3NIDA

The closed headpiece of integrin alphaiib beta3 and its complex with an alpahiib beta3 -specific antagonist that does not induce opening
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
454
structure length
454
Chain Sequence
LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Closed headpiece of integrin {alpha}IIb{beta}3 and its complex with an {alpha}IIb{beta}3-specific antagonist that does not induce opening.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/blood clotting
molecule keywords Integrin alpha-IIb
total genus 110
structure length 454
sequence length 454
chains with identical sequence C
ec nomenclature
pdb deposition date 2010-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 3nidA00
2VC2A 1TYEA 2VDOA 3FCUA 4G1EA 3ZE2A 3T3MA 3NIGA 4O02A 3V4VA 3ZE0A 3K71A 1JV2A 4NENA 5E6RA 3NIFA 3K72A 2VDRA 1M1XA 1U8CA 4IRZA 4WK2A 3K6SA 2VDKA 3VI4A 2VDLA 4UM9A 4MMZA 4WK0A 3ZDZA 3ZDXA 5E6SA 4WJKA 2VDQA 4MMYA 4WK4A 3VI3A 4Z7NA 2VDMA 5FFGA 5HDBA 3ZDYA 4Z7QA 1L5GA 3FCSA 5FFOA 4G1MA 4UM8A 3T3PA 3ZE1A 5E6UA 2VDPA 3IJEA 3V4PA 4Z7OA 3NIDA 2VDNA 4MMXA
chains in the Genus database with same CATH superfamily
4GGAA 4O3TB 4JSXC 4CI1A 4G56B 1VZ3A 3NIFA 3ULEC 2AH1A 3I89A 3C5MA 2EICA 3UVOA 3FM0A 3EQ9A 1I2MB 4OZUA 5C86A 3J81g 1UTCA 4FAND 2GNQA 3AH8B 3JPXA 5EMMB 5SXMA 4J84A 1YR2A 2PM6B 2YNPA 3JZHA 3T3PA 5IC7A 4DNVA 4X3EA 4DNWA 5KDOB 4J79A 3IUJA 2CO0A 4JHPC 3OL2A 5I5JA 4E5ZA 1GOFA 2OJYA 5M5VA 4GGDA 4O1QD 5H14A 2OVQB 4O02A 3EQ7A 2CN3A 3IVMA 4JT6C 5CXCA 3IURA 4WK2A 4A0AA 2H6NA 4L1QD 2G99A 5EM2B 2OK4A 1PBYB 1U4CA 5JWZA 1C9LA 4LG9A 5CYKB 4BL0A 3F3PA 2HJBA 3K26A 4E54A 4GZ8A 4X60B 1SQ9A 1T2XA 2VDNA 3O4JA 3L4OD 5E6UA 5EMLB 4FA4D 5AMSA 4FWWA 4GM3A 3K71A 2EIDA 5FKSA 2P9SC 5IJ8E 1UOQA 1JJUB 5GMKn 4QT8A 4CZYA 4O45A 4E5ZB 5K19A 2H6KA 3MXXA 2Z2PA 2P9KC 2TRCB 4D9SA 4Y7RA 4CY2A 3I7OA 2W18A 2HXCA 3MZKA 4DNUA 2BKLA 3MZLA 3V7DB 2P9UC 2AGLA 3UVNA 3IUNA 3CFSB 5TEEA 2VDPA 3IIYA 3EI2A 3NIDA 4PSWB 2H9MA 2GC7A 4G1EA 3ZE2A 3MUNA 3EWEA 3U4YA 5M5TA 3K72A 4I79A 4L3GD 2HKRA 4AN1A 2IUQA 3I7KA 5K1CC 3K6SA 3EI3A 5TDHB 2B4EA 2O9KA 2EIBA 3RRMC 1TYQC 3OKYA 3NVXA 5H17A 5M5SA 4CY3A 4IMMA 1VE7A 4QQEA 4CZVA 3RLMD 5HYNB 3GREA 