2IURA

Crystal structure of n-quinol form of aromatic amine dehydrogenase (aadh) from alcaligenes faecalis, form a cocrystal
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
360
structure length
360
Chain Sequence
REVLTGGHSVSAPQENRIYVMDSVFMHLTESRVHVYDYTNGKFLGMVPTAFNGHVQVSNDGKKIYTMTTYHERITRGKRSDVVEVWDADKLTFEKEISLPPKRVQGLNYDGLFRQTTDGKFIVLQNASPATSIGIVDVAKGDYVEDVTAAAGCWSVIPQPNRPRSFMTICGDGGLLTINLGEDGKVASQSRSKQMFSVKDDPIFIAPALDKDKAHFVSYYGNVYSADFSGDEVKVDGPWSLLNDEDKAKNWVPGGYNLVGLHRASGRMYVFMHPDGKEGTHKFPAAEIWVMDTKTKQRVARIPGRDALSMTIDQQRNLMLTLDGGNVNVYDISQPEPKLLRTIEGAAEASLQVQFHPVGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AROMATIC AMINE DEHYDROGENASE ALPHA SUBUNIT
publication title Atomic Level Insight Into the Oxidative Half-Reaction of Aromatic Amine Dehydrogenase.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 96
structure length 360
sequence length 360
chains with identical sequence B
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2006-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2iurA01
4J73A 4PBZA 3IKOA 2CN3A 3UVNA 1OMWB 1SQ9A 2I3SA 2IUQA 4PSXB 4J0XA 3K26A 3V9FA 4J78A 2B5LA 4GQBB 3UVLA 4PNKB 3I7LA 3PVUB 2BCJB 3SFZA 1SQJA 5I5MA 4GGDA 3NVNA 4H5JA 1GOTB 2P9IC 3RN1D 2IAAA 4N14A 4GGAA 4QL1A 2H9PA 2J56H 4MK0B 4A09B 4AEZA 4L9OA 3I8EA 3PVWB 3RN0D 4O9DA 4O1QD 5TEFA 1U2VC 5GMKn 4Z8LA 3OW8A 3MKQA 3OTTA 3ORVD 4BH6A 4LG8A 3IJ1A 1A0RB 4E54A 4X63B 1YFQA 3F3FA 2XU7A 2PM7B 4J84A 4FA4D 1VYHC 2P9NC 3EU7A 2GC7A 1XIPA 4JSPC 1S4UX 5IGQA 3JAMg 2OK4A 1K8KC 4X3EA 4A11A 2IURA 4ERYA 5FLXg 3UKUC 4ZOVA 2UZYB 4OWRA 3IIYA 5TDHB 3SN6B 3J81g 3CIKB 4CI3A 5IT9g 3JROA 3PE7A 5B4WA 2OVPB 2MTAH 2IUVA 5H1MA 3JZHA 2H47A 4PXWA 3VA6A 5IJ7E 4FAND 3V5WB 5HE2B 5AFU3 5GXIA 4G56B 3JZNA 4CI2A 3W15A 4J8BA 4QRJA 3F3PA 4J79A 1XKSA 4AOWA 1N6DA 5GXHA 2IWFA 5EM2A 3SWSD 2CN2A 4Y5RD 3OKTA 2PM6B 3CFSB 4ZOYA 3HFQA 3KRWB 5THAA 4KFMB 4L3HD 4U1EI 5FKSA 3UR4A 2AQ5A 2HKRA 3DWLC 2OIZA 5C9ZB 3SHFA 3RSEC 2CE8A 3C5MA 5FA5B 2CNXA 3RRMC 3EI2A 2PM9A 4X60B 3EG6A 3GFCA 4ES0A 1RI6A 3IJ0A 4CI8A 3I89A 1TBGA 3DSMA 2H6QA 5EMKB 4GZ8A 2H9MA 4K3ID 2AGZA 3MKSB 2P9UC 3VH0A 3UVOA 1U4CA 3PXWD 3OKYA 1JMXB 4XEIC 4D6VA 5CYKA 4IMMA 5CXBA 5FQDA 1QNIA 3I2NA 2QXVA 4JT5C 4ERQA 5AMSA 1N6FA 3BG0A 4E54B 2H14A 4J82A 4BUJC 5KDOB 2H68A 3DXKC 4CY3A 1JMZB 5EARA 4E5ZA 4NSXA 3JB9L 4A08A 5IJ8E 4CY1A 5I5JA 1GG2B 4PSWB 4A0BA 4CZVA 4A7JA 3PSLA 5HE3B 4JD2C 1TYQC 3SLED 5FKTA 3P4FA 4L3GD 3MXXA 1Q47A 3F3GA 1NEXB 4QT8A 3C9CA 4A11B 3EWEA 3EI3A 1XHMA 5H17A 2I3TA 5FXYA 3AH8B 2B5NA 5HE1B 2OJYA 4J81A 2YNPA 2Z2NA 1L0QA 3SBRA 2AGXA 2W18A 4PC0A 3RLMD 3PSCB 5I5IA 2G99A 4ZOZA 4QQEA 5EALA 3DXMC 4CY5A 4YVDA 4ERZA 3L4MD 1B9YA 4JSVC 5EM2B 2HESX 4GQ1A 4GQ2P 3I7KA 4IA9A 3A0FA 4GGCA 5K19A 3OKWA 2HYEA 4JSNC 3MZLA 1PI6A 4U7AA 5FKRA 4J8GA 2YBAA 2CE9A 3DM0A 2I0RA 3L4OD 2YNNA 5TEEA 3I7NA 3SJLD 2J57G 4OZUA 4D0KA 4LG9A 4FWWA 3EI2B 2H6NA 2PM9B 3SMRA 3UVMA 5A2Qg 2O9KA 5EAPA 4O3TB 5SXMA 2J55H 2P9KC 3I7HA 2P9LC 3I8CA 1JOFA 2CO0A 2AGYA 4JSXC 3V7DB 3OKYB 4UI9R 4EWRA 3SVWD 3I7OA 3J80g 3MMYA 5HQGA 2IUPA 4X61B 2YNOA 2IWKA 3EI4B 3E0CA 5H14A 5CYKB 3RFHA 2Z2OA 4ESGA 3ULEC 5CXBB 4A2MA 1NR0A 2H9NA 5HE0B 3CFVA 3ZWLB 3AFCA 3EI4A 3NVQA 2CO0C 3K27A 2OVRB 3N0EA 5K1CC 3EI1A 4E5ZB 4A08B 3OL2A 5C2WB 4A0BB 5EMJB 3BG1A 2PBIB 3B7FA 4J87A 1PGUA 3AL8A 5AJAA 3SBQA 3VGZA 4BL0A 4CY2A 2G9AA 1PBYB 4GM9A 4HDJA 1P22A 2GC4A 4O45A 5IGOA 3PXSD 1MDAH 2P9PC 4XYHA 3EI3B 4CI1A 