3F3PA

Crystal structure of the nucleoporin pair nup85-seh1, space group p21212
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
349
structure length
303
Chain Sequence
MQPFDSGHDDLVHDVVYDFYGRHVATCSSDQHIKVFKLDKDTSNWELSDSWRAHDSSIVAIDWASPEYGRIIASASYDKTVKLWEEDPDQEECSGRRWNKLCTLNDSKGSLYSVKFAPAHLGLKLACLGNDGILRLYDALEPSDLRSWTLTSEMKVLSIPQSDFCLSWCPSRFSPEKLAVSALEQAIIYQRGKDGKLHVAAKLPGHKSLIRSISWAPSIGRWYQLIATGCKDGRIRIFKITEKSNLQVELLSEHDDHNGEVWSVSWNLTGTILSSAGDDGKVRLWKATYSNEFKCMSVITAQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoporin SEH1
publication title A fence-like coat for the nuclear pore membrane.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Structural protein
total genus 70
structure length 303
sequence length 349
chains with identical sequence B, E, F, I, J
ec nomenclature
pdb deposition date 2008-10-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3f3pA01
2OIZA 3I7KA 4X60B 3IKOA 5GXIA 4J82A 1GOTB 5H17A 2H6KA 4Y7RA 5HE3B 3RSEC 2B5LA 5FA5B 1ERJA 5H14A 4E5ZB 3EI3A 5GXHA 4H5JA 4J0XA 2P9PC 5EAPA 2CN2A 5TDHB 4ZN4A 4A09B 4O1QD 2H14A 3PXSD 4GGAA 4BH6A 2OJYA 1B9XA 1GP2B 4KFMB 4JD2C 4QL1A 4A08B 3DWLC 2O9KA 4JXMA 2PBIB 2CE9A 2P9IC 3AL9A 1JJUB 1SQJA 2AGXA 4XYIA 1JOFA 1NR0A 2CO0A 5EMMB 4J77A 4L9OA 2CN3A 2G99A 4PBYA 3PVUB 5GMKn 3C5MA 1JMXB 2B5NA 3JB9L 1SQ9A 5AMSA 3RLMD 3V7DB 4GZ8A 3U4YA 4PSWB 2PM9A 2HYEA 3AL8B 2I0SA 2Z2OA 4D0KA 5JWZA 2IUPA 2H6QA 4HDJA 4BUJC 3NVQA 2PM6B 5FKQA 3BG1A 1A0RB 3BWSA 5TEEA 4GM8A 4PBZA 4GQBB 3ZWLB 4E54B 1U2VC 3UR4A 4LG8A 3EI4A 4O9DA 4N14A 2AGZA 1PBYB 3W15A 4ERZA 5FQDA 2J56H 2I0TA 3SLED 3EU7A 3K27A 3ORVD 4ERQA 4XEIC 4CY1A 3CIKB 2HKMA 1U4CA 3MZLA 1RI6A 2B5MA 5CXBB 4CI8A 2YNNA 3NVNA 4GQ2P 5IT9g 2GC4A 1OLZA 2GC7A 5THAA 3IJ1A 4J86A 4ES0A 4A0BA 3FRXA 2OVQB 3CFVA 4CZYA 2UZXB 5EMLB 4A11B 4K3JB 4O45A 3OKWA 2XL3A 2CE8A 4EWRA 1Q47A 1XIPA 4J0WA 1GXRA 3UVLA 1R5MA 4FA4D 4AEZA 2OVRB 5C9ZB 3EI3B 3DM0A 5EAMA 4AOWA 4ZOVA 3GFCA 2EBSA 3SMRA 1B9YA 1MG3A 5HQGA 4O3TB 5TF2A 2H9PA 2J57G 2H13A 3MMYA 2AQ5A 5EMJB 2OVPB 2OK6A 4X3EA 4BL0A 3MKQA 3UVOA 3RN0D 1JMZB 3UKRC 3AFCA 4J84A 4CI3A 4XYHA 2P9SC 4G56B 2I0RA 1PGUA 3DXMC 3SBQA 4TZ4A 1SHYB 2IURA 3PE7A 4FA5D 3EI2B 5EMKB 3N0EA 3MZKA 4UI9R 1OMWB 4ZOZA 2PM9B 3SFZA 4FHLA 5TEFA 2XU7A 3IJ0A 3I7HA 3NVXA 4H5IA 3UVNA 2XYIA 3A0FA 2H47A 4A2LA 3L4MD 4FA1D 1TBGA 3AH8B 3RFGA 4L1QD 4JT6C 2Q7QA 4L3HD 4LGNA 4E5ZA 3F3PA 5AJAA 3EI4B 2YB8B 3PXWD 4R7AB 4J78A 2I3SA 5FLXg 3FM0A 4J8GA 2AGLA 5SXMA 5CXCB 3RMZD 2G9AA 1L0QA 2HXCA 2H68A 5I5JA 2J55H 3SBPA 4CI2A 4IMMA 1PI6A 3VH0A 3EI1B 1K32A 2HJBA 2HKRA 4ERYA 4MK0B 4A0BB 4J79A 1N6DA 3V5WB 3KRXB 4GMBA 2IUQA 4Z8LA 2H9LA 4J87A 3EWEA 2Z2NA 4JSPC 3J81g 1MG2A 5KDOB 3I7OA 4PNKB 5IJ7E 1K8KC 5I5IA 2AH1A 2YNPA 4YVDA 5CYKA 5HE1B 4JT5C 4OWRA 2P9LC 2Z2PA 4JSXC 5FKTA 2IAAA 2H9MA 1XKSA 1TYQC 3BG0A 4QRJA 4ZOXA 4FA9D 3UKUC 3OL2A 1NEXB 4J8BA 2UZYB 2YMUA 4A7JA 1FWXA 3MKSB 3OKYA 3FGBA 2TRCB 3JRPA 3JZGA 2B4EA 2P9UC 5EM2A 4A0AA 3EG6A 4X63B 3RRMC 5I5MA 1S4UX 3PVWB 1N6FA 2GNQA 3UVKA 4CZVA 3B7FA 3OW8A 5HE2B 3L4OD 4ZOYA 4GM9A 3P4FA 2AGWA 2W18A 4X61B 3I8EA 4A11A 2HJ4A 3OTTA 4CZXA 5C2WB 3VA6A 3OKTA 2QXVA 3SHFA 4I79A 4PXWA 3SXTD 5FKRA 3MXXA 4GM3A 3JPXA 4D6VA 4FAND 2I3TA 3I7PA 2YBAA 3E0CA 4GGDA 2YNOA 4Y5RD 5K19A 3GREA 5EALA 3JZNA 4O3UB 3SJLD 4FAVD 4JSVC 3K26A 4IA9A 2OK4A 5FXYA 3UVMA 5B4WA 1MDAH 1VYHC 4GQ1A 4QQEA 4LG9A 4JSNC 5HYNB 3V9FA 2H6NA 3I7NA 4A09A 3CFSB 4CY2A 3I89A 3SBRA 