3OKWA

Mouse semaphorin 6a, extracellular domains 1-2
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
549
structure length
540
Chain Sequence
FPEDSEPISISHGNYTKQYPVFVGHKPGRTQRHRLDIQMIMIMNRTLYVAARDHIYTVDIDTSHTEEIYCSKKLTWKSRQADVDTCRMKGKHKDECHNFIKVLLKKNDDTLFVCGTNAFNPSCRNYRVDTLETFGDEFSGMARCPYDAKHANIALFADGKLYSATVTDFLAIDAVIYRSLGDSPTLRTVKHDSKWLKEPYFVQAVDYGDYIYFFFREIAVEYNGKVVFPRVAQVCKNDMGGSQRVLEKQWTSFLKARLNCSVPGDSHFYFNILQAVTDVIRINGRDVVLATFSTPYNSIPGSAVCAYDMLDIANVFTGRFKEQKSPDSTWTPVPDERVPKPRPGCCAGSSSLEKYATSNEFPDDTLNFIKTHPLMDEAVPSIINRPWFLRTMVRYRLTKIAVDNAAGPYQNHTVVFLGSEKGIILKFLARIGSLNGSLFLEEMNVYNPEKCSYDGVEDKRIMGMQLDRASGSLYVAFSTCVIKVPLGRCERHGKCKKTCIASRDPYCGWVRESGSCAHLSPRLTFEQDIERGNTDGLGDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords Semaphorin-6A
publication title Structural basis of semaphorin-plexin signalling.
pubmed doi rcsb
source organism Mus musculus
total genus 124
structure length 540
sequence length 549
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01403 Sema Sema domain
A PF01437 PSI Plexin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3okwA01
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 3okwA02
5IGQA 4ERQA 3GREA 3IIYA 2CE8A 4JSPC 3PE7A 4A08A 1B9XA 3BG0A 3ULEC 4FA5D 3RLMD 3SLED 2GC7A 2OIZA 1GG2B 4YVDA 4ES0A 1NEXB 4JXMA 2OJYA 3OKYB 5KDOB 1U2VC 4G56B 4CY2A 3NIGB 4CY5A 4FA1D 3ORVD 2VDRB 2TRCB 4E5ZB 3UKUC 2PM6B 4O45A 1PBYB 2PM9A 5E6SB 4A2MA 4L3HD 3NVQA 1TYQC 3I7NA 4QL1A 4QT8A 4PNKB 3FCUB 3I7LA 1A0RB 2Q7QA 3PSCB 1XKSA 2H68A 1SQ9A 3CFVA 4A0AB 3EG6A 5CXBB 4A7JA 4A0BA 1U8CB 3RFHA 4GQBB 4OWRA 2XL3A 3PXSD 2HYEA 3RRMC 1PEVA 3I7HA 1N6DA 3OW8A 1VYHC 4EWRA 1MG2A 2GC4A 2HXCA 1B9YA 4FHLA 2H3XA 2VDMB 4H5JA 1QNIA 3IJCA 3FRXA 4BH6A 3N0EA 2XU7A 3SBRA 1XIPA 3MZKA 4Z7QB 3T3PB 1RI6A 2VDQB 3VI3B 4KFMB 2W18A 2P9SC 3DSMA 1SHYB 3A0FA 2IURA 5GXIA 5AJAA 3L4MD 5FA5B 3RMZD 4A11A 4ERZA 4JT6C 1PI6A 5HYNB 1GOTB 4D0KA 1JOFA 4BL0A 3V7DB 4J87A 2P9NC 3IJ0A 4J77A 4QRJA 3N0DA 4PSXB 1U4CA 3UVMA 1K32A 4O3TB 3J81g 2I0SA 3PSLA 5K1CC 3K26A 5EMLB 5TEFA 2AGXA 3OTTA 2VDKB 4WK2B 3NVXA 5EM2A 2B5MA 2CE9A 3SXTD 3EI2B 3EI3B 3ZWLB 3GFCA 4X63B 5JWZA 3C5MA 4JSNC 3EI4A 4X3EA 2I0RA 5FXYA 3I7OA 3AL8A 4ZOVA 3AL9A 3SJLD 5FKQA 4E54A 4PBYA 2G9AA 2H9MA 3ZE1B 2Z2OA 5SXMA 5EALA 2H9LA 3NVNA 4HDJA 4CZVA 5HE3B 4CI1A 5FKSA 2I0TA 2VDLB 5B4WA 2O9KA 3MZLA 3UVKA 2IWFA 2J56H 2CN2A 3I8CA 4PSWB 1XHMA 4CZXA 5FKRA 5TF2A 2OK6A 3VH0A 2YB8B 4GM8A 1YUKA 2VDPB 2BBKH 2OVRB 2MTAH 2EBSA 3OKYA 4J8GA 2OVPB 1ERJA 1N6FA 3MXXA 4LGNA 1PGUA 3ZE2B 5IGOA 4U7AA 4J8BA 4E5ZA 5IT9g 4IMMA 3SHFA 3JB9L 4Z7OB 1OLZA 4Z8LA 2H6KA 4PC0A 1SQJA 5E6UB 2AGLA 5CXCB 3SVWD 3HFQA 4K3ID 3UVLA 3VA6A 1S4UX 2UZYB 3ODTA 4A0AA 3ZE0B 5CXBA 3FGBA 3RN0D 5IC7A 5EMMB 4WJKB 3CIKB 3UVOA 3J80g 5C2VB 5GXHA 4J0XA 3KRWB 3V5WB 2B5NA 4NSXA 1SSLA 5TDHB 3C9CA 4FWWA 4ZOZA 3SWSD 5FQDA 3EWEA 4FAND 3JAMg 4N14A 4GM3A 5A2Qg 2IWKA 4D6VA 2B5LA 4A09B 4PXWA 4LG8A 4JSXC 3EI1B 2BCJB 3I7PA 3SBPA 3VI4B 2P9IC 4J79A 3I8EA 2AGYA 3I89A 3I7KA 4I79A 5EMKB 2IUVA 4J86A 4GQ2P 2PBIB 4TZ4A 5GMKn 2J55H 2CNXA 2QXVA 5CYKB 5THAA 2H47A 1GXRA 4J81A 3OL2B 2H6NA 5H14A 3F3GA 5HE1B 2AGWA 4CI8A 2YBAA 3B7FA 4FAVD 1TBGA 2XL2A 3JPXA 4L3GD 3RFGA 4LG9A 2CN3A 3JROA 4O9DA 2I3SA 2PM7B 1OMWB 2H14A 2J57G 2AGZA 3RSEC 3EI2A 3EI3A 2OVQB 5I5MA 1JMXB 3KRXB 4GZ8A 2AH1A 1JJUB 2HJBA 5FLXg 5HDBB 3K27A 4UI9R 3L4OD 5EMJB 3AFCA 2CO0A 2YNNA 1K8KC 5HQGA 4J0WA 2H6QA 5H17A 2H9PA 4CZYA 2P9PC 5IJ8E 5E6RB 3PVUB 4FA4D 