3F3PA

Crystal structure of the nucleoporin pair nup85-seh1, space group p21212
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
349
structure length
303
Chain Sequence
MQPFDSGHDDLVHDVVYDFYGRHVATCSSDQHIKVFKLDKDTSNWELSDSWRAHDSSIVAIDWASPEYGRIIASASYDKTVKLWEEDPDQEECSGRRWNKLCTLNDSKGSLYSVKFAPAHLGLKLACLGNDGILRLYDALEPSDLRSWTLTSEMKVLSIPQSDFCLSWCPSRFSPEKLAVSALEQAIIYQRGKDGKLHVAAKLPGHKSLIRSISWAPSIGRWYQLIATGCKDGRIRIFKITEKSNLQVELLSEHDDHNGEVWSVSWNLTGTILSSAGDDGKVRLWKATYSNEFKCMSVITAQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Nucleoporin SEH1
publication title A fence-like coat for the nuclear pore membrane.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 70
structure length 303
sequence length 349
chains with identical sequence B, E, F, I, J
ec nomenclature
pdb deposition date 2008-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3f3pA01
4GGCA 5SXMA 3I2NA 5CXCB 2Z2NA 3P4FA 3EI3B 4J8GA 5FQDA 3AFCA 5H17A 2H6QA 5EMMB 2GC4A 2Q7QA 2I3TA 3OKYB 5EM2B 1PI6A 1S4UX 2XL3A 4FA4D 3V7DB 3EI4A 2I0RA 4UI9R 5KDOB 4J79A 2AH0A 2HYEA 4GM3A 4JSXC 4J8BA 3I7LA 1K8KC 3SVWD 1B9YA 4GM8A 3VH0A 3I7OA 2AGYA 1PBYB 3C5MA 4E54A 4GQ1A 5EALA 1PEVA 4H5IA 2BCJB 3IIYA 3AL8A 2CO0C 1TYQC 3DSMA 4ERQA 2H14A 2P9PC 4PXWA 4QL1A 4IMMA 1XKSA 5THAA 2YBAA 4QQEA 2PBIB 1JMZB 3UKUC 3PSCB 3JZGA 2IAAA 2AGLA 2P9UC 1MDAH 4J78A 1MG2A 4JSPC 2HKRA 3K27A 4KFMB 3ORVD 5EMLB 4FHLA 1NEXB 3IJCA 3SMRA 4CZYA 3I89A 3ZWLB 4J81A 4GQBB 3OTTA 3FRXA 4J82A 4ESGA 4G56B 4X60B 3OW8A 4MK0B 4K3ID 4L1QD 4O3TB 3EI4B 2OJYA 5IGOA 4D6VA 3SLED 4ZOYA 3SJLD 1K32A 5HE2B 3MKSB 2GC7A 5A2Qg 4PSWB 4O3UB 4CZVA 2HJ4A 2H9LA 5FKQA 4U1EI 2W18A 5I5MA 5IC7A 1B9XA 3J81g 3UKRC 3NVQA 3SBRA 2OVQB 4A7JA 2I3SA 2HKMA 3C9CA 4XYHA 2H9MA 2CN2A 2IWFA 3PVWB 4LGNA 5CXBA 3AL9A 2QXVA 5FKSA 3DXKC 3EMHA 2H9NA 3K26A 3UVKA 4A09B 3OKWA 4GM9A 3FGBA 4PNKB 4EWRA 4IA9A 3I7HA 1PGUA 4E5ZA 5JWZA 3EI2A 1QNIA 2OK4A 2B4EA 3IKOA 4ZOVA 3EU7A 1MG3A 1SHYB 5C9ZB 4H5JA 5H14A 3CIKB 3RFHA 4GGAA 4ES0A 2Z2OA 2QC5A 5IGQA 3EWEA 1OMWB 1N6EA 4A0BB 3CFSB 2J57G 4L3GD 4CY1A 2B5NA 4Y5RD 2PM6B 4QRJA 2IUVA 5TEEA 4A0AA 3UVLA 3SBPA 3PXTD 3PE7A 3JZHA 2H13A 2I0TA 5GSAA 3EI1B 3VA6A 1GOTB 5GXHA 4FWWA 3NVXA 3SBQA 1N6FA 2CN3A 5TEFA 1TBGA 3UVOA 5IT9g 3NVNA 2YNOA 4PBZA 4CY5A 5EARA 4CI3A 2HXCA 4ERZA 4FA9D 4J77A 4A11A 3I7KA 4CZXA 5GXIA 3RN1D 3OL2A 4LG8A 3RLMD 4ZOZA 2PM9A 3V5WB 2H9PA 5HYNB 5HQGA 4JT6C 2XYIA 5AJAA 4QT8A 4BUJC 5TDHB 2UZYB 4O45A 2B5MA 3C99A 2IWKA 1JJUB 4HDJA 3OKTA 3AH8B 4FB1D 4CI1A 4LG9A 2EBSA 5FA5B 5I5IA 1R5MA 3JAMg 3UVNA 4FA5D 4OWRA 5GMKn 5K19A 4A08A 5TF2A 3U4YA 4BH6A 4CC9A 5EMKB 2H6KA 4XEIC 4JXMA 4O1QD 4L3HD 3CFVA 2H6NA 4FAVD 5FKRA 1FWXA 5HE0B 2P9SC 1Q47A 5FXYA 5CYKA 4K3JB 3MXXA 3PXWD 5CXCA 4E54B 4J84A 3EI3A 3RFGA 4JD2C 2OK6A 4Y7RA 2CE9A 3AL8B 3RN0D 2J56H 3KRWB 5FLXg 3RSEC 3L4MD 3OKYA 5EM2A 2CO0A 3RMZD 2HJBA 3GFCA 5H1MA 2O9KA 3IIWA 2AGZA 1A0RB 3MKQA 1XIPA 1GP2B 3BG1A 4U7AA 4X63B 4CI2A 3KRXB 3JB9L 2P9NC 1YFQA 2TRCB 1U4CA 3BG0A 3ULEC 3PVUB 2YMUA 3A0FA 3GREA 5EAPA 3VGZA 3SCYA 2BBKH 5K1CC 4J86A 3W15A 4A2LA 4PSXB 3MMYA 5FKTA 5IJ8E 4XYIA 4CY2A 4J0XA 4FA1D 4OZUA 1XHMA 1RI6A 2H68A 2UZXB 3RRMC 3JROA 4D0KA 3N0DA 4GMBA 4I79A 5C2VB 3DWLC 4ZN4A 2CE8A 5CXBB 2XU7A 2CNXA 3B7FA 3SXTD 4J87A 4J73A 5AMSA 5I5JA 1JOFA 5AFU3 4E5ZB 4GQ2P 3EI2B 4ZOXA 4FAND 3ODTA 3SHFA 4GGDA 3MZKA 3PXSD 1SQ9A 2OIZA 5EMJB 3C75H 3SWSD 4N14A 2H47A 2J55H 2P9LC 2AH1A 2AGXA 4CY3A 5EAMA 3F3GA 