4A2MA 4A08A 5A2Qg 2PM7B 3EI2A 4FB1D 5FKSA 3F3GA 4FWWA 5C2VB 3I8CA 3DXKC 4PC0A 3JROA 2IUVA 1XHMA 4CY5A 3PSCB 3I7LA 2P9NC 5CYKB 2CNXA 4CY3A 3SWSD 1YFQA 3SCYA 4GGCA 4NSXA 5EARA 4K3ID 5H1MA 3F3FA 3J80g 3IIYA 2QC5A 5K1CC 2HESX 1N6EA 2BBKH 3AL8A 3OL2B 3C9CA 3C75H 3I2NA 3JZHA 5HE0B 2P9KC 3OKYB 3ODTA 4OZUA 3HFQA 4U1EI 5CXCA 3IJCA 3IIWA 1PEVA 4CC9A 5EM2B 4A0AB 4E54A 4PSXB 4QT8A 3EI1A 1P22A 2IWFA 3PSLA 4J81A 2IWKA 5IC7A 2XL2A 3SN6B 3ULEC 4U7AA 3JAMg 5IGQA 3VGZA 2CO0C 2H9NA 2MTAH 5AFU3 5GSAA 4ESGA 5CXBA 1QNIA 4L3GD 2AGYA 5IGOA 4J73A 3SVWD 3C99A 2AH0A 4CI1A 3RN1D 3RFHA 5IJ8E 3PXTD 2BCJB 1GG2B 2H3XA 3N0DA 3KRWB 3DSMA 3EMHA
chains in the Genus database with same CATH superfamily
2OIZA 3I7KA 4X60B 3IKOA 5GXIA 4J82A 1GOTB 5H17A 2H6KA 4Y7RA 5HE3B 3RSEC 2B5LA 3ZE0A 2VDMA 5FA5B 1ERJA 5H14A 4E5ZB 3EI3A 5GXHA 4H5JA 4J0XA 2P9PC 5EAPA 2CN2A 5TDHB 4ZN4A 4A09B 4MMXA 1E5TA 4O1QD 4O02A 2H14A 3PXSD 4GGAA 4BH6A 2OJYA 1QFSA 1B9XA 1GP2B 4KFMB 4JD2C 4QL1A 4A08B 3DWLC 2O9KA 3IURA 4JXMA 2PBIB 2CE9A 5FFGA 2P9IC 4AN1A 3O4IA 3AL9A 3EQ7A 1JJUB 1SQJA 2AGXA 3NIDA 4XYIA 1JOFA 4AX4A 1NR0A 2CO0A 2EIDA 4Z7NA 5EMMB 4J77A 4L9OA 2CN3A 1UOQA 2G99A 4PBYA 3PVUB 3VI4A 5GMKn 3C5MA 1JMXB 3GC3B 3IUQA 2B5NA 3JB9L 1SQ9A 3KCIA 5AMSA 3RLMD 3V7DB 5C92A 4GZ8A 3U4YA 4PSWB 2PM9A 1E8MA 2HYEA 3AL8B 2I0SA 1L5GA 3ZDZA 2Z2OA 5M5VA 3T3MA 4D0KA 5JWZA 2IUPA 2H6QA 4HDJA 4BUJC 3NVQA 2PM6B 5FKQA 3BG1A 1A0RB 3BWSA 5TEEA 3QHYB 4GM8A 4PBZA 4GQBB 3ZWLB 4E54B 1BPOA 1U2VC 3UR4A 3O4JA 4LG8A 3EI4A 4O9DA 4N14A 2AGZA 1PBYB 3W15A 4ERZA 5FQDA 2J56H 2I0TA 3SLED 3EU7A 3K27A 3ORVD 4ERQA 4XEIC 4CY1A 3CIKB 2HKMA 1U4CA 3MZLA 1RI6A 2B5MA 5CXBB 4CI8A 2YNNA 3NVNA 4GQ2P 4AMYA 5IT9g 5E6RA 4RE5A 2BKLA 2GC4A 1OLZA 2GC7A 5THAA 3IJ1A 4J86A 4ES0A 2EIEA 4A0BA 3FRXA 4G55A 2OVQB 1H2ZA 3CFVA 4CZYA 2UZXB 3QI0A 4RE6A 5EMLB 4A11B 4K3JB 4O45A 3OKWA 2QR5A 1T2XA 2XL3A 4UM9A 2CE8A 4EWRA 3IJEA 4NC4A 1Q47A 1XIPA 4J0WA 4JHPC 4NENA 1GXRA 3UVLA 4G1EA 1R5MA 4FA4D 4AEZA 3EQ9A 2OVRB 5C9ZB 1A12A 4NAAA 3EI3B 3DM0A 1H2WA 5EAMA 4AOWA 1H2YA 4ZOVA 3GFCA 2EBSA 3SMRA 1B9YA 1MG3A 5HQGA 4O3TB 5TF2A 2H9PA 2J57G 2H13A 3FCSA 1E8NA 3MMYA 2AQ5A 5EMJB 1O6FA 2OVPB 2VDOA 2OK6A 4WK2A 4X3EA 4BL0A 3MKQA 3K71A 3UVOA 3ZE1A 4AMZA 3RN0D 1JMZB 3UKRC 3AFCA 4J84A 5C86A 4XYHA 4BCCA 4CI3A 4UM8A 5M5RA 2P9SC 4G56B 2I0RA 1PGUA 3DXMC 3SBQA 4TZ4A 1SHYB 2IURA 3PE7A 4QAMA 4FA5D 1QFMA 3EI2B 1GOGA 3IULA 2VDNA 5EMKB 3N0EA 3MZKA 4UI9R 1OMWB 4ZOZA 2PM9B 3SFZA 4FHLA 5TEFA 3NIGA 1VE6A 4WK4A 2XU7A 3IJ0A 3I7HA 3NVXA 4H5IA 3UVNA 1GOHA 2XYIA 3A0FA 2H47A 4O2WA 4A2LA 3L4MD 4FA1D 2EICA 1TBGA 3AH8B 3RFGA 5HDBA 4L1QD 3OF7A 4JT6C 2Q7QA 4L3HD 4LGNA 4E5ZA 3F3PA 5AJAA 3O4GA 3MUNA 3EI4B 2YB8B 3PXWD 2VZ1A 4R7AB 4J78A 2I3SA 5FLXg 3FM0A 4J8GA 1U8CA 2AGLA 5SXMA 5CXCB 3MVDK 3RMZD 2G9AA 3IVMA 1L0QA 2HXCA 2H68A 5I5JA 2J55H 3SBPA 4CI2A 1PI6A 4IMMA 3VH0A 3EI1B 5E6SA 1K32A 2HJBA 2HKRA 2VDLA 4ERYA 4MK0B 4G1MA 4A0BB 4J79A 1N6DA 3V5WB 3KRXB 4IRZA 4GMBA 4DNUA 2IUQA 4Z8LA 2H9LA 4J87A 4DNVA 3EWEA 4BP9A 2Z2NA 4JSPC 2WQ8A 3K6SA 1VZ3A 2VC2A 3J81g 1MG2A 2VDRA 3T3PA 3I7OA 4PNKB 5IJ7E 5KDOB 1K8KC 2XE4A 5I5IA 2AH1A 2YNPA 4YVDA 5CYKA 1JTDB 5HE1B 4JT5C 4OWRA 2P9LC 2Z2PA 4JSXC 5FKTA 2IAAA 2H9MA 1O6GA 1XKSA 4Z7QA 5M5TA 1TYQC 3BG0A 4AN0A 4QRJA 4ZOXA 4FA9D 3UKUC 3NIFA 1NEXB 3OL2A 4MMZA 4J8BA 5E6UA 2UZYB 2YMUA 4A7JA 1C9LA 1FWXA 3MKSB 3OKYA 3FGBA 1GOFA 2TRCB 3JRPA 1YR2A 2VZ3A 3JZGA 2B4EA 2P9UC 5EM2A 4A0AA 4NBMA 3EG6A 1TYEA 