3NIDA

The closed headpiece of integrin alphaiib beta3 and its complex with an alpahiib beta3 -specific antagonist that does not induce opening
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
454
structure length
454
Chain Sequence
LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin alpha-IIb
publication title Closed headpiece of integrin {alpha}IIb{beta}3 and its complex with an {alpha}IIb{beta}3-specific antagonist that does not induce opening.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/blood clotting
total genus 110
structure length 454
sequence length 454
chains with identical sequence C
ec nomenclature
pdb deposition date 2010-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 3nidA00
3T3PA 2VDQA 3ZDZA 5FFGA 2VDRA 3ZDYA 2VDNA 2VDKA 3NIDA 4Z7OA 1U8CA 4G1EA 4WK4A 3VI3A 1M1XA 4UM9A 2VDLA 4G1MA 4IRZA 4WK2A 2VC2A 5E6SA 4MMYA 2VDMA 4MMZA 3ZE2A 5E6RA 5FFOA 4Z7QA 1L5GA 3FCUA 3V4PA 3ZE0A 3K6SA 3T3MA 3V4VA 3VI4A 3NIFA 1TYEA 4UM8A 4MMXA 2VDOA 4WJKA 4NENA 1JV2A 5E6UA 5HDBA 4WK0A 2VDPA 3ZE1A 3IJEA 3K71A 3FCSA 4Z7NA 3K72A 3NIGA 4O02A 3ZDXA
chains in the Genus database with same CATH superfamily
5IGOA 1K3IA 3SFZA 3UKUC 4Z7OA 3DDUA 4G1EA 3PXTD 2OK4A 5C86A 2I0TA 2OK6A 5C9ZB 4A09A 2HJ4A 2IWFA 4NBMA 2AGYA 2VZ3A 1H2ZA 3UVOA 5IJ8E 1E8NA 1BPOA 2HKRA 4GM8A 2P9KC 4JXMA 3OKYA 4RE5A 3OW8A 4AMZA 5FLXg 3V4VA 3J81g 1NEXB 3V5WB 4FA1D 4BCCA 2B5MA 4RE6A 1GOTB 3SCYA 4FA9D 3RN1D 3DXMC 3VA6A 3IVMA 4FA5D 2H6NA 1JTDB 2UZYB 4G55A 1U8CA 1N6DA 4WK4A 3VI3A 1O6FA 1N6EA 1UOOA 3I7HA 4IRZA 3EG6A 4A2LA 2CO0C 4OZUA 5EMMB 3L4MD 4ZOVA 1XHMA 1SQJA 4G56B 2P9UC 2P9IC 2GNQA 4GM9A 2G99A 3EQ9A 4FHLA 4AN0A 3PVUB 2CN2A 4JT6C 4Z7NA 4PBYA 2PM9A 1I2MB 3NIGA 3RMZD 4O02A 1GG2B 2Z2OA 2EICA 4D9SA 2BCJB 4A2MA 4BL0A 2VDKA 3MUOA 4CZXA 2YBAA 1GOHA 4UM9A 2HXCA 3I2NA 2IURA 3EI1A 5FKSA 4Z7QA 2HESX 5E6RA 3OL2A 2H14A 1MDAH 4J8GA 3UVNA 3DSMA 4PXWA 2IUPA 4O1QD 2GC4A 3F3PA 3IKOA 3EQ8A 3IUQA 4ESGA 5I5MA 3I7KA 4GMBA 2P9LC 3V9FA 4L3HD 1VE6A 3F3FA 1MG3A 2AGLA 3JZHA 4J79A 3P4FA 3ZDXA 1B9XA 5M5UA 4BH6A 2VDRA 4HDJA 2VZ1A 5JWZA 3VGZA 1OLZA 3JRPA 5B4WA 4L9OA 4XEIC 2CE9A 3O4IA 3UVKA 3PXWD 4D6VA 4PSXB 3C75H 3IUMA 4A0BA 3CFVA 4D0KA 4FA4D 3EI2B 