3NIDA

The closed headpiece of integrin alphaiib beta3 and its complex with an alpahiib beta3 -specific antagonist that does not induce opening
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
454
structure length
454
Chain Sequence
b'LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin alpha-IIb
publication title Closed headpiece of integrin {alpha}IIb{beta}3 and its complex with an {alpha}IIb{beta}3-specific antagonist that does not induce opening.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/blood clotting
total genus 110
structure length 454
sequence length 454
chains with identical sequence C
ec nomenclature
pdb deposition date 2010-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 3nidA00
4Z7NA 5E6RA 3T3MA 4G1EA 4MMYA 4Z7QA 3VI3A 2VDQA 4G1MA 3ZDXA 3NIDA 3FCUA 1JV2A 3T3PA 3NIFA 1L5GA 5E6UA 3V4PA 2VDMA 1M1XA 3V4VA 3K72A 4WJKA 5E6SA 2VDLA 2VC2A 2VDOA 5FFGA 1U8CA 5FFOA 3K6SA 3IJEA 4O02A 3K71A 3FCSA 2VDKA 3ZE0A 3ZE1A 3ZE2A 2VDNA 4Z7OA 4NENA 4WK2A 4MMXA 3ZDZA 5HDBA 2VDRA 4UM8A 4WK0A 3VI4A 4MMZA 3ZDYA 4UM9A 1TYEA 4WK4A 4IRZA 2VDPA 3NIGA
chains in the Genus database with same CATH superfamily
2B5MA 4L1MA 4A0AB 3SXTD 4FB1D 5IT9g 4R7AB 3ZDXA 2EIDA 3T3PA 3I7NA 1YFQA 4BCDA 3IJ0A 3JRPA 5C9ZB 4AN0A 2P9SC 2H3XA 4J77A 1VZ2A 4E54A 3RN0D 1U8CA 5THAA 5GMKn 5GSAA 4OWRA 4A0BB 4ZOYA 3EI3A 5FQDA 5EARA 3ZDZA 2OJYA 1H2YA 2IAAA 4AMYA 3KCIA 4UM9A 4AMZA 4A7JA 1PEVA 5H1MA 4J82A 3FM0A 2I0SA 4FA4D 3IJ1A 3OW8A 4L1QD 3U4YA 1JMXB 2HXCA 3IKOA 4J84A 3NIFA 4ESGA 3JZGA 1B9YA 3UVLA 2CN2A 5EMMB 2PM9B 2P9PC 2CE8A 3C9CA 3PVUB 1H2ZA 2PBIB 3AL9A 5HE2B 3L4OD 3K6SA 4PBYA 2MTAH 5EM2B 3PVWB 4BCBA 1N6EA 2YNOA 3RLMD 2J57G 3SLED 3GC3B 1UOPA 2HU5A 2H47A 3EMHA 2Q7QA 4JT5C 1YR2A 4XYHA 1U4CA 3N0DA 3EI4B 5EAMA 3VA6A 2H68A 2XYIA 3C5MA 4QRJA 1OLZA 2VZ1A 3UKRC 4L3HD 1TYQC 3IJCA 2VDLA 4FAND 4H5JA 3UKUC 1PI6A 2CN3A 4CZVA 5FFOA 3KRXB 3UVOA 5I5MA 5C86A 2GNQA 2IWKA 4O02A 3CIKB 2BCJB 4J86A 3ZE1A 2J56H 2YNPA 3DWLC 1N6DA 4MMXA 4WK2A 4EWRA 5AMSA 2UZXB 2H9PA 4A0AA 4A09A 4UM8A 4JT6C 3PSCB 3DXKC 5TEFA 3DDUA 2IWFA 3SFZA 5FA5B 4J8GA 1JOFA 4FA1D 4CI3A 5TDHB 5HE0B 4A0BA 2VDMA 3NVNA 5C2VB 3MXXA 4Y7RA 4PC0A 2P9NC 4GM8A 2P9KC 4J87A 2IUQA 