3F3PA

Crystal structure of the nucleoporin pair nup85-seh1, space group p21212
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
349
structure length
303
Chain Sequence
b'MQPFDSGHDDLVHDVVYDFYGRHVATCSSDQHIKVFKLDKDTSNWELSDSWRAHDSSIVAIDWASPEYGRIIASASYDKTVKLWEEDPDQEECSGRRWNKLCTLNDSKGSLYSVKFAPAHLGLKLACLGNDGILRLYDALEPSDLRSWTLTSEMKVLSIPQSDFCLSWCPSRFSPEKLAVSALEQAIIYQRGKDGKLHVAAKLPGHKSLIRSISWAPSIGRWYQLIATGCKDGRIRIFKITEKSNLQVELLSEHDDHNGEVWSVSWNLTGTILSSAGDDGKVRLWKATYSNEFKCMSVITAQQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoporin SEH1
publication title A fence-like coat for the nuclear pore membrane.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein
total genus 70
structure length 303
sequence length 349
chains with identical sequence B, E, F, I, J
ec nomenclature
pdb deposition date 2008-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3f3pA01
4FHLA 3SN6B 3EI3B 3A0FA 3C75H 2HESX 3EI1A 2H14A 3RRMC 5FXYA 5EMMB 4CI1A 3JZNA 2AGLA 2IUPA 4JSVC 4ZOYA 4A0BA 4A0AB 1L0QA 2HJBA 4E5ZB 5HYNB 5I5JA 4FAND 3UVKA 3FM0A 1TBGA 4GM8A 2H13A 3KRWB 3I8EA 4ERYA 5C2VB 5IJ7E 4J0XA 3AL8A 2I0SA 2P9SC 3AH8B 3OKWA 4BUJC 5CXBB 4TZ4A 2AGXA 2AGZA 1GG2B 4AOWA 2GNQA 4ERQA 5EMJB 1MDAH 4GMBA 1JMXB 5EARA 3JZGA 2YB8B 3MZLA 4PC0A 2OK6A 2OVQB 5JWZA 4CY5A 4A08A 5IJ8E 4E54B 4Y5RD 4ZOVA 3PXSD 3EWEA 4FWWA 2P9NC 4OZUA 1OLZA 3BG1A 4JD2C 5AFU3 3VH0A 4A11A 4D6VA 3C99A 2PM9B 4A0AA 2AQ5A 4A2LA 2XL2A 2P9KC 3BWSA 4X3EA 2CE9A 4CY1A 4IMMA 3RMZD 3CFSB 3RFGA 4PNKB 4PXWA 4XYHA 4O45A 3I7KA 1RI6A 5C2WB 1XHMA 5CYKA 2QXVA 4GQ2P 4X61B 3SCYA 3J81g 1MG3A 5IGQA 3B7FA 2I0TA 4N14A 2IWFA 2CO0A 4FB1D 2H6NA 1N6EA 4J77A 2YBAA 4XYIA 3SMRA 1A0RB 4GGAA 4E54A 4FAVD 3AL9A 3SHFA 4LG9A 2YNOA 3NVQA 1MG2A 3PVWB 4CY3A 3VGZA 2MTAH 5B4WA 4FA1D 3SBQA 1B9YA 4J86A 3PSCB 4KFMB 3PXTD 2P9UC 3L4OD 2PM9A 3UKUC 3SVWD 4EWRA 3I2NA 4ES0A 4L9OA 2H47A 3F3FA 4GM9A 1FWXA 1U2VC 4I79A 1SQJA 5HQGA 3OKYB 3I7HA 1JOFA 2XU7A 3ULEC 2IUVA 4CI8A 1B9XA 3V9FA 2IUQA 3HFQA 2G99A 5H14A 5IC7A 2EBSA 2YNPA 3IKOA 3I7PA 3NVXA 3UR4A 5FKSA 2BCJB 3OL2B 2B4EA 5FQDA 2XYIA 2B5MA 4PSXB 2PM7B 5TF2A 5THAA 3DXKC 3JPXA 4J87A 4J0WA 2IWKA 2AGYA 4MK0B 4Z8LA 1GXRA 1K32A 1PI6A 3JROA 4PSWB 2OK4A 4A7JA 3I7LA 4L3GD 5FA5B 5AMSA 1Q47A 4QQEA 3IIYA 4BL0A 3EI3A 1SHYB 4A09B 4PBZA 5SXMA 5H17A 5HE0B 1PEVA 4X63B 5I5IA 4J84A 1JMZB 2H68A 4FA5D 1N6FA 5TEFA 1QNIA 3SFZA 4E5ZA 2Z2OA 2HKMA 3F3PA 4G56B 1P22A 2O9KA 3MKQA 3OKYA 4O1QD 2UZXB 4H5JA 1XIPA 3V5WB 3K27A 4O9DA 3I7NA 5GXIA 4GZ8A 3P4FA 4U1EI 4O3TB 3OL2A 2HYEA 4O3UB 2YNNA 3EI1B 4D0KA 4CC9A 3E0CA 2CN2A 3GFCA 3N0EA 3IIWA 5CXBA 3UVLA 4A0BB 4R7AB 3SWSD 4QT8A 3UVMA 5FKTA 1SQ9A 3OW8A 4J82A 4CZYA 4IA9A 3ZWLB 3PSLA 3AFCA 3CFVA 3IJCA 2GC7A 4Y7RA 3SBRA 3AL8B 2J55H 4X60B 3C9CA 5EMLB 2PM6B 3IJ0A 2P9IC 3EMHA 4H5IA 4CI3A 2OJYA 1R5MA 5TEEA 3OKTA 1YFQA 4L1QD 4LGNA 3I89A 2H9PA 3DWLC 3RSEC 2J56H 5HE3B 4JT5C 3RN1D 3DM0A 4QRJA 3SXTD 4FA4D 2XL3A 3V7DB 2HJ4A 3UKRC 5FLXg 3SJLD 3L4MD 3FGBA 3MZKA 2PBIB 5GMKn 1S4UX 1N6DA 3IJ1A 4A11B 4YVDA 3UVNA 5HE1B 4ZOZA 5A2Qg 3RLMD 2AH1A 2Z2NA 3RN0D 1TYQC 2P9PC 4JSPC 5I5MA 1K8KC 2I3TA 3I7OA 2YMUA 1GOTB 3ODTA 3PE7A 1XKSA 3EI4B 3EI2B 5IGOA 4OWRA 4ESGA 3SBPA 4L3HD 5AJAA 1ERJA 3NVNA 3EG6A 4GGCA 1PGUA 4J81A 4FA9D 5CYKB 5GSAA 3VA6A 4UI9R 2OIZA 5EM2B 3BG0A 2GC4A 2H9LA 3FRXA 4GQBB 3JZHA 4JSXC 2H9NA 5TDHB 5FKRA 2H6KA 3J80g 2H6QA 2W18A 3ORVD 4JSNC 1OMWB 3PXWD 5CXCB 4ERZA 1U4CA 3N0DA 4JXMA 1NEXB 