4TZ4A 3EI3B 1NR0A 5CXBA 4IA9A 4BH6A 2Q7QA 4BP8A 3ZWLB 5M61A 3SBRA 4FB1D 2AQ5A 1VYHC 3PVWB 3EI2B 4H5JA 4OWRA 5GXIA 1SQJA 3OW8A 3VI4A 5EALA 2QXVA 2YMUA 1XKSA 3V9FA 2AGZA 2P9PC 4KFMB 4CI2A 3C9CA 4QL1A 1N6EA 1YFQA 1A12A 2HU5A 2QC5A 4QRJA 4NSXA 4LG8A 3PE7A 4A2LA 3IULA 3SVWD 4D6VA 2IWKA 5E6RA 4NENA 3B7FA 2CO0C 3I7PA 3RSEC 3SWSD 4O3UB 4BUJC 2CNXA 2JKXA 1UOPA 5HE3B 5M5RA 5M5UA 1E5TA 3KRXB 1UOOA 3L4MD 5FKQA 1PGUA 4O2WA 2OK6A 4JHNA 3IUMA 4AN0A 2EIEA 2H68A 2OIZA 2AGXA 3MKQA 4GQ2P 2VC2A 1TYEA 2CN2A 2XYIA 5I5MA 3SBPA 3OKYB 1H2WA 3VA6A 3I7NA 4E54B 4J87A 4AEZA 1GOHA 2H9NA 4QAMA 4L3HD 2H9LA 2B5NA 2IUPA 4MMYA 5EMKB 3VI3A 3C99A 3KCIA 4GM9A 1P22A 3UKRC 3GC3B 4XYIA 3OKTA 5FFOA 2HJ4A 5C9ZB 1FWXA 1GP2B 5C92A 3PSLA 3DSMA 4NBMA 4PSXB 2VDRA 4YVDA 4NAAA 4G55A 2CE9A 2I3SA 4L9OA 4WK0A 4J73A 5E6SA 2H14A 3EI4A 4N14A 2I0TA 3UVKA 4ERYA 1L5GA 2XU7A 2P9NC 3ORVD 3P4FA 4G1MA 4X63B 4ERZA 5GSAA 2YNOA 3ODTA 4J81A 2UZYB 2EBSA 2B5LA 5THAA 1GOTB 1H2ZA 1JMXB 1JV2A 1XIPA 4RE5A 4UI9R 4A08B 1H2XA 3SXTD 2PM9B 3MKSB 3VH0A 5AJAA 4BCDA 1N6FA 5FQDA 4NC4A 1OLZA 4PNKB 5A2Qg 3I8CA 4X61B 3I7HA 4Z8LA 1K32A 3SMRA 4FA1D 4A11A 4A09A 2HYEA 1JOFA 4A0BA 3HFQA 5IJ7E 1XHMA 2PBIB 4J8BA 1QFSA 4U7AA 4D0KA 3DXKC 5IT9g 4HDJA 2I3TA 5I5IA 3N0DA 3QI0A 2VDOA 2BCJB 3ZE0A 2HESX 3BG0A 3OF7A 3SFZA 1GOGA 4A11B 2XDWA 2I0SA 4ZOVA 4AOWA 3J80g 4FHLA 3ZDZA 1MDAH 2H3XA 1B9YA 4JSPC 3QHYB 3MMYA 3SN6B 1Q47A 4PBYA 5HDBA 4JSNC 4K3ID 4Z7QA 3EU7A 3O4IA 4J0XA 1RI6A 3I7LA 3MVDK 1TBGA 5EAPA 3VGZA 5C2WB 1JTDB 1O6FA 2XZGA 5FA5B 4CY5A 5CYKA 3OTTA 4GQBB 2IAAA 2H13A 3CFVA 1L0QA 1K3IA 3IJ0A 2VDLA 4J82A 4JT5C 2B5MA 1S4UX 5TEFA 3JZNA 1NEXB 4J8GA 4WK4A 4BCBA 3F3GA 3K27A 5FFGA 4JD2C 3ZDYA 3IIWA 2G9AA 2Z2OA 2IUVA 1GG2B 4H5IA 4J78A 1C9IA 4Z7OA 3IJEA 1QFMA 4J86A 4XEIC 3UVLA 1PEVA 4O9DA 4GMBA 2J56H 3W15A 2HU7A 3RFGA 3I8EA 3NVQA 3T3MA 1O6GA 3V4VA 3AFCA 2AGYA 3EQ8A 5FKRA 4CI8A 4IRZA 2H47A 1QNIA 2OVRB 3IUQA 3EMHA 5FXYA 3ZDXA 2Z2NA 1K8KC 2VDQA 3RFHA 3DXMC 2AH0A 2J57G 4CY1A 1VE6A 2MTAH 1GXRA 4GQ1A 1B9XA 3N0EA 3IJCA 5FKTA 3SHFA 5GXHA 2PM7B 4LGNA 5HQGA 3V4PA 5IGQA 1SHYB 3SJLD 4PXWA 1N6DA 3UR4A 5TF2A 3CIKB 1MG2A 4MMXA 3RN0D 4CI3A 3MUOA 3FCUA 4ZOYA 3SBQA 3PSCB 4R7AB 4PC0A 1VZ2A 1PI6A 4ERQA 3OL2B 4A7JA 