3NIDA

The closed headpiece of integrin alphaiib beta3 and its complex with an alpahiib beta3 -specific antagonist that does not induce opening
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
454
structure length
454
Chain Sequence
LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Closed headpiece of integrin {alpha}IIb{beta}3 and its complex with an {alpha}IIb{beta}3-specific antagonist that does not induce opening.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/blood clotting
molecule keywords Integrin alpha-IIb
total genus 110
structure length 454
sequence length 454
chains with identical sequence C
ec nomenclature
pdb deposition date 2010-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 3nidA00
5FFGA 3NIGA 4G1MA 3V4PA 2VDKA 3T3PA 3K71A 5E6RA 4MMYA 3ZDXA 2VDRA 2VDNA 4UM8A 5E6SA 3ZE2A 3ZE1A 3NIFA 3IJEA 5FFOA 3ZDYA 3K72A 3ZDZA 4MMZA 4Z7QA 4NENA 4MMXA 3FCUA 4UM9A 4Z7NA 4G1EA 3NIDA 1TYEA 2VDPA 4Z7OA 1JV2A 1L5GA 2VDQA 4IRZA 3K6SA 4WK0A 3V4VA 2VC2A 2VDMA 1M1XA 3T3MA 5HDBA 4WJKA 3VI4A 3VI3A 4WK4A 2VDOA 4WK2A 4O02A 5E6UA 3ZE0A 3FCSA 1U8CA 2VDLA
chains in the Genus database with same CATH superfamily
4IA9A 3SJLD 4OWRA 1A0RB 3DXKC 1K32A 5FKTA 4CZXA 2AGWA 1QFMA 3F3FA 4AMZA 4ESGA 2XL2A 4OZUA 1B9XA 4JHPC 2VDPA 3J80g 1VYHC 4J77A 4CC9A 4A0BA 4GMBA 3VI3A 2UZXB 3C5MA 5TF2A 3I8EA 3MZLA 1VE7A 3NVQA 3SXTD 4J0WA 4A2LA 2VZ3A 2EBSA 3IKOA 4E54A 3EQ8A 5FFOA 2HXCA 2Z2NA 4RE6A 4AEZA 2HKRA 3IIYA 3NVXA 4ZOZA 3RLMD 2VDMA 4DNVA 4FA9D 3RFGA 3IVMA 3U4YA 2IUQA 2YBAA 4QT8A 2H9LA 3SHFA 3PVUB 2PBIB 3AL9A 3C99A 4YVDA 3V4PA 1MG2A 4PC0A 3JROA 1GOGA 3IULA 3O4GA 2HYEA 4A0AA 3SCYA 5EM2B 3PXWD 4AN0A 2P9LC 5E6SA 2MTAH 2CO0A 3V5WB 3NIFA 3I7LA 2OVPB 1QNIA 4L9OA 4MMZA 4JD2C 3DDUA 3RSEC 4MMXA 3QI0A 2VZ1A 3W15A 3RN1D 4BCBA 1GOTB 3I8CA 5THAA 2OK4A 1B9YA 3IJCA 5M61A 3CFSB 4CZYA 3AH8B 1PEVA 4L1MA 4A09B 2AH0A 2HU8A 3VI4A 4CI2A 2I3TA 1K3IA 5H17A 4O02A 3SBQA 4EWRA 3MKQA 2XDWA 2I3SA 4L3HD 3EI3B 3EWEA 4NSXA 4FA4D 4A11A 1XHMA 4GM3A 3FRXA 4J78A 2VDNA 4JT6C 3L4OD 4O9DA 5IJ8E 2JKXA 2OK6A 2YB8B 5H14A 5EMMB 1YR2A 4D0KA 1U4CA 1JMXB 3NIDA 2EIBA 3JZHA 5AFU3 5AJAA 3MUOA 4NC4A 3SFZA 2HU7A 4PXWA 4WJKA 4WK4A 3ZE0A 3AFCA 3C9CA 4RE5A 