4ZN4A 3JZNA 1R5MA 4O3UB 5C2WB 3EU7A 2H13A 1NR0A 2IUPA 2CO0C 3OKTA 3DXMC 3UKRC 3ZDYB 5H1MA 1Q47A 2HKMA 1YFQA 2OK4A 3C75H 4A2LA 2YMUA 3JZHA 4GGDA 3V9FA 4CC9A 5EARA 2Z2NA 4BUJC 1P22A 3SBQA 5EAMA 4GGAA 3P4FA 5EAPA 5CXCA 3DM0A 4X60B 3E0CA 3I2NA 5IJ7E 4A08B 4Z7NB 3F3FA 1TYEB 4J78A 2VC2B 2IUQA 3UVNA 1JMZB 4AEZA 4QQEA 4WK0B 3PVWB 3MMYA 5I5JA 5K19A 3FM0A 3SFZA 2HJ4A 5HE0B 2VDNB 3DXKC 4XYIA 3UR4A 2G99A 2PM9B 2HKRA 5HE2B 2B4EA 3MKQA 1GP2B 4A09A 3EI1A 3OKWA 3JZGA 3PXTD 4L9OA 3RN1D 5AFU3 3MKSB 3ZDZB 1L0QA 4CI3A 2GNQA 2QC5A 3JRPA 3PXWD 1MG3A 3BG1A 4GGCA 4O1QD 4UM8B 4JSVC 2H9NA 4ZOXA 4OZUA 5CYKA 4K3JB 4XEIC 4A0BB 3SCYA 4WK4B 4L1QD 3OL2A 2AH0A 2P9LC 3F3PA 3C99A 4IA9A 4Y5RD 3IKOA 5C9ZB 4UM9D 4J73A 5I5IA 4U1EI 3SN6B 3NIFB 3AH8B 1MDAH 4ZOYA 2Z2PA 4XYHA 2P28A 2HESX 4PBZA 2UZXB 4JD2C 4GM9A 4Y7RA 3VGZA 4AOWA 4GQ1A 4CI2A 3DWLC 4ERYA 4CY1A 4A11B 2YNOA 2VDOB 5AMSA 3NIDB 2XYIA 3IJ1A 3EMHA 4FB1D 5FKTA 2YNPA 5TEEA 4X61B 4MK0B 3CFSB 5EM2B 4J82A 4UM9B 3T3MB 4R7AB 3IIWA 4JT5C 3BWSA 2IAAA 5GSAA 1N6EA 4ESGA 3EI4B 3SMRA 2P26A 2I3TA 4CY3A 3AL8B 3W15A 4E54B 4H5IA 2P9KC 3U4YA 4J84A 2P9UC 1FWXA 3ZDXB 4GMBA 4FA9D 2AQ5A
chains in the Genus database with same CATH superfamily
2EIEA 5IGQA 4ERQA 3GREA 3IIYA 2CE8A 4JSPC 3PE7A 3O4IA 4A08A 1B9XA 3BG0A 3ULEC 4Z7NA 1TYEA 4FA5D 3RLMD 3SLED 2GC7A 3O4JA 4AMZA 2OIZA 1GG2B 4YVDA 4AN0A 4ES0A 1NEXB 4JXMA 4WK0A 2OJYA 4RE5A 3OKYB 5KDOB 1U2VC 4G56B 4CY2A 3NIGB 4CY5A 4FA1D 3ORVD 2VDRB 1GOGA 2TRCB 4E5ZB 2VDNA 3UKUC 2PM6B 4O45A 1PBYB 2PM9A 2QZPA 5E6SB 3MUNA 4DNVA 4A2MA 4L3HD 1H2WA 3ZDZA 3NVQA 1TYQC 3I7NA 4QL1A 4QT8A 4PNKB 3FCUB 3I7LA 1A0RB 2Q7QA 4G1EA 4UM8A 3PSCB 1L5GA 5M5SA 1XKSA 2H68A 1I2MB 2JWHA 1SQ9A 3CFVA 4A0AB 3EG6A 4NENA 5CXBB 4A7JA 4A0BA 4WK4A 1U8CB 3RFHA 4GQBB 4OWRA 4IRZA 2XL3A 3PXSD 2HYEA 3RRMC 1PEVA 4BCDA 3I7HA 4BP8A 1N6DA 3OW8A 1VYHC 4EWRA 1MG2A 2GC4A 2HXCA 1B9YA 4FHLA 1O6GA 2H3XA 4H5JA 2VDMB 1QNIA 3IJCA 3FRXA 3NIFA 2HU8A 3N0EA 4BH6A 2XU7A 3SBRA 1XIPA 3MZKA 4RE6A 3T3PB 4Z7QB 1RI6A 2VDQB 3VI3B 3IULA 4KFMB 2W18A 2P9SC 3DSMA 1SHYB 3A0FA 1M1XA 2IURA 5GXIA 4MMXA 5AJAA 3QI0A 1H2XA 3L4MD 5FA5B 3RMZD 4A11A 4ERZA 4JT6C 1PI6A 5HYNB 1GOTB 4D0KA 1JOFA 4BL0A 2VDOA 3V7DB 4J87A 2P9NC 3IJ0A 4J77A 4QRJA 3N0DA 4PSXB 3NIDA 2XDWA 1U4CA 4O2WA 3UVMA 1K32A 4O3TB 3J81g 4NBMA 2I0SA 3PSLA 5K1CC 3K26A 2EICA 5EMLB 5TEFA 2AGXA 3OTTA 2VDKB 4WK2B 3K71A 3NVXA 5EM2A 2B5MA 2CE9A 4UM9A 3SXTD 3T3MA 3EI2B 1UOPA 3EI3B 3ZWLB 5C92A 3GFCA 4X63B 5JWZA 3C5MA 4JSNC 3EI4A 4X3EA 2I0RA 5FXYA 3K72A 3I7OA 3AL8A 4ZOVA 3AL9A 3SJLD 5FKQA 4E54A 4PBYA 2G9AA 2H9MA 3ZE1B 2Z2OA 3ZDXA 3V4VA 5SXMA 4JHPC 5EALA 4DNUA 1K3IA 2H9LA 3IUMA 3NVNA 4HDJA 4CZVA 5HE3B 4CI1A 4O02A 3IUQA 5FKSA 2I0TA 2VDLB 5B4WA 2O9KA 3EQ7A 3MZLA 3UVKA 2IWFA 1C9IA 4AMYA 2J56H 2CN2A 3I8CA 3O4GA 4PSWB 1UOQA 1XHMA 4CZXA 5FKRA 5TF2A 2OK6A 1JTDB 3VH0A 2YB8B 4GM8A 1YUKA 2VDPB 2XZGA 2BBKH 2OVRB 2MTAH 1VZ3A 2EBSA 3OKYA 4J8GA 2OVPB 1ERJA 1N6FA 3MXXA 4LGNA 3NIGA 1PGUA 1O6FA 3ZE2B 5IGOA 4U7AA 4J8BA 2VDRA 4E5ZA 5IT9g 1JV2A 4BP9A 4IMMA 4NC4A 1E8NA 4QAMA 3SHFA 3JB9L 5E6SA 4G55A 4Z7OB 2QR5A 1OLZA 2BKLA 4Z8LA 2H6KA 4PC0A 1SQJA 1VE6A 3GC3B 5E6UB 3FCUA 2AGLA 5CXCB 3SVWD 3HFQA 4K3ID 3UVLA 3VA6A 5M5VA 1S4UX 2UZYB 3IUJA 3ODTA 4A0AA 5M5UA 3ZE0B 5CXBA 3FGBA 3RN0D 5IC7A 5EMMB 4WJKB 3CIKB 3UVOA 1H2ZA 3J80g 1U8CA 5C2VB 5GXHA 4J0XA 3KRWB 3V5WB 2B5NA 4NSXA 3IURA 4AX4A 1SSLA 5TDHB 3C9CA 4FWWA 4ZOZA 3SWSD 5FQDA 2EIBA 3EWEA 4FAND 2VDMA 3JAMg 4N14A 2HU7A 4GM3A 4JHNA 