3I7NA 3SN6B 2OVRB 3EG6A 2YNPA 4JT5C 2IURA 4AOWA 2G9AA 3I8CA 3BWSA 4NSXA 4A09A 4Z8LA 1VYHC 5IJ7E 3MZLA 4A0AB 2PM7B 4TZ4A 3IJ1A 2YNNA 2P9IC 2YB8B 3N0EA 3V9FA 4PBYA 4PC0A 2MTAH 4X3EA 4X61B 3F3FA 4GZ8A 2P9KC 4YVDA 2Z2PA 1GG2B 4O9DA 4J0WA 2XL2A 2I0SA 3I7PA 4CI8A 2G99A 3IJ0A 3I8EA 4R7AB 4A2MA 4L9OA 4A0BA 1OLZA 4A11B 3L4OD 2IUQA 5B4WA 4ERYA 2AQ5A 3UR4A 3OL2B 3JPXA 2PM9B 2H3XA 4AEZA 2HESX 2AGWA 3DXMC 1U2VC 3JZNA 3UVMA 3EI1A 1L0QA 2OVPB 1NR0A 5HE1B 1N6DA 3FM0A 2B5LA 3F3PA 5C2WB 1ERJA 2GNQA 3DM0A 3JRPA 4A08B 1SQJA 1JMXB 4JSNC 3HFQA 4BL0A 3E0CA 3J80g 3SFZA 4JSVC 1P22A 5HE3B 2IUPA 1GXRA 5CYKB 3PSLA
chains in the Genus database with same CATH superfamily
4GGCA 5SXMA 2QR5A 3I2NA 5CXCB 2Z2NA 3P4FA 3EI3B 4J8GA 1A12A 5FQDA 3AFCA 5H17A 2H6QA 5EMMB 2GC4A 2Q7QA 5C92A 2I3TA 3OKYB 5EM2B 1PI6A 4NBMA 3OF7A 1S4UX 3IVMA 2XL3A 4FA4D 3V7DB 3EI4A 2I0RA 4UI9R 1UOQA 5KDOB 1UOPA 4J79A 2AH0A 4AMZA 2HYEA 4GM3A 5M5VA 4JSXC 4J8BA 1VZ2A 3I7LA 1K8KC 3SVWD 1B9YA 3GC3B 4GM8A 3VH0A 3I7OA 2AGYA 4WK4A 2HU7A 1PBYB 3C5MA 4E54A 4GQ1A 1GOGA 5EALA 1PEVA 2VDOA 4H5IA 2BCJB 3IIYA 3AL8A 2CO0C 1TYQC 3DSMA 4ERQA 2H14A 1U8CA 2P9PC 4PXWA 4QL1A 4IMMA 5M5SA 1XKSA 5THAA 2YBAA 4QQEA 2PBIB 1JMZB 3UKUC 3PSCB 4NC4A 3JZGA 2IAAA 2AGLA 2P9UC 1MDAH 4J78A 4DNWA 1MG2A 4JSPC 2BKLA 2HKRA 3FCSA 3GD1I 5FFOA 3V4PA 3K27A 4KFMB 3ORVD 5EMLB 4BCDA 3T3PA 4FHLA 3VI4A 3ZDYA 1NEXB 3IJCA 3SMRA 4BP8A 4CZYA 3I89A 3ZWLB 4J81A 4GQBB 4O2WA 3OTTA 3FRXA 4J82A 4BP9A 4G56B 4MMZA 4X60B 3OW8A 4MK0B 4ESGA 4K3ID 4L1QD 4O3TB 3EI4B 2OJYA 2VDPA 5IGOA 4D6VA 3SLED 4ZOYA 3SJLD 1K32A 5HE2B 3MKSB 2GC7A 5A2Qg 4PSWB 4O3UB 4CZVA 2HJ4A 2H9LA 3K72A 2QZPA 5FKQA 4U1EI 2W18A 5I5MA 5IC7A 1B9XA 3J81g 3UKRC 3NVQA 3SBRA 3IUNA 2OVQB 4A7JA 2I3SA 2HKMA 3C9CA 3KCIA 4XYHA 4AN0A 2H9MA 2CN2A 2IWFA 3PVWB 4LGNA 5E6UA 5CXBA 3AL9A 2QXVA 5FKSA 3K71A 3MUOA 3DXKC 3EMHA 2H9NA 3K26A 3UVKA 4A09B 3OKWA 4GM9A 3FGBA 4PNKB 4EWRA 4IA9A 3I7HA 2VZ3A 1PGUA 3NIDA 4E5ZA 5JWZA 3EI2A 2XZGA 1QNIA 1BPOA 2OK4A 2B4EA 3IKOA 4ZOVA 1H2ZA 3EU7A 1MG3A 2EIDA 1SHYB 5C9ZB 3IUJA 4H5JA 3DDUA 4BCCA 5H14A 3CIKB 3RFHA 4GGAA 4ES0A 2Z2OA 2QC5A 4G1MA 5IGQA 3EWEA 1OMWB 1N6EA 3ZE1A 1C9LA 4A0BB 1VE6A 2J57G 3CFSB 3O4IA 4L3GD 4CY1A 2B5NA 1TYEA 4JHPC 4Y5RD 2PM6B 4QRJA 2IUVA 5TEEA 4A0AA 3UVLA 3SBPA 3PXTD 3PE7A 4BCBA 3ZE0A 3JZHA 1M1XA 2H13A 2I0TA 4AMYA 5GSAA 4QAMA 3EI1B 3VA6A 1GOTB 5GXHA 4FWWA 3NVXA 3SBQA 1E8NA 1N6FA 2HU8A 2CN3A 4WJKA 5TEFA 1TBGA 3UVOA 5IT9g 3NVNA 2YNOA 4PBZA 4CY5A 5EARA 4CI3A 4MMXA 1T2XA 2HXCA 4ERZA 4FA9D 1UOOA 4J77A 4A11A 3I7KA 4CZXA 5GXIA 3RN1D 1VE7A 3OL2A 4LG8A 3RLMD 4ZOZA 2PM9A 3V5WB 2H9PA 5HYNB 3V4VA 5HQGA 4JT6C 2XYIA 4O02A 1H2WA 5AJAA 4QT8A 4BUJC 4NENA 5TDHB 2UZYB 4O45A 2B5MA 1VZ3A 1QFSA 3C99A 2IWKA 4WK0A 1JJUB 4HDJA 3OKTA 3AH8B 4FB1D 3MVDK 4CI1A 3IUMA 2EBSA 4LG9A 5FA5B 5I5IA 3EQ8A 1R5MA 3JAMg 3UVNA 4FA5D 4Z7OA 4UM8A 4OWRA 3O4GA 5GMKn 5K19A 4A08A 5TF2A 2VDLA 4RE6A 3U4YA 4BH6A 3MUNA 4CC9A 5EMKB 2H6KA 4XEIC 4JXMA 4O1QD 4L3HD 3CFVA 2H6NA 4FAVD 5FKRA 1FWXA 5HE0B 2P9SC 1Q47A 5FXYA 5CYKA 4K3JB 3MXXA 3VI3A 3PXWD 5CXCA 4E54B 4J84A 1QFMA 3EI3A 3RFGA 4JD2C 2OK6A 4AN1A 4Y7RA 5FFGA 2CE9A 3AL8B 3RN0D 2J56H 3KRWB 5FLXg 3RSEC 3L4MD 3OKYA 5EM2A 2CO0A 3RMZD 2HJBA 1I2MB 2JKXA 3GFCA 5H1MA 2O9KA 2VDQA 3IIWA 2AGZA 5C86A 1A0RB 3MKQA 1XIPA 1JV2A 1GP2B 3BG1A 4DNUA 4U7AA 4X63B 4CI2A 3KRXB 2VDRA 3JB9L 2P9NC 3IURA 1O6FA 3QI0A 5M5RA 1YFQA 3K6SA 2TRCB 3EQ9A 1U4CA 3BG0A 3ULEC 2VDMA 3PVUB 