3EI2B 3OW8A 4XYIA 3IURA 2VDKA 1UOOA 3O4HA 5AMSA 4CY1A 1JTDB 3DM0A 1L0QA 2B5NA 2AGYA 4J82A 1OMWB 1GOFA 4Z7QA 4J8GA 4AMYA 1GG2B 2B5LA 3SVWD 2Q7QA 4J0XA 2OVRB 5M5SA 3OKYB 3F3GA 4H5JA 4BP9A 3J81g 3SN6B 1UTCA 2VDOA 3VGZA 3PXTD 4CY3A 1U8CA 5FFGA 1E8MA 2GC4A 3IJ1A 3OTTA 3AL8B 4CI8A 2HU5A 2IAAA 4E54B 2XYIA 4UM8A 2PM6B 3ZWLB 2PM9B 3OKYA 4Z7NA 3P4FA 1VZ3A 2YNNA 2W18A 3VA6A 1UOQA 2AGLA 4A11B 2O9KA 2IURA 4GQBB 3IUJA 4NBMA 5HDBA 4DNWA 2CO0C 4CZVA 1FWXA 2HJ4A 2GC7A 1E5TA 3NIGA 3EI1A 3I2NA 4O3TB 2QC5A 4J73A 4GM9A 5A2Qg 5I5JA 1K8KC 3ZDXA 3BG1A 3O4JA 4L3GD 1VE6A 2I0SA 3UR4A 4JXMA 2HJBA 1TYQC 2AH1A 5SXMA 3OL2B 5CXCB 4LG8A 4AX4A 4NAAA 2IUPA 2EIDA 2UZYB 3EI4A 3SBPA 4FA5D 2H13A 2CNXA 1C9LA 1VZ2A 1O6GA 1C9IA 3EI1B 2CN2A 3JZNA 3MKSB 4BL0A 3T3PA 3GFCA 3ODTA 4PNKB 4I79A 5HYNB 1U2VC 4ZOXA 3SBRA 4PSXB 3RN0D 2BKLA 2H47A 2Z2PA 1JJUB 2XL3A 5IGOA 4ERYA 4Z7OA 4O45A 4FWWA 3V4VA 4JSPC 4GZ8A 3MUNA 4FA1D 2J57G 5HE1B 3I7HA 5HE3B 2IWFA 5CYKB 3RMZD 3ULEC 1MDAH 3N0DA 4UI9R 2IWKA 4G56B 1GXRA 5HQGA 3ZDYA 4CY2A 2H68A 2EIEA 2QXVA 4TZ4A 2J56H 4CI3A 3BWSA 1GOHA 5TEEA 5FQDA 3UVMA 3I7NA 4BH6A 1L5GA 3FGBA 3EI4B 3K6SA 3E0CA 2P9IC 4Y7RA 4XEIC 2HKMA 1PBYB 3FM0A 2XZGA 1SQJA 3OL2A 3T3MA 5IJ7E 3EQ9A 2B5MA 4WK2A 4KFMB 4O1QD 1N6FA 4J81A 3N0EA 4U7AA 2TRCB 1TBGA 4QRJA 2H6KA 5TDHB 4K3ID 3IUQA 5E6RA 2G99A 2GNQA 4FB1D 5CXBB 5GXHA 3B7FA 1NEXB 3OKTA 4J86A 3ZE2A 4A0BB 4JSXC 1JMZB 3ZDZA 4CI1A 4K3JB 2P9UC 4NENA 2AGXA 1QFSA 1JOFA 2OJYA 5JWZA 4E5ZB 2J55H 4GQ2P 1YFQA 3GC3B 4HDJA 4QAMA 2CE8A 4A09A 2BBKH 3IUMA 5HE0B 1T2XA 4LGNA 2QR5A 1S4UX 3MXXA 4J8BA 2YMUA 4DNUA 1UOPA 4GGAA 5FKSA 4R7AB 1ERJA 3JPXA 4QL1A 3K71A 4A08B 4MMYA 1N6DA 5C2WB 2VDRA 3IJEA 5GMKn 5C9ZB 3ORVD 5B4WA 2I0RA 4BUJC 3DXMC 3KRXB 2P9PC 4JSVC 5FKRA 5FLXg 2QZPA 2I0TA 5IC7A 4J84A 5CYKA 2PM9A 2VC2A 1PGUA 1O6FA 4J87A 4XYHA 5IT9g 1H2ZA 5EMJB 5H1MA 5EARA 3C75H 5TEFA 5FA5B 3PVWB 5M5UA 2WQ8A 4A08A 4X63B 2Z2OA 4LG9A 4CY5A 1N6EA 3EI2A 3ZE1A 1A12A 2H6NA 5GXIA 2YNPA 5C2VB 4PSWB 3UKUC 3A0FA 3FCUA 4ERZA 3EMHA 3CFVA 3L4MD 4QQEA 4L1QD 5EAPA 4PBZA 5C92A 3RRMC 4IMMA 5C86A 3GREA 3V7DB 3IJ0A 2EICA 3PXSD 5K19A 1RI6A 3PSCB 5M5TA 3EG6A 3AL8A 4X60B 5FKQA 1GP2B 2OIZA 3EI3A 3DWLC 4ZOYA 4GGDA 2BCJB 3SWSD 4JHNA 3EQ7A 3UKRC 