5A2Qg 2IWKA 1A12A 4D6VA 2B5LA 3O4HA 4PXWA 3IUNA 4LG8A 4JSXC 4A09B 3EI1B 2BCJB 4Z7QA 3I7PA 3SBPA 3T3PA 3VI4B 2VDQA 2P9IC 3I8EA 3I89A 2AGYA 3I7KA 4J79A 4I79A 5EMKB 3VI3A 2IUVA 4J86A 4GQ2P 2PBIB 4TZ4A 5FFOA 5GMKn 2J55H 2CNXA 2QXVA 1GOHA 5CYKB 3OF7A 5THAA 2H47A 1GXRA 4J81A 3OL2B 2H6NA 5H14A 3F3GA 5HE1B 2AGWA 4CI8A 2YBAA 1BPOA 3B7FA 4FAVD 1TBGA 2XL2A 3JPXA 5M61A 4L3GD 3RFGA 4LG9A 2CN3A 3JROA 4O9DA 2I3SA 2PM7B 2VDKA 4WK2A 3MVDK 3IJEA 1OMWB 2H14A 2J57G 2AGZA 3RSEC 3EI2A 3EI3A 3EQ8A 2OVQB 5I5MA 1JMXB 3KRXB 4GZ8A 2AH1A 1JJUB 2HJBA 5FLXg 5HDBB 3K27A 4UI9R 3L4OD 5EMJB 3AFCA 2CO0A 2YNNA 1K8KC 5HQGA 1VE7A 4J0WA 2H6QA 2VZ1A 5H17A 3ZE1A 2H9PA 4D9SA 4CZYA 2P9PC 5IJ8E 4L1MA 5E6RB 3PVUB 4FA4D 4ZN4A 3JZNA 1R5MA 1YR2A 1QFSA 2VDLA 4O3UB 5C2WB 3EU7A 2H13A 4DNWA 1NR0A 2IUPA 2CO0C 3OKTA 3DXMC 3UKRC 3ZDYB 5H1MA 2VZ3A 3FCSA 1Q47A 1GOFA 2HKMA 2VDPA 1YFQA 2OK4A 3C75H 4A2LA 2YMUA 3JZHA 4G1MA 4GGDA 3V9FA 3ZE2A 3GD1I 4CC9A 5EARA 2Z2NA 1E8MA 4BUJC 1P22A 4Z7OA 3SBQA 5EAMA 3KCIA 4GGAA 1H2YA 3IVMA 3P4FA 5EAPA 5C86A 5E6UA 1C9LA 2VC2A 5CXCA 3DM0A 4X60B 3E0CA 3I2NA 5IJ7E 4A08B 4Z7NB 3F3FA 1TYEB 4J78A 2VC2B 2IUQA 3ZE0A 1UOOA 3UVNA 4WJKA 1JMZB 4AEZA 3DDUA 4QQEA 4WK0B 1VZ2A 3MMYA 3PVWB 2JKXA 5I5JA 4NAAA 5K19A 3FM0A 3SFZA 2HJ4A 3EQ9A 5HE0B 3K6SA 3DXKC 4XYIA 2VDNB 3UR4A 2G99A 2PM9B 2HKRA 5HE2B 2B4EA 3MKQA 1GP2B 4A09A 1QFMA 3EI1A 3OKWA 3JZGA 3VI4A 2EIDA 3PXTD 4L9OA 3RN1D 3MKSB 5AFU3 4BCBA 3ZDZB 1L0QA 4CI3A 2GNQA 2QC5A 3JRPA 3PXWD 1MG3A 3BG1A 4GGCA 4O1QD 4UM8B 4JSVC 3V4PA 2H9NA 4ZOXA 4OZUA 5CYKA 4K3JB 4XEIC 4A0BB 3SCYA 4WK4B 5M5RA 4AN1A 4L1QD 3OL2A 2AH0A 2P9LC 3F3PA 3C99A 4IA9A 4Y5RD 3IKOA 5C9ZB 4UM9D 4J73A 5I5IA 4U1EI 3SN6B 5M5TA 3NIFB 3AH8B 3MUOA 1MDAH 4ZOYA 2Z2PA 4XYHA 2P28A 2HESX 4MMYA 4PBZA 2UZXB 4JD2C 4GM9A 4Y7RA 3VGZA 4AOWA 4GQ1A 4CI2A 3DWLC 2XE4A 4ERYA 4CY1A 5HDBA 1T2XA 4A11B 2YNOA 5FFGA 2VDOB 3QHYB 5AMSA 2JWGA 3NIDB 2XYIA 1UTCA 5E6RA 3IJ1A 3EMHA 4FB1D 5FKTA 2YNPA 5TEEA 4BCCA 4X61B 4MK0B 3CFSB 5EM2B 4J82A 4UM9B 3T3MB 1E5TA 3ZDYA 2HU5A 4R7AB 3IIWA 4JT5C 3BWSA 2IAAA 5GSAA 1N6EA 4MMZA 4ESGA 3EI4B 3SMRA 2P26A 2I3TA 4CY3A 3AL8B 3W15A 4E54B 4H5IA 2P9KC 3U4YA 4J84A 2P9UC 1FWXA 2WQ8A 3ZDXB 4GMBA 4FA9D 2AQ5A
chains in the Genus database with same CATH topology
5IGQA 4ERQA 3GREA 3IIYA 2CE8A 4JSPC 3PE7A 4A08A 1B9XA 3BG0A 3ULEC 4FA5D 3RLMD 3SLED 2GC7A 2OIZA 1GG2B 4YVDA 4ES0A 1NEXB 4JXMA 2OJYA 3OKYB 5KDOB 1U2VC 4G56B 4CY2A 3NIGB 4CY5A 4FA1D 3ORVD 2VDRB 2TRCB 4E5ZB 3UKUC 2PM6B 4O45A 1PBYB 2PM9A 5E6SB 4A2MA 4L3HD 3NVQA 1TYQC 3I7NA 4QL1A 4QT8A 4PNKB 3FCUB 3I7LA 1A0RB 2Q7QA 3PSCB 1XKSA 2H68A 2JWHA 1SQ9A 3CFVA 4A0AB 3EG6A 5CXBB 4A7JA 4A0BA 1U8CB 3RFHA 4GQBB 4OWRA 2XL3A 3PXSD 2HYEA 3RRMC 1PEVA 3I7HA 1N6DA 3OW8A 1VYHC 4EWRA 1MG2A 2GC4A 2HXCA 1B9YA 4FHLA 2H3XA 2VDMB 4H5JA 1QNIA 3IJCA 3FRXA 4BH6A 3N0EA 2XU7A 3SBRA 1XIPA 3MZKA 4Z7QB 3T3PB 1RI6A 2VDQB 3VI3B 4KFMB 2W18A 2P9SC 3DSMA 1SHYB 3A0FA 2IURA 5GXIA 5AJAA 3L4MD 5FA5B 3RMZD 4A11A 4ERZA 4JT6C 1PI6A 5HYNB 1GOTB 4D0KA 1JOFA 4BL0A 3V7DB 4J87A 2P9NC 3IJ0A 4J77A 4QRJA 3N0DA 4PSXB 1U4CA 3UVMA 1K32A 4O3TB 3J81g 2I0SA 3PSLA 5K1CC 3K26A 5EMLB 5TEFA 2AGXA 3OTTA 2VDKB 4WK2B 3NVXA 5EM2A 2B5MA 2CE9A 3SXTD 3EI2B 3EI3B 3ZWLB 3GFCA 4X63B 5JWZA 3C5MA 4JSNC 3EI4A 4X3EA 2I0RA 5FXYA 3I7OA 3AL8A 4ZOVA 3AL9A 3SJLD 5FKQA 4E54A 4PBYA 2G9AA 2H9MA 3ZE1B 2Z2OA 5SXMA 5EALA 2H9LA 3NVNA 4HDJA 4CZVA 5HE3B 4CI1A 5FKSA 2I0TA 2VDLB 5B4WA 2O9KA 3MZLA 3UVKA 2IWFA 2J56H 2CN2A 3I8CA 4PSWB 1XHMA 