2IURA

Crystal structure of n-quinol form of aromatic amine dehydrogenase (aadh) from alcaligenes faecalis, form a cocrystal
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
360
structure length
360
Chain Sequence
REVLTGGHSVSAPQENRIYVMDSVFMHLTESRVHVYDYTNGKFLGMVPTAFNGHVQVSNDGKKIYTMTTYHERITRGKRSDVVEVWDADKLTFEKEISLPPKRVQGLNYDGLFRQTTDGKFIVLQNASPATSIGIVDVAKGDYVEDVTAAAGCWSVIPQPNRPRSFMTICGDGGLLTINLGEDGKVASQSRSKQMFSVKDDPIFIAPALDKDKAHFVSYYGNVYSADFSGDEVKVDGPWSLLNDEDKAKNWVPGGYNLVGLHRASGRMYVFMHPDGKEGTHKFPAAEIWVMDTKTKQRVARIPGRDALSMTIDQQRNLMLTLDGGNVNVYDISQPEPKLLRTIEGAAEASLQVQFHPVGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AROMATIC AMINE DEHYDROGENASE ALPHA SUBUNIT
publication title Atomic Level Insight Into the Oxidative Half-Reaction of Aromatic Amine Dehydrogenase.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 96
structure length 360
sequence length 360
chains with identical sequence B
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2006-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2iurA01
5GMKn 4Y7RA 3ULEC 4GGDA 4BH6A 2P9SC 3IJ1A 3EMHA 3AFCA 4GMBA 4JT6C 5I5IA 4J0WA 4ZOZA 2PM7B 3EU7A 5CYKB 2Z2OA 2CN2A 3BG1A 3I8EA 1RI6A 5EALA 2IAAA 4H5JA 3MMYA 4OZUA 4O3TB 2HJBA 5CXBA 1B9YA 3KRXB 3RLMD 5IGQA 2IURA 3B7FA 5JWZA 4XEIC 4BUJC 2H6NA 2PM9A 2BCJB 3SLED 4FHLA 4A0AB 5EARA 4J8BA 2XU7A 4CZXA 2AGLA 4A0BB 4BL0A 1OLZA 2P9KC 2HYEA 4A09B 4K3ID 2Q7QA 2H9MA 2IWFA 5FKQA 1P22A 2MTAH 4J82A 3PSCB 3UVKA 3C75H 3DSMA 4U1EI 4CI2A 5EMMB 4Z8LA 3RFHA 4R7AB 3V5WB 3EI2B 3J80g 4J8GA 4U7AA 2AH1A 3DWLC 5HYNB 3UR4A 2IUVA 2Z2PA 5SXMA 2UZXB 4L9OA 4JSXC 3RN1D 3C9CA 4ZOVA 3ORVD 1U2VC 5HE0B 2CN3A 4CI8A 2YNNA 3PXSD 4FA9D 3F3PA 4PSWB 4O9DA 2I0TA 2HXCA 3DM0A 4ERYA 5AJAA 5EM2B 4HDJA 1SHYB 3HFQA 3K27A 4QT8A 2YNPA 2H68A 5C9ZB 2H6KA 2O9KA 1N6EA 1TYQC 1N6DA 3UVOA 4X61B 4ZOYA 3DXMC 4J0XA 5IC7A 3NVQA 5H1MA 5C2VB 2CE9A 3EI3A 5I5JA 3OKTA 2H9PA 2I3SA 3OKYB 1XHMA 1A0RB 2IUQA 3OL2B 3RRMC 3EI1B 4PBZA 3SHFA 3MZKA 2CE8A 4H5IA 1XKSA 3AL8B 3FRXA 1L0QA 3A0FA 5GXHA 2H3XA 4GGAA 2B5MA 4FB1D 2H9NA 3VH0A 3VGZA 5HE2B 3EWEA 3ODTA 4LGNA 1GP2B 4J87A 2HKMA 4I79A 1JMZB 2P9NC 1MG2A 2OK4A 3U4YA 5CYKA 4QL1A 3L4OD 5CXCB 5B4WA 4A11B 4L3GD 4FAND 4J78A 1GXRA 4YVDA 3BWSA 4FA4D 4KFMB 4O1QD 4GQBB 2UZYB 5IGOA 1VYHC 5GXIA 3CFVA 4AEZA 2G9AA 3GFCA 1YFQA 4A0AA 3N0EA 1SQJA 3SXTD 4A7JA 3J81g 4LG8A 4A0BA 1PI6A 3PXTD 3E0CA 3JAMg 3EG6A 1QNIA 3IIYA 3F3FA 4PBYA 1GG2B 4A09A 5HE1B 4PC0A 1PEVA 2AGZA 4JXMA 3PVWB 5K1CC 5K19A 4LG9A 4JSVC 4CY2A 3BG0A 1FWXA 4JD2C 4UI9R 3UVNA 3EI2A 5FLXg 5EAPA 1SQ9A 3VA6A 3V7DB 2W18A 4X60B 3P4FA 1U4CA 4QRJA 5THAA 3PXWD 2OK6A 1GOTB 4OWRA 2GC4A 5EAMA 4D0KA 1NR0A 4XYHA 4IMMA 2IUPA 4PXWA 4XYIA 3UKRC 4CZYA 2B4EA 4FWWA 3JZHA 5A2Qg 5FKTA 3OTTA 3EI4B 2G99A 3I7HA 1XIPA 3I89A 4Y5RD 3NVNA 2H47A 5FQDA 5EM2A 5FXYA 1PGUA 1MG3A 1N6FA 2GC7A 5H17A 3FM0A 1K8KC 3SCYA 1JMXB 4E5ZB 3I7NA 4J73A 4D6VA 1S4UX 4AOWA 2OVRB 3JZGA 5HQGA 4JSPC 3OKYA 1PBYB 2HKRA 4EWRA 3OL2A 3EI1A 5TEFA 4J79A 3I7PA 3I7OA 5IT9g 5TF2A 4MK0B 3AL8A 4CY1A 3I2NA 3FGBA 3CIKB 3NVXA 4X3EA 5KDOB 4A08B 4E54B 3W15A 2XL3A 3JRPA 5HE3B 4ZN4A 2YNOA 2CO0C 2P9UC 4FAVD 4QQEA 4ES0A 2OJYA 2TRCB 4L1QD 4J77A 3C99A 3MXXA 4FA5D 4J81A 2B5LA 2OIZA 3DXKC 2OVPB 4ESGA 3MZLA 2HJ4A 3JROA 5EMLB 3SN6B 5CXCA 3SWSD 3IJ0A 4A11A 4ZOXA 2AGXA 3AH8B 5AFU3 3PVUB 4X63B 3OKWA 4ERZA 2Z2NA 5FKRA 3MKQA 4GM9A 2YMUA 2AGWA 3RN0D 4JSNC 3OW8A 5TEEA 4GQ1A 4IA9A 4L3HD 5FKSA 2H13A 