2BBKH 3CIKB 4K3ID 4NSXA 4BH6A 2HXCA 3DXMC 3OTTA 4J8GA 4U7AA 4J79A 4AEZA 2H9MA 3JB9L 2AGWA 2H3XA 2HKRA 4QL1A 4A2MA 2G9AA 2CN3A 5EAMA 5EAPA 3KRXB 2OVPB 3MKSB 5EALA 5K19A 4J8BA 4ZN4A 2AH0A 2B5NA 3EI4A 3EI2A 3W15A 4K3JB 2UZYB 2OVRB 4GM3A 2QC5A 4XEIC 4LG8A 2CO0C 2I3SA 4JT6C 5IT9g 4J73A 5HE2B 3EU7A 4J78A 4CZVA 3UVOA 3JAMg 5C9ZB 3I8CA 3U4YA 3SLED 2B5LA 5EM2A 2I0RA 2IAAA 1GP2B 2CE8A 3GREA 5EMKB 1VYHC 3MXXA 4CI2A 4A09A 4ZOXA 5H1MA 3PVUB 5FKQA 2IURA 5CXCA 3F3GA 1JJUB 1PBYB 5K1CC 3DSMA 4PBYA 2CNXA 4GGDA 3JRPA 2P9LC 3K26A 4CY2A 4CZXA 2Z2PA 5KDOB 1NR0A 4GQ1A 5GXHA 4HDJA 4A08B 2TRCB 3MMYA 3C5MA 2J57G 3RFHA 2Q7QA
chains in the Genus database with same CATH superfamily
4JHPC 4FHLA 3SN6B 3EI3B 4DNWA 3A0FA 3C75H 3EQ9A 4NC4A 3IUNA 2HESX 3EI1A 1VE7A 3VI4A 2H14A 3RRMC 4DNUA 5FXYA 5EMMB 4CI1A 3JZNA 4AMZA 2AGLA 2IUPA 4JSVC 4ZOYA 4A0BA 4A0AB 1L0QA 1QFMA 2HJBA 4E5ZB 5HYNB 2QR5A 5I5JA 4FAND 3UVKA 3FM0A 1TBGA 4GM8A 2H13A 3KRWB 3I8EA 1C9LA 4DNVA 4ERYA 5C2VB 5IJ7E 4J0XA 3AL8A 5C86A 2I0SA 3KCIA 2P9SC 3GD1I 1GOHA 3AH8B 3OKWA 4BUJC 2VDRA 5M5RA 5CXBB 1UOQA 4TZ4A 2AGXA 4JHNA 2AGZA 1GG2B 4AOWA 2GNQA 4ERQA 4MMZA 5EMJB 1MDAH 4GMBA 1JMXB 5EARA 3JZGA 2YB8B 3MZLA 4PC0A 2OK6A 2OVQB 5JWZA 4CY5A 4A08A 5IJ8E 4E54B 4Y5RD 4WK4A 4ZOVA 3PXSD 3EWEA 4FWWA 2P9NC 3IVMA 4OZUA 3V4VA 1OLZA 3BG1A 4JD2C 5AFU3 1BPOA 4RE6A 3IULA 3K71A 2EIEA 3VH0A 4A11A 4D6VA 3C99A 1T2XA 2PM9B 4A0AA 2AQ5A 4A2LA 2XL2A 2P9KC 3BWSA 4X3EA 2CE9A 4CY1A 4IMMA 1M1XA 3RMZD 3CFSB 3RFGA 4PNKB 4PXWA 4XYHA 4O45A 3I7KA 1RI6A 5C2WB 1XHMA 5CYKA 2QXVA 5E6SA 4GQ2P 1K3IA 4X61B 3SCYA 3J81g 1MG3A 5IGQA 3B7FA 3IJEA 2I0TA 4N14A 2XZGA 3T3MA 2IWFA 2CO0A 4Z7OA 4FB1D 2H6NA 1N6EA 4AX4A 2QZPA 4J77A 1VZ3A 2YBAA 4XYIA 3SMRA 1A0RB 2HU8A 4GGAA 4E54A 4FAVD 3AL9A 2XDWA 5M61A 3SHFA 3ZE0A 4LG9A 2YNOA 3NVQA 1MG2A 3PVWB 3O4IA 4CY3A 3VGZA 4O2WA 2MTAH 5B4WA 2VC2A 4FA1D 3SBQA 1B9YA 1H2YA 4J86A 3PSCB 4KFMB 3PXTD 2P9UC 3L4OD 2VDQA 4BCDA 2PM9A 3NIFA 3UKUC 3SVWD 4EWRA 4BP8A 3I2NA 4ES0A 4L9OA 5M5UA 2H47A 3F3FA 4GM9A 1FWXA 4NBMA 1U2VC 4I79A 1SQJA 5HQGA 1VZ2A 3ZDXA 3IUJA 2EIBA 3NIGA 3OKYB 3I7HA 3VI3A 1JOFA 2XU7A 3ULEC 2IUVA 4CI8A 1B9XA 3V9FA 2IUQA 3HFQA 2G99A 5H14A 5IC7A 2EBSA 2YNPA 3EQ7A 3IKOA 3I7PA 3NVXA 3UR4A 5FKSA 2BCJB 3OL2B 2B4EA 5FQDA 2XYIA 2VDMA 2B5MA 4PSXB 2PM7B 1JTDB 5TF2A 1H2XA 5THAA 3DXKC 3JPXA 4J87A 3MUNA 4J0WA 2IWKA 1TYEA 1GOGA 4UM8A 2AGYA 4MK0B 4Z8LA 4G1MA 5FFOA 1GXRA 1K32A 1PI6A 3JROA 4PSWB 2OK4A 4D9SA 4A7JA 5HDBA 3O4GA 3I7LA 4L3GD 5FA5B 5AMSA 1Q47A 4QQEA 3IIYA 1UOPA 4BL0A 5E6RA 3EI3A 1H2WA 1SHYB 4A09B 3IUQA 4PBZA 5C92A 5SXMA 5H17A 5HE0B 1PEVA 4X63B 5I5IA 2XE4A 4J84A 1JMZB 1E8NA 3FCSA 2H68A 3T3PA 4WK2A 4FA5D 3ZE2A 1N6FA 5TEFA 1QNIA 1UOOA 3SFZA 2VZ3A 4E5ZA 2Z2OA 2HKMA 1GOFA 3F3PA 4G56B 1P22A 2O9KA 3MKQA 3OKYA 4O1QD 2UZXB 4H5JA 1XIPA 1A12A 3V5WB 3K27A 4O9DA 3I7NA 5GXIA 4GZ8A 3P4FA 4U1EI 4O3TB 3OL2A 2HYEA 4O3UB 2YNNA 3EI1B 4D0KA 4CC9A 3E0CA 2CN2A 4MMYA 3GFCA 2VDKA 3IIWA 3N0EA 5CXBA 3UVLA 4A0BB 4R7AB 3SWSD 4QT8A 3UVMA 5FKTA 1SQ9A 3OW8A 3GC3B 3QI0A 4J82A 3IURA 4IRZA 4IA9A 4CZYA 3ZWLB 4AN1A 2WQ8A 4MMXA 3PSLA 3AFCA 3CFVA 3IJCA 2GC7A 4Y7RA 1H2ZA 3SBRA 3AL8B 2J55H 4X60B 3C9CA 3K72A 5EMLB 2PM6B 3IJ0A 5M5SA 4WJKA 2P9IC 3EMHA 4H5IA 4CI3A 3ZDZA 1VE6A 2OJYA 1R5MA 1YR2A 3O4HA 5TEEA 5M5VA 3OKTA 1YFQA 3DDUA 4L1QD 4LGNA 3I89A 1L5GA 2H9PA 3DWLC 3RSEC 2J56H 5HE3B 4JT5C 3ZDYA 4UM9A 3RN1D 3DM0A 4QRJA 3SXTD 4FA4D 2XL3A 3V7DB 2HJ4A 3UKRC 5FLXg 