2YMUA 3A0FA 4G1EA 3GREA 5EAPA 3VGZA 3SCYA 2EIEA 2BBKH 5M61A 4WK2A 5K1CC 4D9SA 4J86A 3W15A 4A2LA 4PSXB 3T3MA 3MMYA 5FKTA 5IJ8E 4XYIA 4CY2A 4J0XA 4AX4A 4FA1D 4OZUA 1XHMA 1RI6A 2H68A 2UZXB 1H2YA 3RRMC 3JROA 4D0KA 3N0DA 4GMBA 4I79A 3QHYB 5C2VB 3DWLC 4ZN4A 1K3IA 2CE8A 5CXBB 2XU7A 2CNXA 2HU5A 3O4HA 3B7FA 3SXTD 4UM9A 4DNVA 4J87A 4J73A 5AMSA 5I5JA 1JOFA 5AFU3 4E5ZB 4GQ2P 3EI2B 4ZOXA 4FAND 4Z7NA 3ODTA 3SHFA 4GGDA 5M5UA 3MZKA 3PXSD 1SQ9A 2OIZA 5EMJB 3C75H 3SWSD 3ZDXA 4N14A 2H47A 2J55H 2P9LC 2VDNA 2AH1A 2AGXA 5M5TA 4CY3A 3NIFA 5EAMA 1E5TA 3F3GA 3I7NA 5HDBA 3SN6B 2OVRB 2WQ8A 2YNPA 3EG6A 4JT5C 2IURA 4AOWA 2G9AA 3I8CA 3BWSA 2VDKA 4NSXA 3ZE2A 4A09A 4L1MA 4Z8LA 1O6GA 1VYHC 5IJ7E 2EICA 4Z7QA 3O4JA 3MZLA 4A0AB 3ZDZA 2PM7B 3FCUA 5E6RA 4TZ4A 3IJ1A 2YNNA 4NAAA 2P9IC 2YB8B 3N0EA 3V9FA 1UTCA 4PBYA 4PC0A 2MTAH 4X3EA 4X61B 3F3FA 4GZ8A 2P9KC 2VZ1A 4YVDA 2Z2PA 1GG2B 4O9DA 4J0WA 2XL2A 2I0SA 3I7PA 4CI8A 2G99A 3IJ0A 3I8EA 4R7AB 4A2MA 1YR2A 1GOFA 4L9OA 4A0BA 1OLZA 4A11B 3L4OD 2IUQA 5E6SA 5B4WA 4ERYA 2AQ5A 3UR4A 3OL2B 3JPXA 2PM9B 2H3XA 4RE5A 3IJEA 4AEZA 1C9IA 2HESX 4G55A 2AGWA 1JTDB 2EIBA 3DXMC 1U2VC 3JZNA 3UVMA 3EI1A 1E8MA 1L0QA 4JHNA 2OVPB 1NR0A 3EQ7A 5HE1B 1N6DA 3FM0A 2B5LA 2VC2A 3F3PA 4MMYA 5C2WB 1ERJA 2GNQA 3DM0A 3JRPA 3IULA 3IUQA 4A08B 1H2XA 1SQJA 1GOHA 1JMXB 1L5GA 4JSNC 4IRZA 3HFQA 4BL0A 3E0CA 3J80g 3NIGA 4JSVC 1P22A 5HE3B 3SFZA 2IUPA 1GXRA 2XE4A 2XDWA 5CYKB 3PSLA
chains in the Genus database with same CATH topology
4GGCA 5SXMA 3I2NA 5CXCB 2Z2NA 3P4FA 3EI3B 4J8GA 5FQDA 3AFCA 5H17A 2H6QA 5EMMB 2GC4A 2Q7QA 2I3TA 3OKYB 5EM2B 1PI6A 1S4UX 2XL3A 4FA4D 3V7DB 3EI4A 2I0RA 4UI9R 5KDOB 4J79A 2AH0A 2HYEA 4GM3A 4JSXC 4J8BA 3I7LA 1K8KC 3SVWD 1B9YA 4GM8A 3VH0A 3I7OA 2AGYA 1PBYB 3C5MA 4E54A 4GQ1A 5EALA 1PEVA 4H5IA 2BCJB 3IIYA 3AL8A 2CO0C 1TYQC 3DSMA 4ERQA 2H14A 2P9PC 4PXWA 4QL1A 4IMMA 1XKSA 5THAA 2YBAA 4QQEA 2PBIB 1JMZB 3UKUC 3PSCB 3JZGA 2IAAA 2AGLA 2P9UC 1MDAH 4J78A 1MG2A 4JSPC 2HKRA 3K27A 4KFMB 3ORVD 5EMLB 4FHLA 1NEXB 3IJCA 3SMRA 4CZYA 3I89A 3ZWLB 4J81A 4GQBB 3OTTA 3FRXA 4J82A 4ESGA 4G56B 4X60B 3OW8A 4MK0B 4K3ID 4L1QD 4O3TB 3EI4B 2OJYA 5IGOA 4D6VA 3SLED 4ZOYA 3SJLD 1K32A 5HE2B 3MKSB 2GC7A 5A2Qg 4PSWB 4O3UB 4CZVA 2HJ4A 2H9LA 5FKQA 4U1EI 2W18A 5I5MA 5IC7A 1B9XA 3J81g 3UKRC 3NVQA 3SBRA 2OVQB 4A7JA 2I3SA 2HKMA 3C9CA 4XYHA 2H9MA 2CN2A 2IWFA 3PVWB 4LGNA 5CXBA 3AL9A 2QXVA 5FKSA 3DXKC 3EMHA 2H9NA 3K26A 3UVKA 4A09B 3OKWA 4GM9A 3FGBA 4PNKB 4EWRA 4IA9A 3I7HA 1PGUA 4E5ZA 5JWZA 3EI2A 1QNIA 2OK4A 2B4EA 3IKOA 4ZOVA 3EU7A 1MG3A 1SHYB 5C9ZB 4H5JA 5H14A 3CIKB 3RFHA 4GGAA 4ES0A 2Z2OA 2QC5A 5IGQA 3EWEA 1OMWB 1N6EA 4A0BB 3CFSB 2J57G 4L3GD 4CY1A 2B5NA 4Y5RD 2PM6B 4QRJA 2IUVA 5TEEA 4A0AA 3UVLA 3SBPA 3PXTD 3PE7A 3JZHA 2H13A 2I0TA 5GSAA 3EI1B 3VA6A 1GOTB 5GXHA 4FWWA 3NVXA 3SBQA 1N6FA 2CN3A 5TEFA 1TBGA 3UVOA 5IT9g 3NVNA 2YNOA 4PBZA 4CY5A 5EARA 4CI3A 2HXCA 4ERZA 4FA9D 4J77A 4A11A 3I7KA 4CZXA 5GXIA 3RN1D 3OL2A 4LG8A 3RLMD 4ZOZA 2PM9A 3V5WB 2H9PA 5HYNB 5HQGA 4JT6C 2XYIA 5AJAA 4QT8A 4BUJC 5TDHB 2UZYB 4O45A 2B5MA 3C99A 2IWKA 1JJUB 4HDJA 3OKTA 3AH8B 4FB1D 4CI1A 4LG9A 2EBSA 5FA5B 5I5IA 1R5MA 3JAMg 3UVNA 4FA5D 4OWRA 5GMKn 5K19A 4A08A 5TF2A 3U4YA 4BH6A 4CC9A 5EMKB 2H6KA 4XEIC 4JXMA 4O1QD 4L3HD 3CFVA 2H6NA 4FAVD 5FKRA 1FWXA 5HE0B 2P9SC 1Q47A 5FXYA 5CYKA 4K3JB 3MXXA 3PXWD 5CXCA 4E54B 4J84A 3EI3A 3RFGA 4JD2C 2OK6A 4Y7RA 2CE9A 3AL8B 3RN0D 2J56H 3KRWB 5FLXg 3RSEC 3L4MD 3OKYA 5EM2A 2CO0A 