2XDWA 3EQ8A 4X63B 1S4UX 3RRMC 5I5MA 1K3IA 3PVWB 4BP8A 1N6FA 2GNQA 1VE7A 3GD1I 3UVKA 5M5UA 4L1MA 4CZVA 3B7FA 3OW8A 5HE2B 2EIBA 3L4OD 4ZOYA 4GM9A 2VDPA 3P4FA 2AGWA 2W18A 4X61B 2HU5A 3I8EA 4A11A 2HJ4A 3OTTA 4CZXA 5C2WB 3VA6A 3OKTA 2QXVA 3SHFA 4I79A 4PXWA 3SXTD 5FKRA 3MXXA 3V4VA 4GM3A 1M1XA 3JPXA 3O4HA 4D6VA 4WK0A 4FAND 2I3TA 4BCDA 3I7PA 1VZ2A 3IUNA 2VDQA 2YBAA 3E0CA 4GGDA 5M61A 2YNOA 4Y5RD 5K19A 3GREA 5EALA 3JZNA 3ZE2A 4O3UB 3SJLD 4Z7OA 4FAVD 1UOPA 4JSVC 3K26A 2QZPA 4IA9A 2OK4A 3K72A 5FXYA 3UVMA 5B4WA 1MDAH 1VYHC 4GQ1A 4QQEA 4LG9A 4JSNC 5HYNB 1UOOA 3V9FA 2H6NA 3I7NA 4A09A 3CFSB 4CY2A 3I89A 3SBRA 4A2MA 4A08A 4BCBA 5A2Qg 2PM7B 3EI2A 4FB1D 5FKSA 3F3GA 1I2MB 4FWWA 5C2VB 3I8CA 3DXKC 4PC0A 3JROA 3ZDYA 2IUVA 2VDKA 1XHMA 2XZGA 4CY5A 4JHNA 1UTCA 3MUOA 3PSCB 4D9SA 3I7LA 2P9NC 5CYKB 2CNXA 4CY3A 2HU7A 3SWSD 1YFQA 3SCYA 4GGCA 4NSXA 5EARA 4K3ID 3IUJA 3DDUA 5H1MA 3VI3A 3F3FA 1H2XA 3J80g 3IIYA 2QC5A 5K1CC 2HESX 4MMYA 1N6EA 2BBKH 3AL8A 3OL2B 3C9CA 3V4PA 4WJKA 3C75H 3I2NA 3JZHA 5HE0B 2P9KC 3OKYB 3ODTA 4OZUA 3HFQA 4U1EI 5CXCA 3IJCA 3IIWA 1PEVA 4CC9A 5EM2B 4A0AB 4E54A 4PSXB 4QT8A 3EI1A 5M5SA 1P22A 2IWFA 3PSLA 4J81A 2IWKA 5FFOA 5IC7A 2XL2A 3SN6B 3ULEC 4U7AA 3JAMg 5IGQA 3VGZA 2CO0C 2H9NA 2MTAH 5AFU3 5GSAA 2JKXA 3ZDXA 4ESGA 5CXBA 1QNIA 4L3GD 2AGYA 5IGOA 4J73A 3SVWD 3C99A 2AH0A 3FCUA 4CI1A 3RN1D 3RFHA 5IJ8E 3PXTD 2BCJB 2HU8A 1GG2B 2H3XA 3IUMA 3N0DA 4DNWA 1JV2A 3KRWB 1C9IA 3DSMA 3EMHA
chains in the Genus database with same CATH topology
2OIZA 3I7KA 4X60B 3IKOA 5GXIA 4J82A 1GOTB 5H17A 2H6KA 4Y7RA 5HE3B 3RSEC 2B5LA 5FA5B 1ERJA 5H14A 4E5ZB 3EI3A 5GXHA 4H5JA 4J0XA 2P9PC 5EAPA 2CN2A 5TDHB 4ZN4A 4A09B 4O1QD 2H14A 3PXSD 4GGAA 4BH6A 2OJYA 1B9XA 1GP2B 4KFMB 4JD2C 4QL1A 4A08B 3DWLC 2O9KA 4JXMA 2PBIB 2CE9A 2P9IC 3AL9A 1JJUB 1SQJA 2AGXA 4XYIA 1JOFA 1NR0A 2CO0A 5EMMB 4J77A 4L9OA 2CN3A 2G99A 4PBYA 3PVUB 5GMKn 3C5MA 1JMXB 2B5NA 3JB9L 1SQ9A 5AMSA 3RLMD 3V7DB 4GZ8A 3U4YA 4PSWB 2PM9A 2HYEA 3AL8B 2I0SA 2Z2OA 4D0KA 5JWZA 2IUPA 2H6QA 4HDJA 4BUJC 3NVQA 2PM6B 5FKQA 3BG1A 1A0RB 3BWSA 5TEEA 4GM8A 4PBZA 4GQBB 3ZWLB 4E54B 1U2VC 3UR4A 4LG8A 3EI4A 4O9DA 4N14A 2AGZA 1PBYB 3W15A 4ERZA 5FQDA 2J56H 2I0TA 3SLED 3EU7A 3K27A 3ORVD 4ERQA 4XEIC 4CY1A 3CIKB 2HKMA 1U4CA 3MZLA 1RI6A 2B5MA 5CXBB 4CI8A 2YNNA 3NVNA 4GQ2P 5IT9g 2GC4A 1OLZA 2GC7A 5THAA 3IJ1A 4J86A 4ES0A 4A0BA 3FRXA 2OVQB 3CFVA 4CZYA 2UZXB 5EMLB 4A11B 4K3JB 4O45A 3OKWA 2XL3A 2CE8A 4EWRA 1Q47A 1XIPA 4J0WA 1GXRA 3UVLA 1R5MA 4FA4D 4AEZA 2OVRB 5C9ZB 3EI3B 3DM0A 5EAMA 4AOWA 4ZOVA 3GFCA 2EBSA 3SMRA 1B9YA 1MG3A 5HQGA 4O3TB 5TF2A 2H9PA 2J57G 2H13A 3MMYA 2AQ5A 5EMJB 2OVPB 2OK6A 4X3EA 4BL0A 3MKQA 3UVOA 3RN0D 1JMZB 3UKRC 3AFCA 4J84A 4CI3A 4XYHA 2P9SC 4G56B 2I0RA 1PGUA 3DXMC 3SBQA 4TZ4A 1SHYB 2IURA 3PE7A 4FA5D 3EI2B 5EMKB 3N0EA 3MZKA 4UI9R 1OMWB 4ZOZA 2PM9B 3SFZA 4FHLA 5TEFA 2XU7A 3IJ0A 3I7HA 3NVXA 4H5IA 3UVNA 2XYIA 3A0FA 2H47A 4A2LA 3L4MD 4FA1D 1TBGA 3AH8B 3RFGA 4L1QD 4JT6C 2Q7QA 4L3HD 4LGNA 4E5ZA 3F3PA 5AJAA 3EI4B 2YB8B 3PXWD 4R7AB 4J78A 2I3SA 5FLXg 3FM0A 4J8GA 2AGLA 5SXMA 5CXCB 3RMZD 2G9AA 1L0QA 2HXCA 2H68A 5I5JA 2J55H 3SBPA 4CI2A 4IMMA 1PI6A 3VH0A 3EI1B 1K32A 2HJBA 2HKRA 4ERYA 4MK0B 4A0BB 4J79A 1N6DA 3V5WB 3KRXB 4GMBA 2IUQA 4Z8LA 2H9LA 4J87A 3EWEA 2Z2NA 4JSPC 3J81g 1MG2A 5KDOB 3I7OA 4PNKB 5IJ7E 1K8KC 5I5IA 2AH1A 2YNPA 4YVDA 5CYKA 5HE1B 4JT5C 4OWRA 2P9LC 2Z2PA 4JSXC 5FKTA 2IAAA 2H9MA 1XKSA 1TYQC 3BG0A 4QRJA 4ZOXA 4FA9D 3UKUC 3OL2A 