3NIDA

The closed headpiece of integrin alphaiib beta3 and its complex with an alpahiib beta3 -specific antagonist that does not induce opening
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
454
structure length
454
Chain Sequence
b'LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin alpha-IIb
molecule tags Cell adhesion/blood clotting
source organism Homo sapiens
publication title Closed headpiece of integrin {alpha}IIb{beta}3 and its complex with an {alpha}IIb{beta}3-specific antagonist that does not induce opening.
pubmed doi rcsb
total genus 110
structure length 454
sequence length 454
chains with identical sequence C
ec nomenclature
pdb deposition date 2010-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 3nidA00
2VDKA 2VDPA 4WK4A 3NIGA 3FCUA 3VI4A 2VDQA 3NIDA 2VDNA 1M1XA 1L5GA 5E6RA 4O02A 4NENA 4WK2A 3VI3A 3ZE2A 4MMXA 3FCSA 3K71A 4WK0A 3NIFA 4Z7QA 5HDBA 2VDOA 5FFGA 3K72A 2VDRA 3ZE0A 5FFOA 3ZE1A 3T3MA 4UM9A 4G1EA 2VDLA 4UM8A 3ZDZA 3T3PA 2VDMA 3V4VA 4G1MA 5E6UA 4MMYA 4WJKA 1U8CA 3ZDYA 4Z7NA 3ZDXA 5E6SA 2VC2A 4Z7OA 3IJEA 3V4PA 4IRZA 1TYEA 4MMZA 3K6SA 1JV2A
chains in the Genus database with same CATH superfamily
3VI4A 3MXXA 4AMYA 3AL8A 1M1XA 1GOTB 4G56B 1UOOA 1TBGA 4WK2A 4OWRA 5FXYA 3KCIA 5CYKB 4J86A 4NC4A 4E54A 5M5SA 1UOPA 2XL2A 5B4WA 4UM8A 5EMKB 3JAMg 3FRXA 4Z7OA 5IGQA 3J80g 4E5ZA 3F3GA 4TZ4A 2GC7A 4O3TB 3EI3A 2AQ5A 2VDPA 3MMYA 4J79A 3FCUA 4FAND 4ZOVA 4GGDA 2YNPA 4FA5D 2XYIA 1B9YA 5FQDA 4O2WA 3DM0A 3I7NA 2UZXB 2H9LA 4WK0A 3NVXA 5TEEA 2CE8A 4JSNC 4UM9A 3F3FA 2HESX 4J81A 1E8NA 2I0SA 4ZOXA 4DNUA 3PXWD 3SBRA 3JRPA 1NEXB 4ERZA 4PSWB 4CI8A 4QT8A 4BCBA 4PNKB 2VDKA 4A08A 3CFSB 2OIZA 3SWSD 3I89A 4BCDA 2HYEA 3QHYB 1Q47A 3DXKC 3O4GA 3I7PA 2VZ3A 4A11A 3OW8A 5GXHA 3ZE0A 2H9MA 4PBZA 4BH6A 4JD2C 2Z2NA 4AX4A 3I7LA 3ZDZA 3ZWLB 3RRMC 2OVPB 4J8BA 3EI4A 2WQ8A 4CI3A 2AGZA 3EI2A 4O1QD 3OKYB 4X60B 5M5TA 2BBKH 2H14A 4N14A 4QL1A 1FWXA 4Z8LA 1E8MA 3SFZA 3V9FA 4ERQA 5H1MA 3P4FA 1XKSA 4O9DA 2HJ4A 1P22A 4CY2A 2YNOA 4GQ2P 5EARA 3K71A 2CNXA 1K3IA 4K3JB 3MZKA 5FFOA 5EMMB 3NVNA 4G55A 3W15A 3IUQA 5CXBB 5FKTA 2EBSA 5C2WB 2OVRB 1R5MA 3FM0A 3IUMA 2EICA 4CI1A 2P9KC 3AH8B 2Z2OA 2XL3A 2VDNA 3EU7A 3N0DA 4XYHA 