3RMZD 2HJBA 3GFCA 5H1MA 2O9KA 3IIWA 2AGZA 1A0RB 3MKQA 1XIPA 1GP2B 3BG1A 4U7AA 4X63B 4CI2A 3KRXB 3JB9L 2P9NC 1YFQA 2TRCB 1U4CA 3BG0A 3ULEC 3PVUB 2YMUA 3A0FA 3GREA 5EAPA 3VGZA 3SCYA 2BBKH 5K1CC 4J86A 3W15A 4A2LA 4PSXB 3MMYA 5FKTA 5IJ8E 4XYIA 4CY2A 4J0XA 4FA1D 4OZUA 1XHMA 1RI6A 2H68A 2UZXB 3RRMC 3JROA 4D0KA 3N0DA 4GMBA 4I79A 5C2VB 3DWLC 4ZN4A 2CE8A 5CXBB 2XU7A 2CNXA 3B7FA 3SXTD 4J87A 4J73A 5AMSA 5I5JA 1JOFA 5AFU3 4E5ZB 4GQ2P 3EI2B 4ZOXA 4FAND 3ODTA 3SHFA 4GGDA 3MZKA 3PXSD 1SQ9A 2OIZA 5EMJB 3C75H 3SWSD 4N14A 2H47A 2J55H 2P9LC 2AH1A 2AGXA 4CY3A 5EAMA 3F3GA 3I7NA 3SN6B 2OVRB 3EG6A 2YNPA 4JT5C 2IURA 4AOWA 2G9AA 3I8CA 3BWSA 4NSXA 4A09A 4Z8LA 1VYHC 5IJ7E 3MZLA 4A0AB 2PM7B 4TZ4A 3IJ1A 2YNNA 2P9IC 2YB8B 3N0EA 3V9FA 4PBYA 4PC0A 2MTAH 4X3EA 4X61B 3F3FA 4GZ8A 2P9KC 4YVDA 2Z2PA 1GG2B 4O9DA 4J0WA 2XL2A 2I0SA 3I7PA 4CI8A 2G99A 3IJ0A 3I8EA 4R7AB 4A2MA 4L9OA 4A0BA 1OLZA 4A11B 3L4OD 2IUQA 5B4WA 4ERYA 2AQ5A 3UR4A 3OL2B 3JPXA 2PM9B 2H3XA 4AEZA 2HESX 2AGWA 3DXMC 1U2VC 3JZNA 3UVMA 3EI1A 1L0QA 2OVPB 1NR0A 5HE1B 1N6DA 3FM0A 2B5LA 3F3PA 5C2WB 1ERJA 2GNQA 3DM0A 3JRPA 4A08B 1SQJA 1JMXB 4JSNC 3HFQA 4BL0A 3E0CA 3J80g 3SFZA 4JSVC 1P22A 5HE3B 2IUPA 1GXRA 5CYKB 3PSLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GGC A;  5SXM A;  3I2N A;  5CXC B;  2Z2N A;  3P4F A;  3EI3 B;  4J8G A;  5FQD A;  3AFC A;  5H17 A;  2H6Q A;  5EMM B;  2GC4 A;  2Q7Q A;  2I3T A;  3OKY B;  5EM2 B;  1PI6 A;  1S4U X;  2XL3 A;  4FA4 D;  3V7D B;  3EI4 A;  2I0R A;  4UI9 R;  5KDO B;  4J79 A;  2AH0 A;  2HYE A;  4GM3 A;  4JSX C;  4J8B A;  3I7L A;  1K8K C;  3SVW D;  1B9Y A;  4GM8 A;  3VH0 A;  3I7O A;  2AGY A;  1PBY B;  3C5M A;  4E54 A;  4GQ1 A;  5EAL A;  1PEV A;  4H5I A;  2BCJ B;  3IIY A;  3AL8 A;  2CO0 C;  1TYQ C;  3DSM A;  4ERQ A;  2H14 A;  2P9P C;  4PXW A;  4QL1 A;  4IMM A;  1XKS A;  5THA A;  2YBA A;  4QQE A;  2PBI B;  1JMZ B;  3UKU C;  3PSC B;  3JZG A;  2IAA A;  2AGL A;  2P9U C;  1MDA H;  4J78 A;  1MG2 A;  4JSP C;  2HKR A;  3K27 A;  4KFM B;  3ORV D;  5EML B;  4FHL A;  1NEX B;  3IJC A;  3SMR A;  4CZY A;  3I89 A;  3ZWL B;  4J81 A;  4GQB B;  3OTT A;  3FRX A;  4J82 A;  4ESG A;  4G56 B;  4X60 B;  3OW8 A;  4MK0 B;  4K3I D;  4L1Q D;  4O3T B;  3EI4 B;  2OJY A;  5IGO A;  4D6V A;  3SLE D;  4ZOY A;  3SJL D;  1K32 A;  5HE2 B;  3MKS B;  2GC7 A;  5A2Q g;  4PSW B;  4O3U B;  4CZV A;  2HJ4 A;  2H9L A;  5FKQ A;  4U1E I;  2W18 A;  5I5M A;  5IC7 A;  1B9X A;  3J81 g;  3UKR C;  3NVQ A;  3SBR A;  2OVQ B;  4A7J A;  2I3S A;  2HKM A;  3C9C A;  4XYH A;  2H9M A;  2CN2 A;  2IWF A;  3PVW B;  4LGN A;  5CXB A;  3AL9 A;  2QXV A;  5FKS A;  3DXK C;  3EMH A;  2H9N A;  3K26 A;  3UVK A;  4A09 B;  3OKW A;  4GM9 A;  3FGB A;  4PNK B;  4EWR A;  4IA9 A;  3I7H A;  1PGU A;  4E5Z A;  5JWZ A;  3EI2 A;  1QNI A;  2OK4 A;  2B4E A;  3IKO A;  4ZOV A;  3EU7 A;  1MG3 A;  1SHY B;  5C9Z B;  4H5J A;  5H14 A;  3CIK B;  3RFH A;  4GGA A;  4ES0 A;  2Z2O A;  2QC5 A;  5IGQ A;  3EWE A;  1OMW B;  1N6E A;  4A0B B;  3CFS B;  2J57 G;  4L3G D;  4CY1 A;  2B5N A;  4Y5R D;  2PM6 B;  4QRJ A;  2IUV A;  5TEE A;  4A0A A;  3UVL A;  3SBP A;  3PXT D;  3PE7 A;  3JZH A;  2H13 A;  2I0T A;  5GSA A;  3EI1 B;  3VA6 A;  1GOT B;  5GXH A;  4FWW A;  3NVX A;  3SBQ A;  1N6F A;  2CN3 A;  5TEF A;  1TBG A;  3UVO A;  5IT9 g;  3NVN A;  2YNO A;  4PBZ A;  4CY5 A;  5EAR A;  4CI3 A;  2HXC A;  4ERZ A;  4FA9 D;  4J77 A;  4A11 A;  3I7K A;  4CZX A;  5GXI A;  3RN1 D;  3OL2 A;  