4CZXA 5FKRA 5TF2A 2OK6A 3VH0A 2YB8B 4GM8A 1YUKA 2VDPB 2BBKH 2OVRB 2MTAH 2EBSA 3OKYA 4J8GA 2OVPB 1ERJA 1N6FA 3MXXA 4LGNA 1PGUA 3ZE2B 5IGOA 4U7AA 4J8BA 4E5ZA 5IT9g 4IMMA 3SHFA 3JB9L 4Z7OB 1OLZA 4Z8LA 2H6KA 4PC0A 1SQJA 5E6UB 2AGLA 5CXCB 3SVWD 3HFQA 4K3ID 3UVLA 3VA6A 1S4UX 2UZYB 3ODTA 4A0AA 3ZE0B 5CXBA 3FGBA 3RN0D 5IC7A 5EMMB 4WJKB 3CIKB 3UVOA 3J80g 5C2VB 5GXHA 4J0XA 3KRWB 3V5WB 2B5NA 4NSXA 1SSLA 5TDHB 3C9CA 4FWWA 4ZOZA 3SWSD 5FQDA 3EWEA 4FAND 3JAMg 4N14A 4GM3A 5A2Qg 2IWKA 4D6VA 2B5LA 4A09B 4PXWA 4LG8A 4JSXC 3EI1B 2BCJB 3I7PA 3SBPA 3VI4B 2P9IC 4J79A 3I8EA 2AGYA 3I89A 3I7KA 4I79A 5EMKB 2IUVA 4J86A 4GQ2P 2PBIB 4TZ4A 5GMKn 2J55H 2CNXA 2QXVA 5CYKB 5THAA 2H47A 1GXRA 4J81A 3OL2B 2H6NA 5H14A 3F3GA 5HE1B 2AGWA 4CI8A 2YBAA 3B7FA 4FAVD 1TBGA 2XL2A 3JPXA 4L3GD 3RFGA 4LG9A 2CN3A 3JROA 4O9DA 2I3SA 2PM7B 1OMWB 2H14A 2J57G 2AGZA 3RSEC 3EI2A 3EI3A 2OVQB 5I5MA 1JMXB 3KRXB 4GZ8A 2AH1A 1JJUB 2HJBA 5FLXg 5HDBB 3K27A 4UI9R 3L4OD 5EMJB 3AFCA 2CO0A 2YNNA 1K8KC 5HQGA 4J0WA 2H6QA 5H17A 2H9PA 4CZYA 2P9PC 5IJ8E 5E6RB 3PVUB 4FA4D 4ZN4A 3JZNA 1R5MA 4O3UB 5C2WB 3EU7A 2H13A 1NR0A 2IUPA 2CO0C 3OKTA 3DXMC 3UKRC 3ZDYB 5H1MA 1Q47A 2HKMA 1YFQA 2OK4A 3C75H 4A2LA 2YMUA 3JZHA 4GGDA 3V9FA 4CC9A 5EARA 2Z2NA 4BUJC 1P22A 3SBQA 5EAMA 4GGAA 3P4FA 5EAPA 5CXCA 3DM0A 4X60B 3E0CA 3I2NA 5IJ7E 4A08B 4Z7NB 3F3FA 1TYEB 4J78A 2VC2B 2IUQA 3UVNA 1JMZB 4AEZA 4QQEA 4WK0B 3PVWB 3MMYA 5I5JA 5K19A 3FM0A 3SFZA 2HJ4A 5HE0B 2VDNB 3DXKC 4XYIA 3UR4A 2G99A 2PM9B 2HKRA 5HE2B 2B4EA 3MKQA 1GP2B 4A09A 3EI1A 3OKWA 3JZGA 3PXTD 4L9OA 3RN1D 5AFU3 3MKSB 3ZDZB 1L0QA 4CI3A 2GNQA 2QC5A 3JRPA 3PXWD 1MG3A 3BG1A 4GGCA 4O1QD 4UM8B 4JSVC 2H9NA 4ZOXA 4OZUA 5CYKA 4K3JB 4XEIC 4A0BB 3SCYA 4WK4B 4L1QD 3OL2A 2AH0A 2P9LC 3F3PA 3C99A 4IA9A 4Y5RD 3IKOA 5C9ZB 4UM9D 4J73A 5I5IA 4U1EI 3SN6B 3NIFB 3AH8B 1MDAH 4ZOYA 2Z2PA 4XYHA 2P28A 2HESX 4PBZA 2UZXB 4JD2C 4GM9A 4Y7RA 3VGZA 4AOWA 4GQ1A 4CI2A 3DWLC 4ERYA 4CY1A 4A11B 2YNOA 2VDOB 5AMSA 2JWGA 3NIDB 2XYIA 3IJ1A 3EMHA 4FB1D 5FKTA 2YNPA 5TEEA 4X61B 4MK0B 3CFSB 5EM2B 4J82A 4UM9B 3T3MB 4R7AB 3IIWA 4JT5C 3BWSA 2IAAA 5GSAA 1N6EA 4ESGA 3EI4B 3SMRA 2P26A 2I3TA 4CY3A 3AL8B 3W15A 4E54B 4H5IA 2P9KC 3U4YA 4J84A 2P9UC 1FWXA 3ZDXB 4GMBA 4FA9D 2AQ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IGQ A;  4ERQ A;  3GRE A;  3IIY A;  2CE8 A;  4JSP C;  3PE7 A;  4A08 A;  1B9X A;  3BG0 A;  3ULE C;  4FA5 D;  3RLM D;  3SLE D;  2GC7 A;  2OIZ A;  1GG2 B;  4YVD A;  4ES0 A;  1NEX B;  4JXM A;  2OJY A;  3OKY B;  5KDO B;  1U2V C;  4G56 B;  4CY2 A;  3NIG B;  4CY5 A;  4FA1 D;  3ORV D;  2VDR B;  2TRC B;  4E5Z B;  3UKU C;  2PM6 B;  4O45 A;  1PBY B;  2PM9 A;  5E6S B;  4A2M A;  4L3H D;  3NVQ A;  1TYQ C;  3I7N A;  4QL1 A;  4QT8 A;  4PNK B;  3FCU B;  3I7L A;  1A0R B;  2Q7Q A;  3PSC B;  1XKS A;  2H68 A;  1SQ9 A;  3CFV A;  4A0A B;  3EG6 A;  5CXB B;  4A7J A;  4A0B A;  1U8C B;  3RFH A;  4GQB B;  4OWR A;  2XL3 A;  3PXS D;  2HYE A;  3RRM C;  1PEV A;  3I7H A;  1N6D A;  3OW8 A;  1VYH C;  4EWR A;  1MG2 A;  2GC4 A;  2HXC A;  1B9Y A;  4FHL A;  2H3X A;  2VDM B;  4H5J A;  1QNI A;  3IJC A;  3FRX A;  4BH6 A;  3N0E A;  2XU7 A;  3SBR A;  1XIP A;  3MZK A;  4Z7Q B;  3T3P B;  1RI6 A;  2VDQ B;  3VI3 B;  4KFM B;  2W18 A;  2P9S C;  3DSM A;  1SHY B;  3A0F A;  2IUR A;  5GXI A;  5AJA A;  3L4M D;  5FA5 B;  3RMZ D;  4A11 A;  4ERZ A;  4JT6 C;  1PI6 A;  5HYN B;  1GOT B;  4D0K A;  1JOF A;  4BL0 A;  3V7D B;  4J87 A;  2P9N C;  3IJ0 A;  4J77 A;  4QRJ A;  3N0D A;  4PSX B;  1U4C