2H14A 3RMZD 5CXBB 2YB8B 3I8CA 3L4MD 1NEXB 2P9LC 3SVWD 2PM9B 1JOFA 2IWKA 3I7LA 3UVLA 5FA5B 2J55H 1Q47A 3RFGA 3JZNA 3UVMA 4CC9A 3IIWA 5GSAA 1K32A 2BBKH 4FA1D 2YBAA 5I5MA 4JT5C 4TZ4A 2I3TA 4GZ8A 4G56B 2XYIA 3N0DA 4O45A 2H9LA 2J56H 2CO0A 3SBPA 4K3JB 5H14A 3GREA 3C5MA 4NSXA 3PSLA 2OVQB 3V9FA 3EI4A 2EBSA 3JPXA 4GGCA 2QC5A 2PBIB 3PE7A 4CI1A 5IJ7E 4J86A 4E5ZA 3SJLD 5EMJB 4A2LA 2PM6B 4J84A 4CI3A 5TDHB 2I0RA 2P9IC 3IJCA 1B9XA 1ERJA 2QXVA 4CZVA 4A2MA 3SBQA 1MDAH 4CY5A 3K26A 3SMRA 5EMKB 2GNQA 3UKUC 3AL9A 4CY3A 2H6QA 4N14A 3EI3B 4ERQA 3SFZA 5IJ8E 2HESX 2XL2A 2AQ5A 2P9PC 4GM8A 1OMWB 2J57G 2AGYA 4GQ2P 4A08A 4E54A 5C2WB 1R5MA 1TBGA 3CFSB 3F3GA 2B5NA 3JB9L 3I7KA 4PSXB 1JJUB 2CNXA 3RSEC 3SBRA 3IKOA 2AH0A 5AMSA 3MKSB 3KRWB 2I0SA 4PNKB 4O3UB 4GM3A 3ZWLB
chains in the Genus database with same CATH superfamily
5GMKn 4Y7RA 3O4IA 3ULEC 4GGDA 4BH6A 2P9SC 3IJ1A 3EMHA 3AFCA 4GMBA 4JT6C 5I5IA 1TYEA 4Z7OA 3NIFA 4J0WA 4UM8A 4ZOZA 2PM7B 3EU7A 5CYKB 2Z2OA 2CN2A 3BG1A 3I8EA 1RI6A 5EALA 2IAAA 4H5JA 3MMYA 4OZUA 1QFSA 3KCIA 4BP9A 4O3TB 4MMYA 4UM9A 2HJBA 5CXBA 3IUQA 1B9YA 3KRXB 3RLMD 3QI0A 5IGQA 2IURA 3B7FA 5JWZA 4XEIC 4BUJC 2H6NA 2PM9A 2BCJB 3SLED 4FHLA 4A0AB 5EARA 4J8BA 2XU7A 1C9LA 4CZXA 2AGLA 4A0BB 4BL0A 2HU5A 1OLZA 2P9KC 1E8NA 1H2ZA 2HYEA 4A09B 3GD1I 4WK0A 4K3ID 2Q7QA 2H9MA 2IWFA 5FKQA 1P22A 2MTAH 4J82A 2BKLA 3PSCB 2EICA 3UVKA 3C75H 3DSMA 4U1EI 4CI2A 1E5TA 4Z8LA 5EMMB 3RFHA 3VI4A 3VI3A 4R7AB 3V5WB 3EI2B 4AMYA 3J80g 4J8GA 4U7AA 2XZGA 2AH1A 3DWLC 4D9SA 5HYNB 1UOQA 3UR4A 2IUVA 1UOPA 2Z2PA 5SXMA 3EQ7A 2UZXB 4L9OA 4JSXC 3RN1D 3C9CA 4ZOVA 3K71A 3ORVD 1U2VC 5HE0B 2CN3A 3IUJA 1H2XA 4BCDA 4CI8A 1A12A 1T2XA 2YNNA 3PXSD 3IVMA 4FA9D 3F3PA 4PSWB 2I0TA 4O9DA 4DNWA 2HXCA 3MUOA 2VC2A 3DM0A 4ERYA 5AJAA 5EM2B 4HDJA 1SHYB 3ZDYA 3HFQA 3K27A 4QT8A 2YNPA 2H68A 4MMXA 2H6KA 5C9ZB 2O9KA 1N6EA 5M5TA 1TYQC 1N6DA 3UVOA 4X61B 4ZOYA 3DXMC 4G55A 4J0XA 5IC7A 3NVQA 5H1MA 5C2VB 2CE9A 3EI3A 5I5JA 3OKTA 3IUNA 2H9PA 2I3SA 5E6RA 3OKYB 1GOGA 1XHMA 1H2WA 1A0RB 2IUQA 2XE4A 3OL2B 3RRMC 3EI1B 1VZ2A 4DNVA 4PBZA 1VE6A 3SHFA 2EIDA 2CE8A 3MZKA 1JTDB 4H5IA 1XKSA 3AL8B 3FRXA 1L0QA 3A0FA 5GXHA 2H3XA 4GGAA 2B5MA 4FB1D 2H9NA 3VH0A 3VGZA 5HE2B 3EWEA 1M1XA 3ODTA 4LGNA 1GP2B 4WJKA 4J87A 2HKMA 4I79A 1JMZB 2P9NC 1MG2A 3QHYB 2OK4A 3U4YA 1L5GA 5CYKA 4QL1A 3L4OD 4JHPC 4IRZA 5CXCB 5B4WA 3ZDZA 4A11B 4L3GD 4FAND 1I2MB 4J78A 1GXRA 4YVDA 3BWSA 4FA4D 4KFMB 4O1QD 4GQBB 2UZYB 4NBMA 5M5SA 5IGOA 1VYHC 4RE5A 5GXIA 2VDKA 3CFVA 4AEZA 4WK2A 2G9AA 4WK4A 3GFCA 1YFQA 4A0AA 3N0EA 1SQJA 2WQ8A 1O6FA 3SXTD 4A7JA 3J81g 4LG8A 4A0BA 5FFOA 1PI6A 3EQ8A 3E0CA 3PXTD 3JAMg 3EG6A 1QNIA 3IIYA 3F3FA 4PBYA 1GG2B 4A09A 1UTCA 2VDQA 5HE1B 4PC0A 1PEVA 2AGZA 4JXMA 3PVWB 5K1CC 5K19A 4LG9A 4JSVC 4CY2A 2HU8A 3BG0A 1FWXA 4JD2C 4UI9R 4O2WA 2VZ3A 3UVNA 3EI2A 3IULA 5FLXg 5EAPA 1SQ9A 3VA6A 3V7DB 2W18A 5C92A 3ZE2A 3V4VA 4X60B 3P4FA 1U4CA 5M61A 4QRJA 5THAA 3PXWD 2VDOA 2OK6A 1GOTB 4G1EA 4OWRA 4AN0A 2GC4A 5EAMA 4D0KA 1NR0A 4XYHA 2VDRA 4IMMA 2IUPA 4PXWA 4XYIA 3UKRC 1QFMA 4CZYA 2B4EA 4FWWA 3JZHA 5A2Qg 5FKTA 3OTTA 3EI4B 2G99A 3I7HA 1XIPA 3I89A 4Y5RD 3NVNA 2H47A 5FQDA 4DNUA 5EM2A 5FXYA 1PGUA 1MG3A 1N6FA 2GC7A 3O4GA 5H17A 3FM0A 1K8KC 3SCYA 1JMXB 4E5ZB 3I7NA 4J73A 4D6VA 1S4UX 2QZPA 4Z7QA 3ZWLB 4AOWA 4BCCA 2OVRB 3JZGA 4BCBA 5HQGA 4JSPC 3OKYA 1PBYB 4MMZA 2HKRA 4EWRA 3OL2A 1GOFA 5M5VA 3EI1A 5TEFA 4J79A 1BPOA 3I7PA 3V4PA 3T3PA 2VDLA 3I7OA 5IT9g 5TF2A 4MK0B 3AL8A 4CY1A 3I2NA 2QR5A 3FGBA 