1NEXB 4J8BA 2UZYB 2YMUA 4A7JA 1FWXA 3MKSB 3OKYA 3FGBA 2TRCB 3JRPA 3JZGA 2B4EA 2P9UC 5EM2A 4A0AA 3EG6A 4X63B 3RRMC 5I5MA 1S4UX 3PVWB 1N6FA 2GNQA 3UVKA 4CZVA 3B7FA 3OW8A 5HE2B 3L4OD 4ZOYA 4GM9A 3P4FA 2AGWA 2W18A 4X61B 3I8EA 4A11A 2HJ4A 3OTTA 4CZXA 5C2WB 3VA6A 3OKTA 2QXVA 3SHFA 4I79A 4PXWA 3SXTD 5FKRA 3MXXA 4GM3A 3JPXA 4D6VA 4FAND 2I3TA 3I7PA 2YBAA 3E0CA 4GGDA 2YNOA 4Y5RD 5K19A 3GREA 5EALA 3JZNA 4O3UB 3SJLD 4FAVD 4JSVC 3K26A 4IA9A 2OK4A 5FXYA 3UVMA 5B4WA 1MDAH 1VYHC 4GQ1A 4QQEA 4LG9A 4JSNC 5HYNB 3V9FA 2H6NA 3I7NA 4A09A 3CFSB 4CY2A 3I89A 3SBRA 4A2MA 4A08A 5A2Qg 2PM7B 3EI2A 4FB1D 5FKSA 3F3GA 4FWWA 5C2VB 3I8CA 3DXKC 4PC0A 3JROA 2IUVA 1XHMA 4CY5A 3PSCB 3I7LA 2P9NC 5CYKB 2CNXA 4CY3A 3SWSD 1YFQA 3SCYA 4GGCA 4NSXA 5EARA 4K3ID 5H1MA 3F3FA 3J80g 3IIYA 2QC5A 5K1CC 2HESX 1N6EA 2BBKH 3AL8A 3OL2B 3C9CA 3C75H 3I2NA 3JZHA 5HE0B 2P9KC 3OKYB 3ODTA 4OZUA 3HFQA 4U1EI 5CXCA 3IJCA 3IIWA 1PEVA 4CC9A 5EM2B 4A0AB 4E54A 4PSXB 4QT8A 3EI1A 1P22A 2IWFA 3PSLA 4J81A 2IWKA 5IC7A 2XL2A 3SN6B 3ULEC 4U7AA 3JAMg 5IGQA 3VGZA 2CO0C 2H9NA 2MTAH 5AFU3 5GSAA 4ESGA 5CXBA 1QNIA 4L3GD 2AGYA 5IGOA 4J73A 3SVWD 3C99A 2AH0A 4CI1A 3RN1D 3RFHA 5IJ8E 3PXTD 2BCJB 1GG2B 2H3XA 3N0DA 3KRWB 3DSMA 3EMHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OIZ A;  3I7K A;  4X60 B;  3IKO A;  5GXI A;  4J82 A;  1GOT B;  5H17 A;  2H6K A;  4Y7R A;  5HE3 B;  3RSE C;  2B5L A;  5FA5 B;  1ERJ A;  5H14 A;  4E5Z B;  3EI3 A;  5GXH A;  4H5J A;  4J0X A;  2P9P C;  5EAP A;  2CN2 A;  5TDH B;  4ZN4 A;  4A09 B;  4O1Q D;  2H14 A;  3PXS D;  4GGA A;  4BH6 A;  2OJY A;  1B9X A;  1GP2 B;  4KFM B;  4JD2 C;  4QL1 A;  4A08 B;  3DWL C;  2O9K A;  4JXM A;  2PBI B;  2CE9 A;  2P9I C;  3AL9 A;  1JJU B;  1SQJ A;  2AGX A;  4XYI A;  1JOF A;  1NR0 A;  2CO0 A;  5EMM B;  4J77 A;  4L9O A;  2CN3 A;  2G99 A;  4PBY A;  3PVU B;  5GMK n;  3C5M A;  1JMX B;  2B5N A;  3JB9 L;  1SQ9 A;  5AMS A;  3RLM D;  3V7D B;  4GZ8 A;  3U4Y A;  4PSW B;  2PM9 A;  2HYE A;  3AL8 B;  2I0S A;  2Z2O A;  4D0K A;  5JWZ A;  2IUP A;  2H6Q A;  4HDJ A;  4BUJ C;  3NVQ A;  2PM6 B;  5FKQ A;  3BG1 A;  1A0R B;  3BWS A;  5TEE A;  4GM8 A;  4PBZ A;  4GQB B;  3ZWL B;  4E54 B;  1U2V C;  3UR4 A;  4LG8 A;  3EI4 A;  4O9D A;  4N14 A;  2AGZ A;  1PBY B;  3W15 A;  4ERZ A;  5FQD A;  2J56 H;  2I0T A;  3SLE D;  3EU7 A;  3K27 A;  3ORV D;  4ERQ A;  4XEI C;  4CY1 A;  3CIK B;  2HKM A;  1U4C A;  3MZL A;  1RI6 A;  2B5M A;  5CXB B;  4CI8 A;  2YNN A;  3NVN A;  4GQ2 P;  5IT9 g;  2GC4 A;  1OLZ A;  2GC7 A;  5THA A;  3IJ1 A;  4J86 A;  4ES0 A;  4A0B A;  3FRX A;  2OVQ B;  3CFV A;  4CZY A;  2UZX B;  5EML B;  4A11 B;  4K3J B;  4O45 A;  3OKW A;  2XL3 A;  2CE8 A;  4EWR A;  1Q47 A;  1XIP A;  4J0W A;  1GXR A;  3UVL A;  1R5M A;  4FA4 D;  4AEZ A;  2OVR B;  5C9Z B;  3EI3 B;  3DM0 A;  5EAM A;  4AOW A;  4ZOV A;  3GFC A;  2EBS A;  3SMR A;  1B9Y A;  1MG3 A;  5HQG A;  4O3T B;  5TF2 A;  2H9P A;  2J57 G;  2H13 A;  3MMY A;  2AQ5 A;  5EMJ B;  2OVP B;  2OK6 A;  4X3E A;  4BL0 A;  3MKQ A;  3UVO A;  3RN0 D;  1JMZ B;  3UKR C;  3AFC A;  4J84 A;  4CI3 A;  4XYH A;  2P9S C;  4G56 B;  2I0R A;  1PGU A;  3DXM C;  3SBQ A;  4TZ4 A;  1SHY B;  2IUR A;  3PE7 A;  4FA5 D;  3EI2 B;  5EMK B;  3N0E A;  3MZK A;  4UI9 R;  1OMW B;  4ZOZ A;  2PM9 B;  3SFZ A;  4FHL A;  5TEF A;  2XU7 A;  3IJ0 A;  3I7H A;  3NVX A;  4H5I A;  3UVN A;  2XYI A;  3A0F A;  2H47 A;  4A2L A;  3L4M D;  4FA1 D;  1TBG A;  3AH8 B;  3RFG A;  4L1Q D;  4JT6 