A;  3UVM A;  1K32 A;  4O3T B;  3J81 g;  2I0S A;  3PSL A;  5K1C C;  3K26 A;  5EML B;  5TEF A;  2AGX A;  3OTT A;  2VDK B;  4WK2 B;  3NVX A;  5EM2 A;  2B5M A;  2CE9 A;  3SXT D;  3EI2 B;  3EI3 B;  3ZWL B;  3GFC A;  4X63 B;  5JWZ A;  3C5M A;  4JSN C;  3EI4 A;  4X3E A;  2I0R A;  5FXY A;  3I7O A;  3AL8 A;  4ZOV A;  3AL9 A;  3SJL D;  5FKQ A;  4E54 A;  4PBY A;  2G9A A;  2H9M A;  3ZE1 B;  2Z2O A;  5SXM A;  5EAL A;  2H9L A;  3NVN A;  4HDJ A;  4CZV A;  5HE3 B;  4CI1 A;  5FKS A;  2I0T A;  2VDL B;  5B4W A;  2O9K A;  3MZL A;  3UVK A;  2IWF A;  2J56 H;  2CN2 A;  3I8C A;  4PSW B;  1XHM A;  4CZX A;  5FKR A;  5TF2 A;  2OK6 A;  3VH0 A;  2YB8 B;  4GM8 A;  1YUK A;  2VDP B;  2BBK H;  2OVR B;  2MTA H;  2EBS A;  3OKY A;  4J8G A;  2OVP B;  1ERJ A;  1N6F A;  3MXX A;  4LGN A;  1PGU A;  3ZE2 B;  5IGO A;  4U7A A;  4J8B A;  4E5Z A;  5IT9 g;  4IMM A;  3SHF A;  3JB9 L;  4Z7O B;  1OLZ A;  4Z8L A;  2H6K A;  4PC0 A;  1SQJ A;  5E6U B;  2AGL A;  5CXC B;  3SVW D;  3HFQ A;  4K3I D;  3UVL A;  3VA6 A;  1S4U X;  2UZY B;  3ODT A;  4A0A A;  3ZE0 B;  5CXB A;  3FGB A;  3RN0 D;  5IC7 A;  5EMM B;  4WJK B;  3CIK B;  3UVO A;  3J80 g;  5C2V B;  5GXH A;  4J0X A;  3KRW B;  3V5W B;  2B5N A;  4NSX A;  1SSL A;  5TDH B;  3C9C A;  4FWW A;  4ZOZ A;  3SWS D;  5FQD A;  3EWE A;  4FAN D;  3JAM g;  4N14 A;  4GM3 A;  5A2Q g;  2IWK A;  4D6V A;  2B5L A;  4A09 B;  4PXW A;  4LG8 A;  4JSX C;  3EI1 B;  2BCJ B;  3I7P A;  3SBP A;  3VI4 B;  2P9I C;  4J79 A;  3I8E A;  2AGY A;  3I89 A;  3I7K A;  4I79 A;  5EMK B;  2IUV A;  4J86 A;  4GQ2 P;  2PBI B;  4TZ4 A;  5GMK n;  2J55 H;  2CNX A;  2QXV A;  5CYK B;  5THA A;  2H47 A;  1GXR A;  4J81 A;  3OL2 B;  2H6N A;  5H14 A;  3F3G A;  5HE1 B;  2AGW A;  4CI8 A;  2YBA A;  3B7F A;  4FAV D;  1TBG A;  2XL2 A;  3JPX A;  4L3G D;  3RFG A;  4LG9 A;  2CN3 A;  3JRO A;  4O9D A;  2I3S A;  2PM7 B;  1OMW B;  2H14 A;  2J57 G;  2AGZ A;  3RSE C;  3EI2 A;  3EI3 A;  2OVQ B;  5I5M A;  1JMX B;  3KRX B;  4GZ8 A;  2AH1 A;  1JJU B;  2HJB A;  5FLX g;  5HDB B;  3K27 A;  4UI9 R;  3L4O D;  5EMJ B;  3AFC A;  2CO0 A;  2YNN A;  1K8K C;  5HQG A;  4J0W A;  2H6Q A;  5H17 A;  2H9P A;  4CZY A;  2P9P C;  5IJ8 E;  5E6R B;  3PVU B;  4FA4 D;  4ZN4 A;  3JZN A;  1R5M A;  4O3U B;  5C2W B;  3EU7 A;  2H13 A;  1NR0 A;  2IUP A;  2CO0 C;  3OKT A;  3DXM C;  3UKR C;  3ZDY B;  5H1M A;  1Q47 A;  2HKM A;  1YFQ A;  2OK4 A;  3C75 H;  4A2L A;  2YMU A;  3JZH A;  4GGD A;  3V9F A;  4CC9 A;  5EAR A;  2Z2N A;  4BUJ C;  1P22 A;  3SBQ A;  5EAM A;  4GGA A;  3P4F A;  5EAP A;  5CXC A;  3DM0 A;  4X60 B;  3E0C A;  3I2N A;  5IJ7 E;  4A08 B;  4Z7N B;  3F3F A;  1TYE B;  4J78 A;  2VC2 B;  2IUQ A;  3UVN A;  1JMZ B;  4AEZ A;  4QQE A;  4WK0 B;  3PVW B;  3MMY A;  5I5J A;  5K19 A;  3FM0 A;  3SFZ A;  2HJ4 A;  5HE0 B;  2VDN B;  3DXK C;  4XYI A;  3UR4 A;  2G99 A;  2PM9 B;  2HKR A;  5HE2 B;  2B4E A;  3MKQ A;  1GP2 B;  4A09 A;  3EI1 A;  3OKW A;  3JZG A;  3PXT D;  4L9O A;  3RN1 D;  5AFU 3;  3MKS B;  3ZDZ B;  1L0Q A;  4CI3 A;  2GNQ A;  2QC5 A;  3JRP A;  3PXW D;  1MG3 A;  3BG1 A;  4GGC A;  4O1Q D;  4UM8 B;  4JSV C;  2H9N A;  4ZOX A;  4OZU A;  5CYK A;  4K3J B;  4XEI C;  4A0B B;  3SCY A;  4WK4 B;  4L1Q D;  3OL2 A;  2AH0 A;  2P9L C;  3F3P A;  3C99 A;  4IA9 A;  4Y5R D;  3IKO A;  5C9Z B;  4UM9 D;  4J73 A;  5I5I A;  4U1E I;  3SN6 B;  3NIF B;  3AH8 B;  1MDA H;  4ZOY A;  2Z2P A;  4XYH A;  2P28 A;  2HES X;  4PBZ A;  2UZX B;  4JD2 C;  4GM9 A;  4Y7R A;  3VGZ A;  4AOW A;  4GQ1 A;  4CI2 A;  3DWL C;  4ERY A;  4CY1 A;  4A11 B;  2YNO A;  2VDO B;  5AMS A;  3NID B;  2XYI A;  3IJ1 A;  3EMH A;  4FB1 D;  5FKT A;  2YNP A;  5TEE A;  4X61 B;  4MK0 B;  3CFS B;  5EM2 B;  4J82 A;  4UM9 B;  3T3M B;  4R7A B;  3IIW A;  4JT5 C;  3BWS A;  2IAA A;  5GSA A;  1N6E A;  4ESG A;  3EI4 B;  3SMR A;  2P26 A;  2I3T A;  4CY3 A;  3AL8 B;  3W15 A;  4E54 B;  4H5I A;  2P9K C;  3U4Y A;  4J84 A;  2P9U C;  1FWX A;  3ZDX B;  4GMB A;  4FA9 D;  2AQ5 A; 