4BP8A 3CIKB 3NVXA 4X3EA 5KDOB 4A08B 4E54B 3W15A 2XL3A 3JRPA 5HE3B 4ZN4A 2YNOA 2CO0C 2P9UC 5M5RA 4FAVD 2EIEA 4QQEA 4Z7NA 4RE6A 4ES0A 2OJYA 2TRCB 2VDMA 4L1QD 4J77A 3C99A 1U8CA 3MXXA 4FA5D 4J81A 2B5LA 5E6SA 1K3IA 2OIZA 3DXKC 2OVPB 4ESGA 3MZLA 3IUMA 2HJ4A 1E8MA 3JROA 1VE7A 5EMLB 3SN6B 5CXCA 3SWSD 3IJ0A 4A11A 4ZOXA 5HDBA 3FCUA 2AGXA 3AH8B 5AFU3 3PVUB 4X63B 3OKWA 5C86A 1UOOA 4ERZA 5M5UA 2VDNA 2Z2NA 5FKRA 3MKQA 4GM9A 2YMUA 2AGWA 3RN0D 4JSNC 3OW8A 5TEEA 4GQ1A 4IA9A 4JHNA 4L3HD 5FKSA 2H13A 3O4JA 2H14A 3RMZD 5CXBB 2YB8B 5FFGA 3I8CA 3MUNA 3L4MD 3FCSA 1NEXB 2P9LC 3SVWD 2PM9B 1JOFA 2IWKA 3I7LA 3UVLA 5FA5B 2J55H 4L1MA 1Q47A 3RFGA 3JZNA 1O6GA 3UVMA 4CC9A 3IIWA 5GSAA 1K32A 2BBKH 4FA1D 2YBAA 5I5MA 4JT5C 4TZ4A 2I3TA 4GZ8A 3IJEA 2XYIA 2VDPA 3N0DA 4G56B 3MVDK 3EQ9A 4O45A 2H9LA 2J56H 4G1MA 2CO0A 1YR2A 4AX4A 3IURA 3SBPA 4K3JB 5H14A 2XDWA 3GREA 3C5MA 4NSXA 2EIBA 3PSLA 2OVQB 3V9FA 3EI4A 2EBSA 3JPXA 4GGCA 2QC5A 3NIDA 2PBIB 4NAAA 3PE7A 4CI1A 5IJ7E 1H2YA 4J86A 4E5ZA 3K72A 3O4HA 5EMJB 3SJLD 4A2LA 2PM6B 4J84A 4CI3A 5TDHB 4O02A 2I0RA 2P9IC 3IJCA 5E6UA 1B9XA 1ERJA 1JV2A 2QXVA 4CZVA 4A2MA 3SBQA 1MDAH 4CY5A 3K26A 3SMRA 3ZE0A 5EMKB 2GNQA 3UKUC 3K6SA 3NIGA 3AL9A 3DDUA 3ZE1A 4CY3A 3OF7A 2H6QA 4N14A 3EI3B 4ERQA 3SFZA 5IJ8E 2HESX 2XL2A 2AQ5A 1VZ3A 2P9PC 4GM8A 1OMWB 2J57G 2HU7A 2AGYA 4GQ2P 4A08A 4E54A 5C2WB 1R5MA 1TBGA 3CFSB 3F3GA 2B5NA 3JB9L 3I7KA 4PSXB 1JJUB 2JKXA 4AN1A 2CNXA 1GOHA 3RSEC 3SBRA 4AMZA 4QAMA 3IKOA 1C9IA 2AH0A 5AMSA 3MKSB 3KRWB 2I0SA 4NC4A 4PNKB 2VZ1A 4O3UB 4NENA 3ZDXA 4GM3A 3GC3B 3T3MA
chains in the Genus database with same CATH topology
5GMKn 4Y7RA 3ULEC 4GGDA 4BH6A 2P9SC 3IJ1A 3EMHA 3AFCA 4GMBA 4JT6C 5I5IA 4J0WA 4ZOZA 2PM7B 3EU7A 5CYKB 2Z2OA 2CN2A 3BG1A 3I8EA 1RI6A 5EALA 2IAAA 4H5JA 3MMYA 4OZUA 4O3TB 2HJBA 5CXBA 1B9YA 3KRXB 3RLMD 5IGQA 2IURA 3B7FA 5JWZA 4XEIC 4BUJC 2H6NA 2PM9A 2BCJB 3SLED 4FHLA 4A0AB 5EARA 4J8BA 2XU7A 4CZXA 2AGLA 4A0BB 4BL0A 1OLZA 2P9KC 2HYEA 4A09B 4K3ID 2Q7QA 2H9MA 2IWFA 5FKQA 1P22A 2MTAH 4J82A 3PSCB 3UVKA 3C75H 3DSMA 4U1EI 4CI2A 5EMMB 4Z8LA 3RFHA 4R7AB 3V5WB 3EI2B 3J80g 4J8GA 4U7AA 2AH1A 3DWLC 5HYNB 3UR4A 2IUVA 2Z2PA 5SXMA 2UZXB 4L9OA 4JSXC 3RN1D 3C9CA 4ZOVA 3ORVD 1U2VC 5HE0B 2CN3A 4CI8A 2YNNA 3PXSD 4FA9D 3F3PA 4PSWB 4O9DA 2I0TA 2HXCA 3DM0A 4ERYA 5AJAA 5EM2B 4HDJA 1SHYB 3HFQA 3K27A 4QT8A 2YNPA 2H68A 5C9ZB 2H6KA 2O9KA 1N6EA 1TYQC 1N6DA 3UVOA 4X61B 4ZOYA 3DXMC 4J0XA 5IC7A 3NVQA 5H1MA 5C2VB 2CE9A 3EI3A 5I5JA 3OKTA 2H9PA 2I3SA 3OKYB 1XHMA 1A0RB 2IUQA 3OL2B 3RRMC 3EI1B 4PBZA 3SHFA 3MZKA 2CE8A 4H5IA 1XKSA 3AL8B 3FRXA 1L0QA 3A0FA 5GXHA 2H3XA 4GGAA 2B5MA 4FB1D 2H9NA 3VH0A 3VGZA 5HE2B 3EWEA 3ODTA 4LGNA 1GP2B 4J87A 2HKMA 4I79A 1JMZB 2P9NC 1MG2A 2OK4A 3U4YA 5CYKA 4QL1A 3L4OD 5CXCB 5B4WA 4A11B 4L3GD 4FAND 4J78A 1GXRA 4YVDA 3BWSA 4FA4D 4KFMB 4O1QD 4GQBB 2UZYB 5IGOA 1VYHC 5GXIA 3CFVA 4AEZA 2G9AA 3GFCA 1YFQA 4A0AA 3N0EA 1SQJA 3SXTD 4A7JA 3J81g 4LG8A 4A0BA 1PI6A 3PXTD 3E0CA 3JAMg 3EG6A 1QNIA 3IIYA 3F3FA 4PBYA 1GG2B 4A09A 5HE1B 4PC0A 1PEVA 2AGZA 4JXMA 3PVWB 5K1CC 5K19A 4LG9A 4JSVC 4CY2A 3BG0A 1FWXA 4JD2C 4UI9R 3UVNA 3EI2A 5FLXg 5EAPA 1SQ9A 3VA6A 3V7DB 2W18A 4X60B 3P4FA 1U4CA 4QRJA 5THAA 3PXWD 2OK6A 1GOTB 4OWRA 2GC4A 5EAMA 4D0KA 1NR0A 4XYHA 4IMMA 2IUPA 4PXWA 4XYIA 3UKRC 4CZYA 2B4EA 4FWWA 3JZHA 5A2Qg 5FKTA 3OTTA 3EI4B 2G99A 3I7HA 1XIPA 3I89A 4Y5RD 3NVNA 2H47A 5FQDA 5EM2A 5FXYA 1PGUA 1MG3A 1N6FA 2GC7A 5H17A 3FM0A 1K8KC 3SCYA 1JMXB 4E5ZB 3I7NA 4J73A 4D6VA 