3NIDA

The closed headpiece of integrin alphaiib beta3 and its complex with an alpahiib beta3 -specific antagonist that does not induce opening
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
454
structure length
454
Chain Sequence
LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion/blood clotting
molecule keywords Integrin alpha-IIb
publication title Closed headpiece of integrin {alpha}IIb{beta}3 and its complex with an {alpha}IIb{beta}3-specific antagonist that does not induce opening.
pubmed doi rcsb
source organism Homo sapiens
total genus 110
structure length 454
sequence length 454
chains with identical sequence C
ec nomenclature
pdb deposition date 2010-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 3nidA00
5E6UA 4WK0A 4UM8A 4G1MA 4G1EA 4WJKA 5E6SA 3FCSA 5HDBA 3ZDXA 3FCUA 3ZE1A 4NENA 3ZE2A 3ZDYA 1JV2A 4WK2A 1TYEA 2VDNA 4MMZA 4Z7QA 4UM9A 1M1XA 3NIFA 3T3MA 3T3PA 3V4PA 3ZE0A 2VC2A 2VDMA 2VDPA 2VDKA 2VDQA 5FFOA 4WK4A 3VI3A 3ZDZA 1L5GA 4Z7OA 3K71A 4Z7NA 1U8CA 3NIGA 4IRZA 3IJEA 4MMYA 5FFGA 3V4VA 2VDRA 3K72A 2VDOA 3VI4A 3K6SA 2VDLA 4MMXA 5E6RA 4O02A 3NIDA
chains in the Genus database with same CATH superfamily
5FA5B 2HJBA 3PE7A 3SCYA 4CZXA 4GGAA 5TEFA 3K26A 4PBYA 3ZE1A 4QT8A 2G9AA 3OKTA 2H9MA 2XZGA 3KRWB 3PVUB 5M5TA 2XL3A 1GP2B 3DSMA 4J8GA 5M61A 3SVWD 1E8NA 4A08A 3FGBA 3OL2B 4JSVC 2PM9A 3UVOA 4GM3A 3SXTD 3I7LA 4GGDA 1O6GA 3PSCB 2XDWA 4G1MA 2HJ4A 5AJAA 4ESGA 2H9NA 2GNQA 1H2YA 2H6NA 4JHPC 4JHNA 2P9IC 2H14A 3MZKA 1M1XA 4NSXA 3N0EA 4XYHA 1I2MB 1GOFA 3SBQA 1E8MA 4X3EA 4CY3A 1QFMA 4J87A 3UKRC 3VI3A 3J80g 4QAMA 4JD2C 4U1EI 2AH1A 3JB9L 4CY2A 2HXCA 2XU7A 5B4WA 3RFHA 3IUMA 4LG9A 4XEIC 4PXWA 1SQJA 4LG8A 3VGZA 1U4CA 3DXKC 4AOWA 5TF2A 3IULA 1ERJA 2B5LA 2I0TA 2OJYA 3IVMA 5HQGA 2EIEA 3SN6B 1VYHC 4FHLA 5GXIA 3EI3A 3IURA 1VE6A 3DXMC 2HKRA 3HFQA 5FLXg 5FFGA 2XE4A 3EQ8A 2AQ5A 4MMXA 5C86A 3C5MA 3I7OA 1VE7A 5AFU3 3CIKB 5H14A 4RE5A 4DNWA 4ZN4A 4JSPC 4AN1A 5EMMB 4J81A 3IIYA 3SHFA 4ZOVA 3JPXA 4CY5A 3EWEA 2B4EA 4IRZA 4RE6A 4CI8A 2IUQA 1GOTB 4A08B 2AGZA 5E6RA 5K1CC 2PM9B 3UVNA 4PSWB 3PXTD 3MXXA 5C2WB 4BP8A 4G1EA 4X61B 4IA9A 4J79A 3RN1D 4O1QD 4XYIA 4A0AA 3CFVA 4ZOZA 3ZDYA 1UOOA 4J73A 2BKLA 1N6EA 