4CY2A 5GXIA 3UVMA 2GC7A 3ULEC 1E8MA 3U4YA 4PC0A 3SJLD 4ZOYA 4CI1A 4UM8A 5CXCB 1N6FA 4WJKA 3K71A 3AL8A 3IJEA 4J73A 1JMXB 3PVWB 2TRCB 1A12A 2I3TA 3RFHA 1JJUB 3MKSB 3ODTA 5K19A 2CN3A 3AL8B 4Y7RA 4BUJC 2H6QA 3O4JA 2YNOA 2I3SA 4ZOXA 5IGQA 3PSCB 4X63B 3C9CA 3JPXA 3RFGA 4AN1A 3AL9A 3MXXA 3W15A 2AGXA 3EWEA 5E6UA 4WK0A 4OWRA 3NVQA 4YVDA 2QC5A 2O9KA 4K3ID 4JD2C 5M5TA 3SWSD 3MMYA 2PM7B 3EMHA 3I7NA 4J78A 1H2YA 4CY1A 5FXYA 3SMRA 5FA5B 1K8KC 5CXBB 3HFQA 3I7LA 3DWLC 2IWKA 3PXSD 3EI3B 2IAAA 4JSPC 1JV2A 3I8EA 5AMSA 3KRWB 3JB9L 3K72A 4JSNC 1PEVA 2I0RA 3IJ0A 5EMLB 4R7AB 3ZDYA 3N0DA 5EMKB 3I89A 5FKRA 2EBSA 4J82A 2Q7QA 4WK2A 1PGUA 3SLED 2J56H 4A7JA 2H9LA 2B4EA 3JZNA 3T3MA 2Z2PA 1RI6A 5AJAA 1XKSA 2QZPA 4K3JB 3UVLA 3EQ7A 2VDPA 4L3GD 2I0SA 4J0WA 3L4OD 4CI3A 5FFOA 3IULA 2IUVA 4U7AA 1JMZB 2XL2A 3JZGA 1O6GA 4DNVA 5C92A 3CIKB 4FAVD 5H14A 1E5TA 5EAPA 4JSVC 3C5MA 3BG0A 2H13A 5M5VA 4JHPC 4U1EI 4PNKB 3SN6B 2G9AA 4AMYA 3FM0A 3ZE0A 4E5ZB 5TF2A 3NIFA 1TYEA 2CE8A 4MMXA 2AH0A 3RSEC 1VE7A 5EAMA 4L1QD 1H2XA 2B5LA 2H47A 4J81A 4BCDA 3UR4A 3EI2A 3CFSB 2P9PC 4E54B 4A11B 4G1MA 4O3UB 3OKTA 3RLMD 1B9YA 3EU7A 3GD1I 4NC4A 5CXCA 4AX4A 4J87A 1FWXA 3SBQA 3J80g 4JSXC 4Y5RD 2AH1A 3B7FA 4J8BA 5EMJB 2OVPB 4L1MA 4NSXA 3ZWLB 4GGDA 4GQ1A 5KDOB 3JROA 4O45A 2XYIA 4BP8A 2VDNA 1L0QA 2HKMA 3SBPA 5IJ7E 5EM2B 4CZYA 1SQ9A 2HYEA 3SHFA 3E0CA 4AEZA 4CZVA 5I5JA 2J57G 3OKWA 5C2WB 2AQ5A 2H6KA 5FKQA 2XL3A 2J55H 3RN0D 4A0AB 2H9PA 2Z2NA 5EARA 2H9NA 5HDBA 1TYQC 2H68A 1Q47A 1T2XA 5I5IA 4IA9A 2QXVA 2JKXA 5CXBA 1C9LA 3BWSA 2BBKH 4XYHA 2H3XA 3QI0A 3DXKC 1GOFA 4BP9A 2AGZA 4H5IA 3DM0A 3V7DB 2W18A 1A0RB 5HQGA 4BCBA 1U2VC 3SVWD 3NVXA 3EI3A 1L5GA 3V4PA 3IIWA 4ZOZA 2HU5A 1R5MA 3IUJA 2WQ8A 5M5SA 3I8CA 3K27A 5AFU3 5TDHB 1H2WA 1PBYB 4LGNA 4NENA 4A08B 4ERYA 1MG2A 2BKLA 1VYHC 5CYKB 2VDQA 3ZDZA 4FAND 5M61A 3EI4B 4KFMB 4CI8A 5GXHA 5THAA 2YB8B 5HE1B 5HE3B 5TEFA 3MZKA 5FQDA 5E6SA 2HU8A 4I79A 4MMZA 2AGWA 4A09B 5TEEA 2OVQB 5HE0B 2IUQA 2HU7A 1YR2A 3OKYB 4GGCA 4IMMA 4MK0B 3FCSA 4LG9A 3F3GA 1UOQA 4J0XA 3PE7A 3IUNA 4O9DA 4GQ2P 2P9NC 4AOWA 1YFQA 4O2WA 1VZ2A 2VDLA 1JOFA 2B5NA 4ZN4A 4E5ZA 4J86A 3NVNA 3BG1A 1S4UX 4MMYA 4CI2A 5GMKn 2UZXB 3ZE2A 2P9SC 4PSWB 4GZ8A 4QRJA 3KRXB 4ES0A 2VDOA 2YNNA 