B7FA 5EM2A 3SXTD 5K1CC 3OKWA 3RSEC 4N14A 2OVPB 4Y7RA 1GP2B 2AGXA 2AGYA 2B5MA 4I79A 4FA5D 3JZNA 2YB8B 4G56B 2CO0C 1U2VC 3PSCB 2XU7A 3HFQA 5EAPA 4L1QD 4X63B 5AMSA 4GQBB 2OJYA 3I7HA 2I0TA 4CC9A 4JD2C 5GXHA 2TRCB 3E0CA 5C9ZB 2J56H 3EI1A 1SQJA 3ZWLB 5CXCB 4J0XA 4A08B 4JT6C 2H9LA 5IGQA 4J79A 3BG1A 2H13A 2P9UC 3C5MA 3SBPA 3EI3B 3UKUC 3V5WB 4A0AA 3K26A 2OK4A 2YNOA 5FA5B 4J8BA 5H17A 5EARA 4GM3A 2I3SA 4FWWA 4O3UB 2IWFA 2J55H 4H5JA 2GC7A 5GSAA 5GXIA 2QXVA 4IA9A 5EMKB 3I2NA 3SJLD 4J81A 4JSXC 2IUQA 3OKYA 4GM9A 3C99A 4JXMA 3N0DA 3AFCA 3VGZA 4PNKB 1A0RB 4OZUA 4ERYA 1U4CA 4AEZA 3UR4A 4CY3A 3CFSB 3SMRA 4X3EA 4JSPC 3I7KA 4A11A 3FGBA 3EI2A 5IGOA 4CI8A 3AL9A 1FWXA 2MTAH 4A09B 2CN3A 2HXCA 3MZLA 2OVQB 4ESGA 5CXBA 3V7DB 3PVUB 4O3TB 4A0BA 2PM9A 3CIKB 4K3ID 4J87A 3CFVA 1JJUB 5TDHB 2AH0A 1JMXB 1YFQA 4XYHA 3I8EA 4EWRA 4J73A 3UKRC 4GGAA 2QC5A 2YMUA 2P9IC 4QQEA 1B9XA 3SN6B 5TF2A 3SBQA 5GMKn 3K27A 4E54A 3C75H 3FM0A 4R7AB 5CYKB 3UVNA 3JAMg 4LGNA 3MKSB 2EBSA 5HE2B 2I0SA 4A2LA 2O9KA 2H9NA 3OW8A 4GMBA 1TBGA 4J0WA 5EAMA 3BWSA 2G9AA 1Q47A 4QL1A 4FAND 3NVQA 3SHFA 3EI4A 2P9SC 3JZHA 1B9YA 4JSNC 3EWEA 3PE7A 4PSXB 3NVNA 4FA9D 4J84A 5EMLB 3AL8A 4A2MA 4UI9R 5FQDA 2H9PA 5IC7A 1S4UX 4GQ1A 2PBIB 3DWLC 2HJBA 1XHMA 4J82A 5HE0B 5TEFA 1JOFA 3I7NA 4CY1A 3RFGA 3RMZD 4CZYA 1ERJA 1TYQC 5THAA 4FB1D 3FRXA 2OK6A 5K19A 5FLXg 1VYHC 3KRWB 2AGZA 2I3TA 2AGWA 4PSWB 3OL2B 4ES0A 5I5MA 2HYEA 4J78A 1XKSA 4O45A 2CN2A 3GREA 1NR0A 3SFZA 3IJ0A 4PC0A 1PI6A 4CZVA 3L4OD 5C2WB 3UVKA 1P22A 3I89A 4KFMB 2BCJB 3JPXA 3I7LA 2IUPA 5TEEA 1GG2B 4X61B 3L4MD 3SCYA 4J77A 4XEIC 2PM6B 2XYIA 3DM0A 3UVOA 3UVMA 3VH0A 4CY2A 4D6VA 2H14A 1K8KC 3SWSD 4LG9A 4Z8LA 4PXWA 4GM8A 3I7OA 4PBZA 2G99A 3N0EA 2HESX 5CYKA 2AGLA 4E5ZA
chains in the Genus database with same CATH superfamily
3T3PA 4NBMA 4LG8A 2IURA 4H5IA 3A0FA 2XL2A 3QHYB 3SBRA 1SHYB 2AQ5A 4GGCA 1I2MB 4DNUA 3UVLA 3U4YA 3O4JA 1H2ZA 2IWKA 2VDKA 5E6RA 2Q7QA 3IJ1A 5IJ8E 1YR2A 3DXKC 3F3FA 3AH8B 4K3JB 2B5NA 2Z2PA 3OTTA 4MMXA 3RN0D 4NENA 3NIGA 3OKYB 3IUNA 2IAAA 1GOTB 2JKXA 3F3PA 4ZN4A 5EMMB 3MMYA 4GZ8A 5B4WA 4U1EI 4CI1A 2OIZA 3K6SA 3IJCA 1N6DA 1VE7A 4FAVD 3JZGA 3ODTA 3SVWD 5I5JA 4A11B 4IMMA 5HQGA 1JV2A 2YBAA 5CXCA 4A08A 3EQ7A 4CZXA 2P9NC 2Z2NA 1PEVA 3EI3A 4ZOZA 4BH6A 2UZYB 3SLED 3MKQA 2CNXA 5CXBB 4J86A 2H6NA 4A0BB 1PGUA 2PM9B 5H14A 4WK0A 5E6UA 2CO0A 1MG2A 2CE8A 3DXMC 1A12A 3PXTD 4PBYA 4CI3A 5FXYA 3DSMA 3PXSD 4MK0B 4L9OA 2HU8A 2J57G 4A7JA 4UM9A 4GQ2P 4MMYA 4ZOYA 1MDAH 2P9PC 5KDOB 2EIDA 4E54B 2H6KA 1L0QA 4X60B 2B5LA 3K72A 3P4FA 1OMWB 5C86A 3PVWB 3RFHA 4TZ4A 3MXXA 4XYIA 4BUJC 1QNIA 3MZKA 5IJ7E 2HKMA 1VZ3A 3V9FA 3K71A 4ZOVA 5EM2B 1R5MA 3I7PA 1C9LA 5EALA 2IUVA 3EI4B 2EICA 4BP9A 4A09A 4O1QD 5FKQA 1K32A 2H47A 4AOWA 3J81g 4ERQA 1GXRA 3IIWA 3IURA 3AL8B 1GOGA 1NEXB 2P9LC 3GC3B 1OLZA 3JRPA 2HJ4A 4MMZA 4OWRA 4BP8A 1K3IA 4NSXA 4BL0A 1UOOA 3RN1D 4FHLA 2WQ8A 3IIYA 5AFU3 2AH1A 5AJAA 3MUNA 3O4GA 1RI6A 5I5IA 4AMZA 3EI1B 1UTCA 3I8CA 3IUMA 5M5TA 5JWZA 1O6GA 5HE1B 2BBKH 5HE3B 1MG3A 3NVXA 3J80g 3IUQA 3BG0A 2XDWA 2B4EA 2HKRA 3VA6A 3EMHA 2EIBA 4Y5RD 3PSLA 4A0AB 1JMZB 3ORVD 4YVDA 4ZOXA 2W18A 1BPOA 5HYNB 2VDQA 2H3XA 