4JSNC 3MKSB 3SMRA 4NSXA 4KFMB 4A2LA 1I2MB 1GG2B 4GMBA 2HESX 3AH8B 4PNKB 4TZ4A 3GREA 2P9UC 1UTCA 1K8KC 1JTDB 3JB9L 3EQ9A 2B4EA 2HKMA 5CXBA 5IGOA 3O4HA 2H14A 4FA9D 4DNWA 2VDQA 1JV2A 4QQEA 5EAPA 1K3IA 4QL1A 5EM2A 1M1XA 3PXTD 3V5WB 1SQJA 1GOFA 2HYEA 4U1EI 4AOWA 2HKRA 4GM9A 3EI1A 2VDNA 5H17A 5K19A 2I3TA 5HDBA 4JHNA 3I89A 3C99A 3QHYB 1E5TA 4GQ1A 3V7DB 3V9FA 1TYEA 1XKSA 4J73A 4L3GD 2GC4A 3JZHA 5SXMA 2I0RA 1P22A 3A0FA 4MMYA 4O45A 1JJUB 1VYHC 2EICA 3B7FA 2OVPB 3ODTA 3CFSB 3F3FA 4WJKA 5HYNB 2VC2A 2VDOA 1C9LA 2PM6B 1GOTB 4FHLA 2H9LA 3SHFA 4PXWA 3FCSA 4O2WA 4E5ZB 1MG3A 4X60B 4LG8A 5B4WA 1C9IA 5M61A 3E0CA 4U7AA 5M5VA 3NIGA 1XIPA 2G99A 2CNXA 4A08B 3N0EA 3I7PA 5TEEA 3SBPA 2JKXA 2OVRB 4Z7QA 1RI6A 2IUVA 3F3PA 3K26A 1PGUA 2Z2PA 2AGYA 4BH6A 3AL8A 2XZGA 2PM7B 2OK4A 5HE1B 3I7OA 3RN1D 5FLXg 3MZLA 1E8NA 4GGAA 2AGLA 2VDKA 3ZE2A 3GD1I 2H13A 1L0QA 4I79A 2GC7A 5M5RA 1NEXB 3OL2A 5M5UA 2VDPA 4A11A 1QNIA 3EWEA 1OMWB 2UZYB 3OF7A 3RRMC 5IJ8E 3VI3A 3O4IA 4RE6A 1L5GA 3V4PA 3CFVA 3V4VA 1UOQA 1PBYB 3EU7A 1XHMA 2EBSA 4LGNA 4ZOZA 3ORVD 3I7KA 3BG0A 5I5JA 3SWSD 4BP9A 4AEZA 1T2XA 4J0XA 5KDOB 3W15A 4BCCA 2W18A 3BG1A 4JD2C 2H6KA 4CY1A 4XEIC 3SJLD 4X63B 5CYKB 4K3ID 2AGWA 5CXCB 5FXYA 3IULA 3MUOA 4GGCA 3UVKA 3KRWB 4NBMA 5M5SA 3UVNA 3PE7A 3DSMA 2I3SA 4E5ZA 3HFQA 3EQ7A 4NC4A 3PSLA 4BP8A 1GOGA 5FKRA 5EMJB 5M5TA 2QXVA 3BWSA 1Q47A 2CO0C 1QFSA 2EIBA 3I7LA 5EALA 3IVMA 4E54B 1H2WA 2TRCB 5HQGA 3GFCA 4G56B 5IGQA 1R5MA 3UR4A 3JAMg 4MMZA 2AH0A 4A2MA 3EI3B 3ZWLB 4UI9R 3MVDK 4JHPC 3O4GA 2PM9A 2AH1A 5HE3B 2H9MA 1BPOA 4ERQA 3FCUA 4ERZA 2H6QA 2QZPA 1FWXA 3P4FA 4BUJC 4YVDA 3QI0A 5GXIA 4D9SA 3SVWD 4X61B 4PBZA 4JSXC 2EIEA 3EQ8A 4N14A 1VZ3A 2P9LC 4NENA 3OTTA 2XL3A 3EI4A 3PXSD 4GZ8A 2HU8A 2OK6A 4G1EA 4D0KA 2XDWA 2OIZA 2XE4A 3RMZD 4O3UB 4J8BA 2XU7A 5JWZA 4PSWB 4NAAA 4DNVA 4J78A 2H9NA 5FFGA 3OKWA 3RFHA 4CC9A 1GXRA 3I8EA 3L4MD 3F3GA 4RE5A 2YMUA 1B9XA 1N6FA 3RSEC 2IURA 3MKQA 4FA5D 5FKSA 4CY3A 4Z7NA 5E6RA 4A09B 1GOHA 4O3TB 3FRXA 4G1MA 4FAVD 3C75H 5E6UA 3NVXA 4K3JB 1S4UX 4G55A 3K27A 4CY5A 3IIYA 2QC5A 4MK0B 2H6NA 1A0RB 3AFCA 4GQBB 3ULEC 3ZDYA 3J81g 4L9OA 3SBRA 3MUNA 5C2WB 4CZXA 1SHYB 2P9IC 3VH0A 2AGXA 3EI2B 3PXWD 4CI1A 2G9AA 1GP2B 5CXBB 2B5NA 3I7HA 4QT8A 1O6FA 