4O45A 3MZLA 3ODTA 2GC4A 3K27A 4PSXB 4A2LA 3GC3B 1N6FA 2OJYA 3PXTD 3BG1A 4JT6C 4YVDA 5EAMA 3UR4A 3VA6A 4FB1D 1H2WA 3PVWB 4OZUA 4PC0A 5M5UA 5CYKA 2HU7A 5GMKn 3IKOA 2P9UC 2BKLA 5I5JA 4CI2A 1JMZB 4GQBB 3VH0A 4BP9A 4CZVA 4NSXA 3UKUC 3IIYA 5TDHB 2HJBA 2P9LC 2J57G 4UI9R 2XE4A 3BWSA 1I2MB 1UTCA 3UVLA 4QRJA 1H2YA 2XDWA 5HE0B 3RN1D 4PXWA 1JTDB 2I0TA 3PXSD 4RE5A 3VGZA 5SXMA 4J77A 1S4UX 2B5LA 2HU8A 4GGAA 2VZ1A 2IUPA 1SQJA 3EWEA 1YFQA 3EI3B 1VE7A 2Z2PA 4GGCA 1T2XA 3EQ7A 4E5ZB 5M5RA 2PM6B 2AGWA 3SHFA 4JSVC 1C9IA 3JZNA 3ZDXA 4JXMA 4X61B 1TYQC 2AH0A 5K19A 5H17A 3GD1I 3BG0A 4J87A 2OVQB 4ZOYA 2H6KA 4LG8A 3AL8B 4D0KA 1OMWB 2HKMA 2H9PA 5AMSA 5HDBA 5TEFA 3ULEC 3SBQA 1E5TA 4L1MA 3SBPA 5IJ7E 2EIBA 4QAMA 4GMBA 4A7JA 5JWZA 4FWWA 1VE6A 4L3GD 1U8CA 2H9NA 2VC2A 4L1QD 3AL9A 5C92A 3KRWB 3I7HA 4X63B 3PE7A 3E0CA 4J73A 1OLZA 3IVMA 4A0BB 5I5MA 5FKSA 3MVDK 3OL2A 5I5IA 3RMZD 2IUQA 4X3EA 3NIDA 5K1CC 2CO0A 1N6EA 3GFCA 1GP2B 2H68A 2XZGA 3A0FA 3F3PA 4ERYA 4O02A 2B5MA 4K3ID 4CY1A 5HYNB 2PM9A 3U4YA 4D6VA 4BCCA 2YNNA 1QNIA 3DWLC 2IWFA 5GXIA 5M61A 1GOFA 1K32A 3UVMA 4ES0A 4GQ1A 4U1EI 1XIPA 3IJEA 1PI6A 1QFSA 2QXVA 4Y5RD 3RLMD 1SQ9A 4JHNA 5AJAA 2XU7A 3DSMA 3CFVA 3ORVD 4ZOZA 4IA9A 3DDUA 3SJLD 1A0RB 3UKRC 1H2XA 3VI3A 4KFMB 2HU5A 4DNWA 4J82A 3MKQA 4XYIA 3SN6B 2J55H 2CE9A 3IJ1A 2AGXA 4G1EA 5FA5B 3PSLA 2B5NA 2G99A 3IJCA 3QI0A 5AFU3 4G1MA 3I8EA 3OKTA 4WJKA 4A0AB 2EIDA 3SLED 3UVKA 1QFMA 3MUOA 5H14A 5C2VB 5GSAA 3FGBA 1N6DA 4MMZA 3J81g 1JV2A 4A09A 3L4OD 4AN1A 2AGLA 5EALA 5E6RA 1H2ZA 4CZXA 2VDOA 4JT5C 5CXCB 3JPXA 1MG2A 4NBMA 3IUJA 3ZE1A 4JSXC 4AMZA 2H6NA 4A0BA 3B7FA 4J78A 2CO0C 4FAVD 4Z7NA 2O9KA 2GNQA 4BL0A 2PBIB 4JSPC 4EWRA 2G9AA 4IMMA 3KRXB 3L4MD 1U2VC 1JOFA 4NENA 3ZE2A 4L9OA 2YB8B 2HXCA 2B4EA 5EM2B 1O6GA 3N0EA 4FA4D 1VZ2A 1VYHC 3IULA 3IJ0A 5EM2A 1SHYB 5HQGA 1JMXB 5KDOB 3EG6A 4MK0B 2MTAH 2P9PC 2AGYA 4L3HD 3NVQA 3V4PA 3RFHA 1GXRA 3I2NA 3K6SA 4H5IA 4HDJA 5THAA 5HE1B 3UVOA 4J84A 2J56H 2JKXA 3JZGA 1B9XA 4O3UB 5CXBA 4PBYA 3K26A 2UZYB 5EMLB 3O4IA 1C9LA 1PEVA 2CN3A 2VDMA 5E6UA 3ZDYA 5FLXg 5E6SA 2PM7B 2IWKA 4A09B 3RSEC 2OK4A 3OKYA 2BCJB 3NIGA 3PVUB 4H5JA 3EI2B 1YR2A 3PSCB 4BP8A 3RN0D 4U7AA 4GM9A 3EI4B 3I8CA 1RI6A 1GOGA 2TRCB 4J0XA 2OK6A 1MG3A 5FFGA 3V5WB 