2OVPB 3AH8B 2H6KA 3BWSA 3T3PA 4J0WA 2H13A 3UVMA 3I7HA 5HE1B 4FWWA 3SMRA 5EAMA 3IUNA 5M5SA 4JSXC 1XHMA 4PNKB 5EALA 5FKTA 2HU8A 4HDJA 4A2LA 1T2XA 4GQ1A 3O4IA 3UKUC 2IUPA 4AX4A 5SXMA 2OVRB 4WJKA 3BG1A 3FCSA 3RMZD 3ZDXA 5THAA 4NENA 2CE9A 1JV2A 1SQ9A 4GMBA 3RRMC 5IC7A 2YB8B 3EG6A 3JRPA 3V5WB 5C9ZB 5A2Qg 1NEXB 4BL0A 5EMLB 1U2VC 2Z2OA 3F3FA 4A11A 1VZ3A 4CI1A 2J55H 1FWXA 3EI3B 2I0SA 2VDRA 3P4FA 1E5TA 2H47A 5GXHA 5IJ7E 4LGNA 4Z8LA 4Y7RA 5HE2B 3KCIA 4BP9A 3F3GA 1QNIA 4JT5C 1JMXB 2EIDA 2VZ3A 2AH0A 5E6SA 3RFGA 3NVNA 1UOPA 2QC5A 2UZYB 4CC9A 4CZYA 3ZE2A 2YMUA 3O4HA 4FB1D 4MK0B 2P9UC 3FRXA 4DNVA 1BPOA 3MZLA 3MKQA 2AGLA 3UR4A 4IMMA 1H2ZA 4FAND 3QI0A 3RN0D 3V9FA 4D9SA 4CI3A 3MUOA 2VDPA 2VDKA 2HU7A 4WK4A 4AEZA 5CYKA 5M5UA 3O4GA 2YNNA 3AL9A 3NIGA 3I7KA 4MMYA 5EAPA 3VA6A 3MUNA 3EU7A 4O02A 1H2XA 1UOQA 2HU5A 4DNUA 1B9XA 4WK0A 2H68A 2JKXA 1K3IA 4O45A 4R7AB 4X60B 1Q47A 4GQ2P 3EI2A 2J56H 3I7PA 4A0AB 2QXVA 4E5ZA 3OKYA 5AMSA 2OVQB 3NIFA 3BG0A 2MTAH 4O2WA 4A7JA 3MMYA 3L4MD 4KFMB 2HESX 2XL2A 4X63B 3V4VA 5FKRA 2VDOA 2PM6B 2QZPA 2VDLA 3I2NA 3NIDA 4GZ8A 3JROA 3DM0A 3OTTA 3AL8A 4TZ4A 5HDBA 3FCUA 3IKOA 1JJUB 5IGQA 3OF7A 3NVQA 2I0RA 2YNOA 3E0CA 3V4PA 3T3MA 4BCCA 1MDAH 3ODTA 2CNXA 5H1MA 4A11B 3EI1A 5JWZA 4BUJC 1GOGA 2EBSA 2P9NC 3I8CA 3DDUA 4NBMA 2BCJB 3EI4A 5E6UA 3ZWLB 4J86A 1MG2A 4ES0A 4J8BA 4GQBB 4O3UB 2CO0C 4AMYA 1PI6A 1YFQA 1TYEA 5TDHB 4OZUA 4L3GD 3SJLD 4Z7QA 4A0BA 3RLMD 4CI2A 4FA4D 3SFZA 3IUQA 2Z2PA 3ULEC 2PM7B 5FFOA 3QHYB 3PVWB 5C92A 2HYEA 5CYKB 2H9PA 2YNPA 2EICA 1PEVA 3C75H 4EWRA 4JXMA 4CY1A 2IAAA 4GM9A 2I3TA 1NR0A 3ORVD 5EM2A 4MMZA 3EI2B 1A12A 2I3SA 3PSLA 2IWFA 5I5MA 1PGUA 4CZVA 3EQ7A 4E5ZB 4H5JA 3OKYB 4L3HD 5I5JA 4UI9R 3I8EA 4OWRA 3VI4A 4K3JB 5EARA 1TYQC 3GC3B 3U4YA 1GXRA 5I5IA 4D0KA 1A0RB 2AGWA 4E54A 1TBGA 4QRJA 5GSAA 3C99A 3O4JA 4WK2A 1OLZA 3AL8B 5IT9g 3FM0A 3OKWA 3SLED 2HKMA 3IJ1A 3W15A 4FA5D 1JTDB 3PXSD 4GGCA 2B5MA 1L0QA 2IURA 4ERYA 2P9PC 4L1QD 4FAVD 4Z7NA 2H3XA 3GREA 1RI6A 3GD1I 3K6SA 3A0FA 3K27A 1GOHA 3EI1B 3JZNA 3IUJA 4Y5RD 4UM8A 1R5MA 4I79A 5EMKB 3EMHA 3C9CA 3EI4B 1O6FA 3JZHA 1K8KC 2AGXA 4ERZA 4QQEA 2VDNA 3MVDK 4A09A 2H6QA 5CXCA 2OK6A 5FQDA 3KRXB 3I7NA 2UZXB 5CXBA 4A0BB 2QR5A 1B9YA 2CN3A 4BCDA 1U8CA 2IWKA 5H17A 