1E8MA 4HDJA 3SBQA 4ZOVA 2YBAA 1NR0A 3DM0A 5K1CC 3OKTA 3SN6B 4X3EA 1A12A 2HU7A 3OKYB 4H5IA 5EMKB 2BBKH 4BL0A 4QAMA 1MDAH 3IUJA 4JSPC 3VI4A 2I0TA 2HJBA 4WK4A 1VE7A 3EI1B 4PSXB 4O9DA 2WQ8A 4ZOXA 5I5IA 4ES0A 2IUPA 4Z8LA 2AGZA 1SQ9A 4J79A 1JMZB 5AJAA 4Y5RD 4GM3A 5C92A 3MMYA 5FKTA 3J80g 4ERYA 1H2XA 4OZUA 4CI2A 3RFGA 5IC7A 3IUNA 3UVMA 3VGZA 1UOOA 2B5LA 4J81A 1VE6A 4JSVC 4IA9A 4Z7OA 4A08A 3JPXA 3JZNA 4LG9A 2HJ4A 2VDRA 4WK0A 4JXMA 2XL2A 4GGDA 3T3MA 4DNUA 5H14A 2J55H 3I8CA 3IIWA 2BKLA 3DXMC 3FGBA 5A2Qg 3I2NA 2QR5A 4XYIA 4ZN4A 5AFU3 2YNNA 4D6VA 1QFMA 3K71A 3ZE0A 3AL8B 3IUQA 2Z2OA 2OVQB 1U2VC 3EI2A 4FWWA 5TF2A 4IRZA 3JROA 1O6GA 3O4JA 3OL2B 4J0WA 2VZ3A 3NIDA 5GXHA 3NVQA 4A11B 3IURA 3IUMA 1MG2A 3OKYA 3MZKA 4AN1A 2CE9A 2O9KA 3K72A 5E6SA 4AX4A 4GQ2P 5EMLB 2CO0A 2YB8B 3SCYA 3IJEA 5IJ7E 2Z2NA 4O1QD 1ERJA 5CYKA 4CY2A 4CZYA 1TBGA 5CXCA 5FKQA 2AQ5A 1K32A 4CI8A 4IMMA 3EG6A
chains in the Genus database with same CATH topology
4Z7NA 5E6RA 3T3MA 4G1EA 4MMYA 4Z7QA 3VI3A 2VDQA 4G1MA 3ZDXA 3NIDA 3FCUA 1JV2A 3T3PA 3NIFA 1L5GA 5E6UA 3V4PA 2VDMA 1M1XA 3V4VA 3K72A 4WJKA 5E6SA 2VDLA 2VC2A 2VDOA 5FFGA 1U8CA 5FFOA 3K6SA 3IJEA 4O02A 3K71A 3FCSA 2VDKA 3ZE0A 3ZE1A 3ZE2A 2VDNA 4Z7OA 4NENA 4WK2A 4MMXA 3ZDZA 5HDBA 2VDRA 4UM8A 4WK0A 3VI4A 4MMZA 3ZDYA 4UM9A 1TYEA 4WK4A 4IRZA 2VDPA 3NIGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z7N A;  5E6R A;  3T3M A;  4G1E A;  4MMY A;  4Z7Q A;  3VI3 A;  2VDQ A;  4G1M A;  3ZDX A;  3NID A;  3FCU A;  1JV2 A;  3T3P A;  3NIF A;  1L5G A;  5E6U A;  3V4P A;  2VDM A;  1M1X A;  3V4V A;  3K72 A;  4WJK A;  5E6S A;  2VDL A;  2VC2 A;  2VDO A;  5FFG A;  1U8C A;  5FFO A;  3K6S A;  3IJE A;  4O02 A;  3K71 A;  3FCS A;  2VDK A;  3ZE0 A;  3ZE1 A;  3ZE2 A;  2VDN A;  4Z7O A;  4NEN A;  4WK2 A;  4MMX A;  3ZDZ A;  5HDB A;  2VDR A;  4UM8 A;  4WK0 A;  3VI4 A;  4MMZ A;  3ZDY A;  4UM9 A;  1TYE A;  4WK4 A;  4IRZ A;  2VDP A;  3NIG A; 
#chains in the Genus database with same CATH topology