3SJLD 3L4MD 3FGBA 3MZKA 2PBIB 5GMKn 1S4UX 1N6DA 3K6SA 3IJ1A 4A11B 4YVDA 3UVNA 5HE1B 4ZOZA 5FFGA 5A2Qg 3RLMD 2VZ1A 2AH1A 2Z2NA 3RN0D 1TYQC 2P9PC 4JSPC 5I5MA 1K8KC 2I3TA 3I7OA 1QFSA 3OF7A 2YMUA 1GOTB 3ODTA 3PE7A 4RE5A 4AMYA 1C9IA 1XKSA 3EI4B 3EI2B 5IGOA 4OWRA 4ESGA 3SBPA 2HU5A 4L3HD 3FCUA 1O6FA 5AJAA 1ERJA 3NVNA 3EG6A 3EQ8A 4GGCA 4WK0A 1PGUA 4J81A 4FA9D 5CYKB 5GSAA 3VA6A 4UI9R 2OIZA 5EM2B 3BG0A 2GC4A 2H9LA 3FRXA 4GQBB 3JZHA 4JSXC 1I2MB 1E8MA 2H9NA 3O4JA 5FKRA 1O6GA 3MUOA 5TDHB 2H6KA 4AN0A 3J80g 2H6QA 2W18A 3ORVD 4JSNC 1OMWB 3PXWD 5CXCB 4ERZA 1U4CA 3N0DA 4JXMA 4BCBA 4BCCA 1NEXB 2BBKH 3CIKB 4K3ID 4NSXA 4BH6A 2HXCA 3DXMC 3OTTA 4J8GA 4O02A 4U7AA 4NAAA 4J79A 3MVDK 2VDNA 4AEZA 2EIDA 2H9MA 3QHYB 3JB9L 2AGWA 2H3XA 2HKRA 4QL1A 4A2MA 2G9AA 2CN3A 5EAMA 5EAPA 2BKLA 3KRXB 2OVPB 3MKSB 1U8CA 5EALA 3ZE1A 2VDPA 4QAMA 5K19A 2HU7A 4J8BA 2VDOA 4ZN4A 2AH0A 2B5NA 3EI4A 3EI2A 3W15A 4K3JB 2UZYB 2OVRB 4GM3A 2QC5A 1JV2A 4XEIC 4LG8A 2CO0C 2I3SA 1E5TA 4JT6C 4NENA 5IT9g 4J73A 5HE2B 3EU7A 4J78A 4CZVA 3UVOA 3JAMg 5C9ZB 3I8CA 3U4YA 3SLED 4Z7QA 2B5LA 2EICA 5E6UA 5EM2A 2I0RA 2IAAA 1GP2B 2CE8A 2VDLA 3GREA 5EMKB 1VYHC 3MXXA 4G1EA 4CI2A 3IUMA 4A09A 4ZOXA 5H1MA 4Z7NA 3PVUB 4G55A 5FKQA 2IURA 2JKXA 5CXCA 3F3GA 1JJUB 3NIDA 1PBYB 5K1CC 3DSMA 4PBYA 2CNXA 3JRPA 4GGDA 2P9LC 3K26A 4CY2A 4CZXA 2Z2PA 3V4PA 4BP9A 5KDOB 1NR0A 4GQ1A 5GXHA 4HDJA 1UTCA 5M5TA 4A08B 2TRCB 3MMYA 3C5MA 4L1MA 2J57G 3RFHA 2Q7QA
chains in the Genus database with same CATH topology
4FHLA 3SN6B 3EI3B 3A0FA 3C75H 2HESX 3EI1A 2H14A 3RRMC 5FXYA 5EMMB 4CI1A 3JZNA 2AGLA 2IUPA 4JSVC 4ZOYA 4A0BA 4A0AB 1L0QA 2HJBA 4E5ZB 5HYNB 5I5JA 4FAND 3UVKA 3FM0A 1TBGA 4GM8A 2H13A 3KRWB 3I8EA 4ERYA 5C2VB 5IJ7E 4J0XA 3AL8A 2I0SA 2P9SC 3AH8B 3OKWA 4BUJC 5CXBB 4TZ4A 2AGXA 2AGZA 1GG2B 4AOWA 2GNQA 4ERQA 5EMJB 1MDAH 4GMBA 1JMXB 5EARA 3JZGA 2YB8B 3MZLA 4PC0A 2OK6A 2OVQB 5JWZA 4CY5A 4A08A 5IJ8E 4E54B 4Y5RD 4ZOVA 3PXSD 3EWEA 4FWWA 2P9NC 4OZUA 1OLZA 3BG1A 4JD2C 5AFU3 3VH0A 4A11A 4D6VA 3C99A 2PM9B 4A0AA 2AQ5A 4A2LA 2XL2A 2P9KC 3BWSA 4X3EA 2CE9A 4CY1A 4IMMA 3RMZD 3CFSB 3RFGA 4PNKB 4PXWA 4XYHA 4O45A 3I7KA 1RI6A 5C2WB 1XHMA 5CYKA 2QXVA 4GQ2P 4X61B 3SCYA 3J81g 1MG3A 5IGQA 3B7FA 2I0TA 4N14A 2IWFA 2CO0A 4FB1D 2H6NA 1N6EA 4J77A 2YBAA 4XYIA 3SMRA 1A0RB 4GGAA 4E54A 4FAVD 3AL9A 3SHFA 4LG9A 2YNOA 3NVQA 1MG2A 3PVWB 4CY3A 3VGZA 2MTAH 5B4WA 4FA1D 3SBQA 1B9YA 4J86A 3PSCB 4KFMB 3PXTD 2P9UC 3L4OD 2PM9A 3UKUC 3SVWD 4EWRA 3I2NA 4ES0A 4L9OA 2H47A 3F3FA 4GM9A 1FWXA 1U2VC 4I79A 1SQJA 5HQGA 3OKYB 3I7HA 1JOFA 2XU7A 3ULEC 2IUVA 4CI8A 1B9XA 3V9FA 2IUQA 3HFQA 2G99A 5H14A 5IC7A 2EBSA 2YNPA 3IKOA 3I7PA 3NVXA 3UR4A 5FKSA 2BCJB 3OL2B 2B4EA 5FQDA 2XYIA 2B5MA 4PSXB 2PM7B 5TF2A 5THAA 3DXKC 3JPXA 4J87A 4J0WA 2IWKA 2AGYA 4MK0B 4Z8LA 1GXRA 1K32A 1PI6A 3JROA 4PSWB 2OK4A 4A7JA 3I7LA 4L3GD 5FA5B 5AMSA 1Q47A 4QQEA 3IIYA 4BL0A 3EI3A 1SHYB 4A09B 4PBZA 5SXMA 5H17A 5HE0B 1PEVA 4X63B 5I5IA 4J84A 1JMZB 2H68A 4FA5D 1N6FA 5TEFA 1QNIA 3SFZA 4E5ZA 2Z2OA 2HKMA 3F3PA 4G56B 1P22A 2O9KA 3MKQA 3OKYA 4O1QD 2UZXB 4H5JA 1XIPA 3V5WB 3K27A 4O9DA 3I7NA 5GXIA 4GZ8A 3P4FA 4U1EI 4O3TB 3OL2A 2HYEA 4O3UB 2YNNA 3EI1B 4D0KA 4CC9A 3E0CA 2CN2A 3GFCA 3N0EA 3IIWA 5CXBA 3UVLA 4A0BB 4R7AB 3SWSD 4QT8A 3UVMA 5FKTA 1SQ9A 3OW8A 4J82A 4CZYA 4IA9A 3ZWLB 3PSLA 3AFCA 3CFVA 3IJCA 2GC7A 4Y7RA 3SBRA 3AL8B 2J55H 4X60B 3C9CA 5EMLB 2PM6B 3IJ0A 2P9IC 3EMHA 4H5IA 4CI3A 2OJYA 1R5MA 5TEEA 3OKTA 1YFQA 4L1QD 4LGNA 3I89A 