4LG8 A;  3RLM D;  4ZOZ A;  2PM9 A;  3V5W B;  2H9P A;  5HYN B;  5HQG A;  4JT6 C;  2XYI A;  5AJA A;  4QT8 A;  4BUJ C;  5TDH B;  2UZY B;  4O45 A;  2B5M A;  3C99 A;  2IWK A;  1JJU B;  4HDJ A;  3OKT A;  3AH8 B;  4FB1 D;  4CI1 A;  4LG9 A;  2EBS A;  5FA5 B;  5I5I A;  1R5M A;  3JAM g;  3UVN A;  4FA5 D;  4OWR A;  5GMK n;  5K19 A;  4A08 A;  5TF2 A;  3U4Y A;  4BH6 A;  4CC9 A;  5EMK B;  2H6K A;  4XEI C;  4JXM A;  4O1Q D;  4L3H D;  3CFV A;  2H6N A;  4FAV D;  5FKR A;  1FWX A;  5HE0 B;  2P9S C;  1Q47 A;  5FXY A;  5CYK A;  4K3J B;  3MXX A;  3PXW D;  5CXC A;  4E54 B;  4J84 A;  3EI3 A;  3RFG A;  4JD2 C;  2OK6 A;  4Y7R A;  2CE9 A;  3AL8 B;  3RN0 D;  2J56 H;  3KRW B;  5FLX g;  3RSE C;  3L4M D;  3OKY A;  5EM2 A;  2CO0 A;  3RMZ D;  2HJB A;  3GFC A;  5H1M A;  2O9K A;  3IIW A;  2AGZ A;  1A0R B;  3MKQ A;  1XIP A;  1GP2 B;  3BG1 A;  4U7A A;  4X63 B;  4CI2 A;  3KRX B;  3JB9 L;  2P9N C;  1YFQ A;  2TRC B;  1U4C A;  3BG0 A;  3ULE C;  3PVU B;  2YMU A;  3A0F A;  3GRE A;  5EAP A;  3VGZ A;  3SCY A;  2BBK H;  5K1C C;  4J86 A;  3W15 A;  4A2L A;  4PSX B;  3MMY A;  5FKT A;  5IJ8 E;  4XYI A;  4CY2 A;  4J0X A;  4FA1 D;  4OZU A;  1XHM A;  1RI6 A;  2H68 A;  2UZX B;  3RRM C;  3JRO A;  4D0K A;  3N0D A;  4GMB A;  4I79 A;  5C2V B;  3DWL C;  4ZN4 A;  2CE8 A;  5CXB B;  2XU7 A;  2CNX A;  3B7F A;  3SXT D;  4J87 A;  4J73 A;  5AMS A;  5I5J A;  1JOF A;  5AFU 3;  4E5Z B;  4GQ2 P;  3EI2 B;  4ZOX A;  4FAN D;  3ODT A;  3SHF A;  4GGD A;  3MZK A;  3PXS D;  1SQ9 A;  2OIZ A;  5EMJ B;  3C75 H;  3SWS D;  4N14 A;  2H47 A;  2J55 H;  2P9L C;  2AH1 A;  2AGX A;  4CY3 A;  5EAM A;  3F3G A;  3I7N A;  3SN6 B;  2OVR B;  3EG6 A;  2YNP A;  4JT5 C;  2IUR A;  4AOW A;  2G9A A;  3I8C A;  3BWS A;  4NSX A;  4A09 A;  4Z8L A;  1VYH C;  5IJ7 E;  3MZL A;  4A0A B;  2PM7 B;  4TZ4 A;  3IJ1 A;  2YNN A;  2P9I C;  2YB8 B;  3N0E A;  3V9F A;  4PBY A;  4PC0 A;  2MTA H;  4X3E A;  4X61 B;  3F3F A;  4GZ8 A;  2P9K C;  4YVD A;  2Z2P A;  1GG2 B;  4O9D A;  4J0W A;  2XL2 A;  2I0S A;  3I7P A;  4CI8 A;  2G99 A;  3IJ0 A;  3I8E A;  4R7A B;  4A2M A;  4L9O A;  4A0B A;  1OLZ A;  4A11 B;  3L4O D;  2IUQ A;  5B4W A;  4ERY A;  2AQ5 A;  3UR4 A;  3OL2 B;  3JPX A;  2PM9 B;  2H3X A;  4AEZ A;  2HES X;  2AGW A;  3DXM C;  1U2V C;  3JZN A;  3UVM A;  3EI1 A;  1L0Q A;  2OVP B;  1NR0 A;  5HE1 B;  1N6D A;  3FM0 A;  2B5L A;  3F3P A;  5C2W B;  1ERJ A;  2GNQ A;  3DM0 A;  3JRP A;  4A08 B;  1SQJ A;  1JMX B;  4JSN C;  3HFQ A;  4BL0 A;  3E0C A;  3J80 g;  3SFZ A;  4JSV C;  1P22 A;  5HE3 B;  2IUP A;  1GXR A;  5CYK B;  3PSL A; 
#chains in the Genus database with same CATH topology
 4GGC A;  5SXM A;  2QR5 A;  3I2N A;  5CXC B;  2Z2N A;  3P4F A;  3EI3 B;  4J8G A;  1A12 A;  5FQD A;  3AFC A;  5H17 A;  2H6Q A;  5EMM B;  2GC4 A;  2Q7Q A;  5C92 A;  2I3T A;  3OKY B;  5EM2 B;  1PI6 A;  4NBM A;  3OF7 A;  1S4U X;  3IVM A;  2XL3 A;  4FA4 D;  3V7D B;  3EI4 A;  2I0R A;  4UI9 R;  1UOQ A;  5KDO B;  1UOP A;  4J79 A;  2AH0 A;  4AMZ A;  2HYE A;  4GM3 A;  5M5V A;  4JSX C;  4J8B A;  1VZ2 A;  3I7L A;  1K8K C;  3SVW D;  1B9Y A;  3GC3 B;  4GM8 A;  3VH0 A;  3I7O A;  2AGY A;  4WK4 A;  2HU7 A;  1PBY B;  3C5M A;  4E54 A;  4GQ1 A;  1GOG A;  5EAL A;  1PEV A;  2VDO A;  4H5I A;  2BCJ B;  3IIY A;  3AL8 A;  2CO0 C;  1TYQ C;  3DSM A;  4ERQ A;  2H14 A;  1U8C A;  2P9P C;  4PXW A;  4QL1 A;  4IMM A;  5M5S A;  1XKS A;  5THA A;  2YBA A;  4QQE A;  2PBI B;  1JMZ B;  3UKU C;  3PSC B;  4NC4 