1S4UX 4AOWA 2OVRB 3JZGA 5HQGA 4JSPC 3OKYA 1PBYB 2HKRA 4EWRA 3OL2A 3EI1A 5TEFA 4J79A 3I7PA 3I7OA 5IT9g 5TF2A 4MK0B 3AL8A 4CY1A 3I2NA 3FGBA 3CIKB 3NVXA 4X3EA 5KDOB 4A08B 4E54B 3W15A 2XL3A 3JRPA 5HE3B 4ZN4A 2YNOA 2CO0C 2P9UC 4FAVD 4QQEA 4ES0A 2OJYA 2TRCB 4L1QD 4J77A 3C99A 3MXXA 4FA5D 4J81A 2B5LA 2OIZA 3DXKC 2OVPB 4ESGA 3MZLA 2HJ4A 3JROA 5EMLB 3SN6B 5CXCA 3SWSD 3IJ0A 4A11A 4ZOXA 2AGXA 3AH8B 5AFU3 3PVUB 4X63B 3OKWA 4ERZA 2Z2NA 5FKRA 3MKQA 4GM9A 2YMUA 2AGWA 3RN0D 4JSNC 3OW8A 5TEEA 4GQ1A 4IA9A 4L3HD 5FKSA 2H13A 2H14A 3RMZD 5CXBB 2YB8B 3I8CA 3L4MD 1NEXB 2P9LC 3SVWD 2PM9B 1JOFA 2IWKA 3I7LA 3UVLA 5FA5B 2J55H 1Q47A 3RFGA 3JZNA 3UVMA 4CC9A 3IIWA 5GSAA 1K32A 2BBKH 4FA1D 2YBAA 5I5MA 4JT5C 4TZ4A 2I3TA 4GZ8A 4G56B 2XYIA 3N0DA 4O45A 2H9LA 2J56H 2CO0A 3SBPA 4K3JB 5H14A 3GREA 3C5MA 4NSXA 3PSLA 2OVQB 3V9FA 3EI4A 2EBSA 3JPXA 4GGCA 2QC5A 2PBIB 3PE7A 4CI1A 5IJ7E 4J86A 4E5ZA 3SJLD 5EMJB 4A2LA 2PM6B 4J84A 4CI3A 5TDHB 2I0RA 2P9IC 3IJCA 1B9XA 1ERJA 2QXVA 4CZVA 4A2MA 3SBQA 1MDAH 4CY5A 3K26A 3SMRA 5EMKB 2GNQA 3UKUC 3AL9A 4CY3A 2H6QA 4N14A 3EI3B 4ERQA 3SFZA 5IJ8E 2HESX 2XL2A 2AQ5A 2P9PC 4GM8A 1OMWB 2J57G 2AGYA 4GQ2P 4A08A 4E54A 5C2WB 1R5MA 1TBGA 3CFSB 3F3GA 2B5NA 3JB9L 3I7KA 4PSXB 1JJUB 2CNXA 3RSEC 3SBRA 3IKOA 2AH0A 5AMSA 3MKSB 3KRWB 2I0SA 4PNKB 4O3UB 4GM3A 3ZWLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GMK n;  4Y7R A;  3ULE C;  4GGD A;  4BH6 A;  2P9S C;  3IJ1 A;  3EMH A;  3AFC A;  4GMB A;  4JT6 C;  5I5I A;  4J0W A;  4ZOZ A;  2PM7 B;  3EU7 A;  5CYK B;  2Z2O A;  2CN2 A;  3BG1 A;  3I8E A;  1RI6 A;  5EAL A;  2IAA A;  4H5J A;  3MMY A;  4OZU A;  4O3T B;  2HJB A;  5CXB A;  1B9Y A;  3KRX B;  3RLM D;  5IGQ A;  2IUR A;  3B7F A;  5JWZ A;  4XEI C;  4BUJ C;  2H6N A;  2PM9 A;  2BCJ B;  3SLE D;  4FHL A;  4A0A B;  5EAR A;  4J8B A;  2XU7 A;  4CZX A;  2AGL A;  4A0B B;  4BL0 A;  1OLZ A;  2P9K C;  2HYE A;  4A09 B;  4K3I D;  2Q7Q A;  2H9M A;  2IWF A;  5FKQ A;  1P22 A;  2MTA H;  4J82 A;  3PSC B;  3UVK A;  3C75 H;  3DSM A;  4U1E I;  4CI2 A;  5EMM B;  4Z8L A;  3RFH A;  4R7A B;  3V5W B;  3EI2 B;  3J80 g;  4J8G A;  4U7A A;  2AH1 A;  3DWL C;  5HYN B;  3UR4 A;  2IUV A;  2Z2P A;  5SXM A;  2UZX B;  4L9O A;  4JSX C;  3RN1 D;  3C9C A;  4ZOV A;  3ORV D;  1U2V C;  5HE0 B;  2CN3 A;  4CI8 A;  2YNN A;  3PXS D;  4FA9 D;  3F3P A;  4PSW B;  4O9D A;  2I0T A;  2HXC A;  3DM0 A;  4ERY A;  5AJA A;  5EM2 B;  4HDJ A;  1SHY B;  3HFQ A;  3K27 A;  4QT8 A;  2YNP A;  2H68 A;  5C9Z B;  2H6K A;  2O9K A;  1N6E A;  1TYQ C;  1N6D A;  3UVO A;  4X61 B;  4ZOY A;  3DXM C;  4J0X A;  5IC7 A;  3NVQ A;  5H1M A;  5C2V B;  2CE9 A;  3EI3 A;  5I5J A;  3OKT A;  2H9P A;  2I3S A;  3OKY B;  1XHM A;  1A0R B;  2IUQ A;  3OL2 B;  3RRM C;  3EI1 B;  4PBZ A;  3SHF A;  3MZK A;  2CE8 A;  4H5I A;  1XKS A;  3AL8 B;  3FRX A;  1L0Q A;  3A0F A;  5GXH A;  2H3X A;  4GGA A;  2B5M A;  4FB1 D;  2H9N A;  3VH0 A;  3VGZ A;  5HE2 B;  3EWE A;  3ODT A;  4LGN A;  1GP2 B;  4J87 A;  2HKM A;  4I79 A;  1JMZ B;  2P9N C;  1MG2 A;  2OK4 A;  3U4Y A;  5CYK A;  4QL1 A;  3L4O D;  5CXC B;  5B4W A;  4A11 B;  4L3G D;  4FAN D;  4J78 A;  1GXR A;  4YVD A;  3BWS A;  4FA4 D;  4KFM B;  4O1Q D;  4GQB B;  2UZY B;  5IGO A;  1VYH C;  5GXI A;  3CFV A;  4AEZ A;  2G9A A;  3GFC A;  1YFQ A;  4A0A A;  3N0E A;  1SQJ A;  3SXT D;  4A7J A;  3J81 g;  4LG8 A;  4A0B A;  1PI6 A;  3PXT D;  3E0C A;  3JAM g;  3EG6 A;  1QNI A;  3IIY A;  3F3F A;  4PBY A;  1GG2 B;  4A09 A;  5HE1 B;  4PC0 