1PEVA 3NVXA 2H9LA 5IC7A 2TRCB 4JXMA 3FRXA 4I79A 1K32A 2OVQB 4FA1D 2EBSA 4J86A 3GREA 2AH1A 2I0TA 3UVKA 2AH0A 3C75H 4CZXA 5FKQA 2AGLA 4JT6C 4CC9A 2I0SA 3BWSA 4H5IA 2HJBA 2XL3A 2B5MA 5CXCB 5EMLB 4A09A 4FA9D 3SCYA 2BBKH 1FWXA 2GNQA 1N6EA 2UZXB 3AL9A 3SBPA 5JWZA 4J0WA 5EMMB 2HJ4A 4XYIA 5CXCA 4GM3A 1OLZA 3U4YA 2YMUA 4GM8A 1MG2A 4FAVD 4A2LA 5C2VB 4ZN4A 1B9XA 2Q7QA 5EAMA 1ERJA 4FB1D 2OK6A 3JZGA 3PXTD 3RFGA 2B4EA 2P9SC 2QC5A 4K3JB 2Z2PA 2H6KA 4ZOXA 3JRPA 2AGWA 3I7PA 4FHLA 3FGBA 4LGNA 3UKRC 2HXCA 3N0DA 5GSAA 1JJUB 4A0AB 4O3UB 3IIWA 1GXRA 2H13A 2H3XA 1GP2B 3FM0A 3JPXA 1R5MA 2XL2A 4FA5D 2XYIA 3MZKA 4J77A 3EMHA 1SHYB 4A0AA 4TZ4A 1MG3A 4L1QD 5HYNB 3EI1B 3C99A 3OL2B 3RMZD 4GMBA 4CZYA 4PBYA 3ODTA 3AL8B 2YB8B 5TF2A 3KRXB 4Y7RA 4R7AB 2HKMA 3SXTD 3IJCA
chains in the Genus database with same CATH superfamily
2EIEA 4BP9A 4J73A 2VDKA 4PBZA 3IKOA 2CN3A 3UVNA 1OMWB 1SQ9A 2I3SA 2IUQA 4PSXB 4J0XA 3K26A 3V9FA 4J78A 2B5LA 4GQBB 3UVLA 4PNKB 3I7LA 5M5RA 3PVUB 3OF7A 2BCJB 3SFZA 1SQJA 5I5MA 2VDMA 1H2WA 3QI0A 1JV2A 4BCBA 4GGDA 3NVNA 4H5JA 1GOTB 2QZPA 2P9IC 3RN1D 2IAAA 4N14A 4GGAA 4QL1A 2H9PA 2J56H 4MK0B 4A09B 4AEZA 4L9OA 3I8EA 3PVWB 3RN0D 4DNVA 4O9DA 1TYEA 4O1QD 5TEFA 1U2VC 5GMKn 4Z8LA 3KCIA 3O4HA 3OW8A 3MKQA 3OTTA 4UM9A 3ORVD 4BH6A 4LG8A 3IJ1A 1A0RB 4E54A 4X63B 1YFQA 3F3FA 2XU7A 2PM7B 4J84A 3IURA 3IULA 4NC4A 4FA4D 5C92A 1VYHC 2P9NC 3EU7A 2GC7A 3MVDK 1E8MA 1XIPA 4G1MA 4JSPC 1S4UX 5IGQA 1C9LA 3JAMg 2OK4A 3GC3B 1K8KC 4X3EA 4A11A 2EIDA 2IURA 4ERYA 5FLXg 3UKUC 4ZOVA 1K3IA 2UZYB 4OWRA 3IIYA 3O4GA 5TDHB 3SN6B 3J81g 4BP8A 3CIKB 4CI3A 4DNWA 5IT9g 3JROA 3PE7A 5B4WA 2OVPB 2MTAH 2IUVA 5H1MA 3JZHA 2H47A 4PXWA 3VA6A 5IJ7E 4FAND 3V5WB 3T3PA 1VE7A 5HE2B 5AFU3 5GXIA 4G56B 3JZNA 4CI2A 1T2XA 2XZGA 3W15A 4J8BA 4QRJA 1C9IA 3F3PA 4J79A 1VZ3A 1VE6A 1XKSA 4AOWA 1N6DA 5GXHA 2IWFA 5EM2A 3SWSD 2CN2A 2QR5A 4Y5RD 1O6FA 3OKTA 2PM6B 4AN0A 3CFSB 4NENA 4G55A 4ZOYA 3HFQA 3KRWB 5THAA 4KFMB 4L3HD 4U1EI 5FKSA 3UR4A 4BCDA 2AQ5A 3V4VA 2HKRA 3DWLC 2OIZA 5C9ZB 3SHFA 3RSEC 5HDBA 5M61A 2CE8A 3C5MA 5FA5B 2CNXA 3RRMC 3EI2A 2PM9A 4X60B 3EG6A 4MMXA 4Z7QA 3GFCA 1YR2A 4ES0A 1RI6A 3NIDA 4NAAA 3IJ0A 4CI8A 3I89A 1TBGA 3DSMA 2H6QA 5EMKB 4GZ8A 2H9MA 4K3ID 2AGZA 3MKSB 2P9UC 3VH0A 3UVOA 1U4CA 3PXWD 2WQ8A 3OKYA 4WK0A 1JMXB 4XEIC 4D6VA 5CYKA 4IMMA 2BKLA 5CXBA 3ZDXA 5FQDA 1QNIA 3I2NA 2VDNA 1H2XA 2QXVA 4JT5C 4ERQA 5AMSA 1N6FA 3BG0A 4E54B 2H14A 4J82A 4BUJC 5KDOB 1GOGA 2H68A 3DXKC 4CY3A 5FFGA 1JMZB 5EARA 4E5ZA 4NSXA 3JB9L 4A08A 5IJ8E 4CY1A 5I5JA 1GG2B 4PSWB 4WK2A 4A0BA 4CZVA 4A7JA 3PSLA 5HE3B 4JD2C 1TYQC 3SLED 5FKTA 3ZDYA 3P4FA 4L3GD 3MXXA 1Q47A 3F3GA 1NEXB 3EQ8A 4QT8A 3C9CA 4A11B 4AMYA 3EWEA 3EI3A 1JTDB 3K71A 1XHMA 4WJKA 2I3TA 5FXYA 5H17A 2HU8A 3AH8B 2B5NA 4G1EA 5HE1B 2OJYA 4J81A 2YNPA 2Z2NA 2VZ1A 1L0QA 3SBRA 2AGXA 2W18A 4JHNA 3QHYB 2EIBA 4PC0A 1UOOA 3RLMD 3PSCB 1L5GA 5I5IA 2G99A 4ZOZA 1H2YA 4BCCA 4QQEA 5EALA 1UOPA 3DXMC 4CY5A 1H2ZA 4YVDA 3ZE2A 4ERZA 3L4MD 1B9YA 4JSVC 3MUNA 5EM2B 3GD1I 2HESX 4GQ1A 2VDOA 4GQ2P 3I7KA 4IA9A 3A0FA 4GGCA 5K19A 3OKWA 2HYEA 4JSNC 3MZLA 1PI6A 4U7AA 5FKRA 4J8GA 2YBAA 2CE9A 1E5TA 5FFOA 3DM0A 2I0RA 3L4OD 2YNNA 3NIGA 5TEEA 3I7NA 4UM8A 3SJLD 2J57G 4OZUA 4D0KA 4LG9A 4FWWA 1UTCA 3EI2B 2H6NA 2PM9B 3SMRA 3O4JA 3UVMA 5A2Qg 2O9KA 5EAPA 4O3TB 5E6UA 4AX4A 3ZE1A 5SXMA 2J55H 2P9KC 3I7HA 2P9LC 2XE4A 3I8CA 1JOFA 2CO0A 2AGYA 4JSXC 3V7DB 1QFSA 3ZE0A 3OKYB 4UI9R 4DNUA 4EWRA 4AMZA 3SVWD 3I7OA 4MMZA 3MMYA 5HQGA 2IUPA 4X61B 