 2B5M A;  4L1M A;  4A0A B;  3SXT D;  4FB1 D;  5IT9 g;  4R7A B;  3ZDX A;  2EID A;  3T3P A;  3I7N A;  1YFQ A;  4BCD A;  3IJ0 A;  3JRP A;  5C9Z B;  4AN0 A;  2P9S C;  2H3X A;  4J77 A;  1VZ2 A;  4E54 A;  3RN0 D;  1U8C A;  5THA A;  5GMK n;  5GSA A;  4OWR A;  4A0B B;  4ZOY A;  3EI3 A;  5FQD A;  5EAR A;  3ZDZ A;  2OJY A;  1H2Y A;  2IAA A;  4AMY A;  3KCI A;  4UM9 A;  4AMZ A;  4A7J A;  1PEV A;  5H1M A;  4J82 A;  3FM0 A;  2I0S A;  4FA4 D;  3IJ1 A;  3OW8 A;  4L1Q D;  3U4Y A;  1JMX B;  2HXC A;  3IKO A;  4J84 A;  3NIF A;  4ESG A;  3JZG A;  1B9Y A;  3UVL A;  2CN2 A;  5EMM B;  2PM9 B;  2P9P C;  2CE8 A;  3C9C A;  3PVU B;  1H2Z A;  2PBI B;  3AL9 A;  5HE2 B;  3L4O D;  3K6S A;  4PBY A;  2MTA H;  5EM2 B;  3PVW B;  4BCB A;  1N6E A;  2YNO A;  3RLM D;  2J57 G;  3SLE D;  3GC3 B;  1UOP A;  2HU5 A;  2H47 A;  3EMH A;  2Q7Q A;  4JT5 C;  1YR2 A;  4XYH A;  1U4C A;  3N0D A;  3EI4 B;  5EAM A;  3VA6 A;  2H68 A;  2XYI A;  3C5M A;  4QRJ A;  1OLZ A;  2VZ1 A;  3UKR C;  4L3H D;  1TYQ C;  3IJC A;  2VDL A;  4FAN D;  4H5J A;  3UKU C;  1PI6 A;  2CN3 A;  4CZV A;  5FFO A;  3KRX B;  3UVO A;  5I5M A;  5C86 A;  2GNQ A;  2IWK A;  4O02 A;  3CIK B;  2BCJ B;  4J86 A;  3ZE1 A;  2J56 H;  2YNP A;  3DWL C;  1N6D A;  4MMX A;  4WK2 A;  4EWR A;  5AMS A;  2UZX B;  2H9P A;  4A0A A;  4A09 A;  4UM8 A;  4JT6 C;  3PSC B;  3DXK C;  5TEF A;  3DDU A;  2IWF A;  3SFZ A;  5FA5 B;  4J8G A;  1JOF A;  4FA1 D;  4CI3 A;  5TDH B;  5HE0 B;  4A0B A;  2VDM A;  3NVN A;  5C2V B;  3MXX A;  4Y7R A;  4PC0 A;  2P9N C;  4GM8 A;  2P9K C;  4J87 A;  2IUQ A;  4JSN C;  3MKS B;  3SMR A;  4NSX A;  4KFM B;  4A2L A;  1I2M B;  1GG2 B;  4GMB A;  2HES X;  3AH8 B;  4PNK B;  4TZ4 A;  3GRE A;  2P9U C;  1UTC A;  1K8K C;  1JTD B;  3JB9 L;  3EQ9 A;  2B4E A;  2HKM A;  5CXB A;  5IGO A;  3O4H A;  2H14 A;  4FA9 D;  4DNW A;  2VDQ A;  1JV2 A;  4QQE A;  5EAP A;  1K3I A;  4QL1 A;  5EM2 A;  1M1X A;  3PXT D;  3V5W B;  1SQJ A;  1GOF A;  2HYE A;  4U1E I;  4AOW A;  2HKR A;  4GM9 A;  3EI1 A;  2VDN A;  5H17 A;  5K19 A;  2I3T A;  5HDB A;  4JHN A;  3I89 A;  3C99 A;  3QHY B;  1E5T A;  4GQ1 A;  3V7D B;  3V9F A;  1TYE A;  1XKS A;  4J73 A;  4L3G D;  2GC4 A;  3JZH A;  5SXM A;  2I0R A;  1P22 A;  3A0F A;  4MMY A;  4O45 A;  1JJU B;  1VYH C;  2EIC A;  3B7F A;  2OVP B;  3ODT A;  3CFS B;  3F3F A;  4WJK A;  5HYN B;  2VC2 A;  2VDO A;  1C9L A;  2PM6 B;  1GOT B;  4FHL A;  2H9L A;  3SHF A;  4PXW A;  3FCS A;  4O2W A;  4E5Z B;  1MG3 A;  4X60 B;  4LG8 