3UVLA 1TYEA 3EU7A 2HESX 2XU7A 5EM2A 4A7JA 4A0AB 3HFQA 5FXYA 1M1XA 4GM8A 1H2WA 2AQ5A 4JT5C 3SLED 5E6UA 5M5VA 3FCSA 3QHYB 3PSLA 3SMRA 2IUVA 3I7KA 5EALA 3F3PA 4ERQA 1Q47A 2H14A 4AOWA 4MK0B 5CXBA 4GGCA 5GSAA 1NR0A 5K1CC 2PM7B 3MVDK 2H3XA 1BPOA 5M5RA 4Y5RD 3I7PA 4A2MA 4BCDA 1PI6A 4FAVD 1XIPA 4WK0A 4D9SA 2CN3A 1E8NA 3K26A 5EAMA 2P9KC 4ZN4A 2VDLA 3GD1I 4G1MA 5HE2B 4G55A 1OLZA 4ZOVA 1H2XA 3IUNA 2OVQB 3OKWA 2CE9A 3UVKA 2XE4A 4JSNC 2H9NA 4Z8LA 3K72A 3CIKB 2H9PA 3I7OA 3V9FA 4UM9A 4O3UB 4X61B 1SHYB 4BP8A 3IIWA 3KCIA 4N14A 4O2WA 2AGZA 2G9AA 3JZGA 3PE7A 1SQ9A 3I89A 1P22A 3O4IA 3MMYA 4GQ1A 1R5MA 3RFHA 1H2YA 1XKSA 3JRPA 4X3EA 2YNOA 3OF7A 3JB9L 4H5IA 4D6VA 5I5MA 4U1EI 4J79A 4AN1A 3UVOA 4E5ZA 5EMKB 1I2MB 2B4EA 4FHLA 2P9SC 3DSMA 3UVNA 5KDOB 4FAND 3VH0A 3NVNA 4G1EA 3BG0A 5I5IA 5CXCA 1JV2A 4IRZA 2VDQA 2H6QA 1MG3A 3K27A 5IGQA 3KRWB 4ES0A 4PBYA 2H9MA 5EMLB 4BCCA 3MZKA 2P9NC 3JAMg
chains in the Genus database with same CATH topology
5FFGA 3NIGA 4G1MA 3V4PA 2VDKA 3T3PA 3K71A 5E6RA 4MMYA 3ZDXA 2VDRA 2VDNA 4UM8A 5E6SA 3ZE2A 3ZE1A 3NIFA 3IJEA 5FFOA 3ZDYA 3K72A 3ZDZA 4MMZA 4Z7QA 4NENA 4MMXA 3FCUA 4UM9A 4Z7NA 4G1EA 3NIDA 1TYEA 2VDPA 4Z7OA 1JV2A 1L5GA 2VDQA 4IRZA 3K6SA 4WK0A 3V4VA 2VC2A 2VDMA 1M1XA 3T3MA 5HDBA 4WJKA 3VI4A 3VI3A 4WK4A 2VDOA 4WK2A 4O02A 5E6UA 3ZE0A 3FCSA 1U8CA 2VDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FFG A;  3NIG A;  4G1M A;  3V4P A;  2VDK A;  3T3P A;  3K71 A;  5E6R A;  4MMY A;  3ZDX A;  2VDR A;  2VDN A;  4UM8 A;  5E6S A;  3ZE2 A;  3ZE1 A;  3NIF A;  3IJE A;  5FFO A;  3ZDY A;  3K72 A;  3ZDZ A;  4MMZ A;  4Z7Q A;  4NEN A;  4MMX A;  3FCU A;  4UM9 A;  4Z7N A;  4G1E A;  3NID A;  1TYE A;  2VDP A;  4Z7O A;  1JV2 A;  1L5G A;  2VDQ A;  4IRZ A;  3K6S A;  4WK0 A;  3V4V A;  2VC2 A;  2VDM A;  1M1X A;  3T3M A;  5HDB A;  4WJK A;  3VI4 A;  3VI3 A;  4WK4 A;  2VDO A;  4WK2 A;  4O02 A;  5E6U A;  3ZE0 A;  3FCS A;  1U8C A;  2VDL A; 
#chains in the Genus database with same CATH topology