C;  2Q7Q A;  4L3H D;  4LGN A;  4E5Z A;  3F3P A;  5AJA A;  3EI4 B;  2YB8 B;  3PXW D;  4R7A B;  4J78 A;  2I3S A;  5FLX g;  3FM0 A;  4J8G A;  2AGL A;  5SXM A;  5CXC B;  3RMZ D;  2G9A A;  1L0Q A;  2HXC A;  2H68 A;  5I5J A;  2J55 H;  3SBP A;  4CI2 A;  4IMM A;  1PI6 A;  3VH0 A;  3EI1 B;  1K32 A;  2HJB A;  2HKR A;  4ERY A;  4MK0 B;  4A0B B;  4J79 A;  1N6D A;  3V5W B;  3KRX B;  4GMB A;  2IUQ A;  4Z8L A;  2H9L A;  4J87 A;  3EWE A;  2Z2N A;  4JSP C;  3J81 g;  1MG2 A;  5KDO B;  3I7O A;  4PNK B;  5IJ7 E;  1K8K C;  5I5I A;  2AH1 A;  2YNP A;  4YVD A;  5CYK A;  5HE1 B;  4JT5 C;  4OWR A;  2P9L C;  2Z2P A;  4JSX C;  5FKT A;  2IAA A;  2H9M A;  1XKS A;  1TYQ C;  3BG0 A;  4QRJ A;  4ZOX A;  4FA9 D;  3UKU C;  3OL2 A;  1NEX B;  4J8B A;  2UZY B;  2YMU A;  4A7J A;  1FWX A;  3MKS B;  3OKY A;  3FGB A;  2TRC B;  3JRP A;  3JZG A;  2B4E A;  2P9U C;  5EM2 A;  4A0A A;  3EG6 A;  4X63 B;  3RRM C;  5I5M A;  1S4U X;  3PVW B;  1N6F A;  2GNQ A;  3UVK A;  4CZV A;  3B7F A;  3OW8 A;  5HE2 B;  3L4O D;  4ZOY A;  4GM9 A;  3P4F A;  2AGW A;  2W18 A;  4X61 B;  3I8E A;  4A11 A;  2HJ4 A;  3OTT A;  4CZX A;  5C2W B;  3VA6 A;  3OKT A;  2QXV A;  3SHF A;  4I79 A;  4PXW A;  3SXT D;  5FKR A;  3MXX A;  4GM3 A;  3JPX A;  4D6V A;  4FAN D;  2I3T A;  3I7P A;  2YBA A;  3E0C A;  4GGD A;  2YNO A;  4Y5R D;  5K19 A;  3GRE A;  5EAL A;  3JZN A;  4O3U B;  3SJL D;  4FAV D;  4JSV C;  3K26 A;  4IA9 A;  2OK4 A;  5FXY A;  3UVM A;  5B4W A;  1MDA H;  1VYH C;  4GQ1 A;  4QQE A;  4LG9 A;  4JSN C;  5HYN B;  3V9F A;  2H6N A;  3I7N A;  4A09 A;  3CFS B;  4CY2 A;  3I89 A;  3SBR A;  4A2M A;  4A08 A;  5A2Q g;  2PM7 B;  3EI2 A;  4FB1 D;  5FKS A;  3F3G A;  4FWW A;  5C2V B;  3I8C A;  3DXK C;  4PC0 A;  3JRO A;  2IUV A;  1XHM A;  4CY5 A;  3PSC B;  3I7L A;  2P9N C;  5CYK B;  2CNX A;  4CY3 A;  3SWS D;  1YFQ A;  3SCY A;  4GGC A;  4NSX A;  5EAR A;  4K3I D;  5H1M A;  3F3F A;  3J80 g;  3IIY A;  2QC5 A;  5K1C C;  2HES X;  1N6E A;  2BBK H;  3AL8 A;  3OL2 B;  3C9C A;  3C75 H;  3I2N A;  3JZH A;  5HE0 B;  2P9K C;  3OKY B;  3ODT A;  4OZU A;  3HFQ A;  4U1E I;  5CXC A;  3IJC A;  3IIW A;  1PEV A;  4CC9 A;  5EM2 B;  4A0A B;  4E54 A;  4PSX B;  4QT8 A;  3EI1 A;  1P22 A;  2IWF A;  3PSL A;  4J81 A;  2IWK A;  5IC7 A;  2XL2 A;  3SN6 B;  3ULE C;  4U7A A;  3JAM g;  5IGQ A;  3VGZ A;  2CO0 C;  2H9N A;  2MTA H;  5AFU 3;  5GSA A;  4ESG A;  5CXB A;  1QNI A;  4L3G D;  2AGY A;  5IGO A;  4J73 A;  3SVW D;  3C99 A;  2AH0 A;  4CI1 A;  3RN1 D;  3RFH A;  5IJ8 E;  3PXT D;  2BCJ B;  1GG2 B;  2H3X A;  3N0D A;  3KRW B;  3DSM A;  3EMH A; 
#chains in the Genus database with same CATH topology
 2OIZ A;  3I7K A;  4X60 B;  3IKO A;  5GXI A;  4J82 A;  1GOT B;  5H17 A;  2H6K A;  4Y7R A;  5HE3 B;  3RSE C;  2B5L A;  3ZE0 A;  2VDM A;  5FA5 B;  1ERJ A;  5H14 A;  4E5Z B;  3EI3 A;  5GXH A;  4H5J A;  4J0X A;  2P9P C;  5EAP A;  2CN2 A;  5TDH B;  4ZN4 A;  4A09 B;  4MMX A;  1E5T A;  4O1Q D;  4O02 A;  2H14 A;  3PXS D;  4GGA A;  4BH6 A;  2OJY A;  1QFS A;  1B9X A;  1GP2 B;  4KFM B;  4JD2 C;  4QL1 A;  4A08 B;  3DWL C;  2O9K A;  3IUR A;  4JXM A;  2PBI B;  2CE9 A;  5FFG A;  2P9I C;  4AN1 A;  3O4I A;  3AL9 A;  3EQ7 A;  1JJU B;  1SQJ A;  2AGX A;  3NID A;  4XYI A;  1JOF A;  4AX4 A;  1NR0 A;  2CO0 A;  2EID A;  4Z7N A;  5EMM B;  4J77 A;  4L9O A;  2CN3 A;  1UOQ A;  2G99 A;  4PBY A;  3PVU B;  3VI4 A;  5GMK n;  3C5M A;  1JMX B;  3GC3 B;  3IUQ A;  2B5N A;  3JB9 L;  1SQ9 A;  3KCI