4A11B 3T3MA 4QQEA 4ZN4A 5C9ZB 4AEZA 1O6FA 1GG2B 3IIWA 4XEIC 4CC9A 2H13A 2I3SA 4CZYA 4A08B 3O4HA 5CXCA 4GZ8A 4WK4A 4FA1D 4BUJC 3GREA 3C75H 2VDQA 3MUNA 2YMUA 2W18A 2QZPA 4J0WA 2IURA 3C5MA 4LG9A 5C86A 3I7OA 2P9NC 2P9IC 4CY3A 3MKSB 2CN2A 2IAAA 4NAAA 3T3PA 3C9CA 2PM9B 1VZ3A 4A0AA 3EQ9A 5EAPA 5M5VA 1A12A 1ERJA 4LGNA 5IJ8E 3HFQA 4FHLA 4IRZA 3CIKB 2EIEA 3OL2B 5FKRA 2P9SC 1UOQA 5IC7A 3SCYA 4CY5A 2H3XA 1NR0A 4I79A 1L0QA 3UVNA 3RFGA 2H6QA 4GM3A 4MMXA 3FCSA 1K8KC 3NIFA 3SMRA 1GOHA 3SXTD 2VDRA 3K72A 3AFCA 3C99A 1XHMA 5A2Qg 3EQ8A 2VDLA 4GM8A 5HE2B 4DNVA 1JJUB 4RE6A 4JHPC 1BPOA 5EMJB 2IUVA 3OF7A 2YBAA 3V7DB 3JB9L 4R7AB 3JROA 2AH1A 3I7KA 5TF2A 4ESGA 1L5GA 5FKQA 3SVWD 1MDAH 3EI1B 5HE3B 2I0RA 4FA9D 5IGOA 4D9SA 1PGUA 3IUNA 3IURA 4AOWA 4Z7QA 5IT9g 2Q7QA 4A2MA 3OTTA 1PBYB 4J8GA 3V4VA 1U4CA 4MMYA 4AN0A 3EI1A 3O4JA 2H47A 3JZHA 2HKRA 2QC5A 3OKWA 4Y7RA 2I3TA 1TYEA 3EMHA 4E54B 3DXMC 2QR5A
chains in the Genus database with same CATH topology
2VDKA 2VDPA 4WK4A 3NIGA 3FCUA 3VI4A 2VDQA 3NIDA 2VDNA 1M1XA 1L5GA 5E6RA 4O02A 4NENA 4WK2A 3VI3A 3ZE2A 4MMXA 3FCSA 3K71A 4WK0A 3NIFA 4Z7QA 5HDBA 2VDOA 5FFGA 3K72A 2VDRA 3ZE0A 5FFOA 3ZE1A 3T3MA 4UM9A 4G1EA 2VDLA 4UM8A 3ZDZA 3T3PA 2VDMA 3V4VA 4G1MA 5E6UA 4MMYA 4WJKA 1U8CA 3ZDYA 4Z7NA 3ZDXA 5E6SA 2VC2A 4Z7OA 3IJEA 3V4PA 4IRZA 1TYEA 4MMZA 3K6SA 1JV2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VDK A;  2VDP A;  4WK4 A;  3NIG A;  3FCU A;  3VI4 A;  2VDQ A;  3NID A;  2VDN A;  1M1X A;  1L5G A;  5E6R A;  4O02 A;  4NEN A;  4WK2 A;  3VI3 A;  3ZE2 A;  4MMX A;  3FCS A;  3K71 A;  4WK0 A;  3NIF A;  4Z7Q A;  5HDB A;  2VDO A;  5FFG A;  3K72 A;  2VDR A;  3ZE0 A;  5FFO A;  3ZE1 A;  3T3M A;  4UM9 A;  4G1E A;  2VDL A;  4UM8 A;  3ZDZ A;  3T3P A;  2VDM A;  3V4V A;  4G1M A;  5E6U A;  4MMY A;  4WJK A;  1U8C A;  3ZDY A;  4Z7N A;  3ZDX A;  5E6S A;  2VC2 A;  4Z7O A;  3IJE A;  3V4P A;  4IRZ A;  1TYE A;  4MMZ A;  3K6S A;  1JV2 A; 
#chains in the Genus database with same CATH topology