1XKSA 1N6FA 2W18A 4JSNC 1PBYB 1UTCA 3EQ9A 2TRCB 4U7AA 2P9LC 5GMKn 1C9IA 4BH6A 5TEEA 4PC0A 1OMWB 4NAAA 4J77A 5EMJB 2H9LA 4ERQA 4K3ID 5HYNB 4FA1D 4N14A 3JAMg 3L4OD 4J0XA 3GFCA 4QL1A 3OL2A 1H2WA 5EM2B 2GC4A 2OIZA 4L1MA 3UVLA 3ZDZA 2B5NA 4O9DA 3IJCA 5C2VB 3IIWA 4J82A 5FKQA 4O3TB 4NC4A 4ZOXA 4PBZA 5FKSA 3SBRA 2P9SC 3MKSB 4A2MA 4BCBA 3UVKA 4YVDA 2Q7QA 4ZOYA 1YR2A 4GM8A 4FA9D 1C9LA 4E54B 2CE8A 3IJ0A 5M5RA 2YBAA 1S4UX 2WQ8A 1N6DA 3VH0A 5IJ8E 2VC2A 5K19A 2O9KA 3V7DB 3N0DA 4J78A 3SBPA 3F3PA 5M5VA 3K71A 1JOFA 3AFCA 3IJEA 1VZ2A 2AGYA 3SWSD 2G99A 4D6VA 5FXYA 3JZGA 3NVXA 3I89A 3CFSB 2PBIB 2VZ1A 1K32A 2CN2A 5KDOB 4AMZA 3B7FA 4G55A 3RSEC 2GC7A 1QFSA 5HE0B 5IGOA 3PXWD 2BBKH 1SHYB 4UM9A 5HE3B 2J57G 4G56B 4J84A 4L9OA 1P22A 3J81g 4AN0A 3ZE0A 4A09B 4PSXB 2OK4A 2VDMA 1MG3A 1XIPA 2P9KC 3OW8A 5CXCB 2VDQA 4Z7OA 1L5GA 4JT6C 2XYIA 2CO0A 4H5IA 1GG2B 5CXBB 2EIBA 3K72A 3DWLC 2IUVA 1JMZB 2Z2NA
chains in the Genus database with same CATH topology
5E6UA 4WK0A 4UM8A 4G1MA 4G1EA 4WJKA 5E6SA 3FCSA 5HDBA 3ZDXA 3FCUA 3ZE1A 4NENA 3ZE2A 3ZDYA 1JV2A 4WK2A 1TYEA 2VDNA 4MMZA 4Z7QA 4UM9A 1M1XA 3NIFA 3T3MA 3T3PA 3V4PA 3ZE0A 2VC2A 2VDMA 2VDPA 2VDKA 2VDQA 5FFOA 4WK4A 3VI3A 3ZDZA 1L5GA 4Z7OA 3K71A 4Z7NA 1U8CA 3NIGA 4IRZA 3IJEA 4MMYA 5FFGA 3V4VA 2VDRA 3K72A 2VDOA 3VI4A 3K6SA 2VDLA 4MMXA 5E6RA 4O02A 3NIDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E6U A;  4WK0 A;  4UM8 A;  4G1M A;  4G1E A;  4WJK A;  5E6S A;  3FCS A;  5HDB A;  3ZDX A;  3FCU A;  3ZE1 A;  4NEN A;  3ZE2 A;  3ZDY A;  1JV2 A;  4WK2 A;  1TYE A;  2VDN A;  4MMZ A;  4Z7Q A;  4UM9 A;  1M1X A;  3NIF A;  3T3M A;  3T3P A;  3V4P A;  3ZE0 A;  2VC2 A;  2VDM A;  2VDP A;  2VDK A;  2VDQ A;  5FFO A;  4WK4 A;  3VI3 A;  3ZDZ A;  1L5G A;  4Z7O A;  3K71 A;  4Z7N A;  1U8C A;  3NIG A;  4IRZ A;  3IJE A;  4MMY A;  5FFG A;  3V4V A;  2VDR A;  3K72 A;  2VDO A;  3VI4 A;  3K6S A;  2VDL A;  4MMX A;  5E6R A;  4O02 A;  3NID A; 
#chains in the Genus database with same CATH topology