A;  1PEV A;  2AGZ A;  4JXM A;  3PVW B;  5K1C C;  5K19 A;  4LG9 A;  4JSV C;  4CY2 A;  3BG0 A;  1FWX A;  4JD2 C;  4UI9 R;  3UVN A;  3EI2 A;  5FLX g;  5EAP A;  1SQ9 A;  3VA6 A;  3V7D B;  2W18 A;  4X60 B;  3P4F A;  1U4C A;  4QRJ A;  5THA A;  3PXW D;  2OK6 A;  1GOT B;  4OWR A;  2GC4 A;  5EAM A;  4D0K A;  1NR0 A;  4XYH A;  4IMM A;  2IUP A;  4PXW A;  4XYI A;  3UKR C;  4CZY A;  2B4E A;  4FWW A;  3JZH A;  5A2Q g;  5FKT A;  3OTT A;  3EI4 B;  2G99 A;  3I7H A;  1XIP A;  3I89 A;  4Y5R D;  3NVN A;  2H47 A;  5FQD A;  5EM2 A;  5FXY A;  1PGU A;  1MG3 A;  1N6F A;  2GC7 A;  5H17 A;  3FM0 A;  1K8K C;  3SCY A;  1JMX B;  4E5Z B;  3I7N A;  4J73 A;  4D6V A;  1S4U X;  4AOW A;  2OVR B;  3JZG A;  5HQG A;  4JSP C;  3OKY A;  1PBY B;  2HKR A;  4EWR A;  3OL2 A;  3EI1 A;  5TEF A;  4J79 A;  3I7P A;  3I7O A;  5IT9 g;  5TF2 A;  4MK0 B;  3AL8 A;  4CY1 A;  3I2N A;  3FGB A;  3CIK B;  3NVX A;  4X3E A;  5KDO B;  4A08 B;  4E54 B;  3W15 A;  2XL3 A;  3JRP A;  5HE3 B;  4ZN4 A;  2YNO A;  2CO0 C;  2P9U C;  4FAV D;  4QQE A;  4ES0 A;  2OJY A;  2TRC B;  4L1Q D;  4J77 A;  3C99 A;  3MXX A;  4FA5 D;  4J81 A;  2B5L A;  2OIZ A;  3DXK C;  2OVP B;  4ESG A;  3MZL A;  2HJ4 A;  3JRO A;  5EML B;  3SN6 B;  5CXC A;  3SWS D;  3IJ0 A;  4A11 A;  4ZOX A;  2AGX A;  3AH8 B;  5AFU 3;  3PVU B;  4X63 B;  3OKW A;  4ERZ A;  2Z2N A;  5FKR A;  3MKQ A;  4GM9 A;  2YMU A;  2AGW A;  3RN0 D;  4JSN C;  3OW8 A;  5TEE A;  4GQ1 A;  4IA9 A;  4L3H D;  5FKS A;  2H13 A;  2H14 A;  3RMZ D;  5CXB B;  2YB8 B;  3I8C A;  3L4M D;  1NEX B;  2P9L C;  3SVW D;  2PM9 B;  1JOF A;  2IWK A;  3I7L A;  3UVL A;  5FA5 B;  2J55 H;  1Q47 A;  3RFG A;  3JZN A;  3UVM A;  4CC9 A;  3IIW A;  5GSA A;  1K32 A;  2BBK H;  4FA1 D;  2YBA A;  5I5M A;  4JT5 C;  4TZ4 A;  2I3T A;  4GZ8 A;  4G56 B;  2XYI A;  3N0D A;  4O45 A;  2H9L A;  2J56 H;  2CO0 A;  3SBP A;  4K3J B;  5H14 A;  3GRE A;  3C5M A;  4NSX A;  3PSL A;  2OVQ B;  3V9F A;  3EI4 A;  2EBS A;  3JPX A;  4GGC A;  2QC5 A;  2PBI B;  3PE7 A;  4CI1 A;  5IJ7 E;  4J86 A;  4E5Z A;  3SJL D;  5EMJ B;  4A2L A;  2PM6 B;  4J84 A;  4CI3 A;  5TDH B;  2I0R A;  2P9I C;  3IJC A;  1B9X A;  1ERJ A;  2QXV A;  4CZV A;  4A2M A;  3SBQ A;  1MDA H;  4CY5 A;  3K26 A;  3SMR A;  5EMK B;  2GNQ A;  3UKU C;  3AL9 A;  4CY3 A;  2H6Q A;  4N14 A;  3EI3 B;  4ERQ A;  3SFZ A;  5IJ8 E;  2HES X;  2XL2 A;  2AQ5 A;  2P9P C;  4GM8 A;  1OMW B;  2J57 G;  2AGY A;  4GQ2 P;  4A08 A;  4E54 A;  5C2W B;  1R5M A;  1TBG A;  3CFS B;  3F3G A;  2B5N A;  3JB9 L;  3I7K A;  4PSX B;  1JJU B;  2CNX A;  3RSE C;  3SBR A;  3IKO A;  2AH0 A;  5AMS A;  3MKS B;  3KRW B;  2I0S A;  4PNK B;  4O3U B;  4GM3 A;  3ZWL B; 
#chains in the Genus database with same CATH topology
 5GMK n;  4Y7R A;  3O4I A;  3ULE C;  4GGD A;  4BH6 A;  2P9S C;  3IJ1 A;  3EMH A;  3AFC A;  4GMB A;  4JT6 C;  5I5I A;  1TYE A;  4Z7O A;  3NIF A;  4J0W A;  4UM8 A;  4ZOZ A;  2PM7 B;  3EU7 A;  5CYK B;  2Z2O A;  2CN2 A;  3BG1 A;  3I8E A;  1RI6 A;  5EAL A;  2IAA A;  4H5J A;  3MMY A;  4OZU A;  1QFS A;  3KCI A;  4BP9 A;  4O3T B;  4MMY A;  4UM9 A;  2HJB A;  5CXB A;  3IUQ A;  1B9Y A;  3KRX B;  3RLM D;  3QI0 A;  5IGQ A;  2IUR A;  3B7F A;  5JWZ A;  4XEI C;  4BUJ C;  2H6N A;  2PM9 A;  2BCJ B;  3SLE D;  4FHL A;  4A0A B;  5EAR A;  4J8B A;  2XU7 A;  1C9L A;  4CZX A;  2AGL A;  4A0B B;  4BL0 A;  2HU5 A;  1OLZ A;  2P9K C;  1E8N A;  1H2Z A;  2HYE A;  4A09 B;  3GD1 I;  4WK0 A;  4K3I D;  2Q7Q A;  2H9M A;  2IWF A;  5FKQ A;  1P22 