#chains in the Genus database with same CATH topology
 2EIE A;  5IGQ A;  4ERQ A;  3GRE A;  3IIY A;  2CE8 A;  4JSP C;  3PE7 A;  3O4I A;  4A08 A;  1B9X A;  3BG0 A;  3ULE C;  4Z7N A;  1TYE A;  4FA5 D;  3RLM D;  3SLE D;  2GC7 A;  3O4J A;  4AMZ A;  2OIZ A;  1GG2 B;  4YVD A;  4AN0 A;  4ES0 A;  1NEX B;  4JXM A;  4WK0 A;  2OJY A;  4RE5 A;  3OKY B;  5KDO B;  1U2V C;  4G56 B;  4CY2 A;  3NIG B;  4CY5 A;  4FA1 D;  3ORV D;  2VDR B;  1GOG A;  2TRC B;  4E5Z B;  2VDN A;  3UKU C;  2PM6 B;  4O45 A;  1PBY B;  2PM9 A;  2QZP A;  5E6S B;  3MUN A;  4DNV A;  4A2M A;  4L3H D;  1H2W A;  3ZDZ A;  3NVQ A;  1TYQ C;  3I7N A;  4QL1 A;  4QT8 A;  4PNK B;  3FCU B;  3I7L A;  1A0R B;  2Q7Q A;  4G1E A;  4UM8 A;  3PSC B;  1L5G A;  5M5S A;  1XKS A;  2H68 A;  1I2M B;  2JWH A;  1SQ9 A;  3CFV A;  4A0A B;  3EG6 A;  4NEN A;  5CXB B;  4A7J A;  4A0B A;  4WK4 A;  1U8C B;  3RFH A;  4GQB B;  4OWR A;  4IRZ A;  2XL3 A;  3PXS D;  2HYE A;  3RRM C;  1PEV A;  4BCD A;  3I7H A;  4BP8 A;  1N6D A;  3OW8 A;  1VYH C;  4EWR A;  1MG2 A;  2GC4 A;  2HXC A;  1B9Y A;  4FHL A;  1O6G A;  2H3X A;  4H5J A;  2VDM B;  1QNI A;  3IJC A;  3FRX A;  3NIF A;  2HU8 A;  3N0E A;  4BH6 A;  2XU7 A;  3SBR A;  1XIP A;  3MZK A;  4RE6 A;  3T3P B;  4Z7Q B;  1RI6 A;  2VDQ B;  3VI3 B;  3IUL A;  4KFM B;  2W18 A;  2P9S C;  3DSM A;  1SHY B;  3A0F A;  1M1X A;  2IUR A;  5GXI A;  4MMX A;  5AJA A;  3QI0 A;  1H2X A;  3L4M D;  5FA5 B;  3RMZ D;  4A11 A;  4ERZ A;  4JT6 C;  1PI6 A;  5HYN B;  1GOT B;  4D0K A;  1JOF A;  4BL0 A;  2VDO A;  3V7D B;  4J87 A;  2P9N C;  3IJ0 A;  4J77 A;  4QRJ A;  3N0D A;  4PSX B;  3NID A;  2XDW A;  1U4C A;  4O2W A;  3UVM A;  1K32 A;  4O3T B;  3J81 g;  4NBM A;  2I0S A;  3PSL A;  5K1C C;  3K26 A;  2EIC A;  5EML B;  5TEF A;  2AGX A;  3OTT A;  2VDK B;  4WK2 B;  3K71 A;  3NVX A;  5EM2 A;  2B5M A;  2CE9 A;  4UM9 A;  3SXT D;  3T3M A;  3EI2 B;  1UOP A;  3EI3 B;  3ZWL B;  5C92 A;  3GFC A;  4X63 B;  5JWZ A;  3C5M A;  4JSN C;  3EI4 A;  4X3E A;  2I0R A;  5FXY A;  3K72 A;  3I7O A;  3AL8 A;  4ZOV A;  3AL9 A;  3SJL D;  5FKQ A;  4E54 A;  4PBY A;  2G9A A;  2H9M A;  3ZE1 B;  2Z2O A;  3ZDX A;  3V4V A;  5SXM A;  4JHP C;  5EAL A;  4DNU A;  1K3I A;  2H9L A;  3IUM A;  3NVN A;  4HDJ A;  4CZV A;  5HE3 B;  4CI1 A;  4O02 A;  3IUQ A;  5FKS A;  2I0T A;  2VDL B;  5B4W A;  2O9K A;  3EQ7 A;  3MZL A;  3UVK A;  2IWF A;  1C9I A;  4AMY A;  2J56 H;  2CN2 A;  3I8C A;  3O4G A;  4PSW B;  1UOQ A;  1XHM A;  4CZX A;  5FKR A;  5TF2 A;  2OK6 A;  1JTD B;  3VH0 A;  2YB8 B;  4GM8 A;  1YUK A;  2VDP B;  2XZG A;  2BBK H;  2OVR B;  2MTA H;  1VZ3 A;  2EBS A;  3OKY A;  4J8G A;  2OVP B;  1ERJ A;  1N6F A;  3MXX A;  4LGN A;  3NIG A;  1PGU A;  1O6F A;  3ZE2 B;  5IGO A;  4U7A A;  4J8B A;  2VDR A;  4E5Z A;  5IT9 g;  1JV2 A;  4BP9 A;  4IMM A;  4NC4 A;  1E8N A;  4QAM A;  3SHF A;  3JB9 L;  5E6S A;  4G55 A;  4Z7O B;  2QR5 A;  1OLZ A;  2BKL A;  4Z8L A;  2H6K A;  4PC0 A;  1SQJ A;  1VE6 A;  3GC3 B;  5E6U B;  3FCU A;  2AGL A;  5CXC B;  3SVW D;  3HFQ A;  4K3I D;  3UVL