2H9PA 3DWLC 3RSEC 2J56H 5HE3B 4JT5C 3RN1D 3DM0A 4QRJA 3SXTD 4FA4D 2XL3A 3V7DB 2HJ4A 3UKRC 5FLXg 3SJLD 3L4MD 3FGBA 3MZKA 2PBIB 5GMKn 1S4UX 1N6DA 3IJ1A 4A11B 4YVDA 3UVNA 5HE1B 4ZOZA 5A2Qg 3RLMD 2AH1A 2Z2NA 3RN0D 1TYQC 2P9PC 4JSPC 5I5MA 1K8KC 2I3TA 3I7OA 2YMUA 1GOTB 3ODTA 3PE7A 1XKSA 3EI4B 3EI2B 5IGOA 4OWRA 4ESGA 3SBPA 4L3HD 5AJAA 1ERJA 3NVNA 3EG6A 4GGCA 1PGUA 4J81A 4FA9D 5CYKB 5GSAA 3VA6A 4UI9R 2OIZA 5EM2B 3BG0A 2GC4A 2H9LA 3FRXA 4GQBB 3JZHA 4JSXC 2H9NA 5TDHB 5FKRA 2H6KA 3J80g 2H6QA 2W18A 3ORVD 4JSNC 1OMWB 3PXWD 5CXCB 4ERZA 1U4CA 3N0DA 4JXMA 1NEXB 2BBKH 3CIKB 4K3ID 4NSXA 4BH6A 2HXCA 3DXMC 3OTTA 4J8GA 4U7AA 4J79A 4AEZA 2H9MA 3JB9L 2AGWA 2H3XA 2HKRA 4QL1A 4A2MA 2G9AA 2CN3A 5EAMA 5EAPA 3KRXB 2OVPB 3MKSB 5EALA 5K19A 4J8BA 4ZN4A 2AH0A 2B5NA 3EI4A 3EI2A 3W15A 4K3JB 2UZYB 2OVRB 4GM3A 2QC5A 4XEIC 4LG8A 2CO0C 2I3SA 4JT6C 5IT9g 4J73A 5HE2B 3EU7A 4J78A 4CZVA 3UVOA 3JAMg 5C9ZB 3I8CA 3U4YA 3SLED 2B5LA 5EM2A 2I0RA 2IAAA 1GP2B 2CE8A 3GREA 5EMKB 1VYHC 3MXXA 4CI2A 4A09A 4ZOXA 5H1MA 3PVUB 5FKQA 2IURA 5CXCA 3F3GA 1JJUB 1PBYB 5K1CC 3DSMA 4PBYA 2CNXA 4GGDA 3JRPA 2P9LC 3K26A 4CY2A 4CZXA 2Z2PA 5KDOB 1NR0A 4GQ1A 5GXHA 4HDJA 4A08B 2TRCB 3MMYA 3C5MA 2J57G 3RFHA 2Q7QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FHL A;  3SN6 B;  3EI3 B;  3A0F A;  3C75 H;  2HES X;  3EI1 A;  2H14 A;  3RRM C;  5FXY A;  5EMM B;  4CI1 A;  3JZN A;  2AGL A;  2IUP A;  4JSV C;  4ZOY A;  4A0B A;  4A0A B;  1L0Q A;  2HJB A;  4E5Z B;  5HYN B;  5I5J A;  4FAN D;  3UVK A;  3FM0 A;  1TBG A;  4GM8 A;  2H13 A;  3KRW B;  3I8E A;  4ERY A;  5C2V B;  5IJ7 E;  4J0X A;  3AL8 A;  2I0S A;  2P9S C;  3AH8 B;  3OKW A;  4BUJ C;  5CXB B;  4TZ4 A;  2AGX A;  2AGZ A;  1GG2 B;  4AOW A;  2GNQ A;  4ERQ A;  5EMJ B;  1MDA H;  4GMB A;  1JMX B;  5EAR A;  3JZG A;  2YB8 B;  3MZL A;  4PC0 A;  2OK6 A;  2OVQ B;  5JWZ A;  4CY5 A;  4A08 A;  5IJ8 E;  4E54 B;  4Y5R D;  4ZOV A;  3PXS D;  3EWE A;  4FWW A;  2P9N C;  4OZU A;  1OLZ A;  3BG1 A;  4JD2 C;  5AFU 3;  3VH0 A;  4A11 A;  4D6V A;  3C99 A;  2PM9 B;  4A0A A;  2AQ5 A;  4A2L A;  2XL2 A;  2P9K C;  3BWS A;  4X3E A;  2CE9 A;  4CY1 A;  4IMM A;  3RMZ D;  3CFS B;  3RFG A;  4PNK B;  4PXW A;  4XYH A;  4O45 A;  3I7K A;  1RI6 A;  5C2W B;  1XHM A;  5CYK A;  2QXV A;  4GQ2 P;  4X61 B;  3SCY A;  3J81 g;  1MG3 A;  5IGQ A;  3B7F A;  2I0T A;  4N14 A;  2IWF A;  2CO0 A;  4FB1 D;  2H6N A;  1N6E A;  4J77 A;  2YBA A;  4XYI A;  3SMR A;  1A0R B;  4GGA A;  4E54 A;  4FAV D;  3AL9 A;  3SHF A;  4LG9 A;  2YNO A;  3NVQ A;  1MG2 A;  3PVW B;  4CY3 A;  3VGZ A;  2MTA H;  5B4W A;  4FA1 D;  3SBQ A;  1B9Y A;  4J86 A;  3PSC B;  4KFM B;  3PXT D;  2P9U C;  3L4O D;  2PM9 A;  3UKU C;  3SVW D;  4EWR A;  3I2N A;  4ES0 A;  4L9O A;  2H47 A;  3F3F A;  4GM9 A;  1FWX A;  1U2V C;  4I79 A;  1SQJ A;  5HQG A;  3OKY B;  3I7H A;  1JOF A;  2XU7 A;  3ULE C;  2IUV A;  4CI8 A;  1B9X A;  3V9F A;  2IUQ A;  3HFQ A;  2G99 A;  5H14 A;  5IC7 A;  2EBS A;  2YNP A;  3IKO A;  3I7P A;  3NVX A;  3UR4 A;  5FKS A;  2BCJ B;  3OL2 B;  2B4E A;  5FQD A;  2XYI A;  2B5M A;  4PSX B;  2PM7 B;  5TF2 A;  5THA A;  3DXK C;  3JPX A;  4J87 A;  4J0W A;  2IWK A;  2AGY A;  4MK0 B;  4Z8L A;  1GXR A;  1K32 A;  1PI6 A;  3JRO A;  4PSW B;  2OK4 A;  4A7J A;  3I7L A;  4L3G D;  5FA5 B;  5AMS A;  1Q47 A;  4QQE A;  3IIY A;  4BL0 A;  3EI3 A;  1SHY B;  4A09 B;  4PBZ A;  5SXM A;  5H17 A;  5HE0 B;  1PEV A;  4X63 B;  5I5I A;  4J84 A;  1JMZ B;  2H68 A;  4FA5 