2OVRB 4XYIA 5K1CC 3SXTD 3AH8B 3OF7A 4X60B 4CY5A 2YNPA 3UKRC 4E54A 4A11A 1GXRA 4LG8A 1UTCA 4ERQA 3RRMC 3MUNA 3NIDA 5IC7A 2PM6B 2PM9B 1K32A 3AFCA 3QHYB 2XZGA 4QT8A 4J84A 3IJ1A 5H1MA 2EIBA 3FCUA 1U4CA 3O4HA 3K6SA 3A0FA 3K26A 2YMUA 3FRXA 3EI1B 3OTTA 1PI6A 3OL2B 3MKQA 3O4GA 3ZE1A 1VZ3A 1OMWB 2XU7A 4J77A 5EM2A 4N14A 4TZ4A 4DNWA 4GM3A 5SXMA 1SHYB 1XIPA 3C99A 1QNIA 4FB1D 1GOGA 1QFMA 2EIDA 1M1XA 3IIYA 3N0EA 4JHNA 4X3EA 1NR0A 2VC2A 5C2VB 3SBRA 3JAMg 4A0AA 2VDMA 2CO0A 3MVDK 1QFSA 5A2Qg 5HYNB 4Z8LA 1TBGA 4GGAA 4QL1A 4A0BB 4JT5C 3I7OA 3ORVD 3GC3B 5HE2B 3PSLA 3KCIA 2MTAH 5EALA 5H17A 3T3PA 2CNXA 3FGBA 4PBZA 5FFGA 2QR5A 2H9MA 4EWRA 3MZLA 2XE4A 4NAAA 4H5JA 3IURA 1ERJA 4ERZA 1UOPA 2EIEA 5FKTA 1C9IA 3I7PA 4UI9R 2OIZA 4QAMA 4QQEA 4X61B 3VH0A 4O3TB 4A08A 4CY3A 4GQBB 3VI4A 2HJBA 3IJCA 5CYKA 1GP2B 3GFCA 2OJYA 3EI4A 4FWWA 1P22A 5M5RA 4DNUA 2XDWA 5IT9g 5GSAA 2PBIB 3GREA 4CC9A
chains in the Genus database with same CATH topology
3T3PA 2VDQA 3ZDZA 5FFGA 2VDRA 3ZDYA 2VDNA 2VDKA 3NIDA 4Z7OA 1U8CA 4G1EA 4WK4A 3VI3A 1M1XA 4UM9A 2VDLA 4G1MA 4IRZA 4WK2A 2VC2A 5E6SA 4MMYA 2VDMA 4MMZA 3ZE2A 5E6RA 5FFOA 4Z7QA 1L5GA 3FCUA 3V4PA 3ZE0A 3K6SA 3T3MA 3V4VA 3VI4A 3NIFA 1TYEA 4UM8A 4MMXA 2VDOA 4WJKA 4NENA 1JV2A 5E6UA 5HDBA 4WK0A 2VDPA 3ZE1A 3IJEA 3K71A 3FCSA 4Z7NA 3K72A 3NIGA 4O02A 3ZDXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3T3P A;  2VDQ A;  3ZDZ A;  5FFG A;  2VDR A;  3ZDY A;  2VDN A;  2VDK A;  3NID A;  4Z7O A;  1U8C A;  4G1E A;  4WK4 A;  3VI3 A;  1M1X A;  4UM9 A;  2VDL A;  4G1M A;  4IRZ A;  4WK2 A;  2VC2 A;  5E6S A;  4MMY A;  2VDM A;  4MMZ A;  3ZE2 A;  5E6R A;  5FFO A;  4Z7Q A;  1L5G A;  3FCU A;  3V4P A;  3ZE0 A;  3K6S A;  3T3M A;  3V4V A;  3VI4 A;  3NIF A;  1TYE A;  4UM8 A;  4MMX A;  2VDO A;  4WJK A;  4NEN A;  1JV2 A;  5E6U A;  5HDB A;  4WK0 A;  2VDP A;  3ZE1 A;  3IJE A;  3K71 A;  3FCS A;  4Z7N A;  3K72 A;  3NIG A;  4O02 A;  3ZDX A; 
#chains in the Genus database with same CATH topology