A;  2MTA H;  4J82 A;  2BKL A;  3PSC B;  2EIC A;  3UVK A;  3C75 H;  3DSM A;  4U1E I;  4CI2 A;  1E5T A;  4Z8L A;  5EMM B;  3RFH A;  3VI4 A;  3VI3 A;  4R7A B;  3V5W B;  3EI2 B;  4AMY A;  3J80 g;  4J8G A;  4U7A A;  2XZG A;  2AH1 A;  3DWL C;  4D9S A;  5HYN B;  1UOQ A;  3UR4 A;  2IUV A;  1UOP A;  2Z2P A;  5SXM A;  3EQ7 A;  2UZX B;  4L9O A;  4JSX C;  3RN1 D;  3C9C A;  4ZOV A;  3K71 A;  3ORV D;  1U2V C;  5HE0 B;  2CN3 A;  3IUJ A;  1H2X A;  4BCD A;  4CI8 A;  1A12 A;  1T2X A;  2YNN A;  3PXS D;  3IVM A;  4FA9 D;  3F3P A;  4PSW B;  2I0T A;  4O9D A;  4DNW A;  2HXC A;  3MUO A;  2VC2 A;  3DM0 A;  4ERY A;  5AJA A;  5EM2 B;  4HDJ A;  1SHY B;  3ZDY A;  3HFQ A;  3K27 A;  4QT8 A;  2YNP A;  2H68 A;  4MMX A;  2H6K A;  5C9Z B;  2O9K A;  1N6E A;  5M5T A;  1TYQ C;  1N6D A;  3UVO A;  4X61 B;  4ZOY A;  3DXM C;  4G55 A;  4J0X A;  5IC7 A;  3NVQ A;  5H1M A;  5C2V B;  2CE9 A;  3EI3 A;  5I5J A;  3OKT A;  3IUN A;  2H9P A;  2I3S A;  5E6R A;  3OKY B;  1GOG A;  1XHM A;  1H2W A;  1A0R B;  2IUQ A;  2XE4 A;  3OL2 B;  3RRM C;  3EI1 B;  1VZ2 A;  4DNV A;  4PBZ A;  1VE6 A;  3SHF A;  2EID A;  2CE8 A;  3MZK A;  1JTD B;  4H5I A;  1XKS A;  3AL8 B;  3FRX A;  1L0Q A;  3A0F A;  5GXH A;  2H3X A;  4GGA A;  2B5M A;  4FB1 D;  2H9N A;  3VH0 A;  3VGZ A;  5HE2 B;  3EWE A;  1M1X A;  3ODT A;  4LGN A;  1GP2 B;  4WJK A;  4J87 A;  2HKM A;  4I79 A;  1JMZ B;  2P9N C;  1MG2 A;  3QHY B;  2OK4 A;  3U4Y A;  1L5G A;  5CYK A;  4QL1 A;  3L4O D;  4JHP C;  4IRZ A;  5CXC B;  5B4W A;  3ZDZ A;  4A11 B;  4L3G D;  4FAN D;  1I2M B;  4J78 A;  1GXR A;  4YVD A;  3BWS A;  4FA4 D;  4KFM B;  4O1Q D;  4GQB B;  2UZY B;  4NBM A;  5M5S A;  5IGO A;  1VYH C;  4RE5 A;  5GXI A;  2VDK A;  3CFV A;  4AEZ A;  4WK2 A;  2G9A A;  4WK4 A;  3GFC A;  1YFQ A;  4A0A A;  3N0E A;  1SQJ A;  2WQ8 A;  1O6F A;  3SXT D;  4A7J A;  3J81 g;  4LG8 A;  4A0B A;  5FFO A;  1PI6 A;  3EQ8 A;  3E0C A;  3PXT D;  3JAM g;  3EG6 A;  1QNI A;  3IIY A;  3F3F A;  4PBY A;  1GG2 B;  4A09 A;  1UTC A;  2VDQ A;  5HE1 B;  4PC0 A;  1PEV A;  2AGZ A;  4JXM A;  3PVW B;  5K1C C;  5K19 A;  4LG9 A;  4JSV C;  4CY2 A;  2HU8 A;  3BG0 A;  1FWX A;  4JD2 C;  4UI9 R;  4O2W A;  2VZ3 A;  3UVN A;  3EI2 A;  3IUL A;  5FLX g;  5EAP A;  1SQ9 A;  3VA6 A;  3V7D B;  2W18 A;  5C92 A;  3ZE2 A;  3V4V A;  4X60 B;  3P4F A;  1U4C A;  5M61 A;  4QRJ A;  5THA A;  3PXW D;  2VDO A;  2OK6 A;  1GOT B;  4G1E A;  4OWR A;  4AN0 A;  2GC4 A;  5EAM A;  4D0K A;  1NR0 A;  4XYH A;  2VDR A;  4IMM A;  2IUP A;  4PXW A;  4XYI A;  3UKR C;  1QFM A;  4CZY A;  2B4E A;  4FWW A;  3JZH A;  5A2Q g;  5FKT A;  3OTT A;  3EI4 B;  2G99 A;  3I7H A;  1XIP A;  3I89 A;  4Y5R D;  3NVN A;  2H47 A;  5FQD A;  4DNU A;  5EM2 A;  5FXY A;  1PGU A;  1MG3 A;  1N6F A;  2GC7 A;  3O4G A;  5H17 A;  3FM0 A;  1K8K C;  3SCY A;  1JMX B;  4E5Z B;  3I7N A;  4J73 A;  4D6V A;  1S4U X;  2QZP A;  4Z7Q A;  3ZWL B;  4AOW A;  4BCC A;  2OVR B;  3JZG A;  4BCB A;  5HQG A;  4JSP C;  3OKY A;  1PBY B;  4MMZ A;  2HKR A;  4EWR A;  3OL2 A;  1GOF A;  5M5V A;  3EI1 A;  5TEF A;  4J79 A;  1BPO A;  3I7P A;  3V4P A;  3T3P A;  2VDL A;  3I7O A;  5IT9 g;  5TF2 A;  4MK0 B;  3AL8 A;  4CY1 A;  3I2N A;  2QR5 A;  3FGB A;  4BP8 A;  3CIK B;  3NVX A;  4X3E A;  5KDO B;  4A08 B;  4E54 B;  3W15 A;  2XL3 A;  3JRP A;  5HE3 B;  4ZN4 A;  2YNO A;  2CO0 C;  2P9U C;  5M5R A;  4FAV D;  2EIE A;  4QQE A;  4Z7N A;  4RE6 A;  4ES0 A;  2OJY A;  2TRC B;  2VDM A;  4L1Q D;  4J77 A;  3C99 A;  1U8C A;  