 5FA5 B;  2HJB A;  3PE7 A;  3SCY A;  4CZX A;  4GGA A;  5TEF A;  3K26 A;  4PBY A;  3ZE1 A;  4QT8 A;  2G9A A;  3OKT A;  2H9M A;  2XZG A;  3KRW B;  3PVU B;  5M5T A;  2XL3 A;  1GP2 B;  3DSM A;  4J8G A;  5M61 A;  3SVW D;  1E8N A;  4A08 A;  3FGB A;  3OL2 B;  4JSV C;  2PM9 A;  3UVO A;  4GM3 A;  3SXT D;  3I7L A;  4GGD A;  1O6G A;  3PSC B;  2XDW A;  4G1M A;  2HJ4 A;  5AJA A;  4ESG A;  2H9N A;  2GNQ A;  1H2Y A;  2H6N A;  4JHP C;  4JHN A;  2P9I C;  2H14 A;  3MZK A;  1M1X A;  4NSX A;  3N0E A;  4XYH A;  1I2M B;  1GOF A;  3SBQ A;  1E8M A;  4X3E A;  4CY3 A;  1QFM A;  4J87 A;  3UKR C;  3VI3 A;  3J80 g;  4QAM A;  4JD2 C;  4U1E I;  2AH1 A;  3JB9 L;  4CY2 A;  2HXC A;  2XU7 A;  5B4W A;  3RFH A;  3IUM A;  4LG9 A;  4XEI C;  4PXW A;  1SQJ A;  4LG8 A;  3VGZ A;  1U4C A;  3DXK C;  4AOW A;  5TF2 A;  3IUL A;  1ERJ A;  2B5L A;  2I0T A;  2OJY A;  3IVM A;  5HQG A;  2EIE A;  3SN6 B;  1VYH C;  4FHL A;  5GXI A;  3EI3 A;  3IUR A;  1VE6 A;  3DXM C;  2HKR A;  3HFQ A;  5FLX g;  5FFG A;  2XE4 A;  3EQ8 A;  2AQ5 A;  4MMX A;  5C86 A;  3C5M A;  3I7O A;  1VE7 A;  5AFU 3;  3CIK B;  5H14 A;  4RE5 A;  4DNW A;  4ZN4 A;  4JSP C;  4AN1 A;  5EMM B;  4J81 A;  3IIY A;  3SHF A;  4ZOV A;  3JPX A;  4CY5 A;  3EWE A;  2B4E A;  4IRZ A;  4RE6 A;  4CI8 A;  2IUQ A;  1GOT B;  4A08 B;  2AGZ A;  5E6R A;  5K1C C;  2PM9 B;  3UVN A;  4PSW B;  3PXT D;  3MXX A;  5C2W B;  4BP8 A;  4G1E A;  4X61 B;  4IA9 A;  4J79 A;  3RN1 D;  4O1Q D;  4XYI A;  4A0A A;  3CFV A;  4ZOZ A;  3ZDY A;  1UOO A;  4J73 A;  2BKL A;  1N6E A;  2OVP B;  3AH8 B;  2H6K A;  3BWS A;  3T3P A;  4J0W A;  2H13 A;  3UVM A;  3I7H A;  5HE1 B;  4FWW A;  3SMR A;  5EAM A;  3IUN A;  5M5S A;  4JSX C;  1XHM A;  4PNK B;  5EAL A;  5FKT A;  2HU8 A;  4HDJ A;  4A2L A;  1T2X A;  4GQ1 A;  3O4I A;  3UKU C;  2IUP A;  4AX4 A;  5SXM A;  2OVR B;  4WJK A;  3BG1 A;  3FCS A;  3RMZ D;  3ZDX A;  5THA A;  4NEN A;  2CE9 A;  1JV2 A;  1SQ9 A;  4GMB A;  3RRM C;  5IC7 A;  2YB8 B;  3EG6 A;  3JRP A;  3V5W B;  5C9Z B;  5A2Q g;  1NEX B;  4BL0 A;  5EML B;  1U2V C;  2Z2O A;  3F3F A;  4A11 A;  1VZ3 A;  4CI1 A;  2J55 H;  1FWX A;  3EI3 B;  2I0S A;  2VDR A;  3P4F A;  1E5T A;  2H47 A;  5GXH A;  5IJ7 E;  4LGN A;  4Z8L A;  4Y7R A;  5HE2 B;  3KCI A;  4BP9 A;  3F3G A;  1QNI A;  4JT5 C;  1JMX B;  2EID A;  2VZ3 A;  2AH0 A;  5E6S A;  3RFG A;  3NVN A;  1UOP A;  2QC5 A;  2UZY B;  4CC9 A;  4CZY A;  3ZE2 A;  2YMU A;  3O4H A;  4FB1 D;  4MK0 B;  2P9U C;  3FRX A;  4DNV A;  