1SQ9A 3RRMC 4FA4D 4CI2A 3EG6A 4GGDA 2HU7A 2XL3A 1XIPA 3JROA 4JSVC 2CE9A 3F3GA 2H68A 4CY5A 3RLMD 1N6EA 5FKTA 5HDBA 2I0RA 4RE6A 3ULEC 2YNNA 5EMJB 2OVRB 4AX4A 3W15A 1N6FA 5C2VB 4DNWA 3EU7A 2YNPA 1PBYB 2P9KC 5FKRA 4G55A 2GC4A 5A2Qg 2Z2OA 3OKTA 5E6SA 4L1MA 2H6QA 3PXWD 4QT8A 2H9MA 3EI2B 3IKOA 5H1MA 4HDJA 4U7AA 5SXMA 4ERZA 4QRJA 3OL2A 3EQ8A 4BCCA 5M61A 5IT9g 4J8GA 4E5ZB 3KRXB 4D0KA 4FA1D 2GNQA 4JT5C 4L3GD 3JB9L 4O9DA 3GFCA 4L3HD 5FKSA 3C9CA 3KCIA 2UZXB 2PM7B 3B7FA 4G1MA 5EM2A 3SXTD 5C92A 5K1CC 3OKWA 3RSEC 4N14A 2OVPB 4Y7RA 1GP2B 2AGXA 2AGYA 2B5MA 4I79A 4FA5D 3MUOA 3JZNA 2YB8B 3OF7A 4G56B 2CO0C 1U2VC 3PSCB 2XU7A 3HFQA 5EAPA 4L1QD 4X63B 5AMSA 4GQBB 2OJYA 3I7HA 4O02A 2I0TA 2VDPA 4CC9A 4Z7NA 4JD2C 5GXHA 2TRCB 3E0CA 1O6FA 1QFMA 3QI0A 5C9ZB 2J56H 3EI1A 1M1XA 4Z7OA 1SQJA 2BKLA 3ZWLB 3NIFA 5CXCB 4J0XA 4A08B 4D9SA 4JT6C 2H9LA 5IGQA 4J79A 3O4HA 4BCDA 3BG1A 2H13A 2P9UC 3C5MA 3SBPA 3EI3B 3UKUC 3V5WB 4UM8A 4JHNA 4A0AA 1E8NA 3K26A 2OK4A 2YNOA 5FA5B 4J8BA 5H17A 5EARA 4GM3A 4AMYA 1T2XA 2I3SA 4FWWA 4O3UB 2IWFA 2J55H 4H5JA 2GC7A 5GSAA 5GXIA 2QXVA 4IA9A 4O2WA 5EMKB 3I2NA 3ZDXA 3SJLD 4J81A 2VDMA 4JSXC 2VDOA 4QAMA 2IUQA 3ZE2A 3EQ9A 3FCSA 1GOHA 1QFSA 3C99A 3OKYA 4GM9A 4JXMA 3N0DA 3ZE1A 3AFCA 3VGZA 4PNKB 1A0RB 2VZ1A 3NIDA 3MVDK 4OZUA 5M5RA 4ERYA 1U4CA 4AEZA 3UR4A 4CY3A 3CFSB 3SMRA 4X3EA 4JSPC 3I7KA 4A11A 2HU5A 3FGBA 2QR5A 4AN1A 3EI2A 1H2XA 5FFOA 2VC2A 5IGOA 1E8MA 4CI8A 3AL9A 1FWXA 2MTAH 1JTDB 2CN3A 4A09B 2HXCA 3MZLA 1VZ2A 4WK4A 2OVQB 4ESGA 5CXBA 5FFGA 3V7DB 1C9IA 3PVUB 4O3TB 4A0BA 2PM9A 3CIKB 2EIEA 4K3ID 4J87A 4BCBA 3CFVA 1JJUB 5TDHB 3VI4A 2VDNA 2AH0A 1JMXB 1YFQA 4XYHA 3I8EA 4EWRA 4J73A 3UKRC 4GGAA 4DNVA 2QC5A 2YMUA 2P9IC 4QQEA 1B9XA 3SN6B 5TF2A 3SBQA 4AN0A 3ZDZA 5GMKn 3K27A 4E54A 3C75H 3FM0A 4R7AB 5CYKB 3UVNA 3JAMg 4JHPC 5M5VA 4LGNA 3MKSB 2EBSA 5HE2B 2I0SA 4A2LA 2O9KA 2H9NA 3OW8A 4GMBA 1TBGA 4J0WA 5EAMA 3BWSA 2G9AA 1Q47A 4QL1A 3VI3A 4FAND 3NVQA 3SHFA 3EI4A 2P9SC 3JZHA 2XZGA 1B9YA 2VDLA 4JSNC 4Z7QA 3EWEA 3PE7A 4PSXB 3NVNA 4RE5A 4J84A 4FA9D 3V4PA 5EMLB 3AL8A 4A2MA 4UI9R 5FQDA 2H9PA 2VZ3A 5IC7A 1S4UX 4GQ1A 3GD1I 2PBIB 3DWLC 2HJBA 1XHMA 4J82A 5HE0B 5TEFA 2VDRA 5M5UA 1JOFA 3I7NA 4NAAA 4CY1A 3RFGA 3RMZD 3IVMA 4CZYA 1ERJA 3IJEA 1TYQC 5THAA 3T3MA 4FB1D 3FRXA 1GOFA 2OK6A 5K19A 5FLXg 1VYHC 3DDUA 3KRWB 2AGZA 2I3TA 2AGWA 4PSWB 3OL2B 4ES0A 5I5MA 2HYEA 4WK2A 4J78A 3O4IA 3IUJA 1XKSA 1H2WA 1U8CA 3ZE0A 4O45A 2CN2A 3GREA 2QZPA 3V4VA 1NR0A 3SFZA 3IJ0A 1VE6A 4PC0A 1PI6A 4NC4A 4CZVA 3L4OD 5C2WB 3UVKA 1P22A 3I89A 4KFMB 2BCJB 3JPXA 3I7LA 1H2YA 2IUPA 4WJKA 1GG2B 5TEEA 4X61B 3L4MD 3SCYA 4J77A 4XEIC 2PM6B 2XYIA 3IULA 3DM0A 3UVOA 3UVMA 3VH0A 2XE4A 1E5TA 4CY2A 4D6VA 2H14A 4G1EA 1K8KC 3SWSD 4LG9A 1UOPA 4Z8LA 4PXWA 1TYEA 3I7OA 4GM8A 4PBZA 2G99A 3N0EA 3ZDYA 4IRZA 5M5SA 1L5GA 2HESX 5CYKA 3FCUA 2AGLA 4E5ZA 1UOQA
chains in the Genus database with same CATH topology
4LG8A 2IURA 4H5IA 3A0FA 2XL2A 3SBRA 1SHYB 2AQ5A 4GGCA 3UVLA 3U4YA 2IWKA 2Q7QA 3IJ1A 5IJ8E 3DXKC 3F3FA 3AH8B 4K3JB 2B5NA 2Z2PA 3OTTA 3RN0D 3OKYB 2IAAA 1GOTB 3F3PA 4ZN4A 5EMMB 3MMYA 4GZ8A 5B4WA 4U1EI 4CI1A 2OIZA 3IJCA 1N6DA 4FAVD 3JZGA 3ODTA 3SVWD 5I5JA 4A11B 4IMMA 5HQGA 2YBAA 5CXCA 4A08A 4CZXA 2P9NC 2Z2NA 1PEVA 3EI3A 4ZOZA 4BH6A 2UZYB 3SLED 3MKQA 2CNXA 5CXBB 4J86A 2H6NA 4A0BB 1PGUA 2PM9B 5H14A 2CO0A 1MG2A 2CE8A 3DXMC 3PXTD 4PBYA 4CI3A 5FXYA 3DSMA 3PXSD 4MK0B 4L9OA 2J57G 4A7JA 4GQ2P 4ZOYA 1MDAH 2P9PC 5KDOB 4E54B 2H6KA 1L0QA 4X60B 2B5LA 3P4FA 1OMWB 3PVWB 3RFHA 4TZ4A 3MXXA 4XYIA 4BUJC 1QNIA 3MZKA 5IJ7E 2HKMA 3V9FA 4ZOVA 5EM2B 1R5MA 3I7PA 5EALA 2IUVA 3EI4B 4A09A 4O1QD 5FKQA 1K32A 2H47A 4AOWA 3J81g 4ERQA 1GXRA 3IIWA 3AL8B 2P9LC 1NEXB 1OLZA 3JRPA 2HJ4A 4OWRA 4NSXA 4BL0A 3RN1D 4FHLA 3IIYA 5AFU3 2AH1A 5AJAA 1RI6A 5I5IA 3EI1B 3I8CA 5JWZA 5HE1B 2BBKH 5HE3B 1MG3A 3NVXA 3J80g 3BG0A 2B4EA 2HKRA 3VA6A 3EMHA 4Y5RD 3PSLA 4A0AB 1JMZB 3ORVD 4YVDA 4ZOXA 2W18A 5HYNB 2H3XA 1SQ9A 3RRMC 4FA4D 4CI2A 3EG6A 4GGDA 2XL3A 1XIPA 3JROA 4JSVC 2CE9A 3F3GA 2H68A 4CY5A 3RLMD 1N6EA 5FKTA 2I0RA 3ULEC 2YNNA 5EMJB 2OVRB 3W15A 1N6FA 5C2VB 3EU7A 2YNPA 1PBYB 2P9KC 5FKRA 5A2Qg 2GC4A 2Z2OA 3OKTA 2H6QA 3PXWD 4QT8A 2H9MA 3EI2B 3IKOA 5H1MA 4HDJA 4U7AA 5SXMA 4ERZA 4QRJA 3OL2A 5IT9g 4J8GA 4E5ZB 3KRXB 4D0KA 4FA1D 2GNQA 4JT5C 4L3GD 3JB9L 4O9DA 3GFCA 4L3HD 5FKSA 3C9CA 2UZXB 2PM7B 3B7FA 5EM2A 3SXTD 5K1CC 3OKWA 3RSEC 4N14A 2OVPB 4Y7RA 1GP2B 2AGXA 2AGYA 2B5MA 4I79A 4FA5D 3JZNA 2YB8B 4G56B 2CO0C 1U2VC 3PSCB 2XU7A 3HFQA 5EAPA 4L1QD 4X63B 5AMSA 4GQBB 2OJYA 3I7HA 2I0TA 4CC9A 4JD2C 5GXHA 2TRCB 3E0CA 5C9ZB 2J56H 3EI1A 1SQJA 3ZWLB 5CXCB 4J0XA 4A08B 4JT6C 2H9LA 5IGQA 4J79A 3BG1A 2H13A 2P9UC 3C5MA 3SBPA 3EI3B 3UKUC 3V5WB 4A0AA 3K26A 2OK4A 2YNOA 5FA5B 4J8BA 5H17A 5EARA 4GM3A 2I3SA 4FWWA 4O3UB 2IWFA 2J55H 4H5JA 2GC7A 5GSAA 5GXIA 2QXVA 4IA9A 5EMKB 3I2NA 3SJLD 4J81A 4JSXC 2IUQA 3OKYA 4GM9A 3C99A 4JXMA 3N0DA 3AFCA 3VGZA 4PNKB 1A0RB 4OZUA 4ERYA 1U4CA 4AEZA 3UR4A 4CY3A 3CFSB 3SMRA 4X3EA 4JSPC 3I7KA 4A11A 3FGBA 3EI2A 5IGOA 4CI8A 3AL9A 1FWXA 2MTAH 4A09B 2CN3A 2HXCA 3MZLA 2OVQB 4ESGA 5CXBA 3V7DB 3PVUB 4O3TB 4A0BA 2PM9A 3CIKB 4K3ID 4J87A 3CFVA 1JJUB 5TDHB 2AH0A 1JMXB 1YFQA 4XYHA 3I8EA 4EWRA 4J73A 3UKRC 4GGAA 2QC5A 2YMUA 2P9IC 4QQEA 1B9XA 3SN6B 5TF2A 3SBQA 5GMKn 3K27A 4E54A 3C75H 3FM0A 4R7AB 5CYKB 3UVNA 3JAMg 4LGNA 3MKSB 2EBSA 5HE2B 2I0SA 4A2LA 2O9KA 2H9NA 3OW8A 4GMBA 1TBGA 4J0WA 5EAMA 3BWSA 2G9AA 1Q47A 4QL1A 4FAND 3NVQA 3SHFA 3EI4A 2P9SC 3JZHA 1B9YA 4JSNC 3EWEA 3PE7A 4PSXB 3NVNA 4FA9D 4J84A 5EMLB 3AL8A 4A2MA 4UI9R 5FQDA 2H9PA 5IC7A 1S4UX 4GQ1A 2PBIB 3DWLC 2HJBA 1XHMA 4J82A 5HE0B 5TEFA 1JOFA 3I7NA 4CY1A 3RFGA 3RMZD 4CZYA 1ERJA 1TYQC 5THAA 4FB1D 3FRXA 2OK6A 5K19A 5FLXg 1VYHC 3KRWB 2AGZA 2I3TA 2AGWA 4PSWB 3OL2B 4ES0A 5I5MA 2HYEA 4J78A 1XKSA 4O45A 2CN2A 3GREA 1NR0A 3SFZA 3IJ0A 4PC0A 1PI6A 4CZVA 3L4OD 5C2WB 3UVKA 1P22A 3I89A 4KFMB 2BCJB 3JPXA 3I7LA 2IUPA 5TEEA 1GG2B 4X61B 3L4MD 3SCYA 4J77A 4XEIC 2PM6B 2XYIA 3DM0A 3UVOA 3UVMA 3VH0A 4CY2A 4D6VA 2H14A 1K8KC 3SWSD 4LG9A 4Z8LA 4PXWA 4GM8A 3I7OA 4PBZA 2G99A 3N0EA 2HESX 5CYKA 2AGLA 4E5ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LG8 A;  2IUR A;  4H5I A;  3A0F A;  2XL2 A;  3SBR A;  1SHY B;  2AQ5 A;  4GGC A;  3UVL A;  3U4Y A;  2IWK A;  2Q7Q A;  3IJ1 A;  5IJ8 E;  3DXK C;  3F3F A;  3AH8 B;  4K3J B;  2B5N A;  