A;  5AMS A;  3RLM D;  3V7D B;  5C92 A;  4GZ8 A;  3U4Y A;  4PSW B;  2PM9 A;  1E8M A;  2HYE A;  3AL8 B;  2I0S A;  1L5G A;  3ZDZ A;  2Z2O A;  5M5V A;  3T3M A;  4D0K A;  5JWZ A;  2IUP A;  2H6Q A;  4HDJ A;  4BUJ C;  3NVQ A;  2PM6 B;  5FKQ A;  3BG1 A;  1A0R B;  3BWS A;  5TEE A;  3QHY B;  4GM8 A;  4PBZ A;  4GQB B;  3ZWL B;  4E54 B;  1BPO A;  1U2V C;  3UR4 A;  3O4J A;  4LG8 A;  3EI4 A;  4O9D A;  4N14 A;  2AGZ A;  1PBY B;  3W15 A;  4ERZ A;  5FQD A;  2J56 H;  2I0T A;  3SLE D;  3EU7 A;  3K27 A;  3ORV D;  4ERQ A;  4XEI C;  4CY1 A;  3CIK B;  2HKM A;  1U4C A;  3MZL A;  1RI6 A;  2B5M A;  5CXB B;  4CI8 A;  2YNN A;  3NVN A;  4GQ2 P;  4AMY A;  5IT9 g;  5E6R A;  4RE5 A;  2BKL A;  2GC4 A;  1OLZ A;  2GC7 A;  5THA A;  3IJ1 A;  4J86 A;  4ES0 A;  2EIE A;  4A0B A;  3FRX A;  4G55 A;  2OVQ B;  1H2Z A;  3CFV A;  4CZY A;  2UZX B;  3QI0 A;  4RE6 A;  5EML B;  4A11 B;  4K3J B;  4O45 A;  3OKW A;  2QR5 A;  1T2X A;  2XL3 A;  4UM9 A;  2CE8 A;  4EWR A;  3IJE A;  4NC4 A;  1Q47 A;  1XIP A;  4J0W A;  4JHP C;  4NEN A;  1GXR A;  3UVL A;  4G1E A;  1R5M A;  4FA4 D;  4AEZ A;  3EQ9 A;  2OVR B;  5C9Z B;  1A12 A;  4NAA A;  3EI3 B;  3DM0 A;  1H2W A;  5EAM A;  4AOW A;  1H2Y A;  4ZOV A;  3GFC A;  2EBS A;  3SMR A;  1B9Y A;  1MG3 A;  5HQG A;  4O3T B;  5TF2 A;  2H9P A;  2J57 G;  2H13 A;  3FCS A;  1E8N A;  3MMY A;  2AQ5 A;  5EMJ B;  1O6F A;  2OVP B;  2VDO A;  2OK6 A;  4WK2 A;  4X3E A;  4BL0 A;  3MKQ A;  3K71 A;  3UVO A;  3ZE1 A;  4AMZ A;  3RN0 D;  1JMZ B;  3UKR C;  3AFC A;  4J84 A;  5C86 A;  4XYH A;  4BCC A;  4CI3 A;  4UM8 A;  5M5R A;  2P9S C;  4G56 B;  2I0R A;  1PGU A;  3DXM C;  3SBQ A;  4TZ4 A;  1SHY B;  2IUR A;  3PE7 A;  4QAM A;  4FA5 D;  1QFM A;  3EI2 B;  1GOG A;  3IUL A;  2VDN A;  5EMK B;  3N0E A;  3MZK A;  4UI9 R;  1OMW B;  4ZOZ A;  2PM9 B;  3SFZ A;  4FHL A;  5TEF A;  3NIG A;  1VE6 A;  4WK4 A;  2XU7 A;  3IJ0 A;  3I7H A;  3NVX A;  4H5I A;  3UVN A;  1GOH A;  2XYI A;  3A0F A;  2H47 A;  4O2W A;  4A2L A;  3L4M D;  4FA1 D;  2EIC A;  1TBG A;  3AH8 B;  3RFG A;  5HDB A;  4L1Q D;  3OF7 A;  4JT6 C;  2Q7Q A;  4L3H D;  4LGN A;  4E5Z A;  3F3P A;  5AJA A;  3O4G A;  3MUN A;  3EI4 B;  2YB8 B;  3PXW D;  2VZ1 A;  4R7A B;  4J78 A;  2I3S A;  5FLX g;  3FM0 A;  4J8G A;  1U8C A;  2AGL A;  5SXM A;  5CXC B;  3MVD K;  3RMZ D;  2G9A A;  3IVM A;  1L0Q A;  2HXC A;  2H68 A;  5I5J A;  2J55 H;  3SBP A;  4CI2 A;  1PI6 A;  4IMM A;  3VH0 A;  3EI1 B;  5E6S A;  1K32 A;  2HJB A;  2HKR A;  2VDL A;  4ERY A;  4MK0 B;  4G1M A;  4A0B B;  4J79 A;  1N6D A;  3V5W B;  3KRX B;  4IRZ A;  4GMB A;  4DNU A;  2IUQ A;  4Z8L A;  2H9L A;  4J87 A;  4DNV A;  3EWE A;  4BP9 A;  2Z2N A;  4JSP C;  2WQ8 A;  3K6S A;  1VZ3 A;  2VC2 A;  3J81 g;  1MG2 A;  2VDR A;  3T3P A;  3I7O A;  4PNK B;  5IJ7 E;  5KDO B;  1K8K C;  2XE4 A;  5I5I A;  2AH1 A;  2YNP A;  4YVD A;  5CYK A;  1JTD B;  5HE1 B;  4JT5 C;  4OWR A;  2P9L C;  2Z2P A;  4JSX C;  5FKT A;  2IAA A;  2H9M A;  1O6G A;  1XKS A;  4Z7Q A;  5M5T A;  1TYQ C;  3BG0 A;  4AN0 A;  4QRJ A;  4ZOX A;  4FA9 D;  3UKU C;  3NIF A;  1NEX B;  3OL2 A;  4MMZ A;  4J8B A;  5E6U A;  2UZY B;  2YMU A;  4A7J A;  1C9L A;  1FWX A;  3MKS B;  3OKY A;  3FGB A;  1GOF A;  2TRC B;  3JRP A;  1YR2 A;  2VZ3 A;  3JZG A;  2B4E A;  2P9U C;  5EM2 A;  4A0A A;  4NBM A;  3EG6 A;  1TYE A;  2XDW A;  3EQ8 A;  4X63 B;  1S4U X;  3RRM C;  5I5M A;  1K3I A;  3PVW B;  4BP8 A;  1N6F A;  2GNQ A;  1VE7 A;  3GD1 I;  3UVK A;  5M5U A;  