2YNOA 3J80g 2IWKA 3EI4B 3E0CA 5H14A 5CYKB 3RFHA 2Z2OA 4ESGA 3ULEC 5CXBB 4A2MA 1NR0A 2H9NA 5HE0B 3IJEA 1M1XA 3CFVA 3ZWLB 3AFCA 3EI4A 4O02A 5M5UA 3NVQA 2CO0C 3K27A 1QFMA 2OVRB 3N0EA 5K1CC 1GOHA 4AN1A 3EI1A 4E5ZB 4RE5A 4A08B 3OL2A 5C2WB 4A0BB 5EMJB 3BG1A 2PBIB 3B7FA 4J87A 1PGUA 3AL8A 3MUOA 2EICA 5AJAA 3SBQA 3VGZA 4BL0A 4CY2A 2G9AA 1PBYB 4GM9A 2VDPA 4HDJA 1P22A 4QAMA 2GC4A 4O45A 5IGOA 3PXSD 1VZ2A 1MDAH 3EQ7A 2P9PC 3IVMA 4XYHA 3EI3B 3IUQA 4CI1A 5M5VA 1PEVA 3NVXA 3IUMA 2H9LA 5IC7A 2TRCB 4I79A 3FRXA 1K32A 4JXMA 2OVQB 4FA1D 5E6RA 2EBSA 4J86A 2HU7A 3GREA 4O2WA 2AH1A 2I0TA 3UVKA 5E6SA 2AH0A 3C75H 4CZXA 5FKQA 2AGLA 1A12A 4JT6C 3VI3A 4CC9A 1I2MB 2I0SA 3BWSA 3IUJA 4H5IA 3EQ9A 2HJBA 2XL3A 2B5MA 5CXCB 3T3MA 5EMLB 3NIFA 4A09A 3K6SA 4FA9D 3SCYA 2BBKH 1FWXA 2GNQA 1N6EA 2UZXB 3AL9A 3SBPA 5JWZA 4J0WA 5EMMB 2HJ4A 4XYIA 5CXCA 4GM3A 1OLZA 3U4YA 2YMUA 4GM8A 1MG2A 4FAVD 2VDRA 4A2LA 5C2VB 4ZN4A 1B9XA 2VDQA 3ZDZA 2Q7QA 5EAMA 1ERJA 5M5SA 2JKXA 4FB1D 2OK6A 1O6GA 3FCSA 3JZGA 3PXTD 3RFGA 2B4EA 2P9SC 2QC5A 3VI4A 1BPOA 4K3JB 2Z2PA 2H6KA 4ZOXA 3JRPA 1GOFA 4L1MA 2AGWA 1UOQA 3I7PA 4FHLA 3V4PA 3FGBA 4LGNA 4D9SA 4JHPC 3UKRC 2HXCA 3N0DA 5C86A 5GSAA 2VZ3A 1JJUB 4A0AB 4O3UB 4RE6A 3IIWA 1E8NA 4Z7OA 1GXRA 2H13A 2HU5A 2XDWA 2H3XA 1GP2B 3FM0A 3JPXA 1R5MA 2XL2A 4FA5D 2VDLA 2XYIA 3MZKA 4J77A 3K72A 3EMHA 1SHYB 4A0AA 4TZ4A 4WK4A 3O4IA 4MMYA 1MG3A 4L1QD 3FCUA 5HYNB 4IRZA 3EI1B 3C99A 3OL2B 3RMZD 4GMBA 4CZYA 4Z7NA 5M5TA 3DDUA 1U8CA 4PBYA 3ODTA 3AL8B 4NBMA 2YB8B 5TF2A 3IUNA 3KRXB 4Y7RA 2VC2A 4R7AB 2HKMA 3SXTD 3IJCA
chains in the Genus database with same CATH topology
4J73A 4PBZA 3IKOA 2CN3A 3UVNA 1OMWB 1SQ9A 2I3SA 2IUQA 4PSXB 4J0XA 3K26A 3V9FA 4J78A 2B5LA 4GQBB 3UVLA 4PNKB 3I7LA 3PVUB 2BCJB 3SFZA 1SQJA 5I5MA 4GGDA 3NVNA 4H5JA 1GOTB 2P9IC 3RN1D 2IAAA 4N14A 4GGAA 4QL1A 2H9PA 2J56H 4MK0B 4A09B 4AEZA 4L9OA 3I8EA 3PVWB 3RN0D 4O9DA 4O1QD 5TEFA 1U2VC 5GMKn 4Z8LA 3OW8A 3MKQA 3OTTA 3ORVD 4BH6A 4LG8A 3IJ1A 1A0RB 4E54A 4X63B 1YFQA 3F3FA 2XU7A 2PM7B 4J84A 4FA4D 1VYHC 2P9NC 3EU7A 2GC7A 1XIPA 4JSPC 1S4UX 5IGQA 3JAMg 2OK4A 1K8KC 4X3EA 4A11A 2IURA 4ERYA 5FLXg 3UKUC 4ZOVA 2UZYB 4OWRA 3IIYA 5TDHB 3SN6B 3J81g 3CIKB 4CI3A 5IT9g 3JROA 3PE7A 5B4WA 2OVPB 2MTAH 2IUVA 5H1MA 3JZHA 2H47A 4PXWA 3VA6A 5IJ7E 4FAND 3V5WB 5HE2B 5AFU3 5GXIA 4G56B 3JZNA 4CI2A 3W15A 4J8BA 4QRJA 3F3PA 4J79A 1XKSA 4AOWA 1N6DA 5GXHA 2IWFA 5EM2A 3SWSD 2CN2A 4Y5RD 3OKTA 2PM6B 3CFSB 4ZOYA 3HFQA 3KRWB 5THAA 4KFMB 4L3HD 4U1EI 5FKSA 3UR4A 2AQ5A 2HKRA 3DWLC 2OIZA 5C9ZB 3SHFA 3RSEC 2CE8A 3C5MA 5FA5B 2CNXA 3RRMC 3EI2A 2PM9A 4X60B 3EG6A 3GFCA 4ES0A 1RI6A 3IJ0A 4CI8A 3I89A 1TBGA 3DSMA 2H6QA 5EMKB 4GZ8A 2H9MA 4K3ID 2AGZA 3MKSB 2P9UC 3VH0A 3UVOA 1U4CA 3PXWD 3OKYA 1JMXB 4XEIC 4D6VA 5CYKA 4IMMA 5CXBA 5FQDA 1QNIA 3I2NA 2QXVA 4JT5C 4ERQA 5AMSA 1N6FA 3BG0A 4E54B 2H14A 4J82A 4BUJC 5KDOB 2H68A 3DXKC 4CY3A 1JMZB 5EARA 4E5ZA 4NSXA 3JB9L 4A08A 5IJ8E 4CY1A 5I5JA 1GG2B 4PSWB 4A0BA 4CZVA 4A7JA 3PSLA 5HE3B 4JD2C 1TYQC 3SLED 5FKTA 3P4FA 4L3GD 3MXXA 1Q47A 3F3GA 1NEXB 4QT8A 3C9CA 4A11B 3EWEA 3EI3A 1XHMA 5H17A 2I3TA 5FXYA 3AH8B 2B5NA 5HE1B 2OJYA 4J81A 2YNPA 2Z2NA 1L0QA 3SBRA 2AGXA 2W18A 4PC0A 3RLMD 3PSCB 5I5IA 2G99A 4ZOZA 4QQEA 5EALA 3DXMC 4CY5A 4YVDA 4ERZA 3L4MD 1B9YA 4JSVC 5EM2B 2HESX 4GQ1A 4GQ2P 3I7KA 4IA9A 3A0FA 4GGCA 5K19A 3OKWA 2HYEA 4JSNC 3MZLA 1PI6A 4U7AA 5FKRA 4J8GA 2YBAA 2CE9A 3DM0A 2I0RA 3L4OD 2YNNA 5TEEA 3I7NA 3SJLD 2J57G 4OZUA 4D0KA 4LG9A 4FWWA 3EI2B 2H6NA 