2Z2P A;  3OTT A;  3RN0 D;  3OKY B;  2IAA A;  1GOT B;  3F3P A;  4ZN4 A;  5EMM B;  3MMY A;  4GZ8 A;  5B4W A;  4U1E I;  4CI1 A;  2OIZ A;  3IJC A;  1N6D A;  4FAV D;  3JZG A;  3ODT A;  3SVW D;  5I5J A;  4A11 B;  4IMM A;  5HQG A;  2YBA A;  5CXC A;  4A08 A;  4CZX A;  2P9N C;  2Z2N A;  1PEV A;  3EI3 A;  4ZOZ A;  4BH6 A;  2UZY B;  3SLE D;  3MKQ A;  2CNX A;  5CXB B;  4J86 A;  2H6N A;  4A0B B;  1PGU A;  2PM9 B;  5H14 A;  2CO0 A;  1MG2 A;  2CE8 A;  3DXM C;  3PXT D;  4PBY A;  4CI3 A;  5FXY A;  3DSM A;  3PXS D;  4MK0 B;  4L9O A;  2J57 G;  4A7J A;  4GQ2 P;  4ZOY A;  1MDA H;  2P9P C;  5KDO B;  4E54 B;  2H6K A;  1L0Q A;  4X60 B;  2B5L A;  3P4F A;  1OMW B;  3PVW B;  3RFH A;  4TZ4 A;  3MXX A;  4XYI A;  4BUJ C;  1QNI A;  3MZK A;  5IJ7 E;  2HKM A;  3V9F A;  4ZOV A;  5EM2 B;  1R5M A;  3I7P A;  5EAL A;  2IUV A;  3EI4 B;  4A09 A;  4O1Q D;  5FKQ A;  1K32 A;  2H47 A;  4AOW A;  3J81 g;  4ERQ A;  1GXR A;  3IIW A;  3AL8 B;  2P9L C;  1NEX B;  1OLZ A;  3JRP A;  2HJ4 A;  4OWR A;  4NSX A;  4BL0 A;  3RN1 D;  4FHL A;  3IIY A;  5AFU 3;  2AH1 A;  5AJA A;  1RI6 A;  5I5I A;  3EI1 B;  3I8C A;  5JWZ A;  5HE1 B;  2BBK H;  5HE3 B;  1MG3 A;  3NVX A;  3J80 g;  3BG0 A;  2B4E A;  2HKR A;  3VA6 A;  3EMH A;  4Y5R D;  3PSL A;  4A0A B;  1JMZ B;  3ORV D;  4YVD A;  4ZOX A;  2W18 A;  5HYN B;  2H3X A;  1SQ9 A;  3RRM C;  4FA4 D;  4CI2 A;  3EG6 A;  4GGD A;  2XL3 A;  1XIP A;  3JRO A;  4JSV C;  2CE9 A;  3F3G A;  2H68 A;  4CY5 A;  3RLM D;  1N6E A;  5FKT A;  2I0R A;  3ULE C;  2YNN A;  5EMJ B;  2OVR B;  3W15 A;  1N6F A;  5C2V B;  3EU7 A;  2YNP A;  1PBY B;  2P9K C;  5FKR A;  5A2Q g;  2GC4 A;  2Z2O A;  3OKT A;  2H6Q A;  3PXW D;  4QT8 A;  2H9M A;  3EI2 B;  3IKO A;  5H1M A;  4HDJ A;  4U7A A;  5SXM A;  4ERZ A;  4QRJ A;  3OL2 A;  5IT9 g;  4J8G A;  4E5Z B;  3KRX B;  4D0K A;  4FA1 D;  2GNQ A;  4JT5 C;  4L3G D;  3JB9 L;  4O9D A;  3GFC A;  4L3H D;  5FKS A;  3C9C A;  2UZX B;  2PM7 B;  3B7F A;  5EM2 A;  3SXT D;  5K1C C;  3OKW A;  3RSE C;  4N14 A;  2OVP B;  4Y7R A;  1GP2 B;  2AGX A;  2AGY A;  2B5M A;  4I79 A;  4FA5 D;  3JZN A;  2YB8 B;  4G56 B;  2CO0 C;  1U2V C;  3PSC B;  2XU7 A;  3HFQ A;  5EAP A;  4L1Q D;  4X63 B;  5AMS A;  4GQB B;  2OJY A;  3I7H A;  2I0T A;  4CC9 A;  4JD2 C;  5GXH A;  2TRC B;  3E0C A;  5C9Z B;  2J56 H;  3EI1 A;  1SQJ A;  3ZWL B;  5CXC B;  4J0X A;  4A08 B;  4JT6 C;  2H9L A;  5IGQ A;  4J79 A;  3BG1 A;  2H13 A;  2P9U C;  3C5M A;  3SBP A;  3EI3 B;  3UKU C;  3V5W B;  4A0A A;  3K26 A;  2OK4 A;  2YNO A;  5FA5 B;  4J8B A;  5H17 A;  5EAR A;  4GM3 A;  2I3S A;  4FWW A;  4O3U B;  2IWF A;  2J55 H;  4H5J A;  2GC7 A;  5GSA A;  5GXI A;  2QXV A;  4IA9 A;  5EMK B;  3I2N A;  3SJL D;  4J81 A;  4JSX C;  2IUQ A;  3OKY A;  4GM9 A;  3C99 A;  4JXM A;  3N0D A;  3AFC A;  3VGZ A;  4PNK B;  1A0R B;  4OZU A;  4ERY A;  1U4C A;  4AEZ A;  3UR4 A;  4CY3 A;  3CFS B;  3SMR A;  4X3E A;  4JSP C;  3I7K A;  4A11 A;  3FGB A;  3EI2 A;  5IGO A;  4CI8 A;  3AL9 A;  1FWX A;  2MTA H;  4A09 B;  2CN3 A;  2HXC A;  3MZL A;  2OVQ B;  4ESG A;  5CXB A;  3V7D B;  3PVU B;  4O3T B;  4A0B A;  2PM9 A;  3CIK B;  4K3I D;  4J87 A;  3CFV A;  1JJU B;  5TDH B;  