4L1M A;  4CZV A;  3B7F A;  3OW8 A;  5HE2 B;  2EIB A;  3L4O D;  4ZOY A;  4GM9 A;  2VDP A;  3P4F A;  2AGW A;  2W18 A;  4X61 B;  2HU5 A;  3I8E A;  4A11 A;  2HJ4 A;  3OTT A;  4CZX A;  5C2W B;  3VA6 A;  3OKT A;  2QXV A;  3SHF A;  4I79 A;  4PXW A;  3SXT D;  5FKR A;  3MXX A;  3V4V A;  4GM3 A;  1M1X A;  3JPX A;  3O4H A;  4D6V A;  4WK0 A;  4FAN D;  2I3T A;  4BCD A;  3I7P A;  1VZ2 A;  3IUN A;  2VDQ A;  2YBA A;  3E0C A;  4GGD A;  5M61 A;  2YNO A;  4Y5R D;  5K19 A;  3GRE A;  5EAL A;  3JZN A;  3ZE2 A;  4O3U B;  3SJL D;  4Z7O A;  4FAV D;  1UOP A;  4JSV C;  3K26 A;  2QZP A;  4IA9 A;  2OK4 A;  3K72 A;  5FXY A;  3UVM A;  5B4W A;  1MDA H;  1VYH C;  4GQ1 A;  4QQE A;  4LG9 A;  4JSN C;  5HYN B;  1UOO A;  3V9F A;  2H6N A;  3I7N A;  4A09 A;  3CFS B;  4CY2 A;  3I89 A;  3SBR A;  4A2M A;  4A08 A;  4BCB A;  5A2Q g;  2PM7 B;  3EI2 A;  4FB1 D;  5FKS A;  3F3G A;  1I2M B;  4FWW A;  5C2V B;  3I8C A;  3DXK C;  4PC0 A;  3JRO A;  3ZDY A;  2IUV A;  2VDK A;  1XHM A;  2XZG A;  4CY5 A;  4JHN A;  1UTC A;  3MUO A;  3PSC B;  4D9S A;  3I7L A;  2P9N C;  5CYK B;  2CNX A;  4CY3 A;  2HU7 A;  3SWS D;  1YFQ A;  3SCY A;  4GGC A;  4NSX A;  5EAR A;  4K3I D;  3IUJ A;  3DDU A;  5H1M A;  3VI3 A;  3F3F A;  1H2X A;  3J80 g;  3IIY A;  2QC5 A;  5K1C C;  2HES X;  4MMY A;  1N6E A;  2BBK H;  3AL8 A;  3OL2 B;  3C9C A;  3V4P A;  4WJK A;  3C75 H;  3I2N A;  3JZH A;  5HE0 B;  2P9K C;  3OKY B;  3ODT A;  4OZU A;  3HFQ A;  4U1E I;  5CXC A;  3IJC A;  3IIW A;  1PEV A;  4CC9 A;  5EM2 B;  4A0A B;  4E54 A;  4PSX B;  4QT8 A;  3EI1 A;  5M5S A;  1P22 A;  2IWF A;  3PSL A;  4J81 A;  2IWK A;  5FFO A;  5IC7 A;  2XL2 A;  3SN6 B;  3ULE C;  4U7A A;  3JAM g;  5IGQ A;  3VGZ A;  2CO0 C;  2H9N A;  2MTA H;  5AFU 3;  5GSA A;  2JKX A;  3ZDX A;  4ESG A;  5CXB A;  1QNI A;  4L3G D;  2AGY A;  5IGO A;  4J73 A;  3SVW D;  3C99 A;  2AH0 A;  3FCU A;  4CI1 A;  3RN1 D;  3RFH A;  5IJ8 E;  3PXT D;  2BCJ B;  2HU8 A;  1GG2 B;  2H3X A;  3IUM A;  3N0D A;  4DNW A;  1JV2 A;  3KRW B;  1C9I A;  3DSM A;  3EMH A; 
#chains in the Genus database with same CATH homology
 2OIZ A;  3I7K A;  4X60 B;  3IKO A;  5GXI A;  4J82 A;  1GOT B;  5H17 A;  2H6K A;  4Y7R A;  5HE3 B;  3RSE C;  2B5L A;  5FA5 B;  1ERJ A;  5H14 A;  4E5Z B;  3EI3 A;  5GXH A;  4H5J A;  4J0X A;  2P9P C;  5EAP A;  2CN2 A;  5TDH B;  4ZN4 A;  4A09 B;  4O1Q D;  2H14 A;  3PXS D;  4GGA A;  4BH6 A;  2OJY A;  1B9X A;  1GP2 B;  4KFM B;  4JD2 C;  4QL1 A;  4A08 B;  3DWL C;  2O9K A;  4JXM A;  2PBI B;  2CE9 A;  2P9I C;  3AL9 A;  1JJU B;  1SQJ A;  2AGX A;  4XYI A;  1JOF A;  1NR0 A;  2CO0 A;  5EMM B;  4J77 A;  4L9O A;  2CN3 A;  2G99 A;  4PBY A;  3PVU B;  5GMK n;  3C5M A;  1JMX B;  2B5N A;  3JB9 L;  1SQ9 A;  5AMS A;  3RLM D;  3V7D B;  4GZ8 A;  3U4Y A;  4PSW B;  2PM9 A;  2HYE A;  3AL8 B;  2I0S A;  2Z2O A;  4D0K A;  5JWZ A;  2IUP A;  2H6Q A;  4HDJ A;  4BUJ C;  3NVQ A;  2PM6 B;  5FKQ A;  3BG1 A;  1A0R B;  3BWS A;  5TEE A;  4GM8 A;  4PBZ A;  4GQB B;  3ZWL B;  4E54 B;  1U2V C;  3UR4 A;  4LG8 A;  3EI4 A;  4O9D A;  4N14 A;  2AGZ A;  1PBY B;  3W15 A;  4ERZ A;  5FQD A;  2J56 H;  2I0T A;  3SLE D;  3EU7 A;  3K27 A;  3ORV D;  4ERQ A;  4XEI C;  4CY1 A;  3CIK B;  2HKM A;  1U4C A;  3MZL A;  1RI6 A;  2B5M A;  5CXB B;  4CI8 A;  2YNN A;  3NVN A;  4GQ2 P;  5IT9 g;  2GC4 A;  1OLZ A;  2GC7 A;  5THA A;  3IJ1 A;  4J86 A;  4ES0 A;  4A0B A;  3FRX A;  2OVQ B;  3CFV A;  4CZY A;  2UZX B;  5EML B;  4A11 B;  4K3J B;  