3MXX A;  4FA5 D;  4J81 A;  2B5L A;  5E6S A;  1K3I A;  2OIZ A;  3DXK C;  2OVP B;  4ESG A;  3MZL A;  3IUM A;  2HJ4 A;  1E8M A;  3JRO A;  1VE7 A;  5EML B;  3SN6 B;  5CXC A;  3SWS D;  3IJ0 A;  4A11 A;  4ZOX A;  5HDB A;  3FCU A;  2AGX A;  3AH8 B;  5AFU 3;  3PVU B;  4X63 B;  3OKW A;  5C86 A;  1UOO A;  4ERZ A;  5M5U A;  2VDN A;  2Z2N A;  5FKR A;  3MKQ A;  4GM9 A;  2YMU A;  2AGW A;  3RN0 D;  4JSN C;  3OW8 A;  5TEE A;  4GQ1 A;  4IA9 A;  4JHN A;  4L3H D;  5FKS A;  2H13 A;  3O4J A;  2H14 A;  3RMZ D;  5CXB B;  2YB8 B;  5FFG A;  3I8C A;  3MUN A;  3L4M D;  3FCS A;  1NEX B;  2P9L C;  3SVW D;  2PM9 B;  1JOF A;  2IWK A;  3I7L A;  3UVL A;  5FA5 B;  2J55 H;  4L1M A;  1Q47 A;  3RFG A;  3JZN A;  1O6G A;  3UVM A;  4CC9 A;  3IIW A;  5GSA A;  1K32 A;  2BBK H;  4FA1 D;  2YBA A;  5I5M A;  4JT5 C;  4TZ4 A;  2I3T A;  4GZ8 A;  3IJE A;  2XYI A;  2VDP A;  3N0D A;  4G56 B;  3MVD K;  3EQ9 A;  4O45 A;  2H9L A;  2J56 H;  4G1M A;  2CO0 A;  1YR2 A;  4AX4 A;  3IUR A;  3SBP A;  4K3J B;  5H14 A;  2XDW A;  3GRE A;  3C5M A;  4NSX A;  2EIB A;  3PSL A;  2OVQ B;  3V9F A;  3EI4 A;  2EBS A;  3JPX A;  4GGC A;  2QC5 A;  3NID A;  2PBI B;  4NAA A;  3PE7 A;  4CI1 A;  5IJ7 E;  1H2Y A;  4J86 A;  4E5Z A;  3K72 A;  3O4H A;  5EMJ B;  3SJL D;  4A2L A;  2PM6 B;  4J84 A;  4CI3 A;  5TDH B;  4O02 A;  2I0R A;  2P9I C;  3IJC A;  5E6U A;  1B9X A;  1ERJ A;  1JV2 A;  2QXV A;  4CZV A;  4A2M A;  3SBQ A;  1MDA H;  4CY5 A;  3K26 A;  3SMR A;  3ZE0 A;  5EMK B;  2GNQ A;  3UKU C;  3K6S A;  3NIG A;  3AL9 A;  3DDU A;  3ZE1 A;  4CY3 A;  3OF7 A;  2H6Q A;  4N14 A;  3EI3 B;  4ERQ A;  3SFZ A;  5IJ8 E;  2HES X;  2XL2 A;  2AQ5 A;  1VZ3 A;  2P9P C;  4GM8 A;  1OMW B;  2J57 G;  2HU7 A;  2AGY A;  4GQ2 P;  4A08 A;  4E54 A;  5C2W B;  1R5M A;  1TBG A;  3CFS B;  3F3G A;  2B5N A;  3JB9 L;  3I7K A;  4PSX B;  1JJU B;  2JKX A;  4AN1 A;  2CNX A;  1GOH A;  3RSE C;  3SBR A;  4AMZ A;  4QAM A;  3IKO A;  1C9I A;  2AH0 A;  5AMS A;  3MKS B;  3KRW B;  2I0S A;  4NC4 A;  4PNK B;  2VZ1 A;  4O3U B;  4NEN A;  3ZDX A;  4GM3 A;  3GC3 B;  3T3M A; 
#chains in the Genus database with same CATH homology
 5GMK n;  4Y7R A;  3ULE C;  4GGD A;  4BH6 A;  2P9S C;  3IJ1 A;  3EMH A;  3AFC A;  4GMB A;  4JT6 C;  5I5I A;  4J0W A;  4ZOZ A;  2PM7 B;  3EU7 A;  5CYK B;  2Z2O A;  2CN2 A;  3BG1 A;  3I8E A;  1RI6 A;  5EAL A;  2IAA A;  4H5J A;  3MMY A;  4OZU A;  4O3T B;  2HJB A;  5CXB A;  1B9Y A;  3KRX B;  3RLM D;  5IGQ A;  2IUR A;  3B7F A;  5JWZ A;  4XEI C;  4BUJ C;  2H6N A;  2PM9 A;  2BCJ B;  3SLE D;  4FHL A;  4A0A B;  5EAR A;  4J8B A;  2XU7 A;  4CZX A;  2AGL A;  4A0B B;  4BL0 A;  1OLZ A;  2P9K C;  2HYE A;  4A09 B;  4K3I D;  2Q7Q A;  2H9M A;  2IWF A;  5FKQ A;  1P22 A;  2MTA H;  4J82 A;  3PSC B;  3UVK A;  3C75 H;  3DSM A;  4U1E I;  4CI2 A;  5EMM B;  4Z8L A;  3RFH A;  4R7A B;  3V5W B;  3EI2 B;  3J80 g;  4J8G A;  4U7A A;  2AH1 A;  3DWL C;  5HYN B;  3UR4 A;  2IUV A;  2Z2P A;  5SXM A;  2UZX B;  4L9O A;  4JSX C;  3RN1 D;  3C9C A;  4ZOV A;  3ORV D;  1U2V C;  5HE0 B;  2CN3 A;  4CI8 A;  2YNN A;  3PXS D;  4FA9 D;  3F3P A;  4PSW B;  4O9D A;  2I0T A;  2HXC A;  3DM0 A;  4ERY A;  5AJA A;  5EM2 B;  4HDJ A;  1SHY B;  3HFQ A;  3K27 A;  4QT8 A;  2YNP A;  2H68 A;  5C9Z B;  2H6K A;  2O9K A;  1N6E A;  1TYQ C;  1N6D A;  3UVO A;  4X61 B;  4ZOY A;  3DXM C;  4J0X A;  5IC7 A;  3NVQ A;  5H1M A;  5C2V B;  2CE9 A;  3EI3 A;  5I5J A;  3OKT A;  2H9P A;  2I3S A;  3OKY B;  1XHM A;  1A0R B;  2IUQ A;  3OL2 B;  3RRM C;  3EI1 B;  4PBZ A;  3SHF A;  3MZK A;  2CE8 A;  4H5I A;  1XKS A;  3AL8 B;  3FRX A;  1L0Q A;  3A0F A;  5GXH A;  2H3X A;  4GGA A;  2B5M A;  4FB1 D;  2H9N A;  3VH0 A;  3VGZ A;  5HE2 B;  3EWE A;  3ODT A;  4LGN A;  1GP2 B;  4J87 A;  2HKM A;  4I79 A;  1JMZ B;  2P9N C;  1MG2 A;  2OK4 A;  3U4Y A;  5CYK A;  4QL1 A;  3L4O D;  5CXC B;  5B4W A;  4A11 B;  4L3G D;  4FAN D;  4J78 A;  1GXR A;  4YVD A;  3BWS A;  4FA4 D;  4KFM B;  4O1Q D;  4GQB B;  2UZY B;  5IGO A;  1VYH C;  5GXI A;  3CFV A;  4AEZ A;  2G9A A;  3GFC A;  1YFQ A;  4A0A A;  3N0E A;  1SQJ A;  3SXT D;  4A7J A;  3J81 g;  4LG8 A;  4A0B A;  1PI6 A;  3PXT D;  3E0C A;  3JAM g;  3EG6 A;  1QNI A;  3IIY A;  3F3F A;  4PBY A;  1GG2 B;  4A09 A;  5HE1 B;  4PC0 A;  1PEV A;  2AGZ A;  4JXM A;  3PVW B;  5K1C C;  5K19 A;  4LG9 A;  4JSV C;  4CY2 A;  3BG0 A;  1FWX A;  4JD2 C;  4UI9 R;  3UVN A;  3EI2 A;  5FLX g;  5EAP A;  1SQ9 A;  3VA6 A;  3V7D B;  2W18 A;  4X60 B;  3P4F A;  1U4C A;  4QRJ A;  5THA A;  3PXW D;  2OK6 A;  1GOT B;  4OWR A;  2GC4 A;  5EAM A;  4D0K A;  1NR0 A;  4XYH A;  4IMM A;  2IUP A;  4PXW A;  4XYI A;  3UKR C;  4CZY A;  2B4E A;  4FWW A;  3JZH A;  5A2Q g;  5FKT A;  3OTT A;  3EI4 B;  2G99 A;  3I7H A;  1XIP A;  3I89 A;  4Y5R D;  3NVN A;  2H47 A;  5FQD A;  5EM2 A;  5FXY A;  1PGU A;  1MG3 A;  1N6F A;  2GC7 A;  5H17 A;  3FM0 A;  1K8K C;  3SCY A;  1JMX B;  4E5Z B;  3I7N A;  4J73 A;  4D6V A;  1S4U X;  4AOW A;  2OVR B;  3JZG A;  5HQG A;  4JSP C;  3OKY A;  1PBY B;  2HKR A;  4EWR A;  3OL2 A;  3EI1 A;  5TEF A;  4J79 A;  3I7P A;  3I7O A;  5IT9 g;  5TF2 A;  4MK0 B;  3AL8 A;  4CY1 A;  3I2N A;  3FGB A;  3CIK B;  3NVX A;  4X3E A;  5KDO B;  4A08 B;  4E54 B;  3W15 A;  2XL3 A;  3JRP A;  5HE3 B;  4ZN4 A;  2YNO A;  2CO0 C;  2P9U C;  4FAV D;  4QQE A;  4ES0 A;  2OJY A;  2TRC B;  4L1Q D;  4J77 A;  3C99 A;  3MXX A;  4FA5 D;  4J81 A;  2B5L A;  2OIZ A;  3DXK C;  2OVP B;  4ESG A;  3MZL A;  2HJ4 A;  3JRO A;  5EML B;  3SN6 B;  5CXC A;  3SWS D;  3IJ0 A;  4A11 A;  4ZOX A;  2AGX A;  3AH8 B;  5AFU 3;  3PVU B;  4X63 B;  3OKW A;  4ERZ A;  2Z2N A;  5FKR A;  3MKQ A;  4GM9 A;  2YMU A;  2AGW A;  3RN0 D;  4JSN C;  3OW8 A;  5TEE A;  4GQ1 A;  4IA9 A;  4L3H D;  5FKS A;  2H13 A;  2H14 A;  3RMZ D;  5CXB B;  2YB8 B;  3I8C A;  3L4M D;  1NEX B;  2P9L C;  3SVW D;  2PM9 B;  1JOF A;  2IWK A;  3I7L A;  3UVL A;  5FA5 B;  2J55 H;  1Q47 A;  3RFG A;  3JZN A;  3UVM A;  4CC9 A;  3IIW A;  5GSA A;  1K32 A;  2BBK H;  4FA1 D;  2YBA A;  5I5M A;  4JT5 C;  4TZ4 A;  2I3T A;  4GZ8 A;  4G56 B;  2XYI A;  3N0D A;  4O45 A;  2H9L A;  2J56 H;  2CO0 A;  3SBP A;  4K3J B;  5H14 A;  3GRE A;  3C5M A;  4NSX A;  3PSL A;  2OVQ B;  3V9F A;  3EI4 A;  2EBS A;  3JPX A;  4GGC A;  2QC5 A;  2PBI B;  3PE7 A;  4CI1 A;  5IJ7 E;  4J86 A;  4E5Z A;  3SJL D;  5EMJ B;  4A2L A;  2PM6 B;  4J84 A;  4CI3 A;  5TDH B;  2I0R A;  2P9I C;  3IJC A;  1B9X A;  1ERJ A;  2QXV A;  4CZV A;  4A2M A;  3SBQ A;  1MDA H;  4CY5 A;  3K26 A;  3SMR A;  5EMK B;  2GNQ A;  3UKU C;  3AL9 A;  4CY3 A;  2H6Q A;  4N14 A;  3EI3 B;  4ERQ A;  3SFZ A;  5IJ8 E;  2HES X;  2XL2 A;  2AQ5 A;  2P9P C;  4GM8 A;  1OMW B;  2J57 G;  2AGY A;  4GQ2 P;  4A08 A;  4E54 A;  5C2W B;  1R5M A;  1TBG A;  3CFS B;  3F3G A;  2B5N A;  3JB9 L;  3I7K A;  4PSX B;  1JJU B;  2CNX A;  3RSE C;  3SBR A;  3IKO A;  2AH0 A;  5AMS A;  3MKS B;  3KRW B;  2I0S A;  4PNK B;  4O3U B;  4GM3 A;  3ZWL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...