A;  3JZG A;  2IAA A;  2AGL A;  2P9U C;  1MDA H;  4J78 A;  4DNW A;  1MG2 A;  4JSP C;  2BKL A;  2HKR A;  3FCS A;  3GD1 I;  5FFO A;  3V4P A;  3K27 A;  4KFM B;  3ORV D;  5EML B;  4BCD A;  3T3P A;  4FHL A;  3VI4 A;  3ZDY A;  1NEX B;  3IJC A;  3SMR A;  4BP8 A;  4CZY A;  3I89 A;  3ZWL B;  4J81 A;  4GQB B;  4O2W A;  3OTT A;  3FRX A;  4J82 A;  4BP9 A;  4G56 B;  4MMZ A;  4X60 B;  3OW8 A;  4MK0 B;  4ESG A;  4K3I D;  4L1Q D;  4O3T B;  3EI4 B;  2OJY A;  2VDP A;  5IGO A;  4D6V A;  3SLE D;  4ZOY A;  3SJL D;  1K32 A;  5HE2 B;  3MKS B;  2GC7 A;  5A2Q g;  4PSW B;  4O3U B;  4CZV A;  2HJ4 A;  2H9L A;  3K72 A;  2QZP A;  5FKQ A;  4U1E I;  2W18 A;  5I5M A;  5IC7 A;  1B9X A;  3J81 g;  3UKR C;  3NVQ A;  3SBR A;  3IUN A;  2OVQ B;  4A7J A;  2I3S A;  2HKM A;  3C9C A;  3KCI A;  4XYH A;  4AN0 A;  2H9M A;  2CN2 A;  2IWF A;  3PVW B;  4LGN A;  5E6U A;  5CXB A;  3AL9 A;  2QXV A;  5FKS A;  3K71 A;  3MUO A;  3DXK C;  3EMH A;  2H9N A;  3K26 A;  3UVK A;  4A09 B;  3OKW A;  4GM9 A;  3FGB A;  4PNK B;  4EWR A;  4IA9 A;  3I7H A;  2VZ3 A;  1PGU A;  3NID A;  4E5Z A;  5JWZ A;  3EI2 A;  2XZG A;  1QNI A;  1BPO A;  2OK4 A;  2B4E A;  3IKO A;  4ZOV A;  1H2Z A;  3EU7 A;  1MG3 A;  2EID A;  1SHY B;  5C9Z B;  3IUJ A;  4H5J A;  3DDU A;  4BCC A;  5H14 A;  3CIK B;  3RFH A;  4GGA A;  4ES0 A;  2Z2O A;  2QC5 A;  4G1M A;  5IGQ A;  3EWE A;  1OMW B;  1N6E A;  3ZE1 A;  1C9L A;  4A0B B;  1VE6 A;  2J57 G;  3CFS B;  3O4I A;  4L3G D;  4CY1 A;  2B5N A;  1TYE A;  4JHP C;  4Y5R D;  2PM6 B;  4QRJ A;  2IUV A;  5TEE A;  4A0A A;  3UVL A;  3SBP A;  3PXT D;  3PE7 A;  4BCB A;  3ZE0 A;  3JZH A;  1M1X A;  2H13 A;  2I0T A;  4AMY A;  5GSA A;  4QAM A;  3EI1 B;  3VA6 A;  1GOT B;  5GXH A;  4FWW A;  3NVX A;  3SBQ A;  1E8N A;  1N6F A;  2HU8 A;  2CN3 A;  4WJK A;  5TEF A;  1TBG A;  3UVO A;  5IT9 g;  3NVN A;  2YNO A;  4PBZ A;  4CY5 A;  5EAR A;  4CI3 A;  4MMX A;  1T2X A;  2HXC A;  4ERZ A;  4FA9 D;  1UOO A;  4J77 A;  4A11 A;  3I7K A;  4CZX A;  5GXI A;  3RN1 D;  1VE7 A;  3OL2 A;  4LG8 A;  3RLM D;  4ZOZ A;  2PM9 A;  3V5W B;  2H9P A;  5HYN B;  3V4V A;  5HQG A;  4JT6 C;  2XYI A;  4O02 A;  1H2W A;  5AJA A;  4QT8 A;  4BUJ C;  4NEN A;  5TDH B;  2UZY B;  4O45 A;  2B5M A;  1VZ3 A;  1QFS A;  3C99 A;  2IWK A;  4WK0 A;  1JJU B;  4HDJ A;  3OKT A;  3AH8 B;  4FB1 D;  3MVD K;  4CI1 A;  3IUM A;  2EBS A;  4LG9 A;  5FA5 B;  5I5I A;  3EQ8 A;  1R5M A;  3JAM g;  3UVN A;  4FA5 D;  4Z7O A;  4UM8 A;  4OWR A;  3O4G A;  5GMK n;  5K19 A;  4A08 A;  5TF2 A;  2VDL A;  4RE6 A;  3U4Y A;  4BH6 A;  3MUN A;  4CC9 A;  5EMK B;  2H6K A;  4XEI C;  4JXM A;  4O1Q D;  4L3H D;  3CFV A;  2H6N A;  4FAV D;  5FKR A;  1FWX A;  5HE0 B;  2P9S C;  1Q47 A;  5FXY A;  5CYK A;  4K3J B;  3MXX A;  3VI3 A;  3PXW D;  5CXC A;  4E54 B;  4J84 A;  1QFM A;  3EI3 A;  3RFG A;  4JD2 C;  2OK6 A;  4AN1 A;  4Y7R A;  5FFG A;  2CE9 A;  3AL8 B;  3RN0 D;  2J56 H;  3KRW B;  5FLX g;  3RSE C;  3L4M D;  3OKY A;  5EM2 A;  2CO0 A;  3RMZ D;  2HJB A;  1I2M B;  2JKX A;  3GFC A;  5H1M A;  2O9K A;  2VDQ A;  3IIW A;  2AGZ A;  5C86 A;  1A0R B;  3MKQ A;  1XIP A;  1JV2 A;  1GP2 B;  3BG1 A;  4DNU A;  4U7A A;  4X63 B;  4CI2 A;  3KRX B;  2VDR A;  3JB9 L;  2P9N C;  3IUR A;  1O6F A;  3QI0 A;  5M5R A;  1YFQ A;  3K6S A;  2TRC B;  3EQ9 A;  1U4C A;  3BG0 A;  3ULE C;  2VDM A;  3PVU B;  2YMU A;  3A0F A;  4G1E A;  3GRE A;  5EAP A;  3VGZ A;  3SCY A;  2EIE A;  2BBK H;  5M61 A;  4WK2 A;  5K1C C;  4D9S A;  