 4IA9 A;  3SJL D;  4OWR A;  1A0R B;  3DXK C;  1K32 A;  5FKT A;  4CZX A;  2AGW A;  1QFM A;  3F3F A;  4AMZ A;  4ESG A;  2XL2 A;  4OZU A;  1B9X A;  4JHP C;  2VDP A;  3J80 g;  1VYH C;  4J77 A;  4CC9 A;  4A0B A;  4GMB A;  3VI3 A;  2UZX B;  3C5M A;  5TF2 A;  3I8E A;  3MZL A;  1VE7 A;  3NVQ A;  3SXT D;  4J0W A;  4A2L A;  2VZ3 A;  2EBS A;  3IKO A;  4E54 A;  3EQ8 A;  5FFO A;  2HXC A;  2Z2N A;  4RE6 A;  4AEZ A;  2HKR A;  3IIY A;  3NVX A;  4ZOZ A;  3RLM D;  2VDM A;  4DNV A;  4FA9 D;  3RFG A;  3IVM A;  3U4Y A;  2IUQ A;  2YBA A;  4QT8 A;  2H9L A;  3SHF A;  3PVU B;  2PBI B;  3AL9 A;  3C99 A;  4YVD A;  3V4P A;  1MG2 A;  4PC0 A;  3JRO A;  1GOG A;  3IUL A;  3O4G A;  2HYE A;  4A0A A;  3SCY A;  5EM2 B;  3PXW D;  4AN0 A;  2P9L C;  5E6S A;  2MTA H;  2CO0 A;  3V5W B;  3NIF A;  3I7L A;  2OVP B;  1QNI A;  4L9O A;  4MMZ A;  4JD2 C;  3DDU A;  3RSE C;  4MMX A;  3QI0 A;  2VZ1 A;  3W15 A;  3RN1 D;  4BCB A;  1GOT B;  3I8C A;  5THA A;  2OK4 A;  1B9Y A;  3IJC A;  5M61 A;  3CFS B;  4CZY A;  3AH8 B;  1PEV A;  4L1M A;  4A09 B;  2AH0 A;  2HU8 A;  3VI4 A;  4CI2 A;  2I3T A;  1K3I A;  5H17 A;  4O02 A;  3SBQ A;  4EWR A;  3MKQ A;  2XDW A;  2I3S A;  4L3H D;  3EI3 B;  3EWE A;  4NSX A;  4FA4 D;  4A11 A;  1XHM A;  4GM3 A;  3FRX A;  4J78 A;  2VDN A;  4JT6 C;  3L4O D;  4O9D A;  5IJ8 E;  2JKX A;  2OK6 A;  2YB8 B;  5H14 A;  5EMM B;  1YR2 A;  4D0K A;  1U4C A;  1JMX B;  3NID A;  2EIB A;  3JZH A;  5AFU 3;  5AJA A;  3MUO A;  4NC4 A;  3SFZ A;  2HU7 A;  4PXW A;  4WJK A;  4WK4 A;  3ZE0 A;  3AFC A;  3C9C A;  4RE5 A;  3EI2 B;  3OW8 A;  4XYI A;  3IUR A;  2VDK A;  1UOO A;  3O4H A;  5AMS A;  4CY1 A;  1JTD B;  3DM0 A;  1L0Q A;  2B5N A;  2AGY A;  4J82 A;  1OMW B;  1GOF A;  4Z7Q A;  4J8G A;  4AMY A;  1GG2 B;  2B5L A;  3SVW D;  2Q7Q A;  4J0X A;  2OVR B;  5M5S A;  3OKY B;  3F3G A;  4H5J A;  4BP9 A;  3J81 g;  3SN6 B;  1UTC A;  2VDO A;  3VGZ A;  3PXT D;  4CY3 A;  1U8C A;  5FFG A;  1E8M A;  2GC4 A;  3IJ1 A;  3OTT A;  3AL8 B;  4CI8 A;  2HU5 A;  2IAA A;  4E54 B;  2XYI A;  4UM8 A;  2PM6 B;  3ZWL B;  2PM9 B;  3OKY A;  4Z7N A;  3P4F A;  1VZ3 A;  2YNN A;  2W18 A;  3VA6 A;  1UOQ A;  2AGL A;  4A11 B;  2O9K A;  2IUR A;  4GQB B;  3IUJ A;  4NBM A;  5HDB A;  4DNW A;  2CO0 C;  4CZV A;  1FWX A;  2HJ4 A;  2GC7 A;  1E5T A;  3NIG A;  3EI1 A;  3I2N A;  4O3T B;  2QC5 A;  4J73 A;  4GM9 A;  5A2Q g;  5I5J A;  1K8K C;  3ZDX A;  3BG1 A;  3O4J A;  4L3G D;  1VE6 A;  2I0S A;  3UR4 A;  4JXM A;  2HJB A;  1TYQ C;  2AH1 A;  5SXM A;  3OL2 B;  5CXC B;  4LG8 A;  4AX4 A;  4NAA A;  2IUP A;  2EID A;  2UZY B;  3EI4 A;  3SBP A;  4FA5 D;  2H13 A;  2CNX A;  1C9L A;  1VZ2 A;  1O6G A;  1C9I A;  3EI1 B;  2CN2 A;  3JZN A;  3MKS B;  4BL0 A;  3T3P A;  3GFC A;  3ODT A;  4PNK B;  4I79 A;  5HYN B;  1U2V C;  4ZOX A;  3SBR A;  4PSX B;  3RN0 D;  2BKL A;  2H47 A;  2Z2P A;  1JJU B;  2XL3 A;  5IGO A;  4ERY A;  4Z7O A;  4O45 A;  4FWW A;  3V4V A;  4JSP C;  4GZ8 A;  3MUN A;  4FA1 D;  2J57 G;  5HE1 B;  3I7H A;  5HE3 B;  2IWF A;  5CYK B;  3RMZ D;  3ULE C;  1MDA H;  3N0D A;  4UI9 R;  2IWK A;  4G56 B;  1GXR A;  5HQG A;  3ZDY A;  4CY2 A;  2H68 A;  2EIE A;  2QXV A;  4TZ4 A;  2J56 H;  4CI3 A;  3BWS A;  1GOH A;  5TEE A;  5FQD A;  3UVM A;  3I7N A;  4BH6 A;  1L5G A;  3FGB A;  3EI4 B;  3K6S A;  3E0C A;  2P9I C;  4Y7R A;  4XEI C;  2HKM A;  1PBY B;  3FM0 A;  2XZG A;  1SQJ A;  3OL2 A;  3T3M A;  5IJ7 E;  3EQ9 A;  2B5M A;  4WK2 A;  4KFM B;  4O1Q D;  1N6F A;  4J81 A;  3N0E A;  4U7A A;  2TRC B;  1TBG A;  4QRJ A;  2H6K A;  5TDH B;  4K3I D;  3IUQ A;  5E6R A;  2G99 A;  2GNQ A;  4FB1 D;  5CXB B;  5GXH A;  3B7F A;  1NEX B;  3OKT A;  4J86 A;  3ZE2 A;  4A0B B;  4JSX C;  1JMZ B;  3ZDZ A;  4CI1 A;  4K3J B;  2P9U C;  4NEN A;  2AGX A;  1QFS A;  1JOF A;  2OJY A;  5JWZ A;  4E5Z B;  2J55 H;  4GQ2 P;  1YFQ A;  3GC3 B;  4HDJ A;  4QAM A;  2CE8 A;  4A09 A;  2BBK H;  3IUM A;  5HE0 B;  1T2X A;  4LGN A;  2QR5 A;  1S4U X;  3MXX A;  4J8B A;  2YMU A;  4DNU A;  1UOP A;  4GGA A;  5FKS A;  4R7A B;  1ERJ A;  3JPX A;  4QL1 A;  3K71 A;  4A08 B;  4MMY A;  1N6D A;  5C2W B;  2VDR A;  3IJE A;  5GMK n;  5C9Z B;  3ORV D;  5B4W A;  2I0R A;  4BUJ C;  3DXM C;  3KRX B;  2P9P C;  4JSV C;  5FKR A;  5FLX g;  2QZP A;  2I0T A;  5IC7 A;  4J84 A;  5CYK A;  2PM9 A;  2VC2 A;  1PGU A;  1O6F A;  4J87 A;  4XYH A;  5IT9 g;  1H2Z A;  5EMJ B;  5H1M A;  5EAR A;  3C75 H;  5TEF A;  5FA5 B;  3PVW B;  5M5U A;  2WQ8 A;  4A08 A;  4X63 B;  2Z2O A;  4LG9 A;  4CY5 A;  1N6E A;  3EI2 A;  3ZE1 A;  1A12 A;  2H6N A;  5GXI A;  2YNP A;  5C2V B;  4PSW B;  3UKU C;  3A0F A;  3FCU A;  4ERZ A;  3EMH A;  3CFV A;  3L4M D;  4QQE A;  4L1Q D;  5EAP A;  4PBZ A;  5C92 A;  3RRM C;  4IMM A;  5C86 A;  3GRE A;  3V7D B;  3IJ0 