 5IGO A;  1K3I A;  3SFZ A;  3UKU C;  4Z7O A;  3DDU A;  4G1E A;  3PXT D;  2OK4 A;  5C86 A;  2I0T A;  2OK6 A;  5C9Z B;  4A09 A;  2HJ4 A;  2IWF A;  4NBM A;  2AGY A;  2VZ3 A;  1H2Z A;  3UVO A;  5IJ8 E;  1E8N A;  1BPO A;  2HKR A;  4GM8 A;  2P9K C;  4JXM A;  3OKY A;  4RE5 A;  3OW8 A;  4AMZ A;  5FLX g;  3V4V A;  3J81 g;  1NEX B;  3V5W B;  4FA1 D;  4BCC A;  2B5M A;  4RE6 A;  1GOT B;  3SCY A;  4FA9 D;  3RN1 D;  3DXM C;  3VA6 A;  3IVM A;  4FA5 D;  2H6N A;  1JTD B;  2UZY B;  4G55 A;  1U8C A;  1N6D A;  4WK4 A;  3VI3 A;  1O6F A;  1N6E A;  1UOO A;  3I7H A;  4IRZ A;  3EG6 A;  4A2L A;  2CO0 C;  4OZU A;  5EMM B;  3L4M D;  4ZOV A;  1XHM A;  1SQJ A;  4G56 B;  2P9U C;  2P9I C;  2GNQ A;  4GM9 A;  2G99 A;  3EQ9 A;  4FHL A;  4AN0 A;  3PVU B;  2CN2 A;  4JT6 C;  4Z7N A;  4PBY A;  2PM9 A;  1I2M B;  3NIG A;  3RMZ D;  4O02 A;  1GG2 B;  2Z2O A;  2EIC A;  4D9S A;  2BCJ B;  4A2M A;  4BL0 A;  2VDK A;  3MUO A;  4CZX A;  2YBA A;  1GOH A;  4UM9 A;  2HXC A;  3I2N A;  2IUR A;  3EI1 A;  5FKS A;  4Z7Q A;  2HES X;  5E6R A;  3OL2 A;  2H14 A;  1MDA H;  4J8G A;  3UVN A;  3DSM A;  4PXW A;  2IUP A;  4O1Q D;  2GC4 A;  3F3P A;  3IKO A;  3EQ8 A;  3IUQ A;  4ESG A;  5I5M A;  3I7K A;  4GMB A;  2P9L C;  3V9F A;  4L3H D;  1VE6 A;  3F3F A;  1MG3 A;  2AGL A;  3JZH A;  4J79 A;  3P4F A;  3ZDX A;  1B9X A;  5M5U A;  4BH6 A;  2VDR A;  4HDJ A;  2VZ1 A;  5JWZ A;  3VGZ A;  1OLZ A;  3JRP A;  5B4W A;  4L9O A;  4XEI C;  2CE9 A;  3O4I A;  3UVK A;  3PXW D;  4D6V A;  4PSX B;  3C75 H;  3IUM A;  4A0B A;  3CFV A;  4D0K A;  4FA4 D;  3EI2 B;  4CY2 A;  5GXI A;  3UVM A;  2GC7 A;  3ULE C;  1E8M A;  3U4Y A;  4PC0 A;  3SJL D;  4ZOY A;  4CI1 A;  4UM8 A;  5CXC B;  1N6F A;  4WJK A;  3K71 A;  3AL8 A;  3IJE A;  4J73 A;  1JMX B;  3PVW B;  2TRC B;  1A12 A;  2I3T A;  3RFH A;  1JJU B;  3MKS B;  3ODT A;  5K19 A;  2CN3 A;  3AL8 B;  4Y7R A;  4BUJ C;  2H6Q A;  3O4J A;  2YNO A;  2I3S A;  4ZOX A;  5IGQ A;  3PSC B;  4X63 B;  3C9C A;  3JPX A;  3RFG A;  4AN1 A;  3AL9 A;  3MXX A;  3W15 A;  2AGX A;  3EWE A;  5E6U A;  4WK0 A;  4OWR A;  3NVQ A;  4YVD A;  2QC5 A;  2O9K A;  4K3I D;  4JD2 C;  5M5T A;  3SWS D;  3MMY A;  2PM7 B;  3EMH A;  3I7N A;  4J78 A;  1H2Y A;  4CY1 A;  5FXY A;  3SMR A;  5FA5 B;  1K8K C;  5CXB B;  3HFQ A;  3I7L A;  3DWL C;  2IWK A;  3PXS D;  3EI3 B;  2IAA A;  4JSP C;  1JV2 A;  3I8E A;  5AMS A;  3KRW B;  3JB9 L;  3K72 A;  4JSN C;  1PEV A;  2I0R A;  3IJ0 A;  5EML B;  4R7A B;  3ZDY A;  3N0D A;  5EMK