4J86 A;  3W15 A;  4A2L A;  4PSX B;  3T3M A;  3MMY A;  5FKT A;  5IJ8 E;  4XYI A;  4CY2 A;  4J0X A;  4AX4 A;  4FA1 D;  4OZU A;  1XHM A;  1RI6 A;  2H68 A;  2UZX B;  1H2Y A;  3RRM C;  3JRO A;  4D0K A;  3N0D A;  4GMB A;  4I79 A;  3QHY B;  5C2V B;  3DWL C;  4ZN4 A;  1K3I A;  2CE8 A;  5CXB B;  2XU7 A;  2CNX A;  2HU5 A;  3O4H A;  3B7F A;  3SXT D;  4UM9 A;  4DNV A;  4J87 A;  4J73 A;  5AMS A;  5I5J A;  1JOF A;  5AFU 3;  4E5Z B;  4GQ2 P;  3EI2 B;  4ZOX A;  4FAN D;  4Z7N A;  3ODT A;  3SHF A;  4GGD A;  5M5U A;  3MZK A;  3PXS D;  1SQ9 A;  2OIZ A;  5EMJ B;  3C75 H;  3SWS D;  3ZDX A;  4N14 A;  2H47 A;  2J55 H;  2P9L C;  2VDN A;  2AH1 A;  2AGX A;  5M5T A;  4CY3 A;  3NIF A;  5EAM A;  1E5T A;  3F3G A;  3I7N A;  5HDB A;  3SN6 B;  2OVR B;  2WQ8 A;  2YNP A;  3EG6 A;  4JT5 C;  2IUR A;  4AOW A;  2G9A A;  3I8C A;  3BWS A;  2VDK A;  4NSX A;  3ZE2 A;  4A09 A;  4L1M A;  4Z8L A;  1O6G A;  1VYH C;  5IJ7 E;  2EIC A;  4Z7Q A;  3O4J A;  3MZL A;  4A0A B;  3ZDZ A;  2PM7 B;  3FCU A;  5E6R A;  4TZ4 A;  3IJ1 A;  2YNN A;  4NAA A;  2P9I C;  2YB8 B;  3N0E A;  3V9F A;  1UTC A;  4PBY A;  4PC0 A;  2MTA H;  4X3E A;  4X61 B;  3F3F A;  4GZ8 A;  2P9K C;  2VZ1 A;  4YVD A;  2Z2P A;  1GG2 B;  4O9D A;  4J0W A;  2XL2 A;  2I0S A;  3I7P A;  4CI8 A;  2G99 A;  3IJ0 A;  3I8E A;  4R7A B;  4A2M A;  1YR2 A;  1GOF A;  4L9O A;  4A0B A;  1OLZ A;  4A11 B;  3L4O D;  2IUQ A;  5E6S A;  5B4W A;  4ERY A;  2AQ5 A;  3UR4 A;  3OL2 B;  3JPX A;  2PM9 B;  2H3X A;  4RE5 A;  3IJE A;  4AEZ A;  1C9I A;  2HES X;  4G55 A;  2AGW A;  1JTD B;  2EIB A;  3DXM C;  1U2V C;  3JZN A;  3UVM A;  3EI1 A;  1E8M A;  1L0Q A;  4JHN A;  2OVP B;  1NR0 A;  3EQ7 A;  5HE1 B;  1N6D A;  3FM0 A;  2B5L A;  2VC2 A;  3F3P A;  4MMY A;  5C2W B;  1ERJ A;  2GNQ A;  3DM0 A;  3JRP A;  3IUL A;  3IUQ A;  4A08 B;  1H2X A;  1SQJ A;  1GOH A;  1JMX B;  1L5G A;  4JSN C;  4IRZ A;  3HFQ A;  4BL0 A;  3E0C A;  3J80 g;  3NIG A;  4JSV C;  1P22 A;  5HE3 B;  3SFZ A;  2IUP A;  1GXR A;  2XE4 A;  2XDW A;  5CYK B;  3PSL A; 
#chains in the Genus database with same CATH homology
 4GGC A;  5SXM A;  3I2N A;  5CXC B;  2Z2N A;  3P4F A;  3EI3 B;  4J8G A;  5FQD A;  3AFC A;  5H17 A;  2H6Q A;  5EMM B;  2GC4 A;  2Q7Q A;  2I3T A;  3OKY B;  5EM2 B;  1PI6 A;  1S4U X;  2XL3 A;  4FA4 D;  3V7D B;  3EI4 A;  2I0R A;  4UI9 R;  5KDO B;  4J79 A;  2AH0 A;  2HYE A;  4GM3 A;  4JSX C;  4J8B A;  3I7L A;  1K8K C;  3SVW D;  1B9Y A;  4GM8 A;  3VH0 A;  3I7O A;  2AGY A;  1PBY B;  3C5M A;  4E54 A;  4GQ1 A;  5EAL A;  1PEV A;  4H5I A;  2BCJ B;  3IIY A;  3AL8 A;  2CO0 C;  1TYQ C;  3DSM A;  4ERQ A;  2H14 A;  2P9P C;  4PXW A;  4QL1 A;  4IMM A;  1XKS A;  5THA A;  2YBA A;  4QQE A;  2PBI B;  1JMZ B;  3UKU C;  3PSC B;  3JZG A;  2IAA A;  2AGL A;  2P9U C;  1MDA H;  4J78 A;  1MG2 A;  4JSP C;  2HKR A;  3K27 A;  4KFM B;  3ORV D;  5EML B;  4FHL A;  1NEX B;  3IJC A;  3SMR A;  4CZY A;  3I89 A;  3ZWL B;  4J81 A;  4GQB B;  3OTT A;  3FRX A;  4J82 A;  4ESG A;  4G56 B;  4X60 B;  3OW8 A;  4MK0 B;  4K3I D;  4L1Q D;  4O3T B;  3EI4 B;  2OJY A;  5IGO A;  4D6V A;  3SLE D;  4ZOY A;  3SJL D;  1K32 A;  5HE2 B;  3MKS B;  2GC7 A;  5A2Q g;  4PSW B;  4O3U B;  4CZV A;  2HJ4 A;  2H9L A;  5FKQ A;  4U1E I;  2W18 A;  5I5M A;  5IC7 A;  1B9X A;  3J81 g;  3UKR C;  3NVQ A;  3SBR A;  2OVQ B;  4A7J A;  2I3S A;  2HKM A;  3C9C A;  4XYH A;  2H9M A;  2CN2 A;  2IWF A;  3PVW B;  4LGN A;  5CXB A;  3AL9 A;  2QXV A;  5FKS A;  