A;  2EIC A;  3PXS D;  5K19 A;  1RI6 A;  3PSC B;  5M5T A;  3EG6 A;  3AL8 A;  4X60 B;  5FKQ A;  1GP2 B;  2OIZ A;  3EI3 A;  3DWL C;  4ZOY A;  4GGD A;  2BCJ B;  3SWS D;  4JHN A;  3EQ7 A;  3UKR C;  3UVL A;  1TYE A;  3EU7 A;  2HES X;  2XU7 A;  5EM2 A;  4A7J A;  4A0A B;  3HFQ A;  5FXY A;  1M1X A;  4GM8 A;  1H2W A;  2AQ5 A;  4JT5 C;  3SLE D;  5E6U A;  5M5V A;  3FCS A;  3QHY B;  3PSL A;  3SMR A;  2IUV A;  3I7K A;  5EAL A;  3F3P A;  4ERQ A;  1Q47 A;  2H14 A;  4AOW A;  4MK0 B;  5CXB A;  4GGC A;  5GSA A;  1NR0 A;  5K1C C;  2PM7 B;  3MVD K;  2H3X A;  1BPO A;  5M5R A;  4Y5R D;  3I7P A;  4A2M A;  4BCD A;  1PI6 A;  4FAV D;  1XIP A;  4WK0 A;  4D9S A;  2CN3 A;  1E8N A;  3K26 A;  5EAM A;  2P9K C;  4ZN4 A;  2VDL A;  3GD1 I;  4G1M A;  5HE2 B;  4G55 A;  1OLZ A;  4ZOV A;  1H2X A;  3IUN A;  2OVQ B;  3OKW A;  2CE9 A;  3UVK A;  2XE4 A;  4JSN C;  2H9N A;  4Z8L A;  3K72 A;  3CIK B;  2H9P A;  3I7O A;  3V9F A;  4UM9 A;  4O3U B;  4X61 B;  1SHY B;  4BP8 A;  3IIW A;  3KCI A;  4N14 A;  4O2W A;  2AGZ A;  2G9A A;  3JZG A;  3PE7 A;  1SQ9 A;  3I89 A;  1P22 A;  3O4I A;  3MMY A;  4GQ1 A;  1R5M A;  3RFH A;  1H2Y A;  1XKS A;  3JRP A;  4X3E A;  2YNO A;  3OF7 A;  3JB9 L;  4H5I A;  4D6V A;  5I5M A;  4U1E I;  4J79 A;  4AN1 A;  3UVO A;  4E5Z A;  5EMK B;  1I2M B;  2B4E A;  4FHL A;  2P9S C;  3DSM A;  3UVN A;  5KDO B;  4FAN D;  3VH0 A;  3NVN A;  4G1E A;  3BG0 A;  5I5I A;  5CXC A;  1JV2 A;  4IRZ A;  2VDQ A;  2H6Q A;  1MG3 A;  3K27 A;  5IGQ A;  3KRW B;  4ES0 A;  4PBY A;  2H9M A;  5EML B;  4BCC A;  3MZK A;  2P9N C;  3JAM g; 
#chains in the Genus database with same CATH homology
 5FFG A;  3NIG A;  4G1M A;  3V4P A;  2VDK A;  3T3P A;  3K71 A;  5E6R A;  4MMY A;  3ZDX A;  2VDR A;  2VDN A;  4UM8 A;  5E6S A;  3ZE2 A;  3ZE1 A;  3NIF A;  3IJE A;  5FFO A;  3ZDY A;  3K72 A;  3ZDZ A;  4MMZ A;  4Z7Q A;  4NEN A;  4MMX A;  3FCU A;  4UM9 A;  4Z7N A;  4G1E A;  3NID A;  1TYE A;  2VDP A;  4Z7O A;  1JV2 A;  1L5G A;  2VDQ A;  4IRZ A;  3K6S A;  4WK0 A;  3V4V A;  2VC2 A;  2VDM A;  1M1X A;  3T3M A;  5HDB A;  4WJK A;  3VI4 A;  3VI3 A;  4WK4 A;  2VDO A;  4WK2 A;  4O02 A;  5E6U A;  3ZE0 A;  3FCS A;  1U8C A;  2VDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...