A;  5B4W A;  1C9I A;  5M61 A;  3E0C A;  4U7A A;  5M5V A;  3NIG A;  1XIP A;  2G99 A;  2CNX A;  4A08 B;  3N0E A;  3I7P A;  5TEE A;  3SBP A;  2JKX A;  2OVR B;  4Z7Q A;  1RI6 A;  2IUV A;  3F3P A;  3K26 A;  1PGU A;  2Z2P A;  2AGY A;  4BH6 A;  3AL8 A;  2XZG A;  2PM7 B;  2OK4 A;  5HE1 B;  3I7O A;  3RN1 D;  5FLX g;  3MZL A;  1E8N A;  4GGA A;  2AGL A;  2VDK A;  3ZE2 A;  3GD1 I;  2H13 A;  1L0Q A;  4I79 A;  2GC7 A;  5M5R A;  1NEX B;  3OL2 A;  5M5U A;  2VDP A;  4A11 A;  1QNI A;  3EWE A;  1OMW B;  2UZY B;  3OF7 A;  3RRM C;  5IJ8 E;  3VI3 A;  3O4I A;  4RE6 A;  1L5G A;  3V4P A;  3CFV A;  3V4V A;  1UOQ A;  1PBY B;  3EU7 A;  1XHM A;  2EBS A;  4LGN A;  4ZOZ A;  3ORV D;  3I7K A;  3BG0 A;  5I5J A;  3SWS D;  4BP9 A;  4AEZ A;  1T2X A;  4J0X A;  5KDO B;  3W15 A;  4BCC A;  2W18 A;  3BG1 A;  4JD2 C;  2H6K A;  4CY1 A;  4XEI C;  3SJL D;  4X63 B;  5CYK B;  4K3I D;  2AGW A;  5CXC B;  5FXY A;  3IUL A;  3MUO A;  4GGC A;  3UVK A;  3KRW B;  4NBM A;  5M5S A;  3UVN A;  3PE7 A;  3DSM A;  2I3S A;  4E5Z A;  3HFQ A;  3EQ7 A;  4NC4 A;  3PSL A;  4BP8 A;  1GOG A;  5FKR A;  5EMJ B;  5M5T A;  2QXV A;  3BWS A;  1Q47 A;  2CO0 C;  1QFS A;  2EIB A;  3I7L A;  5EAL A;  3IVM A;  4E54 B;  1H2W A;  2TRC B;  5HQG A;  3GFC A;  4G56 B;  5IGQ A;  1R5M A;  3UR4 A;  3JAM g;  4MMZ A;  2AH0 A;  4A2M A;  3EI3 B;  3ZWL B;  4UI9 R;  3MVD K;  4JHP C;  3O4G A;  2PM9 A;  2AH1 A;  5HE3 B;  2H9M A;  1BPO A;  4ERQ A;  3FCU A;  4ERZ A;  2H6Q A;  2QZP A;  1FWX A;  3P4F A;  4BUJ C;  4YVD A;  3QI0 A;  5GXI A;  4D9S A;  3SVW D;  4X61 B;  4PBZ A;  4JSX C;  2EIE A;  3EQ8 A;  4N14 A;  1VZ3 A;  2P9L C;  4NEN A;  3OTT A;  2XL3 A;  3EI4 A;  3PXS D;  4GZ8 A;  2HU8 A;  2OK6 A;  4G1E A;  4D0K A;  2XDW A;  2OIZ A;  2XE4 A;  3RMZ D;  4O3U B;  4J8B A;  2XU7 A;  5JWZ A;  4PSW B;  4NAA A;  4DNV A;  4J78 A;  2H9N A;  5FFG A;  3OKW A;  3RFH A;  4CC9 A;  1GXR A;  3I8E A;  3L4M D;  3F3G A;  4RE5 A;  2YMU A;  1B9X A;  1N6F A;  3RSE C;  2IUR A;  3MKQ A;  4FA5 D;  5FKS A;  4CY3 A;  4Z7N A;  5E6R A;  4A09 B;  1GOH A;  4O3T B;  3FRX A;  4G1M A;  4FAV D;  3C75 H;  5E6U A;  3NVX A;  4K3J B;  1S4U X;  4G55 A;  3K27 A;  4CY5 A;  3IIY A;  2QC5 A;  4MK0 B;  2H6N A;  1A0R B;  3AFC A;  4GQB