3DXK C;  3EMH A;  2H9N A;  3K26 A;  3UVK A;  4A09 B;  3OKW A;  4GM9 A;  3FGB A;  4PNK B;  4EWR A;  4IA9 A;  3I7H A;  1PGU A;  4E5Z A;  5JWZ A;  3EI2 A;  1QNI A;  2OK4 A;  2B4E A;  3IKO A;  4ZOV A;  3EU7 A;  1MG3 A;  1SHY B;  5C9Z B;  4H5J A;  5H14 A;  3CIK B;  3RFH A;  4GGA A;  4ES0 A;  2Z2O A;  2QC5 A;  5IGQ A;  3EWE A;  1OMW B;  1N6E A;  4A0B B;  3CFS B;  2J57 G;  4L3G D;  4CY1 A;  2B5N A;  4Y5R D;  2PM6 B;  4QRJ A;  2IUV A;  5TEE A;  4A0A A;  3UVL A;  3SBP A;  3PXT D;  3PE7 A;  3JZH A;  2H13 A;  2I0T A;  5GSA A;  3EI1 B;  3VA6 A;  1GOT B;  5GXH A;  4FWW A;  3NVX A;  3SBQ A;  1N6F A;  2CN3 A;  5TEF A;  1TBG A;  3UVO A;  5IT9 g;  3NVN A;  2YNO A;  4PBZ A;  4CY5 A;  5EAR A;  4CI3 A;  2HXC A;  4ERZ A;  4FA9 D;  4J77 A;  4A11 A;  3I7K A;  4CZX A;  5GXI A;  3RN1 D;  3OL2 A;  4LG8 A;  3RLM D;  4ZOZ A;  2PM9 A;  3V5W B;  2H9P A;  5HYN B;  5HQG A;  4JT6 C;  2XYI A;  5AJA A;  4QT8 A;  4BUJ C;  5TDH B;  2UZY B;  4O45 A;  2B5M A;  3C99 A;  2IWK A;  1JJU B;  4HDJ A;  3OKT A;  3AH8 B;  4FB1 D;  4CI1 A;  4LG9 A;  2EBS A;  5FA5 B;  5I5I A;  1R5M A;  3JAM g;  3UVN A;  4FA5 D;  4OWR A;  5GMK n;  5K19 A;  4A08 A;  5TF2 A;  3U4Y A;  4BH6 A;  4CC9 A;  5EMK B;  2H6K A;  4XEI C;  4JXM A;  4O1Q D;  4L3H D;  3CFV A;  2H6N A;  4FAV D;  5FKR A;  1FWX A;  5HE0 B;  2P9S C;  1Q47 A;  5FXY A;  5CYK A;  4K3J B;  3MXX A;  3PXW D;  5CXC A;  4E54 B;  4J84 A;  3EI3 A;  3RFG A;  4JD2 C;  2OK6 A;  4Y7R A;  2CE9 A;  3AL8 B;  3RN0 D;  2J56 H;  3KRW B;  5FLX g;  3RSE C;  3L4M D;  3OKY A;  5EM2 A;  2CO0 A;  3RMZ D;  2HJB A;  3GFC A;  5H1M A;  2O9K A;  3IIW A;  2AGZ A;  1A0R B;  3MKQ A;  1XIP A;  1GP2 B;  3BG1 A;  4U7A A;  4X63 B;  4CI2 A;  3KRX B;  3JB9 L;  2P9N C;  1YFQ A;  2TRC B;  1U4C A;  3BG0 A;  3ULE C;  3PVU B;  2YMU A;  3A0F A;  3GRE A;  5EAP A;  3VGZ A;  3SCY A;  2BBK H;  5K1C C;  4J86 A;  3W15 A;  4A2L A;  4PSX B;  3MMY A;  5FKT A;  5IJ8 E;  4XYI A;  4CY2 A;  4J0X A;  4FA1 D;  4OZU A;  1XHM A;  1RI6 A;  2H68 A;  2UZX B;  3RRM C;  3JRO A;  4D0K A;  3N0D A;  4GMB A;  4I79 A;  5C2V B;  3DWL C;  4ZN4 A;  2CE8 A;  5CXB B;  2XU7 A;  2CNX A;  3B7F A;  3SXT D;  4J87 A;  4J73 A;  5AMS A;  5I5J A;  1JOF A;  5AFU 3;  4E5Z B;  4GQ2 P;  3EI2 B;  4ZOX A;  4FAN D;  3ODT A;  3SHF A;  4GGD A;  3MZK A;  3PXS D;  1SQ9 A;  2OIZ A;  5EMJ B;  3C75 H;  3SWS D;  4N14 A;  2H47 A;  2J55 H;  2P9L C;  2AH1 A;  2AGX A;  4CY3 A;  5EAM A;  3F3G A;  3I7N A;  3SN6 B;  2OVR B;  3EG6 A;  2YNP A;  4JT5 C;  2IUR A;  4AOW A;  2G9A A;  3I8C A;  3BWS A;  4NSX A;  4A09 A;  4Z8L A;  1VYH C;  5IJ7 E;  3MZL A;  4A0A B;  2PM7 B;  4TZ4 A;  3IJ1 A;  2YNN A;  2P9I C;  2YB8 B;  3N0E A;  3V9F A;  4PBY A;  4PC0 A;  2MTA H;  4X3E A;  4X61 B;  3F3F A;  4GZ8 A;  2P9K C;  4YVD A;  2Z2P A;  1GG2 B;  4O9D A;  4J0W A;  2XL2 A;  2I0S A;  3I7P A;  4CI8 A;  2G99 A;  3IJ0 A;  3I8E A;  4R7A B;  4A2M A;  4L9O A;  4A0B A;  1OLZ A;  4A11 B;  3L4O D;  2IUQ A;  5B4W A;  4ERY A;  2AQ5 A;  3UR4 A;  3OL2 B;  3JPX A;  2PM9 B;  2H3X A;  4AEZ A;  2HES X;  2AGW A;  3DXM C;  1U2V C;  3JZN A;  3UVM A;  3EI1 A;  1L0Q A;  2OVP B;  1NR0 A;  5HE1 B;  1N6D A;  3FM0 A;  2B5L A;  3F3P A;  5C2W B;  1ERJ A;  2GNQ A;  3DM0 A;  3JRP A;  4A08 B;  1SQJ A;  1JMX B;  4JSN C;  3HFQ A;  4BL0 A;  3E0C A;  3J80 g;  3SFZ A;  4JSV C;  1P22 A;  5HE3 B;  2IUP A;  1GXR A;  5CYK B;  3PSL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...