A;  3VA6 A;  5M5V A;  1S4U X;  2UZY B;  3IUJ A;  3ODT A;  4A0A A;  5M5U A;  3ZE0 B;  5CXB A;  3FGB A;  3RN0 D;  5IC7 A;  5EMM B;  4WJK B;  3CIK B;  3UVO A;  1H2Z A;  3J80 g;  1U8C A;  5C2V B;  5GXH A;  4J0X A;  3KRW B;  3V5W B;  2B5N A;  4NSX A;  3IUR A;  4AX4 A;  1SSL A;  5TDH B;  3C9C A;  4FWW A;  4ZOZ A;  3SWS D;  5FQD A;  2EIB A;  3EWE A;  4FAN D;  2VDM A;  3JAM g;  4N14 A;  2HU7 A;  4GM3 A;  4JHN A;  5A2Q g;  2IWK A;  1A12 A;  4D6V A;  2B5L A;  3O4H A;  4PXW A;  3IUN A;  4LG8 A;  4JSX C;  4A09 B;  3EI1 B;  2BCJ B;  4Z7Q A;  3I7P A;  3SBP A;  3T3P A;  3VI4 B;  2VDQ A;  2P9I C;  3I8E A;  3I89 A;  2AGY A;  3I7K A;  4J79 A;  4I79 A;  5EMK B;  3VI3 A;  2IUV A;  4J86 A;  4GQ2 P;  2PBI B;  4TZ4 A;  5FFO A;  5GMK n;  2J55 H;  2CNX A;  2QXV A;  1GOH A;  5CYK B;  3OF7 A;  5THA A;  2H47 A;  1GXR A;  4J81 A;  3OL2 B;  2H6N A;  5H14 A;  3F3G A;  5HE1 B;  2AGW A;  4CI8 A;  2YBA A;  1BPO A;  3B7F A;  4FAV D;  1TBG A;  2XL2 A;  3JPX A;  5M61 A;  4L3G D;  3RFG A;  4LG9 A;  2CN3 A;  3JRO A;  4O9D A;  2I3S A;  2PM7 B;  2VDK A;  4WK2 A;  3MVD K;  3IJE A;  1OMW B;  2H14 A;  2J57 G;  2AGZ A;  3RSE C;  3EI2 A;  3EI3 A;  3EQ8 A;  2OVQ B;  5I5M A;  1JMX B;  3KRX B;  4GZ8 A;  2AH1 A;  1JJU B;  2HJB A;  5FLX g;  5HDB B;  3K27 A;  4UI9 R;  3L4O D;  5EMJ B;  3AFC A;  2CO0 A;  2YNN A;  1K8K C;  5HQG A;  1VE7 A;  4J0W A;  2H6Q A;  2VZ1 A;  5H17 A;  3ZE1 A;  2H9P A;  4D9S A;  4CZY A;  2P9P C;  5IJ8 E;  4L1M A;  5E6R B;  3PVU B;  4FA4 D;  4ZN4 A;  3JZN A;  1R5M A;  1YR2 A;  1QFS A;  2VDL A;  4O3U B;  5C2W B;  3EU7 A;  2H13 A;  4DNW A;  1NR0 A;  2IUP A;  2CO0 C;  3OKT A;  3DXM C;  3UKR C;  3ZDY B;  5H1M A;  2VZ3 A;  3FCS A;  1Q47 A;  1GOF A;  2HKM A;  2VDP A;  1YFQ A;  2OK4 A;  3C75 H;  4A2L A;  2YMU A;  3JZH A;  4G1M A;  4GGD A;  3V9F A;  3ZE2 A;  3GD1 I;  4CC9 A;  5EAR A;  2Z2N A;  1E8M A;  4BUJ C;  1P22 A;  4Z7O A;  3SBQ A;  5EAM A;  3KCI A;  4GGA A;  1H2Y A;  3IVM A;  3P4F A;  5EAP A;  5C86 A;  5E6U A;  1C9L A;  2VC2 A;  5CXC A;  3DM0 A;  4X60 B;  3E0C A;  3I2N A;  5IJ7 E;  4A08 B;  4Z7N B;  3F3F A;  1TYE B;  4J78 A;  2VC2 B;  2IUQ A;  3ZE0 A;  1UOO A;  3UVN A;  4WJK A;  1JMZ B;  4AEZ A;  3DDU A;  4QQE A;  4WK0 B;  1VZ2 A;  3MMY A;  3PVW B;  2JKX A;  5I5J A;  4NAA A;  5K19 A;  3FM0 A;  3SFZ A;  2HJ4 A;  3EQ9 A;  5HE0 B;  3K6S A;  3DXK C;  4XYI A;  2VDN B;  3UR4 A;  2G99 A;  2PM9 B;  2HKR A;  5HE2 B;  2B4E A;  3MKQ A;  1GP2 B;  4A09 A;  1QFM A;  3EI1 A;  3OKW A;  3JZG A;  3VI4 A;  2EID A;  3PXT D;  4L9O A;  3RN1 D;  3MKS B;  5AFU 3;  4BCB A;  3ZDZ B;  1L0Q A;  4CI3 A;  2GNQ A;  2QC5 A;  3JRP A;  3PXW D;  1MG3 A;  3BG1 A;  4GGC A;  4O1Q D;  4UM8 B;  4JSV C;  3V4P A;  2H9N A;  4ZOX A;  4OZU A;  5CYK A;  4K3J B;  4XEI C;  4A0B B;  3SCY A;  4WK4 B;  5M5R A;  4AN1 A;  4L1Q D;  3OL2 A;  2AH0 A;  2P9L C;  3F3P A;  3C99 A;  4IA9 A;  4Y5R D;  3IKO A;  5C9Z B;  4UM9 D;  4J73 A;  5I5I A;  4U1E I;  3SN6 B;  5M5T A;  3NIF B;  3AH8 B;  3MUO A;  1MDA H;  4ZOY A;  2Z2P A;  4XYH A;  2P28 A;  2HES X;  4MMY A;  4PBZ A;  2UZX B;  4JD2 C;  4GM9 A;  4Y7R A;  3VGZ A;  4AOW A;  4GQ1 A;  4CI2 A;  3DWL C;  2XE4 A;  4ERY A;  4CY1 A;  5HDB A;  1T2X A;  4A11 B;  2YNO A;  5FFG A;  2VDO B;  3QHY B;  5AMS A;  2JWG A;  3NID B;  2XYI A;  1UTC A;  5E6R A;  3IJ1 A;  3EMH A;  4FB1 D;  5FKT A;  2YNP A;  5TEE A;  4BCC A;  4X61 B;  4MK0 B;  3CFS B;  5EM2 B;  4J82 A;  4UM9 B;  3T3M B;  1E5T A;  3ZDY A;  2HU5 A;  4R7A B;  3IIW A;  4JT5 C;  3BWS A;  2IAA A;  5GSA A;  1N6E A;  4MMZ A;  4ESG A;  3EI4 B;  3SMR A;  2P26 A;  2I3T A;  4CY3 A;  3AL8 B;  3W15 A;  4E54 B;  4H5I A;  2P9K C;  3U4Y A;  4J84 A;  2P9U C;  1FWX A;  2WQ8 A;  3ZDX B;  4GMB A;  4FA9 D;  2AQ5 A; 