D;  1N6F A;  5TEF A;  1QNI A;  3SFZ A;  4E5Z A;  2Z2O A;  2HKM A;  3F3P A;  4G56 B;  1P22 A;  2O9K A;  3MKQ A;  3OKY A;  4O1Q D;  2UZX B;  4H5J A;  1XIP A;  3V5W B;  3K27 A;  4O9D A;  3I7N A;  5GXI A;  4GZ8 A;  3P4F A;  4U1E I;  4O3T B;  3OL2 A;  2HYE A;  4O3U B;  2YNN A;  3EI1 B;  4D0K A;  4CC9 A;  3E0C A;  2CN2 A;  3GFC A;  3N0E A;  3IIW A;  5CXB A;  3UVL A;  4A0B B;  4R7A B;  3SWS D;  4QT8 A;  3UVM A;  5FKT A;  1SQ9 A;  3OW8 A;  4J82 A;  4CZY A;  4IA9 A;  3ZWL B;  3PSL A;  3AFC A;  3CFV A;  3IJC A;  2GC7 A;  4Y7R A;  3SBR A;  3AL8 B;  2J55 H;  4X60 B;  3C9C A;  5EML B;  2PM6 B;  3IJ0 A;  2P9I C;  3EMH A;  4H5I A;  4CI3 A;  2OJY A;  1R5M A;  5TEE A;  3OKT A;  1YFQ A;  4L1Q D;  4LGN A;  3I89 A;  2H9P A;  3DWL C;  3RSE C;  2J56 H;  5HE3 B;  4JT5 C;  3RN1 D;  3DM0 A;  4QRJ A;  3SXT D;  4FA4 D;  2XL3 A;  3V7D B;  2HJ4 A;  3UKR C;  5FLX g;  3SJL D;  3L4M D;  3FGB A;  3MZK A;  2PBI B;  5GMK n;  1S4U X;  1N6D A;  3IJ1 A;  4A11 B;  4YVD A;  3UVN A;  5HE1 B;  4ZOZ A;  5A2Q g;  3RLM D;  2AH1 A;  2Z2N A;  3RN0 D;  1TYQ C;  2P9P C;  4JSP C;  5I5M A;  1K8K C;  2I3T A;  3I7O A;  2YMU A;  1GOT B;  3ODT A;  3PE7 A;  1XKS A;  3EI4 B;  3EI2 B;  5IGO A;  4OWR A;  4ESG A;  3SBP A;  4L3H D;  5AJA A;  1ERJ A;  3NVN A;  3EG6 A;  4GGC A;  1PGU A;  4J81 A;  4FA9 D;  5CYK B;  5GSA A;  3VA6 A;  4UI9 R;  2OIZ A;  5EM2 B;  3BG0 A;  2GC4 A;  2H9L A;  3FRX A;  4GQB B;  3JZH A;  4JSX C;  2H9N A;  5TDH B;  5FKR A;  2H6K A;  3J80 g;  2H6Q A;  2W18 A;  3ORV D;  4JSN C;  1OMW B;  3PXW D;  5CXC B;  4ERZ A;  1U4C A;  3N0D A;  4JXM A;  1NEX B;  2BBK H;  3CIK B;  4K3I D;  4NSX A;  4BH6 A;  2HXC A;  3DXM C;  3OTT A;  4J8G A;  4U7A A;  4J79 A;  4AEZ A;  2H9M A;  3JB9 L;  2AGW A;  2H3X A;  2HKR A;  4QL1 A;  4A2M A;  2G9A A;  2CN3 A;  5EAM A;  5EAP A;  3KRX B;  2OVP B;  3MKS B;  5EAL A;  5K19 A;  4J8B A;  4ZN4 A;  2AH0 A;  2B5N A;  3EI4 A;  3EI2 A;  3W15 A;  4K3J B;  2UZY B;  2OVR B;  4GM3 A;  2QC5 A;  4XEI C;  4LG8 A;  2CO0 C;  2I3S A;  4JT6 C;  5IT9 g;  4J73 A;  5HE2 B;  3EU7 A;  4J78 A;  4CZV A;  3UVO A;  3JAM g;  5C9Z B;  3I8C A;  3U4Y A;  3SLE D;  2B5L A;  5EM2 A;  2I0R A;  2IAA A;  1GP2 B;  2CE8 A;  3GRE A;  5EMK B;  1VYH C;  3MXX A;  4CI2 A;  4A09 A;  4ZOX A;  5H1M A;  3PVU B;  5FKQ A;  2IUR A;  5CXC A;  3F3G A;  1JJU B;  1PBY B;  5K1C C;  3DSM A;  4PBY A;  2CNX A;  4GGD A;  3JRP A;  2P9L C;  3K26 A;  4CY2 A;  4CZX A;  2Z2P A;  5KDO B;  1NR0 A;  4GQ1 A;  5GXH A;  4HDJ A;  4A08 B;  2TRC B;  3MMY A;  3C5M A;  2J57 G;  3RFH A;  2Q7Q A; 
#chains in the Genus database with same CATH topology
 4JHP C;  4FHL A;  3SN6 B;  3EI3 B;  4DNW A;  3A0F A;  3C75 H;  3EQ9 A;  4NC4 A;  3IUN A;  2HES X;  3EI1 A;  1VE7 A;  3VI4 A;  2H14 A;  3RRM C;  4DNU A;  5FXY A;  5EMM B;  4CI1 A;  3JZN A;  4AMZ A;  2AGL A;  2IUP A;  4JSV C;  4ZOY A;  4A0B A;  4A0A B;  1L0Q A;  1QFM A;  2HJB A;  4E5Z B;  5HYN B;  2QR5 A;  5I5J A;  4FAN D;  3UVK A;  3FM0 A;  1TBG A;  4GM8 A;  2H13 A;  3KRW B;  3I8E A;  1C9L A;  4DNV A;  4ERY A;  5C2V B;  5IJ7 E;  4J0X A;  3AL8 A;  5C86 A;  2I0S A;  3KCI A;  2P9S C;  3GD1 I;  1GOH A;  3AH8 B;  3OKW A;  4BUJ C;  2VDR A;  5M5R A;  5CXB B;  1UOQ A;  4TZ4 A;  2AGX A;  4JHN A;  2AGZ A;  1GG2 B;  4AOW A;  2GNQ A;  4ERQ A;  4MMZ A;  5EMJ B;  1MDA H;  4GMB A;  1JMX B;  5EAR A;  3JZG A;  2YB8 B;  3MZL A;  4PC0 A;  2OK6 A;  2OVQ B;  5JWZ A;  4CY5 A;  4A08 A;  5IJ8 E;  4E54 B;  4Y5R D;  4WK4 A;  4ZOV A;  3PXS D;  3EWE A;  4FWW A;  2P9N C;  3IVM A;  4OZU A;  3V4V A;  1OLZ A;  3BG1 A;  4JD2 C;  5AFU 3;  1BPO A;  4RE6 A;  3IUL A;  3K71 A;  2EIE A;  3VH0 A;  4A11 A;  4D6V A;  3C99 A;  1T2X A;  2PM9 B;  4A0A A;  2AQ5 A;  4A2L A;  2XL2 A;  2P9K C;  3BWS A;  4X3E A;  2CE9 A;  4CY1 A;  4IMM A;  1M1X A;  3RMZ D;  3CFS B;  3RFG A;  4PNK B;  4PXW A;  4XYH A;  4O45 A;  3I7K A;  1RI6 A;  5C2W B;  1XHM A;  5CYK A;  2QXV A;  5E6S A;  4GQ2 P;  1K3I A;  4X61 B;  3SCY A;  3J81 g;  1MG3 A;  5IGQ A;  3B7F A;  3IJE A;  2I0T A;  4N14 A;  2XZG A;  3T3M A;  2IWF A;  2CO0 A;  4Z7O A;  4FB1 D;  2H6N A;  1N6E A;  4AX4 A;  2QZP A;  4J77 A;  1VZ3 A;  2YBA A;  4XYI A;  3SMR A;  1A0R B;  2HU8 A;  4GGA A;  4E54 A;  4FAV D;  3AL9 A;  2XDW A;  5M61 A;  3SHF A;  3ZE0 A;  4LG9 A;  2YNO A;  3NVQ A;  1MG2 A;  3PVW B;  3O4I A;  4CY3 A;  3VGZ A;  4O2W A;  2MTA H;  5B4W A;  2VC2 A;  4FA1 D;  3SBQ A;  1B9Y A;  1H2Y A;  4J86 A;  3PSC B;  4KFM B;  3PXT D;  2P9U C;  3L4O D;  2VDQ A;  4BCD A;  2PM9 A;  3NIF A;  3UKU C;  3SVW D;  4EWR A;  4BP8 A;  3I2N A;  4ES0 A;  4L9O A;  5M5U A;  2H47 A;  3F3F A;  4GM9 A;  1FWX A;  4NBM A;  1U2V C;  4I79 A;  1SQJ A;  5HQG A;  1VZ2 A;  3ZDX A;  3IUJ A;  2EIB A;  3NIG A;  3OKY B;  3I7H A;  3VI3 A;  1JOF A;  2XU7 A;  3ULE C;  2IUV A;  4CI8 A;  1B9X A;  3V9F A;  2IUQ A;  3HFQ A;  2G99 A;  5H14 A;  5IC7 A;  2EBS A;  2YNP A;  3EQ7 A;  3IKO A;  3I7P A;  3NVX A;  3UR4 A;  5FKS A;  2BCJ B;  3OL2 B;  2B4E A;  5FQD A;  2XYI A;  2VDM A;  2B5M A;  4PSX B;  2PM7 B;  1JTD B;  5TF2 A;  1H2X A;  5THA A;  3DXK C;  3JPX A;  4J87 A;  3MUN A;  4J0W A;  2IWK A;  1TYE A;  1GOG A;  4UM8 A;  2AGY A;  4MK0 B;  4Z8L A;  4G1M A;  5FFO A;  1GXR A;  1K32 A;  1PI6 A;  3JRO A;  4PSW B;  2OK4 A;  4D9S A;  4A7J A;  5HDB A;  3O4G A;  3I7L A;  4L3G D;  5FA5 B;  5AMS A;  1Q47 A;  4QQE A;  3IIY A;  1UOP A;  4BL0 A;  5E6R A;  3EI3 A;  1H2W A;  1SHY B;  4A09 B;  3IUQ A;  4PBZ A;  5C92 A;  5SXM A;  5H17 A;  5HE0 B;  1PEV A;  4X63 B;  5I5I A;  2XE4 A;  4J84 A;  1JMZ B;  1E8N A;  3FCS A;  2H68 A;  3T3P A;  4WK2 A;  4FA5 D;  3ZE2 A;  1N6F A;  5TEF A;  1QNI A;  1UOO A;  3SFZ A;  2VZ3 A;  4E5Z A;  2Z2O A;  2HKM A;  1GOF A;  3F3P A;  4G56 B;  1P22 A;  2O9K A;  3MKQ A;  3OKY A;  4O1Q D;  2UZX B;  4H5J A;  1XIP A;  1A12 A;  3V5W B;  3K27 A;  4O9D A;  3I7N A;  5GXI A;  4GZ8 A;  3P4F A;  4U1E I;  4O3T B;  3OL2 A;  2HYE A;  4O3U B;  2YNN A;  3EI1 B;  4D0K A;  4CC9 A;  3E0C A;  2CN2 A;  4MMY A;  3GFC A;  2VDK A;  3IIW A;  3N0E A;  5CXB A;  3UVL A;  4A0B B;  4R7A B;  3SWS D;  4QT8 A;  3UVM A;  5FKT A;  1SQ9 A;  3OW8 A;  3GC3 B;  3QI0 A;  4J82 A;  3IUR A;  4IRZ A;  4IA9 A;  4CZY A;  3ZWL B;  4AN1 A;  2WQ8 A;  4MMX A;  3PSL A;  3AFC A;  3CFV A;  3IJC A;  2GC7 A;  4Y7R A;  1H2Z A;  3SBR A;  3AL8 B;  2J55 H;  4X60 B;  3C9C A;  3K72 A;  5EML B;  2PM6 B;  3IJ0 A;  5M5S A;  4WJK A;  2P9I C;  3EMH A;  4H5I A;  4CI3 A;  3ZDZ A;  1VE6 A;  2OJY A;  1R5M A;  1YR2 A;  3O4H A;  5TEE A;  5M5V A;  3OKT A;  1YFQ A;  3DDU A;  4L1Q D;  4LGN A;  3I89 A;  1L5G A;  2H9P A;  3DWL C;  3RSE C;  2J56 H;  5HE3 B;  4JT5 C;  3ZDY A;  4UM9 A;  3RN1 D;  3DM0 A;  4QRJ A;  3SXT D;  4FA4 D;  2XL3 A;  3V7D B;  2HJ4 A;  3UKR C;  5FLX g;  3SJL D;  3L4M D;  3FGB A;  3MZK A;  2PBI B;  5GMK n;  1S4U X;  1N6D A;  3K6S A;  3IJ1 A;  4A11 B;  4YVD A;  3UVN A;  5HE1 B;  4ZOZ A;  5FFG A;  5A2Q g;  3RLM D;  2VZ1 A;  2AH1 A;  2Z2N A;  3RN0 D;  1TYQ C;  2P9P C;  4JSP C;  5I5M A;  1K8K C;  2I3T A;  3I7O A;  1QFS A;  3OF7 A;  2YMU A;  1GOT B;  3ODT A;  3PE7 A;  4RE5 A;  4AMY A;  1C9I A;  1XKS A;  3EI4 B;  3EI2 B;  5IGO A;  4OWR A;  4ESG A;  3SBP A;  2HU5 A;  4L3H D;  3FCU A;  1O6F A;  5AJA A;  1ERJ A;  3NVN A;  3EG6 A;  3EQ8 A;  4GGC A;  4WK0 A;  1PGU A;  4J81 A;  4FA9 D;  5CYK B;  5GSA A;  3VA6 A;  4UI9 R;  2OIZ A;  5EM2 B;  3BG0 A;  2GC4 A;  2H9L A;  3FRX A;  4GQB B;  3JZH A;  4JSX C;  1I2M B;  1E8M A;  2H9N A;  3O4J A;  5FKR A;  1O6G A;  3MUO A;  5TDH B;  2H6K A;  4AN0 A;  3J80 g;  2H6Q A;  2W18 A;  3ORV D;  4JSN C;  1OMW B;  3PXW D;  5CXC B;  4ERZ A;  1U4C A;  3N0D A;  4JXM A;  4BCB A;  4BCC A;  1NEX B;  2BBK H;  3CIK B;  4K3I D;  4NSX A;  4BH6 A;  2HXC A;  3DXM C;  3OTT A;  4J8G A;  4O02 A;  4U7A A;  4NAA A;  4J79 A;  3MVD K;  2VDN A;  4AEZ A;  2EID A;  2H9M A;  3QHY B;  3JB9 L;  2AGW A;  2H3X A;  2HKR A;  4QL1 A;  4A2M A;  2G9A A;  2CN3 A;  5EAM A;  5EAP A;  2BKL A;  3KRX B;  2OVP B;  3MKS B;  1U8C A;  5EAL A;  3ZE1 A;  2VDP A;  4QAM A;  5K19 A;  2HU7 A;  4J8B A;  2VDO A;  4ZN4 A;  2AH0 A;  2B5N A;  3EI4 A;  3EI2 A;  3W15 A;  4K3J B;  2UZY B;  2OVR B;  4GM3 A;  2QC5 A;  1JV2 A;  4XEI C;  4LG8 A;  2CO0 C;  2I3S A;  1E5T A;  4JT6 C;  4NEN A;  5IT9 g;  4J73 A;  5HE2 B;  3EU7 A;  4J78 A;  4CZV A;  3UVO A;  3JAM g;  5C9Z B;  3I8C A;  3U4Y A;  3SLE D;  4Z7Q A;  2B5L A;  2EIC A;  5E6U A;  5EM2 A;  2I0R A;  2IAA A;  1GP2 B;  2CE8 A;  2VDL A;  3GRE A;  5EMK B;  1VYH C;  3MXX A;  4G1E A;  4CI2 A;  3IUM A;  4A09 A;  4ZOX A;  5H1M A;  4Z7N A;  3PVU B;  4G55 A;  5FKQ A;  2IUR A;  2JKX A;  5CXC A;  3F3G A;  1JJU B;  3NID A;  1PBY B;  5K1C C;  3DSM A;  4PBY A;  2CNX A;  3JRP A;  4GGD A;  2P9L C;  3K26 A;  4CY2 A;  4CZX A;  2Z2P A;  3V4P A;  4BP9 A;  5KDO B;  1NR0 A;  4GQ1 A;  5GXH A;  4HDJ A;  1UTC A;  5M5T A;  4A08 B;  2TRC B;  3MMY A;  3C5M A;  4L1M A;  2J57 G;  3RFH A;  2Q7Q A; 
#chains in the Genus database with same CATH homology
 4FHL A;  3SN6 B;  3EI3 B;  3A0F A;  3C75 H;  2HES X;  3EI1 A;  2H14 A;  3RRM C;  5FXY A;  5EMM B;  4CI1 A;  3JZN A;  2AGL A;  2IUP A;  4JSV C;  4ZOY A;  4A0B A;  4A0A B;  1L0Q A;  2HJB A;  4E5Z B;  5HYN B;  5I5J A;  4FAN D;  3UVK A;  3FM0 A;  1TBG A;  4GM8 A;  2H13 A;  3KRW B;  3I8E A;  4ERY A;  5C2V B;  5IJ7 E;  4J0X A;  3AL8 A;  2I0S A;  2P9S C;  3AH8 B;  3OKW A;  4BUJ C;  5CXB B;  4TZ4 A;  2AGX A;  2AGZ A;  1GG2 B;  4AOW A;  2GNQ A;  4ERQ A;  5EMJ B;  1MDA H;  4GMB A;  1JMX B;  5EAR A;  3JZG A;  2YB8 B;  3MZL A;  4PC0 A;  2OK6 A;  2OVQ B;  5JWZ A;  4CY5 A;  4A08 A;  5IJ8 E;  4E54 B;  4Y5R D;  4ZOV A;  3PXS D;  3EWE A;  4FWW A;  2P9N C;  4OZU A;  1OLZ A;  3BG1 A;  4JD2 C;  5AFU 3;  3VH0 A;  4A11 A;  4D6V A;  3C99 A;  2PM9 B;  4A0A A;  2AQ5 A;  4A2L A;  2XL2 A;  2P9K C;  3BWS A;  4X3E A;  2CE9 A;  4CY1 A;  4IMM A;  3RMZ D;  3CFS B;  3RFG A;  4PNK B;  4PXW A;  4XYH A;  4O45 A;  3I7K A;  1RI6 A;  5C2W B;  1XHM A;  5CYK A;  2QXV A;  4GQ2 P;  4X61 B;  3SCY A;  3J81 g;  1MG3 A;  5IGQ A;  3B7F A;  2I0T A;  4N14 A;  2IWF A;  2CO0 A;  4FB1 D;  2H6N A;  1N6E A;  4J77 A;  2YBA A;  4XYI A;  3SMR A;  1A0R B;  4GGA A;  4E54 A;  4FAV D;  3AL9 A;  3SHF A;  4LG9 A;  2YNO A;  3NVQ A;  1MG2 A;  3PVW B;  4CY3 A;  3VGZ A;  2MTA H;  5B4W A;  4FA1 D;  3SBQ A;  1B9Y A;  4J86 A;  3PSC B;  