4J77A 3PXWD 4AX4A 2HU8A 3AL8A 2YB8B 2XL2A 3PVUB 3UVMA 2OVPB 4AMYA 4ES0A 3GFCA 3PXTD 1E8MA 4J0WA 3A0FA 4L1MA 4FA9D 1MG3A 5B4WA 3EG6A 3AL9A 5H1MA 1H2YA 4JXMA 4A0AB 4RE6A 3C75H 4BCCA 4ZOXA 3DDUA 3AL8B 2I0RA 3FGBA 5IGOA 3JZGA 3UKUC 2IWFA 3I2NA 1ERJA 2QZPA 5EARA 4AMZA 2AGWA 2XL3A 2HKMA 3KRWB 4GM8A 3IJ1A 5EMJB 5HE2B 5FLXg 4Z7NA 4Y5RD 2VDMA 5HE0B 4A2MA 2BBKH 3SCYA 4A08A 2VZ1A 3FRXA 2XE4A 4BP9A 2UZXB 5HE1B 1OMWB 4UM8A 4FA5D 4U1EI 4CZXA 5EM2A 3NVNA 3EI4B 2WQ8A 3BG1A 1A0RB 3RN1D 5CXBB 3O4GA 3DWLC 4ESGA 2VDKA 3BWSA 2H6QA 4UM9A 2YNNA 4MMZA 3JRPA 4A0BB 3E0CA 2YBAA 2P9IC 3JROA 2VZ3A 4PBZA 1BPOA 4CC9A 5CXCB 2J55H 1R5MA 5EAMA 3DM0A 3FCSA 2PM9A 4ZOZA 4FAVD 4EWRA 1JMZB 3ZE1A 5C2VB 4K3JB 4JSVC 3GD1I 3PXSD 3JAMg 3NIGA 2GC4A 1M1XA 1U8CA 5AFU3 4MK0B 3O4HA 3V5WB 3SLED 4XYHA 4A09B 3JB9L 4WJKA 3F3FA 3EI1A 4GGCA 1U2VC 3IKOA 3OKWA 2P9LC 4ZN4A 2QR5A 2IURA 2H9PA 3EI1B 1E8NA 2CE8A 3RMZD
chains in the Genus database with same CATH topology
2VC2A 1TYEA 2VDOA 3FCUA 4G1EA 3ZE2A 3T3MA 3NIGA 4O02A 3V4VA 3ZE0A 3K71A 1JV2A 4NENA 5E6RA 3NIFA 3K72A 2VDRA 1M1XA 1U8CA 4IRZA 4WK2A 3K6SA 2VDKA 3VI4A 2VDLA 4UM9A 4MMZA 4WK0A 3ZDZA 3ZDXA 5E6SA 4WJKA 2VDQA 4MMYA 4WK4A 3VI3A 4Z7NA 2VDMA 5FFGA 5HDBA 3ZDYA 4Z7QA 1L5GA 3FCSA 5FFOA 4G1MA 4UM8A 3T3PA 3ZE1A 5E6UA 2VDPA 3IJEA 3V4PA 4Z7OA 3NIDA 2VDNA 4MMXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VC2 A;  1TYE A;  2VDO A;  3FCU A;  4G1E A;  3ZE2 A;  3T3M A;  3NIG A;  4O02 A;  3V4V A;  3ZE0 A;  3K71 A;  1JV2 A;  4NEN A;  5E6R A;  3NIF A;  3K72 A;  2VDR A;  1M1X A;  1U8C A;  4IRZ A;  4WK2 A;  3K6S A;  2VDK A;  3VI4 A;  2VDL A;  4UM9 A;  4MMZ A;  4WK0 A;  3ZDZ A;  3ZDX A;  5E6S A;  4WJK A;  2VDQ A;  4MMY A;  4WK4 A;  3VI3 A;  4Z7N A;  2VDM A;  5FFG A;  5HDB A;  3ZDY A;  4Z7Q A;  1L5G A;  3FCS A;  5FFO A;  4G1M A;  4UM8 A;  3T3P A;  3ZE1 A;  5E6U A;  2VDP A;  3IJE A;  3V4P A;  4Z7O A;  3NID A;  2VDN A;  4MMX A; 
#chains in the Genus database with same CATH topology
 4GGA A;  4O3T B;  4JSX C;  4CI1 A;  4G56 B;  1VZ3 A;  3NIF A;  3ULE C;  2AH1 A;  3I89 A;  3C5M A;  2EIC A;  3UVO A;  3FM0 A;  3EQ9 A;  1I2M B;  4OZU A;  5C86 A;  3J81 g;  1UTC A;  4FAN D;  2GNQ A;  3AH8 B;  3JPX A;  5EMM B;  5SXM A;  4J84 A;  1YR2 A;  2PM6 B;  2YNP A;  3JZH A;  3T3P A;  5IC7 A;  4DNV A;  4X3E A;  4DNW A;  5KDO B;  4J79 A;  3IUJ A;  2CO0 A;  4JHP C;  3OL2 A;  5I5J A;  4E5Z A;  1GOF A;  2OJY A;  5M5V A;  4GGD A;  4O1Q D;  5H14 A;  2OVQ B;  4O02 A;  3EQ7 A;  2CN3 A;  3IVM A;  4JT6 C;  5CXC A;  3IUR A;  4WK2 A;  4A0A A;  2H6N A;  4L1Q D;  2G99 A;  5EM2 B;  2OK4 A;  1PBY B;  1U4C A;  5JWZ A;  1C9L A;  4LG9 A;  5CYK B;  4BL0 A;  3F3P A;  2HJB A;  3K26 A;  4E54 A;  4GZ8 A;  4X60 B;  1SQ9 A;  1T2X A;  2VDN A;  3O4J A;  3L4O D;  5E6U A;  5EML B;  4FA4 D;  5AMS A;  4FWW A;  4GM3 A;  3K71 A;  2EID A;  5FKS A;  2P9S C;  5IJ8 E;  1UOQ A;  1JJU B;  5GMK n;  4QT8 A;  4CZY A;  4O45 A;  4E5Z B;  5K19 A;  2H6K A;  3MXX A;  2Z2P A;  2P9K C;  2TRC B;  4D9S A;  4Y7R A;  4CY2 A;  3I7O A;  2W18 A;  2HXC A;  3MZK A;  4DNU A;  2BKL A;  3MZL A;  3V7D B;  2P9U C;  2AGL A;  3UVN A;  3IUN A;  3CFS B;  5TEE A;  2VDP A;  3IIY A;  3EI2 A;  3NID A;  4PSW B;  2H9M A;  2GC7 A;  4G1E A;  3ZE2 A;  3MUN A;  3EWE A;  3U4Y A;  5M5T A;  3K72 A;  4I79 A;  4L3G D;  2HKR A;  4AN1 A;  2IUQ A;  3I7K A;  5K1C C;  3K6S A;  3EI3 A;  5TDH B;  2B4E A;  2O9K A;  2EIB A;  3RRM C;  1TYQ C;  3OKY A;  3NVX A;  5H17 A;  5M5S A;  4CY3 A;  4IMM A;  1VE7 A;  4QQE A;  4CZV A;  3RLM D;  5HYN B;  3GRE A;  4TZ4 A;  3EI3 B;  1NR0 A;  5CXB A;  4IA9 A;  4BH6 A;  2Q7Q A;  4BP8 A;  3ZWL B;  5M61 A;  3SBR A;  4FB1 D;  2AQ5 A;  1VYH C;  3PVW B;  3EI2 B;  4H5J A;  4OWR A;  5GXI A;  1SQJ A;  3OW8 A;  3VI4 A;  5EAL A;  2QXV A;  2YMU A;  1XKS A;  3V9F A;  2AGZ A;  2P9P C;  4KFM B;  4CI2 A;  3C9C A;  4QL1 A;  1N6E A;  1YFQ A;  1A12 A;  2HU5 A;  2QC5 A;  4QRJ A;  4NSX A;  4LG8 A;  3PE7 A;  4A2L A;  3IUL A;  3SVW D;  4D6V A;  2IWK A;  5E6R A;  4NEN A;  3B7F A;  2CO0 C;  3I7P A;  3RSE C;  3SWS D;  4O3U B;  4BUJ C;  2CNX A;  2JKX A;  1UOP A;  5HE3 B;  5M5R A;  5M5U A;  1E5T A;  3KRX B;  1UOO A;  3L4M D;  5FKQ A;  1PGU A;  4O2W A;  2OK6 A;  4JHN A;  3IUM A;  4AN0 A;  2EIE A;  2H68 A;  2OIZ A;  2AGX A;  3MKQ A;  4GQ2 P;  2VC2 A;  1TYE A;  2CN2 A;  2XYI A;  5I5M A;  3SBP A;  3OKY B;  1H2W A;  3VA6 A;  3I7N A;  4E54 B;  4J87 A;  4AEZ A;  1GOH A;  2H9N A;  4QAM A;  4L3H D;  2H9L