B;  3I89 A;  5FKR A;  2EBS A;  4J82 A;  2Q7Q A;  4WK2 A;  1PGU A;  3SLE D;  2J56 H;  4A7J A;  2H9L A;  2B4E A;  3JZN A;  3T3M A;  2Z2P A;  1RI6 A;  5AJA A;  1XKS A;  2QZP A;  4K3J B;  3UVL A;  3EQ7 A;  2VDP A;  4L3G D;  2I0S A;  4J0W A;  3L4O D;  4CI3 A;  5FFO A;  3IUL A;  2IUV A;  4U7A A;  1JMZ B;  2XL2 A;  3JZG A;  1O6G A;  4DNV A;  5C92 A;  3CIK B;  4FAV D;  5H14 A;  1E5T A;  5EAP A;  4JSV C;  3C5M A;  3BG0 A;  2H13 A;  5M5V A;  4JHP C;  4U1E I;  4PNK B;  3SN6 B;  2G9A A;  4AMY A;  3FM0 A;  3ZE0 A;  4E5Z B;  5TF2 A;  3NIF A;  1TYE A;  2CE8 A;  4MMX A;  2AH0 A;  3RSE C;  1VE7 A;  5EAM A;  4L1Q D;  1H2X A;  2B5L A;  2H47 A;  4J81 A;  4BCD A;  3UR4 A;  3EI2 A;  3CFS B;  2P9P C;  4E54 B;  4A11 B;  4G1M A;  4O3U B;  3OKT A;  3RLM D;  1B9Y A;  3EU7 A;  3GD1 I;  4NC4 A;  5CXC A;  4AX4 A;  4J87 A;  1FWX A;  3SBQ A;  3J80 g;  4JSX C;  4Y5R D;  2AH1 A;  3B7F A;  4J8B A;  5EMJ B;  2OVP B;  4L1M A;  4NSX A;  3ZWL B;  4GGD A;  4GQ1 A;  5KDO B;  3JRO A;  4O45 A;  2XYI A;  4BP8 A;  2VDN A;  1L0Q A;  2HKM A;  3SBP A;  5IJ7 E;  5EM2 B;  4CZY A;  1SQ9 A;  2HYE A;  3SHF A;  3E0C A;  4AEZ A;  4CZV A;  5I5J A;  2J57 G;  3OKW A;  5C2W B;  2AQ5 A;  2H6K A;  5FKQ A;  2XL3 A;  2J55 H;  3RN0 D;  4A0A B;  2H9P A;  2Z2N A;  5EAR A;  2H9N A;  5HDB A;  1TYQ C;  2H68 A;  1Q47 A;  1T2X A;  5I5I A;  4IA9 A;  2QXV A;  2JKX A;  5CXB A;  1C9L A;  3BWS A;  2BBK H;  4XYH A;  2H3X A;  3QI0 A;  3DXK C;  1GOF A;  4BP9 A;  2AGZ A;  4H5I A;  3DM0 A;  3V7D B;  2W18 A;  1A0R B;  5HQG A;  4BCB A;  1U2V C;  3SVW D;  3NVX A;  3EI3 A;  1L5G A;  3V4P A;  3IIW A;  4ZOZ A;  2HU5 A;  1R5M A;  3IUJ A;  2WQ8 A;  5M5S A;  3I8C A;  3K27 A;  5AFU 3;  5TDH B;  1H2W A;  1PBY B;  4LGN A;  4NEN A;  4A08 B;  4ERY A;  1MG2 A;  2BKL A;  1VYH C;  5CYK B;  2VDQ A;  3ZDZ A;  4FAN D;  5M61 A;  3EI4 B;  4KFM B;  4CI8 A;  5GXH A;  5THA A;  2YB8 B;  5HE1 B;  5HE3 B;  5TEF A;  3MZK A;  5FQD A;  5E6S A;  2HU8 A;  4I79 A;  4MMZ A;  2AGW A;  4A09 B;  5TEE A;  2OVQ B;  5HE0 B;  2IUQ A;  2HU7 A;  1YR2 A;  3OKY B;  4GGC A;  4IMM A;  4MK0 B;  3FCS A;  4LG9 A;  3F3G A;  1UOQ A;  4J0X A;  3PE7 A;  3IUN A;  4O9D A;  4GQ2 P;  2P9N C;  4AOW A;  1YFQ A;  4O2W A;  1VZ2 