 3VI4 A;  3MXX A;  4AMY A;  3AL8 A;  1M1X A;  1GOT B;  4G56 B;  1UOO A;  1TBG A;  4WK2 A;  4OWR A;  5FXY A;  3KCI A;  5CYK B;  4J86 A;  4NC4 A;  4E54 A;  5M5S A;  1UOP A;  2XL2 A;  5B4W A;  4UM8 A;  5EMK B;  3JAM g;  3FRX A;  4Z7O A;  5IGQ A;  3J80 g;  4E5Z A;  3F3G A;  4TZ4 A;  2GC7 A;  4O3T B;  3EI3 A;  2AQ5 A;  2VDP A;  3MMY A;  4J79 A;  3FCU A;  4FAN D;  4ZOV A;  4GGD A;  2YNP A;  4FA5 D;  2XYI A;  1B9Y A;  5FQD A;  4O2W A;  3DM0 A;  3I7N A;  2UZX B;  2H9L A;  4WK0 A;  3NVX A;  5TEE A;  2CE8 A;  4JSN C;  4UM9 A;  3F3F A;  2HES X;  4J81 A;  1E8N A;  2I0S A;  4ZOX A;  4DNU A;  3PXW D;  3SBR A;  3JRP A;  1NEX B;  4ERZ A;  4PSW B;  4CI8 A;  4QT8 A;  4BCB A;  4PNK B;  2VDK A;  4A08 A;  3CFS B;  2OIZ A;  3SWS D;  3I89 A;  4BCD A;  2HYE A;  3QHY B;  1Q47 A;  3DXK C;  3O4G A;  3I7P A;  2VZ3 A;  4A11 A;  3OW8 A;  5GXH A;  3ZE0 A;  2H9M A;  4PBZ A;  4BH6 A;  4JD2 C;  2Z2N A;  4AX4 A;  3I7L A;  3ZDZ A;  3ZWL B;  3RRM C;  2OVP B;  4J8B A;  3EI4 A;  2WQ8 A;  4CI3 A;  2AGZ A;  3EI2 A;  4O1Q D;  3OKY B;  4X60 B;  5M5T A;  2BBK H;  2H14 A;  4N14 A;  4QL1 A;  1FWX A;  4Z8L A;  1E8M A;  3SFZ A;  3V9F A;  4ERQ A;  5H1M A;  3P4F A;  1XKS A;  4O9D A;  2HJ4 A;  1P22 A;  4CY2 A;  2YNO A;  4GQ2 P;  5EAR A;  3K71 A;  2CNX A;  1K3I A;  4K3J B;  3MZK A;  5FFO A;  5EMM B;  3NVN A;  4G55 A;  3W15 A;  3IUQ A;  5CXB B;  5FKT A;  2EBS A;  5C2W B;  2OVR B;  1R5M A;  3FM0 A;  3IUM A;  2EIC A;  4CI1 A;  2P9K C;  3AH8 B;  2Z2O A;  2XL3 A;  2VDN A;  3EU7 A;  3N0D A;  4XYH A;  4O45 A;  3MZL A;  3ODT A;  2GC4 A;  3K27 A;  4PSX B;  4A2L A;  3GC3 B;  1N6F A;  2OJY A;  3PXT D;  3BG1 A;  4JT6 C;  4YVD A;  5EAM A;  3UR4 A;  3VA6 A;  4FB1 D;  1H2W A;  3PVW B;  4OZU A;  4PC0 A;  5M5U A;  5CYK A;  2HU7 A;  5GMK n;  3IKO A;  2P9U C;  2BKL A;  5I5J A;  4CI2 A;  1JMZ B;  4GQB B;  3VH0 A;  4BP9 A;  4CZV A;  4NSX A;  3UKU C;  3IIY A;  5TDH B;  2HJB A;  2P9L C;  2J57 G;  4UI9 R;  2XE4 A;  3BWS A;  1I2M B;  1UTC A;  3UVL A;  4QRJ A;  1H2Y A;  2XDW A;  5HE0 B;  3RN1 D;  4PXW A;  1JTD B;  2I0T A;  3PXS D;  4RE5 A;  3VGZ A;  5SXM A;  4J77 A;  1S4U X;  2B5L A;  2HU8 A;  4GGA A;  2VZ1 A;  2IUP A;  1SQJ A;  3EWE A;  1YFQ A;  3EI3 B;  1VE7 A;  2Z2P A;  4GGC A;  1T2X A;  3EQ7 A;  4E5Z B;  5M5R A;  2PM6 B;  2AGW A;  3SHF A;  4JSV C;  1C9I A;  3JZN A;  3ZDX A;  4JXM A;  4X61 B;  1TYQ C;  2AH0 A;  5K19 A;  5H17 A;  3GD1 I;  3BG0 A;  4J87 A;  2OVQ B;  4ZOY A;  2H6K A;  