2AH0 A;  1JMX B;  1YFQ A;  4XYH A;  3I8E A;  4EWR A;  4J73 A;  3UKR C;  4GGA A;  2QC5 A;  2YMU A;  2P9I C;  4QQE A;  1B9X A;  3SN6 B;  5TF2 A;  3SBQ A;  5GMK n;  3K27 A;  4E54 A;  3C75 H;  3FM0 A;  4R7A B;  5CYK B;  3UVN A;  3JAM g;  4LGN A;  3MKS B;  2EBS A;  5HE2 B;  2I0S A;  4A2L A;  2O9K A;  2H9N A;  3OW8 A;  4GMB A;  1TBG A;  4J0W A;  5EAM A;  3BWS A;  2G9A A;  1Q47 A;  4QL1 A;  4FAN D;  3NVQ A;  3SHF A;  3EI4 A;  2P9S C;  3JZH A;  1B9Y A;  4JSN C;  3EWE A;  3PE7 A;  4PSX B;  3NVN A;  4FA9 D;  4J84 A;  5EML B;  3AL8 A;  4A2M A;  4UI9 R;  5FQD A;  2H9P A;  5IC7 A;  1S4U X;  4GQ1 A;  2PBI B;  3DWL C;  2HJB A;  1XHM A;  4J82 A;  5HE0 B;  5TEF A;  1JOF A;  3I7N A;  4CY1 A;  3RFG A;  3RMZ D;  4CZY A;  1ERJ A;  1TYQ C;  5THA A;  4FB1 D;  3FRX A;  2OK6 A;  5K19 A;  5FLX g;  1VYH C;  3KRW B;  2AGZ A;  2I3T A;  2AGW A;  4PSW B;  3OL2 B;  4ES0 A;  5I5M A;  2HYE A;  4J78 A;  1XKS A;  4O45 A;  2CN2 A;  3GRE A;  1NR0 A;  3SFZ A;  3IJ0 A;  4PC0 A;  1PI6 A;  4CZV A;  3L4O D;  5C2W B;  3UVK A;  1P22 A;  3I89 A;  4KFM B;  2BCJ B;  3JPX A;  3I7L A;  2IUP A;  5TEE A;  1GG2 B;  4X61 B;  3L4M D;  3SCY A;  4J77 A;  4XEI C;  2PM6 B;  2XYI A;  3DM0 A;  3UVO A;  3UVM A;  3VH0 A;  4CY2 A;  4D6V A;  2H14 A;  1K8K C;  3SWS D;  4LG9 A;  4Z8L A;  4PXW A;  4GM8 A;  3I7O A;  4PBZ A;  2G99 A;  3N0E A;  2HES X;  5CYK A;  2AGL A;  4E5Z A; 
#chains in the Genus database with same CATH topology
 3T3P A;  4NBM A;  4LG8 A;  2IUR A;  4H5I A;  3A0F A;  2XL2 A;  3QHY B;  3SBR A;  1SHY B;  2AQ5 A;  4GGC A;  1I2M B;  4DNU A;  3UVL A;  3U4Y A;  3O4J A;  1H2Z A;  2IWK A;  2VDK A;  5E6R A;  2Q7Q A;  3IJ1 A;  5IJ8 E;  1YR2 A;  3DXK C;  3F3F A;  3AH8 B;  4K3J B;  2B5N A;  2Z2P A;  3OTT A;  4MMX A;  3RN0 D;  4NEN A;  3NIG A;  3OKY B;  3IUN A;  2IAA A;  1GOT B;  2JKX A;  3F3P A;  4ZN4 A;  5EMM B;  3MMY A;  4GZ8 A;  5B4W A;  4U1E I;  4CI1 A;  2OIZ A;  3K6S A;  3IJC A;  1N6D A;  1VE7 A;  4FAV D;  3JZG A;  3ODT A;  3SVW D;  5I5J A;  4A11 B;  4IMM A;  5HQG A;  1JV2 A;  2YBA A;  5CXC A;  4A08 A;  3EQ7 A;  4CZX A;  2P9N C;  2Z2N A;  1PEV A;  3EI3 A;  4ZOZ A;  4BH6 A;  2UZY B;  3SLE D;  3MKQ A;  2CNX A;  5CXB B;  4J86 A;  2H6N A;  4A0B B;  1PGU A;  2PM9 B;  5H14 A;  4WK0 A;  5E6U A;  2CO0 A;  1MG2 A;  2CE8 A;  3DXM C;  1A12 A;  3PXT D;  4PBY A;  4CI3 A;  5FXY A;  3DSM A;  3PXS D;  4MK0 B;  4L9O A;  2HU8 A;  2J57 G;  4A7J A;  4UM9 A;  4GQ2 P;  4MMY A;  4ZOY A;  1MDA H;  2P9P C;  5KDO B;  2EID A;  4E54 B;  2H6K A;  1L0Q A;  4X60 B;  2B5L A;  3K72 A;  3P4F A;  1OMW B;  5C86 A;  3PVW B;  3RFH A;  4TZ4 A;  3MXX A;  4XYI A;  4BUJ C;  1QNI A;  3MZK A;  5IJ7 E;  2HKM A;  1VZ3 A;  3V9F A;  3K71 A;  4ZOV A;  5EM2 B;  1R5M A;  3I7P A;  1C9L A;  5EAL A;  2IUV A;  3EI4 B;  2EIC A;  4BP9 A;  4A09 A;  4O1Q D;  5FKQ A;  1K32 A;  2H47 A;  4AOW A;  3J81 g;  4ERQ A;  1GXR A;  3IIW A;  3IUR A;  3AL8 B;  1GOG A;  1NEX B;  2P9L C;  3GC3 B;  1OLZ A;  3JRP A;  2HJ4 A;  4MMZ A;  4OWR A;  4BP8 A;  1K3I A;  4NSX A;  4BL0 A;  1UOO A;  3RN1 D;  4FHL A;  2WQ8 A;  3IIY A;  5AFU 3;  2AH1 A;  5AJA A;  3MUN A;  3O4G A;  1RI6 