A;  2B5N A;  2IUP A;  4MMY A;  5EMK B;  3VI3 A;  3C99 A;  3KCI A;  4GM9 A;  1P22 A;  3UKR C;  3GC3 B;  4XYI A;  3OKT A;  5FFO A;  2HJ4 A;  5C9Z B;  1FWX A;  1GP2 B;  5C92 A;  3PSL A;  3DSM A;  4NBM A;  4PSX B;  2VDR A;  4YVD A;  4NAA A;  4G55 A;  2CE9 A;  2I3S A;  4L9O A;  4WK0 A;  4J73 A;  5E6S A;  2H14 A;  3EI4 A;  4N14 A;  2I0T A;  3UVK A;  4ERY A;  1L5G A;  2XU7 A;  2P9N C;  3ORV D;  3P4F A;  4G1M A;  4X63 B;  4ERZ A;  5GSA A;  2YNO A;  3ODT A;  4J81 A;  2UZY B;  2EBS A;  2B5L A;  5THA A;  1GOT B;  1H2Z A;  1JMX B;  1JV2 A;  1XIP A;  4RE5 A;  4UI9 R;  4A08 B;  1H2X A;  3SXT D;  2PM9 B;  3MKS B;  3VH0 A;  5AJA A;  4BCD A;  1N6F A;  5FQD A;  4NC4 A;  1OLZ A;  4PNK B;  5A2Q g;  3I8C A;  4X61 B;  3I7H A;  4Z8L A;  1K32 A;  3SMR A;  4FA1 D;  4A11 A;  4A09 A;  2HYE A;  1JOF A;  4A0B A;  3HFQ A;  5IJ7 E;  1XHM A;  2PBI B;  4J8B A;  1QFS A;  4U7A A;  4D0K A;  3DXK C;  5IT9 g;  4HDJ A;  2I3T A;  5I5I A;  3N0D A;  3QI0 A;  2VDO A;  2BCJ B;  3ZE0 A;  2HES X;  3BG0 A;  3OF7 A;  3SFZ A;  1GOG A;  4A11 B;  2XDW A;  2I0S A;  4ZOV A;  4AOW A;  3J80 g;  4FHL A;  3ZDZ A;  1MDA H;  2H3X A;  1B9Y A;  4JSP C;  3QHY B;  3MMY A;  3SN6 B;  1Q47 A;  4PBY A;  5HDB A;  4JSN C;  4K3I D;  4Z7Q A;  3EU7 A;  3O4I A;  4J0X A;  1RI6 A;  3I7L A;  3MVD K;  1TBG A;  5EAP A;  3VGZ A;  5C2W B;  1JTD B;  1O6F A;  2XZG A;  5FA5 B;  4CY5 A;  5CYK A;  3OTT A;  4GQB B;  2IAA A;  2H13 A;  3CFV A;  1L0Q A;  1K3I A;  3IJ0 A;  2VDL A;  4J82 A;  4JT5 C;  2B5M A;  1S4U X;  5TEF A;  3JZN A;  1NEX B;  4J8G A;  4WK4 A;  4BCB A;  3F3G A;  3K27 A;  5FFG A;  4JD2 C;  3ZDY A;  3IIW A;  2G9A A;  2Z2O A;  2IUV A;  1GG2 B;  4H5I A;  4J78 A;  1C9I A;  4Z7O A;  3IJE A;  1QFM A;  4J86 A;  4XEI C;  3UVL A;  1PEV A;  4O9D A;  4GMB A;  2J56 H;  3W15 A;  2HU7 A;  3RFG A;  3I8E A;  3NVQ A;  3T3M A;  1O6G A;  3V4V A;  3AFC A;  2AGY A;  3EQ8 A;  5FKR A;  4CI8 A;  4IRZ A;  2H47 A;  1QNI A;  2OVR B;  3IUQ A;  3EMH A;  5FXY A;  3ZDX A;  2Z2N A;  1K8K C;  2VDQ A;  3RFH A;  3DXM C;  2AH0 A;  2J57 G;  4CY1 A;  1VE6 A;  2MTA H;  1GXR A;  4GQ1 A;  1B9X A;  3N0E A;  3IJC A;  5FKT A;  3SHF A;  5GXH A;  2PM7 B;  4LGN A;  5HQG A;  3V4P A;  5IGQ A;  1SHY B;  3SJL