4LG8 A;  3AL8 B;  4D0K A;  1OMW B;  2HKM A;  2H9P A;  5AMS A;  5HDB A;  5TEF A;  3ULE C;  3SBQ A;  1E5T A;  4L1M A;  3SBP A;  5IJ7 E;  2EIB A;  4QAM A;  4GMB A;  4A7J A;  5JWZ A;  4FWW A;  1VE6 A;  4L3G D;  1U8C A;  2H9N A;  2VC2 A;  4L1Q D;  3AL9 A;  5C92 A;  3KRW B;  3I7H A;  4X63 B;  3PE7 A;  3E0C A;  4J73 A;  1OLZ A;  3IVM A;  4A0B B;  5I5M A;  5FKS A;  3MVD K;  3OL2 A;  5I5I A;  3RMZ D;  2IUQ A;  4X3E A;  3NID A;  5K1C C;  2CO0 A;  1N6E A;  3GFC A;  1GP2 B;  2H68 A;  2XZG A;  3A0F A;  3F3P A;  4ERY A;  4O02 A;  2B5M A;  4K3I D;  4CY1 A;  5HYN B;  2PM9 A;  3U4Y A;  4D6V A;  4BCC A;  2YNN A;  1QNI A;  3DWL C;  2IWF A;  5GXI A;  5M61 A;  1GOF A;  1K32 A;  3UVM A;  4ES0 A;  4GQ1 A;  4U1E I;  1XIP A;  3IJE A;  1PI6 A;  1QFS A;  2QXV A;  4Y5R D;  3RLM D;  1SQ9 A;  4JHN A;  5AJA A;  2XU7 A;  3DSM A;  3CFV A;  3ORV D;  4ZOZ A;  4IA9 A;  3DDU A;  3SJL D;  1A0R B;  3UKR C;  1H2X A;  3VI3 A;  4KFM B;  2HU5 A;  4DNW A;  4J82 A;  3MKQ A;  4XYI A;  3SN6 B;  2J55 H;  2CE9 A;  3IJ1 A;  2AGX A;  4G1E A;  5FA5 B;  3PSL A;  2B5N A;  2G99 A;  3IJC A;  3QI0 A;  5AFU 3;  4G1M A;  3I8E A;  3OKT A;  4WJK A;  4A0A B;  2EID A;  3SLE D;  3UVK A;  1QFM A;  3MUO A;  5H14 A;  5C2V B;  5GSA A;  3FGB A;  1N6D A;  4MMZ A;  3J81 g;  1JV2 A;  4A09 A;  3L4O D;  4AN1 A;  2AGL A;  5EAL A;  5E6R A;  1H2Z A;  4CZX A;  2VDO A;  4JT5 C;  5CXC B;  3JPX A;  1MG2 A;  4NBM A;  3IUJ A;  3ZE1 A;  4JSX C;  4AMZ A;  2H6N A;  4A0B A;  3B7F A;  4J78 A;  2CO0 C;  4FAV D;  4Z7N A;  2O9K A;  2GNQ A;  4BL0 A;  2PBI B;  4JSP C;  4EWR A;  2G9A A;  4IMM A;  3KRX B;  3L4M D;  1U2V C;  1JOF A;  4NEN A;  3ZE2 A;  4L9O A;  2YB8 B;  2HXC A;  2B4E A;  5EM2 B;  1O6G A;  3N0E A;  4FA4 D;  1VZ2 A;  1VYH C;  3IUL A;  3IJ0 A;  5EM2 A;  1SHY B;  5HQG A;  1JMX B;  5KDO B;  3EG6 A;  4MK0 B;  2MTA H;  2P9P C;  2AGY A;  4L3H D;  3NVQ A;  3V4P A;  3RFH A;  1GXR A;  3I2N A;  3K6S A;  4H5I A;  4HDJ A;  5THA A;  5HE1 B;  3UVO A;  4J84 A;  2J56 H;  2JKX A;  3JZG A;  1B9X A;  4O3U B;  5CXB A;  4PBY A;  3K26 A;  2UZY B;  5EML B;  3O4I A;  1C9L A;  1PEV A;  2CN3 A;  2VDM A;  5E6U A;  3ZDY A;  5FLX g;  5E6S A;  2PM7 B;  2IWK A;  4A09 B;  3RSE C;  2OK4 A;  3OKY A;  2BCJ B;  3NIG A;  3PVU B;  4H5J A;  3EI2 B;  1YR2 A;  3PSC B;  4BP8 A;  3RN0 D;  4U7A A;  4GM9 A;  3EI4 B;  3I8C A;  1RI6 A;  1GOG A;  2TRC B;  4J0X A;  2OK6 A;  1MG3 A;  5FFG A;  3V5W B;  4A11 B;  3T3M A;  4QQE A;  4ZN4 A;  5C9Z B;  4AEZ A;  1O6F A;  1GG2 B;  3IIW A;  4XEI C;  4CC9 A;  2H13 A;  2I3S A;  4CZY A;  4A08 B;  3O4H A;  5CXC A;  4GZ8 A;  4WK4 A;  4FA1 D;  4BUJ C;  3GRE A;  3C75 H;  2VDQ A;  3MUN A;  2YMU A;  2W18 A;  2QZP A;  4J0W A;  2IUR A;  3C5M A;  4LG9 A;  5C86 A;  3I7O A;  2P9N C;  2P9I C;  4CY3 A;  3MKS B;  2CN2 A;  2IAA A;  4NAA A;  3T3P A;  3C9C A;  2PM9 B;  1VZ3 A;  4A0A A;  3EQ9 A;  5EAP A;  5M5V A;  1A12 A;  1ERJ A;  4LGN A;  5IJ8 E;  3HFQ A;  4FHL A;  4IRZ A;  3CIK B;  2EIE A;  3OL2 B;  5FKR A;  2P9S C;  1UOQ A;  5IC7 A;  3SCY A;  4CY5 A;  2H3X A;  1NR0 A;  4I79 A;  1L0Q A;  3UVN A;  3RFG A;  2H6Q A;  4GM3 A;  4MMX A;  3FCS A;  1K8K C;  3NIF A;  3SMR A;  1GOH A;  3SXT D;  2VDR A;  3K72 A;  3AFC A;  3C99 A;  1XHM A;  5A2Q g;  3EQ8 A;  2VDL A;  4GM8 A;  5HE2 B;  4DNV A;  1JJU B;  4RE6 A;  4JHP C;  1BPO A;  5EMJ B;  2IUV A;  3OF7 A;  2YBA A;  3V7D B;  3JB9 L;  4R7A B;  3JRO A;  2AH1 A;  3I7K A;  5TF2 A;  4ESG A;  1L5G A;  5FKQ A;  3SVW D;  1MDA H;  3EI1 B;  5HE3 B;  2I0R A;  4FA9 D;  5IGO A;  4D9S A;  1PGU A;  3IUN A;  3IUR A;  4AOW A;  4Z7Q A;  5IT9 g;  2Q7Q A;  4A2M A;  3OTT A;  1PBY B;  4J8G A;  3V4V A;  1U4C A;  4MMY A;  4AN0 A;  3EI1 A;  3O4J A;  2H47 A;  3JZH A;  2HKR A;  2QC5 A;  3OKW A;  4Y7R A;  2I3T A;  1TYE A;  3EMH A;  4E54 B;  3DXM C;  2QR5 A; 
#chains in the Genus database with same CATH homology
 2VDK A;  2VDP A;  4WK4 A;  3NIG A;  3FCU A;  3VI4 A;  2VDQ A;  3NID A;  2VDN A;  1M1X A;  1L5G A;  5E6R A;  4O02 A;  4NEN A;  4WK2 A;  3VI3 A;  3ZE2 A;  4MMX A;  3FCS A;  3K71 A;  4WK0 A;  3NIF A;  4Z7Q A;  5HDB A;  2VDO A;  5FFG A;  3K72 A;  2VDR A;  3ZE0 A;  5FFO A;  3ZE1 A;  3T3M A;  4UM9 A;  4G1E A;  2VDL A;  4UM8 A;  3ZDZ A;  3T3P A;  2VDM A;  3V4V A;  4G1M A;  5E6U A;  4MMY A;  4WJK A;  1U8C A;  3ZDY A;  4Z7N A;  3ZDX A;  5E6S A;  2VC2 A;  4Z7O A;  3IJE A;  3V4P A;  4IRZ A;  1TYE A;  4MMZ A;  3K6S A;  1JV2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...