A;  5I5I A;  4AMZ A;  3EI1 B;  1UTC A;  3I8C A;  3IUM A;  5M5T A;  5JWZ A;  1O6G A;  5HE1 B;  2BBK H;  5HE3 B;  1MG3 A;  3NVX A;  3J80 g;  3IUQ A;  3BG0 A;  2XDW A;  2B4E A;  2HKR A;  3VA6 A;  3EMH A;  2EIB A;  4Y5R D;  3PSL A;  4A0A B;  1JMZ B;  3ORV D;  4YVD A;  4ZOX A;  2W18 A;  1BPO A;  5HYN B;  2VDQ A;  2H3X A;  1SQ9 A;  3RRM C;  4FA4 D;  4CI2 A;  3EG6 A;  4GGD A;  2HU7 A;  2XL3 A;  1XIP A;  3JRO A;  4JSV C;  2CE9 A;  3F3G A;  2H68 A;  4CY5 A;  3RLM D;  1N6E A;  5FKT A;  5HDB A;  2I0R A;  4RE6 A;  3ULE C;  2YNN A;  5EMJ B;  2OVR B;  4AX4 A;  3W15 A;  1N6F A;  5C2V B;  4DNW A;  3EU7 A;  2YNP A;  1PBY B;  2P9K C;  5FKR A;  4G55 A;  2GC4 A;  5A2Q g;  2Z2O A;  3OKT A;  5E6S A;  4L1M A;  2H6Q A;  3PXW D;  4QT8 A;  2H9M A;  3EI2 B;  3IKO A;  5H1M A;  4HDJ A;  4U7A A;  5SXM A;  4ERZ A;  4QRJ A;  3OL2 A;  3EQ8 A;  4BCC A;  5M61 A;  5IT9 g;  4J8G A;  4E5Z B;  3KRX B;  4D0K A;  4FA1 D;  2GNQ A;  4JT5 C;  4L3G D;  3JB9 L;  4O9D A;  3GFC A;  4L3H D;  5FKS A;  3C9C A;  3KCI A;  2UZX B;  2PM7 B;  3B7F A;  4G1M A;  5EM2 A;  3SXT D;  5C92 A;  5K1C C;  3OKW A;  3RSE C;  4N14 A;  2OVP B;  4Y7R A;  1GP2 B;  2AGX A;  2AGY A;  2B5M A;  4I79 A;  4FA5 D;  3MUO A;  3JZN A;  2YB8 B;  3OF7 A;  4G56 B;  2CO0 C;  1U2V C;  3PSC B;  2XU7 A;  3HFQ A;  5EAP A;  4L1Q D;  4X63 B;  5AMS A;  4GQB B;  2OJY A;  3I7H A;  4O02 A;  2I0T A;  2VDP A;  4CC9 A;  4Z7N A;  4JD2 C;  5GXH A;  2TRC B;  3E0C A;  1O6F A;  1QFM A;  3QI0 A;  5C9Z B;  2J56 H;  3EI1 A;  1M1X A;  4Z7O A;  1SQJ A;  2BKL A;  3ZWL B;  3NIF A;  5CXC B;  4J0X A;  4A08 B;  4D9S A;  4JT6 C;  2H9L A;  5IGQ A;  4J79 A;  3O4H A;  4BCD A;  3BG1 A;  2H13 A;  2P9U C;  3C5M A;  3SBP A;  3EI3 B;  3UKU C;  3V5W B;  4UM8 A;  4JHN A;  4A0A A;  1E8N A;  3K26 A;  2OK4 A;  2YNO A;  5FA5 B;  4J8B A;  5H17 A;  5EAR A;  4GM3 A;  4AMY A;  1T2X A;  2I3S A;  4FWW A;  4O3U B;  2IWF A;  2J55 H;  4H5J A;  2GC7 A;  5GSA A;  5GXI A;  2QXV A;  4IA9 A;  4O2W A;  5EMK B;  3I2N A;  3ZDX A;  3SJL D;  4J81 A;  2VDM A;  4JSX C;  2VDO A;  4QAM A;  2IUQ A;  3ZE2 A;  3EQ9 A;  3FCS A;  1GOH A;  1QFS A;  3C99 A;  3OKY A;  4GM9 A;  4JXM A;  3N0D A;  3ZE1 A;  3AFC A;  3VGZ A;  4PNK B;  1A0R B;  2VZ1 A;  3NID A;  3MVD K;  4OZU A;  5M5R A;  4ERY A;  1U4C A;  4AEZ A;  3UR4 A;  4CY3 A;  3CFS B;  3SMR A;  4X3E A;  4JSP C;  3I7K A;  4A11 A;  2HU5 A;  3FGB A;  2QR5 A;  4AN1 A;  3EI2 A;  1H2X A;  5FFO A;  2VC2 A;  5IGO A;  1E8M A;  4CI8 A;  3AL9 A;  1FWX A;  2MTA H;  1JTD B;  2CN3 A;  4A09 B;  2HXC A;  3MZL A;  1VZ2 A;  4WK4 A;  2OVQ B;  4ESG A;  5CXB A;  5FFG A;  3V7D B;  1C9I A;  3PVU B;  4O3T B;  4A0B A;  2PM9 A;  3CIK B;  2EIE A;  4K3I D;  4J87 A;  4BCB A;  3CFV A;  1JJU B;  5TDH B;  3VI4 A;  2VDN A;  2AH0 A;  1JMX B;  1YFQ A;  4XYH A;  3I8E A;  4EWR A;  4J73 A;  3UKR C;  4GGA A;  4DNV A;  2QC5 A;  2YMU A;  2P9I C;  4QQE A;  1B9X A;  3SN6 B;  5TF2 A;  3SBQ A;  4AN0 A;  3ZDZ A;  5GMK n;  3K27 A;  4E54 A;  3C75 H;  3FM0 A;  4R7A B;  5CYK B;  3UVN A;  3JAM g;  4JHP C;  5M5V A;  4LGN A;  3MKS B;  2EBS A;  5HE2 B;  2I0S A;  4A2L A;  2O9K A;  2H9N A;  3OW8 A;  