2PM9B 3SMRA 3UVMA 5A2Qg 2O9KA 5EAPA 4O3TB 5SXMA 2J55H 2P9KC 3I7HA 2P9LC 3I8CA 1JOFA 2CO0A 2AGYA 4JSXC 3V7DB 3OKYB 4UI9R 4EWRA 3SVWD 3I7OA 3J80g 3MMYA 5HQGA 2IUPA 4X61B 2YNOA 2IWKA 3EI4B 3E0CA 5H14A 5CYKB 3RFHA 2Z2OA 4ESGA 3ULEC 5CXBB 4A2MA 1NR0A 2H9NA 5HE0B 3CFVA 3ZWLB 3AFCA 3EI4A 3NVQA 2CO0C 3K27A 2OVRB 3N0EA 5K1CC 3EI1A 4E5ZB 4A08B 3OL2A 5C2WB 4A0BB 5EMJB 3BG1A 2PBIB 3B7FA 4J87A 1PGUA 3AL8A 5AJAA 3SBQA 3VGZA 4BL0A 4CY2A 2G9AA 1PBYB 4GM9A 4HDJA 1P22A 2GC4A 4O45A 5IGOA 3PXSD 1MDAH 2P9PC 4XYHA 3EI3B 4CI1A 1PEVA 3NVXA 2H9LA 5IC7A 2TRCB 4JXMA 3FRXA 4I79A 1K32A 2OVQB 4FA1D 2EBSA 4J86A 3GREA 2AH1A 2I0TA 3UVKA 2AH0A 3C75H 4CZXA 5FKQA 2AGLA 4JT6C 4CC9A 2I0SA 3BWSA 4H5IA 2HJBA 2XL3A 2B5MA 5CXCB 5EMLB 4A09A 4FA9D 3SCYA 2BBKH 1FWXA 2GNQA 1N6EA 2UZXB 3AL9A 3SBPA 5JWZA 4J0WA 5EMMB 2HJ4A 4XYIA 5CXCA 4GM3A 1OLZA 3U4YA 2YMUA 4GM8A 1MG2A 4FAVD 4A2LA 5C2VB 4ZN4A 1B9XA 2Q7QA 5EAMA 1ERJA 4FB1D 2OK6A 3JZGA 3PXTD 3RFGA 2B4EA 2P9SC 2QC5A 4K3JB 2Z2PA 2H6KA 4ZOXA 3JRPA 2AGWA 3I7PA 4FHLA 3FGBA 4LGNA 3UKRC 2HXCA 3N0DA 5GSAA 1JJUB 4A0AB 4O3UB 3IIWA 1GXRA 2H13A 2H3XA 1GP2B 3FM0A 3JPXA 1R5MA 2XL2A 4FA5D 2XYIA 3MZKA 4J77A 3EMHA 1SHYB 4A0AA 4TZ4A 1MG3A 4L1QD 5HYNB 3EI1B 3C99A 3OL2B 3RMZD 4GMBA 4CZYA 4PBYA 3ODTA 3AL8B 2YB8B 5TF2A 3KRXB 4Y7RA 4R7AB 2HKMA 3SXTD 3IJCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J73 A;  4PBZ A;  3IKO A;  2CN3 A;  3UVN A;  1OMW B;  1SQ9 A;  2I3S A;  2IUQ A;  4PSX B;  4J0X A;  3K26 A;  3V9F A;  4J78 A;  2B5L A;  4GQB B;  3UVL A;  4PNK B;  3I7L A;  3PVU B;  2BCJ B;  3SFZ A;  1SQJ A;  5I5M A;  4GGD A;  3NVN A;  4H5J A;  1GOT B;  2P9I C;  3RN1 D;  2IAA A;  4N14 A;  4GGA A;  4QL1 A;  2H9P A;  2J56 H;  4MK0 B;  4A09 B;  4AEZ A;  4L9O A;  3I8E A;  3PVW B;  3RN0 D;  4O9D A;  4O1Q D;  5TEF A;  1U2V C;  5GMK n;  4Z8L A;  3OW8 A;  3MKQ A;  3OTT A;  3ORV D;  4BH6 A;  4LG8 A;  3IJ1 A;  1A0R B;  4E54 A;  4X63 B;  1YFQ A;  3F3F A;  2XU7 A;  2PM7 B;  4J84 A;  4FA4 D;  1VYH C;  2P9N C;  3EU7 A;  2GC7 A;  1XIP A;  4JSP C;  1S4U X;  5IGQ A;  3JAM g;  2OK4 A;  1K8K C;  4X3E A;  4A11 A;  2IUR A;  4ERY A;  5FLX g;  3UKU C;  4ZOV A;  2UZY B;  4OWR A;  3IIY A;  5TDH B;  3SN6 B;  3J81 g;  3CIK B;  4CI3 A;  5IT9 g;  3JRO A;  3PE7 A;  5B4W A;  2OVP B;  2MTA H;  2IUV A;  5H1M A;  3JZH A;  2H47 A;  4PXW A;  3VA6 A;  5IJ7 E;  4FAN D;  3V5W B;  5HE2 B;  5AFU 3;  5GXI A;  4G56 B;  3JZN A;  4CI2 A;  3W15 A;  4J8B A;  4QRJ A;  3F3P A;  4J79 A;  1XKS A;  4AOW A;  1N6D A;  5GXH A;  2IWF A;  5EM2 A;  3SWS D;  2CN2 A;  4Y5R D;  3OKT A;  2PM6 B;  3CFS B;  4ZOY A;  3HFQ A;  3KRW B;  5THA A;  4KFM B;  4L3H D;  4U1E I;  5FKS A;  3UR4 A;  2AQ5 A;  2HKR A;  3DWL C;  2OIZ A;  5C9Z B;  3SHF A;  3RSE C;  2CE8 A;  3C5M A;  5FA5 B;  2CNX A;  3RRM C;  3EI2 A;  2PM9 A;  4X60 B;  3EG6 A;  3GFC A;  4ES0 A;  1RI6 A;  3IJ0 A;  4CI8 A;  3I89 A;  1TBG A;  3DSM A;  2H6Q A;  5EMK B;  4GZ8 A;  2H9M A;  4K3I D;  2AGZ A;  3MKS B;  2P9U C;  3VH0 A;  3UVO A;  1U4C A;  3PXW D;  3OKY A;  1JMX B;  4XEI C;  4D6V A;  5CYK A;  4IMM A;  5CXB A;  5FQD A;  1QNI A;  3I2N A;  2QXV A;  4JT5 C;  4ERQ A;  5AMS A;  1N6F A;  3BG0 A;  4E54 B;  2H14 A;  4J82 A;  4BUJ C;  5KDO B;  2H68 A;  3DXK C;  4CY3 A;  1JMZ B;  5EAR A;  4E5Z A;  4NSX A;  3JB9 L;  4A08 A;  5IJ8 E;  4CY1 A;  5I5J A;  1GG2 B;  4PSW B;  4A0B A;  4CZV A;  4A7J A;  3PSL A;  5HE3 B;  4JD2 C;  1TYQ C;  3SLE D;  5FKT A;  3P4F A;  4L3G D;  3MXX