4O45 A;  3OKW A;  2XL3 A;  2CE8 A;  4EWR A;  1Q47 A;  1XIP A;  4J0W A;  1GXR A;  3UVL A;  1R5M A;  4FA4 D;  4AEZ A;  2OVR B;  5C9Z B;  3EI3 B;  3DM0 A;  5EAM A;  4AOW A;  4ZOV A;  3GFC A;  2EBS A;  3SMR A;  1B9Y A;  1MG3 A;  5HQG A;  4O3T B;  5TF2 A;  2H9P A;  2J57 G;  2H13 A;  3MMY A;  2AQ5 A;  5EMJ B;  2OVP B;  2OK6 A;  4X3E A;  4BL0 A;  3MKQ A;  3UVO A;  3RN0 D;  1JMZ B;  3UKR C;  3AFC A;  4J84 A;  4CI3 A;  4XYH A;  2P9S C;  4G56 B;  2I0R A;  1PGU A;  3DXM C;  3SBQ A;  4TZ4 A;  1SHY B;  2IUR A;  3PE7 A;  4FA5 D;  3EI2 B;  5EMK B;  3N0E A;  3MZK A;  4UI9 R;  1OMW B;  4ZOZ A;  2PM9 B;  3SFZ A;  4FHL A;  5TEF A;  2XU7 A;  3IJ0 A;  3I7H A;  3NVX A;  4H5I A;  3UVN A;  2XYI A;  3A0F A;  2H47 A;  4A2L A;  3L4M D;  4FA1 D;  1TBG A;  3AH8 B;  3RFG A;  4L1Q D;  4JT6 C;  2Q7Q A;  4L3H D;  4LGN A;  4E5Z A;  3F3P A;  5AJA A;  3EI4 B;  2YB8 B;  3PXW D;  4R7A B;  4J78 A;  2I3S A;  5FLX g;  3FM0 A;  4J8G A;  2AGL A;  5SXM A;  5CXC B;  3RMZ D;  2G9A A;  1L0Q A;  2HXC A;  2H68 A;  5I5J A;  2J55 H;  3SBP A;  4CI2 A;  4IMM A;  1PI6 A;  3VH0 A;  3EI1 B;  1K32 A;  2HJB A;  2HKR A;  4ERY A;  4MK0 B;  4A0B B;  4J79 A;  1N6D A;  3V5W B;  3KRX B;  4GMB A;  2IUQ A;  4Z8L A;  2H9L A;  4J87 A;  3EWE A;  2Z2N A;  4JSP C;  3J81 g;  1MG2 A;  5KDO B;  3I7O A;  4PNK B;  5IJ7 E;  1K8K C;  5I5I A;  2AH1 A;  2YNP A;  4YVD A;  5CYK A;  5HE1 B;  4JT5 C;  4OWR A;  2P9L C;  2Z2P A;  4JSX C;  5FKT A;  2IAA A;  2H9M A;  1XKS A;  1TYQ C;  3BG0 A;  4QRJ A;  4ZOX A;  4FA9 D;  3UKU C;  3OL2 A;  1NEX B;  4J8B A;  2UZY B;  2YMU A;  4A7J A;  1FWX A;  3MKS B;  3OKY A;  3FGB A;  2TRC B;  3JRP A;  3JZG A;  2B4E A;  2P9U C;  5EM2 A;  4A0A A;  3EG6 A;  4X63 B;  3RRM C;  5I5M A;  1S4U X;  3PVW B;  1N6F A;  2GNQ A;  3UVK A;  4CZV A;  3B7F A;  3OW8 A;  5HE2 B;  3L4O D;  4ZOY A;  4GM9 A;  3P4F A;  2AGW A;  2W18 A;  4X61 B;  3I8E A;  4A11 A;  2HJ4 A;  3OTT A;  4CZX A;  5C2W B;  3VA6 A;  3OKT A;  2QXV A;  3SHF A;  4I79 A;  4PXW A;  3SXT D;  5FKR A;  3MXX A;  4GM3 A;  3JPX A;  4D6V A;  4FAN D;  2I3T A;  3I7P A;  2YBA A;  3E0C A;  4GGD A;  2YNO A;  4Y5R D;  5K19 A;  3GRE A;  5EAL A;  3JZN A;  4O3U B;  3SJL D;  4FAV D;  4JSV C;  3K26 A;  4IA9 A;  2OK4 A;  5FXY A;  3UVM A;  5B4W A;  1MDA H;  1VYH C;  4GQ1 A;  4QQE A;  4LG9 A;  4JSN C;  5HYN B;  3V9F A;  2H6N A;  3I7N A;  4A09 A;  3CFS B;  4CY2 A;  3I89 A;  3SBR A;  4A2M A;  4A08 A;  5A2Q g;  2PM7 B;  3EI2 A;  4FB1 D;  5FKS A;  3F3G A;  4FWW A;  5C2V B;  3I8C A;  3DXK C;  4PC0 A;  3JRO A;  2IUV A;  1XHM A;  4CY5 A;  3PSC B;  3I7L A;  2P9N C;  5CYK B;  2CNX A;  4CY3 A;  3SWS D;  1YFQ A;  3SCY A;  4GGC A;  4NSX A;  5EAR A;  4K3I D;  5H1M A;  3F3F A;  3J80 g;  3IIY A;  2QC5 A;  5K1C C;  2HES X;  1N6E A;  2BBK H;  3AL8 A;  3OL2 B;  3C9C A;  3C75 H;  3I2N A;  3JZH A;  5HE0 B;  2P9K C;  3OKY B;  3ODT A;  4OZU A;  3HFQ A;  4U1E I;  5CXC A;  3IJC A;  3IIW A;  1PEV A;  4CC9 A;  5EM2 B;  4A0A B;  4E54 A;  4PSX B;  4QT8 A;  3EI1 A;  1P22 A;  2IWF A;  3PSL A;  4J81 A;  2IWK A;  5IC7 A;  2XL2 A;  3SN6 B;  3ULE C;  4U7A A;  3JAM g;  5IGQ A;  3VGZ A;  2CO0 C;  2H9N A;  2MTA H;  5AFU 3;  5GSA A;  4ESG A;  5CXB A;  1QNI A;  4L3G D;  2AGY A;  5IGO A;  4J73 A;  3SVW D;  3C99 A;  2AH0 A;  4CI1 A;  3RN1 D;  3RFH A;  5IJ8 E;  3PXT D;  2BCJ B;  1GG2 B;  2H3X A;  3N0D A;  3KRW B;  3DSM A;  3EMH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...