4GMB A;  1TBG A;  4J0W A;  5EAM A;  3BWS A;  2G9A A;  1Q47 A;  4QL1 A;  3VI3 A;  4FAN D;  3NVQ A;  3SHF A;  3EI4 A;  2P9S C;  3JZH A;  2XZG A;  1B9Y A;  2VDL A;  4JSN C;  4Z7Q A;  3EWE A;  3PE7 A;  4PSX B;  3NVN A;  4RE5 A;  4J84 A;  4FA9 D;  3V4P A;  5EML B;  3AL8 A;  4A2M A;  4UI9 R;  5FQD A;  2H9P A;  2VZ3 A;  5IC7 A;  1S4U X;  4GQ1 A;  3GD1 I;  2PBI B;  3DWL C;  2HJB A;  1XHM A;  4J82 A;  5HE0 B;  5TEF A;  2VDR A;  5M5U A;  1JOF A;  3I7N A;  4NAA A;  4CY1 A;  3RFG A;  3RMZ D;  3IVM A;  4CZY A;  1ERJ A;  3IJE A;  1TYQ C;  5THA A;  3T3M A;  4FB1 D;  3FRX A;  1GOF A;  2OK6 A;  5K19 A;  5FLX g;  1VYH C;  3DDU A;  3KRW B;  2AGZ A;  2I3T A;  2AGW A;  4PSW B;  3OL2 B;  4ES0 A;  5I5M A;  2HYE A;  4WK2 A;  4J78 A;  3O4I A;  3IUJ A;  1XKS A;  1H2W A;  1U8C A;  3ZE0 A;  4O45 A;  2CN2 A;  3GRE A;  2QZP A;  3V4V A;  1NR0 A;  3SFZ A;  3IJ0 A;  1VE6 A;  4PC0 A;  1PI6 A;  4NC4 A;  4CZV A;  3L4O D;  5C2W B;  3UVK A;  1P22 A;  3I89 A;  4KFM B;  2BCJ B;  3JPX A;  3I7L A;  1H2Y A;  2IUP A;  4WJK A;  1GG2 B;  5TEE A;  4X61 B;  3L4M D;  3SCY A;  4J77 A;  4XEI C;  2PM6 B;  2XYI A;  3IUL A;  3DM0 A;  3UVO A;  3UVM A;  3VH0 A;  2XE4 A;  1E5T A;  4CY2 A;  4D6V A;  2H14 A;  4G1E A;  1K8K C;  3SWS D;  4LG9 A;  1UOP A;  4Z8L A;  4PXW A;  1TYE A;  3I7O A;  4GM8 A;  4PBZ A;  2G99 A;  3N0E A;  3ZDY A;  4IRZ A;  5M5S A;  1L5G A;  2HES X;  5CYK A;  3FCU A;  2AGL A;  4E5Z A;  1UOQ A; 
#chains in the Genus database with same CATH homology
 4LG8 A;  2IUR A;  4H5I A;  3A0F A;  2XL2 A;  3SBR A;  1SHY B;  2AQ5 A;  4GGC A;  3UVL A;  3U4Y A;  2IWK A;  2Q7Q A;  3IJ1 A;  5IJ8 E;  3DXK C;  3F3F A;  3AH8 B;  4K3J B;  2B5N A;  2Z2P A;  3OTT A;  3RN0 D;  3OKY B;  2IAA A;  1GOT B;  3F3P A;  4ZN4 A;  5EMM B;  3MMY A;  4GZ8 A;  5B4W A;  4U1E I;  4CI1 A;  2OIZ A;  3IJC A;  1N6D A;  4FAV D;  3JZG A;  3ODT A;  3SVW D;  5I5J A;  4A11 B;  4IMM A;  5HQG A;  2YBA A;  5CXC A;  4A08 A;  4CZX A;  2P9N C;  2Z2N A;  1PEV A;  3EI3 A;  4ZOZ A;  4BH6 A;  2UZY B;  3SLE D;  3MKQ A;  2CNX A;  5CXB B;  4J86 A;  2H6N A;  4A0B B;  1PGU A;  2PM9 B;  5H14 A;  2CO0 A;  1MG2 A;  2CE8 A;  3DXM C;  3PXT D;  4PBY A;  4CI3 A;  5FXY A;  3DSM A;  3PXS D;  4MK0 B;  4L9O A;  2J57 G;  4A7J A;  4GQ2 P;  4ZOY A;  1MDA H;  2P9P C;  5KDO B;  4E54 B;  2H6K A;  1L0Q A;  4X60 B;  2B5L A;  3P4F A;  1OMW B;  3PVW B;  3RFH A;  4TZ4 A;  3MXX A;  4XYI A;  4BUJ C;  1QNI A;  3MZK A;  5IJ7 E;  2HKM A;  3V9F A;  4ZOV A;  5EM2 B;  1R5M A;  3I7P A;  5EAL A;  2IUV A;  3EI4 B;  4A09 A;  4O1Q D;  5FKQ A;  1K32 A;  2H47 A;  4AOW A;  3J81 g;  4ERQ A;  1GXR A;  3IIW A;  3AL8 B;  2P9L C;  1NEX B;  1OLZ A;  3JRP A;  2HJ4 A;  4OWR A;  4NSX A;  4BL0 A;  3RN1 D;  4FHL A;  3IIY A;  5AFU 3;  2AH1 A;  5AJA A;  1RI6 A;  5I5I A;  3EI1 B;  3I8C A;  5JWZ A;  5HE1 B;  2BBK H;  5HE3 B;  1MG3 A;  3NVX A;  3J80 g;  3BG0 A;  2B4E A;  2HKR A;  3VA6 A;  3EMH A;  4Y5R D;  3PSL A;  4A0A B;  1JMZ B;  3ORV D;  4YVD A;  4ZOX A;  2W18 A;  5HYN B;  2H3X A;  1SQ9 A;  3RRM C;  4FA4 D;  4CI2 A;  3EG6 A;  4GGD A;  2XL3 A;  1XIP A;  3JRO A;  4JSV C;  2CE9 A;  3F3G A;  2H68 A;  