A;  1Q47 A;  3F3G A;  1NEX B;  4QT8 A;  3C9C A;  4A11 B;  3EWE A;  3EI3 A;  1XHM A;  5H17 A;  2I3T A;  5FXY A;  3AH8 B;  2B5N A;  5HE1 B;  2OJY A;  4J81 A;  2YNP A;  2Z2N A;  1L0Q A;  3SBR A;  2AGX A;  2W18 A;  4PC0 A;  3RLM D;  3PSC B;  5I5I A;  2G99 A;  4ZOZ A;  4QQE A;  5EAL A;  3DXM C;  4CY5 A;  4YVD A;  4ERZ A;  3L4M D;  1B9Y A;  4JSV C;  5EM2 B;  2HES X;  4GQ1 A;  4GQ2 P;  3I7K A;  4IA9 A;  3A0F A;  4GGC A;  5K19 A;  3OKW A;  2HYE A;  4JSN C;  3MZL A;  1PI6 A;  4U7A A;  5FKR A;  4J8G A;  2YBA A;  2CE9 A;  3DM0 A;  2I0R A;  3L4O D;  2YNN A;  5TEE A;  3I7N A;  3SJL D;  2J57 G;  4OZU A;  4D0K A;  4LG9 A;  4FWW A;  3EI2 B;  2H6N A;  2PM9 B;  3SMR A;  3UVM A;  5A2Q g;  2O9K A;  5EAP A;  4O3T B;  5SXM A;  2J55 H;  2P9K C;  3I7H A;  2P9L C;  3I8C A;  1JOF A;  2CO0 A;  2AGY A;  4JSX C;  3V7D B;  3OKY B;  4UI9 R;  4EWR A;  3SVW D;  3I7O A;  3J80 g;  3MMY A;  5HQG A;  2IUP A;  4X61 B;  2YNO A;  2IWK A;  3EI4 B;  3E0C A;  5H14 A;  5CYK B;  3RFH A;  2Z2O A;  4ESG A;  3ULE C;  5CXB B;  4A2M A;  1NR0 A;  2H9N A;  5HE0 B;  3CFV A;  3ZWL B;  3AFC A;  3EI4 A;  3NVQ A;  2CO0 C;  3K27 A;  2OVR B;  3N0E A;  5K1C C;  3EI1 A;  4E5Z B;  4A08 B;  3OL2 A;  5C2W B;  4A0B B;  5EMJ B;  3BG1 A;  2PBI B;  3B7F A;  4J87 A;  1PGU A;  3AL8 A;  5AJA A;  3SBQ A;  3VGZ A;  4BL0 A;  4CY2 A;  2G9A A;  1PBY B;  4GM9 A;  4HDJ A;  1P22 A;  2GC4 A;  4O45 A;  5IGO A;  3PXS D;  1MDA H;  2P9P C;  4XYH A;  3EI3 B;  4CI1 A;  1PEV A;  3NVX A;  2H9L A;  5IC7 A;  2TRC B;  4JXM A;  3FRX A;  4I79 A;  1K32 A;  2OVQ B;  4FA1 D;  2EBS A;  4J86 A;  3GRE A;  2AH1 A;  2I0T A;  3UVK A;  2AH0 A;  3C75 H;  4CZX A;  5FKQ A;  2AGL A;  4JT6 C;  4CC9 A;  2I0S A;  3BWS A;  4H5I A;  2HJB A;  2XL3 A;  2B5M A;  5CXC B;  5EML B;  4A09 A;  4FA9 D;  3SCY A;  2BBK H;  1FWX A;  2GNQ A;  1N6E A;  2UZX B;  3AL9 A;  3SBP A;  5JWZ A;  4J0W A;  5EMM B;  2HJ4 A;  4XYI A;  5CXC A;  4GM3 A;  1OLZ A;  3U4Y A;  2YMU A;  4GM8 A;  1MG2 A;  4FAV D;  4A2L A;  5C2V B;  4ZN4 A;  1B9X A;  2Q7Q A;  5EAM A;  1ERJ A;  4FB1 D;  2OK6 A;  3JZG A;  3PXT D;  3RFG A;  2B4E A;  2P9S C;  2QC5 A;  4K3J B;  2Z2P A;  2H6K A;  4ZOX A;  3JRP A;  2AGW A;  3I7P A;  4FHL A;  3FGB A;  4LGN A;  3UKR C;  2HXC A;  3N0D A;  5GSA A;  1JJU B;  4A0A B;  4O3U B;  3IIW A;  1GXR A;  2H13 A;  2H3X A;  1GP2 B;  3FM0 A;  3JPX A;  1R5M A;  2XL2 A;  4FA5 D;  2XYI A;  3MZK A;  4J77 A;  3EMH A;  1SHY B;  4A0A A;  4TZ4 A;  1MG3 A;  4L1Q D;  5HYN B;  3EI1 B;  3C99 A;  3OL2 B;  3RMZ D;  4GMB A;  4CZY A;  4PBY A;  3ODT A;  3AL8 B;  2YB8 B;  5TF2 A;  3KRX B;  4Y7R A;  4R7A B;  2HKM A;  3SXT D;  3IJC A; 
#chains in the Genus database with same CATH topology
 2EIE A;  4BP9 A;  4J73 A;  2VDK A;  4PBZ A;  3IKO A;  2CN3 A;  3UVN A;  1OMW B;  1SQ9 A;  2I3S A;  2IUQ A;  4PSX B;  4J0X A;  3K26 A;  3V9F A;  4J78 A;  2B5L A;  4GQB B;  3UVL A;  4PNK B;  3I7L A;  5M5R A;  3PVU B;  3OF7 A;  2BCJ B;  3SFZ A;  1SQJ A;  5I5M A;  2VDM A;  1H2W A;  3QI0 A;  1JV2 A;  4BCB A;  4GGD A;  3NVN A;  4H5J A;  1GOT B;  2QZP A;  2P9I C;  3RN1 D;  2IAA A;  4N14 A;  4GGA A;  4QL1 A;  2H9P A;  2J56 H;  4MK0 B;  4A09 B;  4AEZ A;  4L9O A;  3I8E A;  3PVW B;  3RN0 D;  4DNV A;  4O9D A;  1TYE A;  4O1Q D;  5TEF A;  1U2V C;  5GMK n;  4Z8L A;  3KCI A;  3O4H A;  3OW8 A;  3MKQ A;  3OTT A;  4UM9 A;  3ORV D;  4BH6 A;  4LG8 A;  3IJ1 A;  1A0R B;  4E54 A;  4X63 B;  1YFQ A;  3F3F A;  2XU7 A;  2PM7 B;  4J84 