1BPO A;  3MZL A;  3MKQ A;  2AGL A;  3UR4 A;  4IMM A;  1H2Z A;  4FAN D;  3QI0 A;  3RN0 D;  3V9F A;  4D9S A;  4CI3 A;  3MUO A;  2VDP A;  2VDK A;  2HU7 A;  4WK4 A;  4AEZ A;  5CYK A;  5M5U A;  3O4G A;  2YNN A;  3AL9 A;  3NIG A;  3I7K A;  4MMY A;  5EAP A;  3VA6 A;  3MUN A;  3EU7 A;  4O02 A;  1H2X A;  1UOQ A;  2HU5 A;  4DNU A;  1B9X A;  4WK0 A;  2H68 A;  2JKX A;  1K3I A;  4O45 A;  4R7A B;  4X60 B;  1Q47 A;  4GQ2 P;  3EI2 A;  2J56 H;  3I7P A;  4A0A B;  2QXV A;  4E5Z A;  3OKY A;  5AMS A;  2OVQ B;  3NIF A;  3BG0 A;  2MTA H;  4O2W A;  4A7J A;  3MMY A;  3L4M D;  4KFM B;  2HES X;  2XL2 A;  4X63 B;  3V4V A;  5FKR A;  2VDO A;  2PM6 B;  2QZP A;  2VDL A;  3I2N A;  3NID A;  4GZ8 A;  3JRO A;  3DM0 A;  3OTT A;  3AL8 A;  4TZ4 A;  5HDB A;  3FCU A;  3IKO A;  1JJU B;  5IGQ A;  3OF7 A;  3NVQ A;  2I0R A;  2YNO A;  3E0C A;  3V4P A;  3T3M A;  4BCC A;  1MDA H;  3ODT A;  2CNX A;  5H1M A;  4A11 B;  3EI1 A;  5JWZ A;  4BUJ C;  1GOG A;  2EBS A;  2P9N C;  3I8C A;  3DDU A;  4NBM A;  2BCJ B;  3EI4 A;  5E6U A;  3ZWL B;  4J86 A;  1MG2 A;  4ES0 A;  4J8B A;  4GQB B;  4O3U B;  2CO0 C;  4AMY A;  1PI6 A;  1YFQ A;  1TYE A;  5TDH B;  4OZU A;  4L3G D;  3SJL D;  4Z7Q A;  4A0B A;  3RLM D;  4CI2 A;  4FA4 D;  3SFZ A;  3IUQ A;  2Z2P A;  3ULE C;  2PM7 B;  5FFO A;  3QHY B;  3PVW B;  5C92 A;  2HYE A;  5CYK B;  2H9P A;  2YNP A;  2EIC A;  1PEV A;  3C75 H;  4EWR A;  4JXM A;  4CY1 A;  2IAA A;  4GM9 A;  2I3T A;  1NR0 A;  3ORV D;  5EM2 A;  4MMZ A;  3EI2 B;  1A12 A;  2I3S A;  3PSL A;  2IWF A;  5I5M A;  1PGU A;  4CZV A;  3EQ7 A;  4E5Z B;  4H5J A;  3OKY B;  4L3H D;  5I5J A;  4UI9 R;  3I8E A;  4OWR A;  3VI4 A;  4K3J B;  5EAR A;  1TYQ C;  3GC3 B;  3U4Y A;  1GXR A;  5I5I A;  4D0K A;  1A0R B;  2AGW A;  4E54 A;  1TBG A;  4QRJ A;  5GSA A;  3C99 A;  3O4J A;  4WK2 A;  1OLZ A;  3AL8 B;  5IT9 g;  3FM0 A;  3OKW A;  3SLE D;  2HKM A;  3IJ1 A;  3W15 A;  4FA5 D;  1JTD B;  3PXS D;  4GGC A;  2B5M A;  1L0Q A;  2IUR A;  4ERY A;  2P9P C;  4L1Q D;  4FAV D;  4Z7N A;  2H3X A;  3GRE A;  1RI6 A;  3GD1 I;  3K6S A;  3A0F A;  3K27 A;  1GOH A;  3EI1 B;  3JZN A;  3IUJ A;  4Y5R D;  4UM8 A;  1R5M A;  4I79 A;  5EMK B;  3EMH A;  3C9C A;  3EI4 B;  1O6F A;  3JZH A;  1K8K C;  2AGX A;  4ERZ A;  4QQE A;  2VDN A;  3MVD K;  4A09 A;  2H6Q A;  5CXC A;  2OK6 A;  5FQD A;  3KRX B;  3I7N A;  2UZX B;  5CXB A;  4A0B B;  2QR5 A;  1B9Y A;  2CN3 A;  4BCD A;  1U8C A;  2IWK A;  5H17 A;  1XKS A;  1N6F A;  2W18 A;  4JSN C;  1PBY B;  1UTC A;  3EQ9 A;  2TRC B;  4U7A A;  2P9L C;  5GMK n;  1C9I A;  4BH6 A;  5TEE A;  4PC0 A;  1OMW B;  4NAA A;  4J77 A;  5EMJ B;  2H9L A;  4ERQ A;  4K3I D;  5HYN B;  4FA1 D;  4N14 A;  3JAM g;  3L4O D;  4J0X A;  3GFC A;  4QL1 A;  3OL2 A;  1H2W A;  5EM2 B;  2GC4 A;  2OIZ A;  4L1M A;  3UVL A;  3ZDZ A;  2B5N A;  4O9D A;  3IJC A;  5C2V B;  3IIW A;  4J82 A;  5FKQ A;  4O3T B;  4NC4 A;  4ZOX A;  4PBZ A;  5FKS A;  3SBR A;  2P9S C;  3MKS B;  4A2M A;  4BCB A;  3UVK A;  4YVD A;  2Q7Q A;  4ZOY A;  1YR2 A;  4GM8 A;  4FA9 D;  1C9L A;  4E54 B;  2CE8 A;  3IJ0 A;  5M5R A;  2YBA A;  1S4U X;  2WQ8 A;  1N6D A;  3VH0 A;  5IJ8 E;  2VC2 A;  5K19 A;  2O9K A;  3V7D B;  3N0D A;  4J78 A;  3SBP A;  3F3P A;  5M5V A;  3K71 A;  1JOF A;  3AFC A;  3IJE A;  1VZ2 A;  2AGY A;  3SWS D;  2G99 A;  4D6V A;  5FXY A;  3JZG A;  3NVX A;  3I89 A;  3CFS B;  2PBI B;  2VZ1 A;  1K32 A;  2CN2 A;  5KDO B;  4AMZ A;  3B7F A;  4G55 A;  3RSE C;  2GC7 A;  1QFS A;  5HE0 B;  5IGO A;  3PXW D;  2BBK H;  1SHY B;  4UM9 A;  5HE3 B;  2J57 G;  4G56 B;  4J84 A;  4L9O A;  1P22 A;  3J81 g;  4AN0 A;  3ZE0 A;  4A09 B;  4PSX B;  2OK4 A;  2VDM A;  1MG3 A;  1XIP A;  2P9K C;  3OW8 A;  5CXC B;  2VDQ A;  4Z7O A;  1L5G A;  4JT6 C;  2XYI A;  2CO0 A;  4H5I A;  1GG2 B;  5CXB B;  2EIB A;  3K72 A;  3DWL C;  2IUV A;  1JMZ B;  2Z2N A; 
#chains in the Genus database with same CATH homology
 5E6U A;  4WK0 A;  4UM8 A;  4G1M A;  4G1E A;  4WJK A;  5E6S A;  3FCS A;  5HDB A;  3ZDX A;  3FCU A;  3ZE1 A;  4NEN A;  3ZE2 A;  3ZDY A;  1JV2 A;  4WK2 A;  1TYE A;  2VDN A;  4MMZ A;  4Z7Q A;  4UM9 A;  1M1X A;  3NIF A;  3T3M A;  3T3P A;  3V4P A;  3ZE0 A;  2VC2 A;  2VDM A;  2VDP A;  2VDK A;  2VDQ A;  5FFO A;  4WK4 A;  3VI3 A;  3ZDZ A;  1L5G A;  4Z7O A;  3K71 A;  4Z7N A;  1U8C A;  3NIG A;  4IRZ A;  3IJE A;  4MMY A;  5FFG A;  3V4V A;  2VDR A;  3K72 A;  2VDO A;  3VI4 A;  3K6S A;  2VDL A;  4MMX A;  5E6R A;  4O02 A;  3NID A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...