4CY5 A;  3RLM D;  1N6E A;  5FKT A;  2I0R A;  3ULE C;  2YNN A;  5EMJ B;  2OVR B;  3W15 A;  1N6F A;  5C2V B;  3EU7 A;  2YNP A;  1PBY B;  2P9K C;  5FKR A;  5A2Q g;  2GC4 A;  2Z2O A;  3OKT A;  2H6Q A;  3PXW D;  4QT8 A;  2H9M A;  3EI2 B;  3IKO A;  5H1M A;  4HDJ A;  4U7A A;  5SXM A;  4ERZ A;  4QRJ A;  3OL2 A;  5IT9 g;  4J8G A;  4E5Z B;  3KRX B;  4D0K A;  4FA1 D;  2GNQ A;  4JT5 C;  4L3G D;  3JB9 L;  4O9D A;  3GFC A;  4L3H D;  5FKS A;  3C9C A;  2UZX B;  2PM7 B;  3B7F A;  5EM2 A;  3SXT D;  5K1C C;  3OKW A;  3RSE C;  4N14 A;  2OVP B;  4Y7R A;  1GP2 B;  2AGX A;  2AGY A;  2B5M A;  4I79 A;  4FA5 D;  3JZN A;  2YB8 B;  4G56 B;  2CO0 C;  1U2V C;  3PSC B;  2XU7 A;  3HFQ A;  5EAP A;  4L1Q D;  4X63 B;  5AMS A;  4GQB B;  2OJY A;  3I7H A;  2I0T A;  4CC9 A;  4JD2 C;  5GXH A;  2TRC B;  3E0C A;  5C9Z B;  2J56 H;  3EI1 A;  1SQJ A;  3ZWL B;  5CXC B;  4J0X A;  4A08 B;  4JT6 C;  2H9L A;  5IGQ A;  4J79 A;  3BG1 A;  2H13 A;  2P9U C;  3C5M A;  3SBP A;  3EI3 B;  3UKU C;  3V5W B;  4A0A A;  3K26 A;  2OK4 A;  2YNO A;  5FA5 B;  4J8B A;  5H17 A;  5EAR A;  4GM3 A;  2I3S A;  4FWW A;  4O3U B;  2IWF A;  2J55 H;  4H5J A;  2GC7 A;  5GSA A;  5GXI A;  2QXV A;  4IA9 A;  5EMK B;  3I2N A;  3SJL D;  4J81 A;  4JSX C;  2IUQ A;  3OKY A;  4GM9 A;  3C99 A;  4JXM A;  3N0D A;  3AFC A;  3VGZ A;  4PNK B;  1A0R B;  4OZU A;  4ERY A;  1U4C A;  4AEZ A;  3UR4 A;  4CY3 A;  3CFS B;  3SMR A;  4X3E A;  4JSP C;  3I7K A;  4A11 A;  3FGB A;  3EI2 A;  5IGO A;  4CI8 A;  3AL9 A;  1FWX A;  2MTA H;  4A09 B;  2CN3 A;  2HXC A;  3MZL A;  2OVQ B;  4ESG A;  5CXB A;  3V7D B;  3PVU B;  4O3T B;  4A0B A;  2PM9 A;  3CIK B;  4K3I D;  4J87 A;  3CFV A;  1JJU B;  5TDH B;  2AH0 A;  1JMX B;  1YFQ A;  4XYH A;  3I8E A;  4EWR A;  4J73 A;  3UKR C;  4GGA A;  2QC5 A;  2YMU A;  2P9I C;  4QQE A;  1B9X A;  3SN6 B;  5TF2 A;  3SBQ A;  5GMK n;  3K27 A;  4E54 A;  3C75 H;  3FM0 A;  4R7A B;  5CYK B;  3UVN A;  3JAM g;  4LGN A;  3MKS B;  2EBS A;  5HE2 B;  2I0S A;  4A2L A;  2O9K A;  2H9N A;  3OW8 A;  4GMB A;  1TBG A;  4J0W A;  5EAM A;  3BWS A;  2G9A A;  1Q47 A;  4QL1 A;  4FAN D;  3NVQ A;  3SHF A;  3EI4 A;  2P9S C;  3JZH A;  1B9Y A;  4JSN C;  3EWE A;  3PE7 A;  4PSX B;  3NVN A;  4FA9 D;  4J84 A;  5EML B;  3AL8 A;  4A2M A;  4UI9 R;  5FQD A;  2H9P A;  5IC7 A;  1S4U X;  4GQ1 A;  2PBI B;  3DWL C;  2HJB A;  1XHM A;  4J82 A;  5HE0 B;  5TEF A;  1JOF A;  3I7N A;  4CY1 A;  3RFG A;  3RMZ D;  4CZY A;  1ERJ A;  1TYQ C;  5THA A;  4FB1 D;  3FRX A;  2OK6 A;  5K19 A;  5FLX g;  1VYH C;  3KRW B;  2AGZ A;  2I3T A;  2AGW A;  4PSW B;  3OL2 B;  4ES0 A;  5I5M A;  2HYE A;  4J78 A;  1XKS A;  4O45 A;  2CN2 A;  3GRE A;  1NR0 A;  3SFZ A;  3IJ0 A;  4PC0 A;  1PI6 A;  4CZV A;  3L4O D;  5C2W B;  3UVK A;  1P22 A;  3I89 A;  4KFM B;  2BCJ B;  3JPX A;  3I7L A;  2IUP A;  5TEE A;  1GG2 B;  4X61 B;  3L4M D;  3SCY A;  4J77 A;  4XEI C;  2PM6 B;  2XYI A;  3DM0 A;  3UVO A;  3UVM A;  3VH0 A;  4CY2 A;  4D6V A;  2H14 A;  1K8K C;  3SWS D;  4LG9 A;  4Z8L A;  4PXW A;  4GM8 A;  3I7O A;  4PBZ A;  2G99 A;  3N0E A;  2HES X;  5CYK A;  2AGL A;  4E5Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...