A;  2VDL A;  1JOF A;  2B5N A;  4ZN4 A;  4E5Z A;  4J86 A;  3NVN A;  3BG1 A;  1S4U X;  4MMY A;  4CI2 A;  5GMK n;  2UZX B;  3ZE2 A;  2P9S C;  4PSW B;  4GZ8 A;  4QRJ A;  3KRX B;  4ES0 A;  2VDO A;  2YNN A;  2OVR B;  4XYI A;  5K1C C;  3SXT D;  3AH8 B;  3OF7 A;  4X60 B;  4CY5 A;  2YNP A;  3UKR C;  4E54 A;  4A11 A;  1GXR A;  4LG8 A;  1UTC A;  4ERQ A;  3RRM C;  3MUN A;  3NID A;  5IC7 A;  2PM6 B;  2PM9 B;  1K32 A;  3AFC A;  3QHY B;  2XZG A;  4QT8 A;  4J84 A;  3IJ1 A;  5H1M A;  2EIB A;  3FCU A;  1U4C A;  3O4H A;  3K6S A;  3A0F A;  3K26 A;  2YMU A;  3FRX A;  3EI1 B;  3OTT A;  1PI6 A;  3OL2 B;  3MKQ A;  3O4G A;  3ZE1 A;  1VZ3 A;  1OMW B;  2XU7 A;  4J77 A;  5EM2 A;  4N14 A;  4TZ4 A;  4DNW A;  4GM3 A;  5SXM A;  1SHY B;  1XIP A;  3C99 A;  1QNI A;  4FB1 D;  1GOG A;  1QFM A;  2EID A;  1M1X A;  3IIY A;  3N0E A;  4JHN A;  4X3E A;  1NR0 A;  2VC2 A;  5C2V B;  3SBR A;  3JAM g;  4A0A A;  2VDM A;  2CO0 A;  3MVD K;  1QFS A;  5A2Q g;  5HYN B;  4Z8L A;  1TBG A;  4GGA A;  4QL1 A;  4A0B B;  4JT5 C;  3I7O A;  3ORV D;  3GC3 B;  5HE2 B;  3PSL A;  3KCI A;  2MTA H;  5EAL A;  5H17 A;  3T3P A;  2CNX A;  3FGB A;  4PBZ A;  5FFG A;  2QR5 A;  2H9M A;  4EWR A;  3MZL A;  2XE4 A;  4NAA A;  4H5J A;  3IUR A;  1ERJ A;  4ERZ A;  1UOP A;  2EIE A;  5FKT A;  1C9I A;  3I7P A;  4UI9 R;  2OIZ A;  4QAM A;  4QQE A;  4X61 B;  3VH0 A;  4O3T B;  4A08 A;  4CY3 A;  4GQB B;  3VI4 A;  2HJB A;  3IJC A;  5CYK A;  1GP2 B;  3GFC A;  2OJY A;  3EI4 A;  4FWW A;  1P22 A;  5M5R A;  4DNU A;  2XDW A;  5IT9 g;  5GSA A;  2PBI B;  3GRE A;  4CC9 A; 
#chains in the Genus database with same CATH homology
 3T3P A;  2VDQ A;  3ZDZ A;  5FFG A;  2VDR A;  3ZDY A;  2VDN A;  2VDK A;  3NID A;  4Z7O A;  1U8C A;  4G1E A;  4WK4 A;  3VI3 A;  1M1X A;  4UM9 A;  2VDL A;  4G1M A;  4IRZ A;  4WK2 A;  2VC2 A;  5E6S A;  4MMY A;  2VDM A;  4MMZ A;  3ZE2 A;  5E6R A;  5FFO A;  4Z7Q A;  1L5G A;  3FCU A;  3V4P A;  3ZE0 A;  3K6S A;  3T3M A;  3V4V A;  3VI4 A;  3NIF A;  1TYE A;  4UM8 A;  4MMX A;  2VDO A;  4WJK A;  4NEN A;  1JV2 A;  5E6U A;  5HDB A;  4WK0 A;  2VDP A;  3ZE1 A;  3IJE A;  3K71 A;  3FCS A;  4Z7N A;  3K72 A;  3NIG A;  4O02 A;  3ZDX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...