D;  4PXW A;  1N6D A;  3UR4 A;  5TF2 A;  3CIK B;  1MG2 A;  4MMX A;  3RN0 D;  4CI3 A;  3MUO A;  3FCU A;  4ZOY A;  3SBQ A;  3PSC B;  4R7A B;  4PC0 A;  1VZ2 A;  1PI6 A;  4ERQ A;  3OL2 B;  4A7J A;  4J77 A;  3PXW D;  4AX4 A;  2HU8 A;  3AL8 A;  2YB8 B;  2XL2 A;  3PVU B;  3UVM A;  2OVP B;  4AMY A;  4ES0 A;  3GFC A;  3PXT D;  1E8M A;  4J0W A;  3A0F A;  4L1M A;  4FA9 D;  1MG3 A;  5B4W A;  3EG6 A;  3AL9 A;  5H1M A;  1H2Y A;  4JXM A;  4A0A B;  4RE6 A;  3C75 H;  4BCC A;  4ZOX A;  3DDU A;  3AL8 B;  2I0R A;  3FGB A;  5IGO A;  3JZG A;  3UKU C;  2IWF A;  3I2N A;  1ERJ A;  2QZP A;  5EAR A;  4AMZ A;  2AGW A;  2XL3 A;  2HKM A;  3KRW B;  4GM8 A;  3IJ1 A;  5EMJ B;  5HE2 B;  5FLX g;  4Z7N A;  4Y5R D;  2VDM A;  5HE0 B;  4A2M A;  2BBK H;  3SCY A;  4A08 A;  2VZ1 A;  3FRX A;  2XE4 A;  4BP9 A;  2UZX B;  5HE1 B;  1OMW B;  4UM8 A;  4FA5 D;  4U1E I;  4CZX A;  5EM2 A;  3NVN A;  3EI4 B;  2WQ8 A;  3BG1 A;  1A0R B;  3RN1 D;  5CXB B;  3O4G A;  3DWL C;  4ESG A;  2VDK A;  3BWS A;  2H6Q A;  4UM9 A;  2YNN A;  4MMZ A;  3JRP A;  4A0B B;  3E0C A;  2YBA A;  2P9I C;  3JRO A;  2VZ3 A;  4PBZ A;  1BPO A;  4CC9 A;  5CXC B;  2J55 H;  1R5M A;  5EAM A;  3DM0 A;  3FCS A;  2PM9 A;  4ZOZ A;  4FAV D;  4EWR A;  1JMZ B;  3ZE1 A;  5C2V B;  4K3J B;  4JSV C;  3GD1 I;  3PXS D;  3JAM g;  3NIG A;  2GC4 A;  1M1X A;  1U8C A;  5AFU 3;  4MK0 B;  3O4H A;  3V5W B;  3SLE D;  4XYH A;  4A09 B;  3JB9 L;  4WJK A;  3F3F A;  3EI1 A;  4GGC A;  1U2V C;  3IKO A;  3OKW A;  2P9L C;  4ZN4 A;  2QR5 A;  2IUR A;  2H9P A;  3EI1 B;  1E8N A;  2CE8 A;  3RMZ D; 
#chains in the Genus database with same CATH homology
 2VC2 A;  1TYE A;  2VDO A;  3FCU A;  4G1E A;  3ZE2 A;  3T3M A;  3NIG A;  4O02 A;  3V4V A;  3ZE0 A;  3K71 A;  1JV2 A;  4NEN A;  5E6R A;  3NIF A;  3K72 A;  2VDR A;  1M1X A;  1U8C A;  4IRZ A;  4WK2 A;  3K6S A;  2VDK A;  3VI4 A;  2VDL A;  4UM9 A;  4MMZ A;  4WK0 A;  3ZDZ A;  3ZDX A;  5E6S A;  4WJK A;  2VDQ A;  4MMY A;  4WK4 A;  3VI3 A;  4Z7N A;  2VDM A;  5FFG A;  5HDB A;  3ZDY A;  4Z7Q A;  1L5G A;  3FCS A;  5FFO A;  4G1M A;  4UM8 A;  3T3P A;  3ZE1 A;  5E6U A;  2VDP A;  3IJE A;  3V4P A;  4Z7O A;  3NID A;  2VDN A;  4MMX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...