4KFM B;  3PXT D;  2P9U C;  3L4O D;  2PM9 A;  3UKU C;  3SVW D;  4EWR A;  3I2N A;  4ES0 A;  4L9O A;  2H47 A;  3F3F A;  4GM9 A;  1FWX A;  1U2V C;  4I79 A;  1SQJ A;  5HQG A;  3OKY B;  3I7H A;  1JOF A;  2XU7 A;  3ULE C;  2IUV A;  4CI8 A;  1B9X A;  3V9F A;  2IUQ A;  3HFQ A;  2G99 A;  5H14 A;  5IC7 A;  2EBS A;  2YNP A;  3IKO A;  3I7P A;  3NVX A;  3UR4 A;  5FKS A;  2BCJ B;  3OL2 B;  2B4E A;  5FQD A;  2XYI A;  2B5M A;  4PSX B;  2PM7 B;  5TF2 A;  5THA A;  3DXK C;  3JPX A;  4J87 A;  4J0W A;  2IWK A;  2AGY A;  4MK0 B;  4Z8L A;  1GXR A;  1K32 A;  1PI6 A;  3JRO A;  4PSW B;  2OK4 A;  4A7J A;  3I7L A;  4L3G D;  5FA5 B;  5AMS A;  1Q47 A;  4QQE A;  3IIY A;  4BL0 A;  3EI3 A;  1SHY B;  4A09 B;  4PBZ A;  5SXM A;  5H17 A;  5HE0 B;  1PEV A;  4X63 B;  5I5I A;  4J84 A;  1JMZ B;  2H68 A;  4FA5 D;  1N6F A;  5TEF A;  1QNI A;  3SFZ A;  4E5Z A;  2Z2O A;  2HKM A;  3F3P A;  4G56 B;  1P22 A;  2O9K A;  3MKQ A;  3OKY A;  4O1Q D;  2UZX B;  4H5J A;  1XIP A;  3V5W B;  3K27 A;  4O9D A;  3I7N A;  5GXI A;  4GZ8 A;  3P4F A;  4U1E I;  4O3T B;  3OL2 A;  2HYE A;  4O3U B;  2YNN A;  3EI1 B;  4D0K A;  4CC9 A;  3E0C A;  2CN2 A;  3GFC A;  3N0E A;  3IIW A;  5CXB A;  3UVL A;  4A0B B;  4R7A B;  3SWS D;  4QT8 A;  3UVM A;  5FKT A;  1SQ9 A;  3OW8 A;  4J82 A;  4CZY A;  4IA9 A;  3ZWL B;  3PSL A;  3AFC A;  3CFV A;  3IJC A;  2GC7 A;  4Y7R A;  3SBR A;  3AL8 B;  2J55 H;  4X60 B;  3C9C A;  5EML B;  2PM6 B;  3IJ0 A;  2P9I C;  3EMH A;  4H5I A;  4CI3 A;  2OJY A;  1R5M A;  5TEE A;  3OKT A;  1YFQ A;  4L1Q D;  4LGN A;  3I89 A;  2H9P A;  3DWL C;  3RSE C;  2J56 H;  5HE3 B;  4JT5 C;  3RN1 D;  3DM0 A;  4QRJ A;  3SXT D;  4FA4 D;  2XL3 A;  3V7D B;  2HJ4 A;  3UKR C;  5FLX g;  3SJL D;  3L4M D;  3FGB A;  3MZK A;  2PBI B;  5GMK n;  1S4U X;  1N6D A;  3IJ1 A;  4A11 B;  4YVD A;  3UVN A;  5HE1 B;  4ZOZ A;  5A2Q g;  3RLM D;  2AH1 A;  2Z2N A;  3RN0 D;  1TYQ C;  2P9P C;  4JSP C;  5I5M A;  1K8K C;  2I3T A;  3I7O A;  2YMU A;  1GOT B;  3ODT A;  3PE7 A;  1XKS A;  3EI4 B;  3EI2 B;  5IGO A;  4OWR A;  4ESG A;  3SBP A;  4L3H D;  5AJA A;  1ERJ A;  3NVN A;  3EG6 A;  4GGC A;  1PGU A;  4J81 A;  4FA9 D;  5CYK B;  5GSA A;  3VA6 A;  4UI9 R;  2OIZ A;  5EM2 B;  3BG0 A;  2GC4 A;  2H9L A;  3FRX A;  4GQB B;  3JZH A;  4JSX C;  2H9N A;  5TDH B;  5FKR A;  2H6K A;  3J80 g;  2H6Q A;  2W18 A;  3ORV D;  4JSN C;  1OMW B;  3PXW D;  5CXC B;  4ERZ A;  1U4C A;  3N0D A;  4JXM A;  1NEX B;  2BBK H;  3CIK B;  4K3I D;  4NSX A;  4BH6 A;  2HXC A;  3DXM C;  3OTT A;  4J8G A;  4U7A A;  4J79 A;  4AEZ A;  2H9M A;  3JB9 L;  2AGW A;  2H3X A;  2HKR A;  4QL1 A;  4A2M A;  2G9A A;  2CN3 A;  5EAM A;  5EAP A;  3KRX B;  2OVP B;  3MKS B;  5EAL A;  5K19 A;  4J8B A;  4ZN4 A;  2AH0 A;  2B5N A;  3EI4 A;  3EI2 A;  3W15 A;  4K3J B;  2UZY B;  2OVR B;  4GM3 A;  2QC5 A;  4XEI C;  4LG8 A;  2CO0 C;  2I3S A;  4JT6 C;  5IT9 g;  4J73 A;  5HE2 B;  3EU7 A;  4J78 A;  4CZV A;  3UVO A;  3JAM g;  5C9Z B;  3I8C A;  3U4Y A;  3SLE D;  2B5L A;  5EM2 A;  2I0R A;  2IAA A;  1GP2 B;  2CE8 A;  3GRE A;  5EMK B;  1VYH C;  3MXX A;  4CI2 A;  4A09 A;  4ZOX A;  5H1M A;  3PVU B;  5FKQ A;  2IUR A;  5CXC A;  3F3G A;  1JJU B;  1PBY B;  5K1C C;  3DSM A;  4PBY A;  2CNX A;  4GGD A;  3JRP A;  2P9L C;  3K26 A;  4CY2 A;  4CZX A;  2Z2P A;  5KDO B;  1NR0 A;  4GQ1 A;  5GXH A;  4HDJ A;  4A08 B;  2TRC B;  3MMY A;  3C5M A;  2J57 G;  3RFH A;  2Q7Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...