A;  3IUR A;  3IUL A;  4NC4 A;  4FA4 D;  5C92 A;  1VYH C;  2P9N C;  3EU7 A;  2GC7 A;  3MVD K;  1E8M A;  1XIP A;  4G1M A;  4JSP C;  1S4U X;  5IGQ A;  1C9L A;  3JAM g;  2OK4 A;  3GC3 B;  1K8K C;  4X3E A;  4A11 A;  2EID A;  2IUR A;  4ERY A;  5FLX g;  3UKU C;  4ZOV A;  1K3I A;  2UZY B;  4OWR A;  3IIY A;  3O4G A;  5TDH B;  3SN6 B;  3J81 g;  4BP8 A;  3CIK B;  4CI3 A;  4DNW A;  5IT9 g;  3JRO A;  3PE7 A;  5B4W A;  2OVP B;  2MTA H;  2IUV A;  5H1M A;  3JZH A;  2H47 A;  4PXW A;  3VA6 A;  5IJ7 E;  4FAN D;  3V5W B;  3T3P A;  1VE7 A;  5HE2 B;  5AFU 3;  5GXI A;  4G56 B;  3JZN A;  4CI2 A;  1T2X A;  2XZG A;  3W15 A;  4J8B A;  4QRJ A;  1C9I A;  3F3P A;  4J79 A;  1VZ3 A;  1VE6 A;  1XKS A;  4AOW A;  1N6D A;  5GXH A;  2IWF A;  5EM2 A;  3SWS D;  2CN2 A;  2QR5 A;  4Y5R D;  1O6F A;  3OKT A;  2PM6 B;  4AN0 A;  3CFS B;  4NEN A;  4G55 A;  4ZOY A;  3HFQ A;  3KRW B;  5THA A;  4KFM B;  4L3H D;  4U1E I;  5FKS A;  3UR4 A;  4BCD A;  2AQ5 A;  3V4V A;  2HKR A;  3DWL C;  2OIZ A;  5C9Z B;  3SHF A;  3RSE C;  5HDB A;  5M61 A;  2CE8 A;  3C5M A;  5FA5 B;  2CNX A;  3RRM C;  3EI2 A;  2PM9 A;  4X60 B;  3EG6 A;  4MMX A;  4Z7Q A;  3GFC A;  1YR2 A;  4ES0 A;  1RI6 A;  3NID A;  4NAA A;  3IJ0 A;  4CI8 A;  3I89 A;  1TBG A;  3DSM A;  2H6Q A;  5EMK B;  4GZ8 A;  2H9M A;  4K3I D;  2AGZ A;  3MKS B;  2P9U C;  3VH0 A;  3UVO A;  1U4C A;  3PXW D;  2WQ8 A;  3OKY A;  4WK0 A;  1JMX B;  4XEI C;  4D6V A;  5CYK A;  4IMM A;  2BKL A;  5CXB A;  3ZDX A;  5FQD A;  1QNI A;  3I2N A;  2VDN A;  1H2X A;  2QXV A;  4JT5 C;  4ERQ A;  5AMS A;  1N6F A;  3BG0 A;  4E54 B;  2H14 A;  4J82 A;  4BUJ C;  5KDO B;  1GOG A;  2H68 A;  3DXK C;  4CY3 A;  5FFG A;  1JMZ B;  5EAR A;  4E5Z A;  4NSX A;  3JB9 L;  4A08 A;  5IJ8 E;  4CY1 A;  5I5J A;  1GG2 B;  4PSW B;  4WK2 A;  4A0B A;  4CZV A;  4A7J A;  3PSL A;  5HE3 B;  4JD2 C;  1TYQ C;  3SLE D;  5FKT A;  3ZDY A;  3P4F A;  4L3G D;  3MXX A;  1Q47 A;  3F3G A;  1NEX B;  3EQ8 A;  4QT8 A;  3C9C A;  4A11 B;  4AMY A;  3EWE A;  3EI3 A;  1JTD B;  3K71 A;  1XHM A;  4WJK A;  2I3T A;  5FXY A;  5H17 A;  2HU8 A;  3AH8 B;  2B5N A;  4G1E A;  5HE1 B;  2OJY A;  4J81 A;  2YNP A;  2Z2N A;  2VZ1 A;  1L0Q A;  3SBR A;  2AGX A;  2W18 A;  4JHN A;  3QHY B;  2EIB A;  4PC0 A;  1UOO A;  3RLM D;  3PSC B;  1L5G A;  5I5I A;  2G99 A;  4ZOZ A;  1H2Y A;  4BCC A;  4QQE A;  5EAL A;  1UOP A;  3DXM C;  4CY5 A;  1H2Z A;  4YVD A;  3ZE2 A;  4ERZ A;  3L4M D;  1B9Y A;  4JSV C;  3MUN A;  5EM2 B;  3GD1 I;  2HES X;  4GQ1 A;  2VDO A;  4GQ2 P;  3I7K A;  4IA9 A;  3A0F A;  4GGC A;  5K19 A;  3OKW A;  2HYE A;  4JSN C;  3MZL A;  1PI6 A;  4U7A A;  5FKR A;  4J8G A;  2YBA A;  2CE9 A;  1E5T A;  5FFO A;  3DM0 A;  2I0R A;  3L4O D;  2YNN A;  3NIG A;  5TEE A;  3I7N A;  4UM8 A;  3SJL D;  2J57 G;  4OZU A;  4D0K A;  4LG9 A;  4FWW A;  1UTC A;  3EI2 B;  2H6N A;  2PM9 B;  3SMR A;  3O4J A;  3UVM A;  5A2Q g;  2O9K A;  5EAP A;  4O3T B;  5E6U A;  4AX4 A;  3ZE1 A;  5SXM A;  2J55 H;  2P9K C;  3I7H A;  2P9L C;  2XE4 A;  3I8C A;  1JOF A;  2CO0 A;  2AGY A;  4JSX C;  3V7D B;  1QFS A;  3ZE0 A;  3OKY B;  4UI9 R;  4DNU A;  4EWR A;  4AMZ A;  3SVW D;  3I7O A;  4MMZ A;  3MMY A;  5HQG A;  2IUP A;  4X61 B;  2YNO A;  3J80 g;  2IWK A;  3EI4 B;  3E0C A;  5H14 A;  5CYK B;  3RFH A;  2Z2O A;  4ESG A;  3ULE C;  5CXB B;  4A2M A;  1NR0 A;  2H9N A;  5HE0 B;  3IJE A;  1M1X A;  3CFV A;  3ZWL B;  3AFC A;  3EI4 A;  4O02 A;  5M5U A;  3NVQ A;  2CO0 C;  3K27 A;  1QFM A;  2OVR B;  