B;  3ULE C;  3ZDY A;  3J81 g;  4L9O A;  3SBR A;  3MUN A;  5C2W B;  4CZX A;  1SHY B;  2P9I C;  3VH0 A;  2AGX A;  3EI2 B;  3PXW D;  4CI1 A;  2G9A A;  1GP2 B;  5CXB B;  2B5N A;  3I7H A;  4QT8 A;  1O6F A;  1E8M A;  4HDJ A;  3SBQ A;  4ZOV A;  2YBA A;  1NR0 A;  3DM0 A;  5K1C C;  3OKT A;  3SN6 B;  4X3E A;  1A12 A;  2HU7 A;  3OKY B;  4H5I A;  5EMK B;  2BBK H;  4BL0 A;  4QAM A;  1MDA H;  3IUJ A;  4JSP C;  3VI4 A;  2I0T A;  2HJB A;  4WK4 A;  1VE7 A;  3EI1 B;  4PSX B;  4O9D A;  2WQ8 A;  4ZOX A;  5I5I A;  4ES0 A;  2IUP A;  4Z8L A;  2AGZ A;  1SQ9 A;  4J79 A;  1JMZ B;  5AJA A;  4Y5R D;  4GM3 A;  5C92 A;  3MMY A;  5FKT A;  3J80 g;  4ERY A;  1H2X A;  4OZU A;  4CI2 A;  3RFG A;  5IC7 A;  3IUN A;  3UVM A;  3VGZ A;  1UOO A;  2B5L A;  4J81 A;  1VE6 A;  4JSV C;  4IA9 A;  4Z7O A;  4A08 A;  3JPX A;  3JZN A;  4LG9 A;  2HJ4 A;  2VDR A;  4WK0 A;  4JXM A;  2XL2 A;  4GGD A;  3T3M A;  4DNU A;  5H14 A;  2J55 H;  3I8C A;  3IIW A;  2BKL A;  3DXM C;  3FGB A;  5A2Q g;  3I2N A;  2QR5 A;  4XYI A;  4ZN4 A;  5AFU 3;  2YNN A;  4D6V A;  1QFM A;  3K71 A;  3ZE0 A;  3AL8 B;  3IUQ A;  2Z2O A;  2OVQ B;  1U2V C;  3EI2 A;  4FWW A;  5TF2 A;  4IRZ A;  3JRO A;  1O6G A;  3O4J A;  3OL2 B;  4J0W A;  2VZ3 A;  3NID A;  5GXH A;  3NVQ A;  4A11 B;  3IUR A;  3IUM A;  1MG2 A;  3OKY A;  3MZK A;  4AN1 A;  2CE9 A;  2O9K A;  3K72 A;  5E6S A;  4AX4 A;  4GQ2 P;  5EML B;  2CO0 A;  2YB8 B;  3SCY A;  3IJE A;  5IJ7 E;  2Z2N A;  4O1Q D;  1ERJ A;  5CYK A;  4CY2 A;  4CZY A;  1TBG A;  5CXC A;  5FKQ A;  2AQ5 A;  1K32 A;  4CI8 A;  4IMM A;  3EG6 A; 
#chains in the Genus database with same CATH homology
 4Z7N A;  5E6R A;  3T3M A;  4G1E A;  4MMY A;  4Z7Q A;  3VI3 A;  2VDQ A;  4G1M A;  3ZDX A;  3NID A;  3FCU A;  1JV2 A;  3T3P A;  3NIF A;  1L5G A;  5E6U A;  3V4P A;  2VDM A;  1M1X A;  3V4V A;  3K72 A;  4WJK A;  5E6S A;  2VDL A;  2VC2 A;  2VDO A;  5FFG A;  1U8C A;  5FFO A;  3K6S A;  3IJE A;  4O02 A;  3K71 A;  3FCS A;  2VDK A;  3ZE0 A;  3ZE1 A;  3ZE2 A;  2VDN A;  4Z7O A;  4NEN A;  4WK2 A;  4MMX A;  3ZDZ A;  5HDB A;  2VDR A;  4UM8 A;  4WK0 A;  3VI4 A;  4MMZ A;  3ZDY A;  4UM9 A;  1TYE A;  4WK4 A;  4IRZ A;  2VDP A;  3NIG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...