3N0E A;  5K1C C;  1GOH A;  4AN1 A;  3EI1 A;  4E5Z B;  4RE5 A;  4A08 B;  3OL2 A;  5C2W B;  4A0B B;  5EMJ B;  3BG1 A;  2PBI B;  3B7F A;  4J87 A;  1PGU A;  3AL8 A;  3MUO A;  2EIC A;  5AJA A;  3SBQ A;  3VGZ A;  4BL0 A;  4CY2 A;  2G9A A;  1PBY B;  4GM9 A;  2VDP A;  4HDJ A;  1P22 A;  4QAM A;  2GC4 A;  4O45 A;  5IGO A;  3PXS D;  1VZ2 A;  1MDA H;  3EQ7 A;  2P9P C;  3IVM A;  4XYH A;  3EI3 B;  3IUQ A;  4CI1 A;  5M5V A;  1PEV A;  3NVX A;  3IUM A;  2H9L A;  5IC7 A;  2TRC B;  4I79 A;  3FRX A;  1K32 A;  4JXM A;  2OVQ B;  4FA1 D;  5E6R A;  2EBS A;  4J86 A;  2HU7 A;  3GRE A;  4O2W A;  2AH1 A;  2I0T A;  3UVK A;  5E6S A;  2AH0 A;  3C75 H;  4CZX A;  5FKQ A;  2AGL A;  1A12 A;  4JT6 C;  3VI3 A;  4CC9 A;  1I2M B;  2I0S A;  3BWS A;  3IUJ A;  4H5I A;  3EQ9 A;  2HJB A;  2XL3 A;  2B5M A;  5CXC B;  3T3M A;  5EML B;  3NIF A;  4A09 A;  3K6S A;  4FA9 D;  3SCY A;  2BBK H;  1FWX A;  2GNQ A;  1N6E A;  2UZX B;  3AL9 A;  3SBP A;  5JWZ A;  4J0W A;  5EMM B;  2HJ4 A;  4XYI A;  5CXC A;  4GM3 A;  1OLZ A;  3U4Y A;  2YMU A;  4GM8 A;  1MG2 A;  4FAV D;  2VDR A;  4A2L A;  5C2V B;  4ZN4 A;  1B9X A;  2VDQ A;  3ZDZ A;  2Q7Q A;  5EAM A;  1ERJ A;  5M5S A;  2JKX A;  4FB1 D;  2OK6 A;  1O6G A;  3FCS A;  3JZG A;  3PXT D;  3RFG A;  2B4E A;  2P9S C;  2QC5 A;  3VI4 A;  1BPO A;  4K3J B;  2Z2P A;  2H6K A;  4ZOX A;  3JRP A;  1GOF A;  4L1M A;  2AGW A;  1UOQ A;  3I7P A;  4FHL A;  3V4P A;  3FGB A;  4LGN A;  4D9S A;  4JHP C;  3UKR C;  2HXC A;  3N0D A;  5C86 A;  5GSA A;  2VZ3 A;  1JJU B;  4A0A B;  4O3U B;  4RE6 A;  3IIW A;  1E8N A;  4Z7O A;  1GXR A;  2H13 A;  2HU5 A;  2XDW A;  2H3X A;  1GP2 B;  3FM0 A;  3JPX A;  1R5M A;  2XL2 A;  4FA5 D;  2VDL A;  2XYI A;  3MZK A;  4J77 A;  3K72 A;  3EMH A;  1SHY B;  4A0A A;  4TZ4 A;  4WK4 A;  3O4I A;  4MMY A;  1MG3 A;  4L1Q D;  3FCU A;  5HYN B;  4IRZ A;  3EI1 B;  3C99 A;  3OL2 B;  3RMZ D;  4GMB A;  4CZY A;  4Z7N A;  5M5T A;  3DDU A;  1U8C A;  4PBY A;  3ODT A;  3AL8 B;  4NBM A;  2YB8 B;  5TF2 A;  3IUN A;  3KRX B;  4Y7R A;  2VC2 A;  4R7A B;  2HKM A;  3SXT D;  3IJC A; 
#chains in the Genus database with same CATH homology
 4J73 A;  4PBZ A;  3IKO A;  2CN3 A;  3UVN A;  1OMW B;  1SQ9 A;  2I3S A;  2IUQ A;  4PSX B;  4J0X A;  3K26 A;  3V9F A;  4J78 A;  2B5L A;  4GQB B;  3UVL A;  4PNK B;  3I7L A;  3PVU B;  2BCJ B;  3SFZ A;  1SQJ A;  5I5M A;  4GGD A;  3NVN A;  4H5J A;  1GOT B;  2P9I C;  3RN1 D;  2IAA A;  4N14 A;  4GGA A;  4QL1 A;  2H9P A;  2J56 H;  4MK0 B;  4A09 B;  4AEZ A;  4L9O A;  3I8E A;  3PVW B;  3RN0 D;  4O9D A;  4O1Q D;  5TEF A;  1U2V C;  5GMK n;  4Z8L A;  3OW8 A;  3MKQ A;  3OTT A;  3ORV D;  4BH6 A;  4LG8 A;  3IJ1 A;  1A0R B;  4E54 A;  4X63 B;  1YFQ A;  3F3F A;  2XU7 A;  2PM7 B;  4J84 A;  4FA4 D;  1VYH C;  2P9N C;  3EU7 A;  2GC7 A;  1XIP A;  4JSP C;  1S4U X;  5IGQ A;  3JAM g;  2OK4 A;  1K8K C;  4X3E A;  4A11 A;  2IUR A;  4ERY A;  5FLX g;  3UKU C;  4ZOV A;  2UZY B;  4OWR A;  3IIY A;  5TDH B;  3SN6 B;  3J81 g;  3CIK B;  4CI3 A;  5IT9 g;  3JRO A;  3PE7 A;  5B4W A;  2OVP B;  2MTA H;  2IUV A;  5H1M A;  3JZH A;  2H47 A;  4PXW A;  3VA6 A;  5IJ7 E;  4FAN D;  3V5W B;  5HE2 B;  5AFU 3;  5GXI A;  4G56 B;  3JZN A;  4CI2 A;  3W15 A;  4J8B A;  4QRJ A;  3F3P A;  4J79 A;  1XKS A;  4AOW A;  1N6D A;  5GXH A;  2IWF A;  5EM2 A;  3SWS D;  2CN2 A;  4Y5R D;  3OKT A;  2PM6 B;  3CFS B;  4ZOY A;  3HFQ A;  3KRW B;  5THA A;  4KFM B;  4L3H D;  4U1E I;  5FKS A;  3UR4 A;  2AQ5 A;  2HKR A;  3DWL C;  2OIZ A;  5C9Z B;  3SHF A;  3RSE C;  2CE8 A;  3C5M A;  5FA5 B;  2CNX A;  3RRM C;  3EI2 A;  2PM9 A;  4X60 B;  3EG6 A;  3GFC A;  4ES0 A;  1RI6 A;  3IJ0 A;  4CI8 A;  3I89 A;  1TBG A;  3DSM A;  2H6Q A;  5EMK B;  4GZ8 A;  2H9M A;  4K3I D;  2AGZ A;  3MKS B;  2P9U C;  3VH0 A;  3UVO A;  1U4C A;  3PXW D;  3OKY A;  1JMX B;  4XEI C;  4D6V A;  5CYK A;  4IMM A;  5CXB A;  5FQD A;  1QNI A;  3I2N A;  2QXV A;  4JT5 C;  4ERQ A;  5AMS A;  1N6F A;  3BG0 A;  4E54 B;  2H14 A;  4J82 A;  4BUJ C;  5KDO B;  2H68 A;  3DXK C;  4CY3 A;  1JMZ B;  5EAR A;  4E5Z A;  4NSX A;  3JB9 L;  4A08 A;  5IJ8 E;  4CY1 A;  5I5J A;  1GG2 B;  4PSW B;  4A0B A;  4CZV A;  4A7J A;  3PSL A;  5HE3 B;  4JD2 C;  1TYQ C;  3SLE D;  5FKT A;  3P4F A;  4L3G D;  3MXX A;  1Q47 A;  3F3G A;  1NEX B;  4QT8 A;  3C9C A;  4A11 B;  3EWE A;  3EI3 A;  1XHM A;  5H17 A;  2I3T A;  5FXY A;  3AH8 B;  2B5N A;  5HE1 B;  2OJY A;  4J81 A;  2YNP A;  2Z2N A;  1L0Q A;  3SBR A;  2AGX A;  2W18 A;  4PC0 A;  3RLM D;  3PSC B;  5I5I A;  2G99 A;  4ZOZ A;  4QQE A;  5EAL A;  3DXM C;  4CY5 A;  4YVD A;  4ERZ A;  3L4M D;  1B9Y A;  4JSV C;  5EM2 B;  2HES X;  4GQ1 A;  4GQ2 P;  3I7K A;  4IA9 A;  3A0F A;  4GGC A;  5K19 A;  3OKW A;  2HYE A;  4JSN C;  3MZL A;  1PI6 A;  4U7A A;  5FKR A;  4J8G A;  2YBA A;  2CE9 A;  3DM0 A;  2I0R A;  3L4O D;  2YNN A;  5TEE A;  3I7N A;  3SJL D;  2J57 G;  4OZU A;  4D0K A;  4LG9 A;  4FWW A;  3EI2 B;  2H6N A;  2PM9 B;  3SMR A;  3UVM A;  5A2Q g;  2O9K A;  5EAP A;  4O3T B;  5SXM A;  2J55 H;  2P9K C;  3I7H A;  2P9L C;  3I8C A;  1JOF A;  2CO0 A;  2AGY A;  4JSX C;  3V7D B;  3OKY B;  4UI9 R;  4EWR A;  3SVW D;  3I7O A;  3J80 g;  3MMY A;  5HQG A;  2IUP A;  4X61 B;  2YNO A;  2IWK A;  3EI4 B;  3E0C A;  5H14 A;  5CYK B;  3RFH A;  2Z2O A;  4ESG A;  3ULE C;  5CXB B;  4A2M A;  1NR0 A;  2H9N A;  5HE0 B;  3CFV A;  3ZWL B;  3AFC A;  3EI4 A;  3NVQ A;  2CO0 C;  3K27 A;  2OVR B;  3N0E A;  5K1C C;  3EI1 A;  4E5Z B;  4A08 B;  3OL2 A;  5C2W B;  4A0B B;  5EMJ B;  3BG1 A;  2PBI B;  3B7F A;  4J87 A;  1PGU A;  3AL8 A;  5AJA A;  3SBQ A;  3VGZ A;  4BL0 A;  4CY2 A;  2G9A A;  1PBY B;  4GM9 A;  4HDJ A;  1P22 A;  2GC4 A;  4O45 A;  5IGO A;  3PXS D;  1MDA H;  2P9P C;  4XYH A;  3EI3 B;  4CI1 A;  1PEV A;  3NVX A;  2H9L A;  5IC7 A;  2TRC B;  4JXM A;  3FRX A;  4I79 A;  1K32 A;  2OVQ B;  4FA1 D;  2EBS A;  4J86 A;  3GRE A;  2AH1 A;  2I0T A;  3UVK A;  2AH0 A;  3C75 H;  4CZX A;  5FKQ A;  2AGL A;  4JT6 C;  4CC9 A;  2I0S A;  3BWS A;  4H5I A;  2HJB A;  2XL3 A;  2B5M A;  5CXC B;  5EML B;  4A09 A;  4FA9 D;  3SCY A;  2BBK H;  1FWX A;  2GNQ A;  1N6E A;  2UZX B;  3AL9 A;  3SBP A;  5JWZ A;  4J0W A;  5EMM B;  2HJ4 A;  4XYI A;  5CXC A;  4GM3 A;  1OLZ A;  3U4Y A;  2YMU A;  4GM8 A;  1MG2 A;  4FAV D;  4A2L A;  5C2V B;  4ZN4 A;  1B9X A;  2Q7Q A;  5EAM A;  1ERJ A;  4FB1 D;  2OK6 A;  3JZG A;  3PXT D;  3RFG A;  2B4E A;  2P9S C;  2QC5 A;  4K3J B;  2Z2P A;  2H6K A;  4ZOX A;  3JRP A;  2AGW A;  3I7P A;  4FHL A;  3FGB A;  4LGN A;  3UKR C;  2HXC A;  3N0D A;  5GSA A;  1JJU B;  4A0A B;  4O3U B;  3IIW A;  1GXR A;  2H13 A;  2H3X A;  1GP2 B;  3FM0 A;  3JPX A;  1R5M A;  2XL2 A;  4FA5 D;  2XYI A;  3MZK A;  4J77 A;  3EMH A;  1SHY B;  4A0A A;  4TZ4 A;  1MG3 A;  4L1Q D;  5HYN B;  3EI1 B;  3C99 A;  3OL2 B;  3RMZ D;  4GMB A;  4CZY A;  4PBY A;  3ODT A;  3AL8 B;  2YB8 B;  5TF2 A;  3KRX B;  4Y7R A;  4R7A B;  2HKM A;  3SXT D;  3IJC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...