#chains in the Genus database with same CATH homology
 5IGQ A;  4ERQ A;  3GRE A;  3IIY A;  2CE8 A;  4JSP C;  3PE7 A;  4A08 A;  1B9X A;  3BG0 A;  3ULE C;  4FA5 D;  3RLM D;  3SLE D;  2GC7 A;  2OIZ A;  1GG2 B;  4YVD A;  4ES0 A;  1NEX B;  4JXM A;  2OJY A;  3OKY B;  5KDO B;  1U2V C;  4G56 B;  4CY2 A;  3NIG B;  4CY5 A;  4FA1 D;  3ORV D;  2VDR B;  2TRC B;  4E5Z B;  3UKU C;  2PM6 B;  4O45 A;  1PBY B;  2PM9 A;  5E6S B;  4A2M A;  4L3H D;  3NVQ A;  1TYQ C;  3I7N A;  4QL1 A;  4QT8 A;  4PNK B;  3FCU B;  3I7L A;  1A0R B;  2Q7Q A;  3PSC B;  1XKS A;  2H68 A;  2JWH A;  1SQ9 A;  3CFV A;  4A0A B;  3EG6 A;  5CXB B;  4A7J A;  4A0B A;  1U8C B;  3RFH A;  4GQB B;  4OWR A;  2XL3 A;  3PXS D;  2HYE A;  3RRM C;  1PEV A;  3I7H A;  1N6D A;  3OW8 A;  1VYH C;  4EWR A;  1MG2 A;  2GC4 A;  2HXC A;  1B9Y A;  4FHL A;  2H3X A;  2VDM B;  4H5J A;  1QNI A;  3IJC A;  3FRX A;  4BH6 A;  3N0E A;  2XU7 A;  3SBR A;  1XIP A;  3MZK A;  4Z7Q B;  3T3P B;  1RI6 A;  2VDQ B;  3VI3 B;  4KFM B;  2W18 A;  2P9S C;  3DSM A;  1SHY B;  3A0F A;  2IUR A;  5GXI A;  5AJA A;  3L4M D;  5FA5 B;  3RMZ D;  4A11 A;  4ERZ A;  4JT6 C;  1PI6 A;  5HYN B;  1GOT B;  4D0K A;  1JOF A;  4BL0 A;  3V7D B;  4J87 A;  2P9N C;  3IJ0 A;  4J77 A;  4QRJ A;  3N0D A;  4PSX B;  1U4C A;  3UVM A;  1K32 A;  4O3T B;  3J81 g;  2I0S A;  3PSL A;  5K1C C;  3K26 A;  5EML B;  5TEF A;  2AGX A;  3OTT A;  2VDK B;  4WK2 B;  3NVX A;  5EM2 A;  2B5M A;  2CE9 A;  3SXT D;  3EI2 B;  3EI3 B;  3ZWL B;  3GFC A;  4X63 B;  5JWZ A;  3C5M A;  4JSN C;  3EI4 A;  4X3E A;  2I0R A;  5FXY A;  3I7O A;  3AL8 A;  4ZOV A;  3AL9 A;  3SJL D;  5FKQ A;  4E54 A;  4PBY A;  2G9A A;  2H9M A;  3ZE1 B;  2Z2O A;  5SXM A;  5EAL A;  2H9L A;  3NVN A;  4HDJ A;  4CZV A;  5HE3 B;  4CI1 A;  5FKS A;  2I0T A;  2VDL B;  5B4W A;  2O9K A;  3MZL A;  3UVK A;  2IWF A;  2J56 H;  2CN2 A;  3I8C A;  4PSW B;  1XHM A;  4CZX A;  5FKR A;  5TF2 A;  2OK6 A;  3VH0 A;  2YB8 B;  4GM8 A;  1YUK A;  2VDP B;  2BBK H;  2OVR B;  2MTA H;  2EBS A;  3OKY A;  4J8G A;  2OVP B;  1ERJ A;  1N6F A;  3MXX A;  4LGN A;  1PGU A;  3ZE2 B;  5IGO A;  4U7A A;  4J8B A;  4E5Z A;  5IT9 g;  4IMM A;  3SHF A;  3JB9 L;  4Z7O B;  1OLZ A;  4Z8L A;  2H6K A;  4PC0 A;  1SQJ A;  5E6U B;  2AGL A;  5CXC B;  3SVW D;  3HFQ A;  4K3I D;  3UVL A;  3VA6 A;  1S4U X;  2UZY B;  3ODT A;  4A0A A;  3ZE0 B;  5CXB A;  3FGB A;  3RN0 D;  5IC7 A;  5EMM B;  4WJK B;  3CIK B;  3UVO A;  3J80 g;  5C2V B;  5GXH A;  4J0X A;  3KRW B;  3V5W B;  2B5N A;  4NSX A;  1SSL A;  5TDH B;  3C9C A;  4FWW A;  4ZOZ A;  3SWS D;  5FQD A;  3EWE A;  4FAN D;  3JAM g;  4N14 A;  4GM3 A;  5A2Q g;  2IWK A;  4D6V A;  2B5L A;  4A09 B;  4PXW A;  4LG8 A;  4JSX C;  3EI1 B;  2BCJ B;  3I7P A;  3SBP A;  3VI4 B;  2P9I C;  4J79 A;  3I8E A;  2AGY A;  3I89 A;  3I7K A;  4I79 A;  5EMK B;  2IUV A;  4J86 A;  4GQ2 P;  2PBI B;  4TZ4 A;  5GMK n;  2J55 H;  2CNX A;  2QXV A;  5CYK B;  5THA A;  2H47 A;  1GXR A;  4J81 A;  3OL2 B;  2H6N A;  5H14 A;  3F3G A;  5HE1 B;  2AGW A;  4CI8 A;  2YBA A;  3B7F A;  4FAV D;  1TBG A;  2XL2 A;  3JPX A;  4L3G D;  3RFG A;  4LG9 A;  2CN3 A;  3JRO A;  4O9D A;  2I3S A;  2PM7 B;  1OMW B;  2H14 A;  2J57 G;  2AGZ A;  3RSE C;  3EI2 A;  3EI3 A;  2OVQ B;  5I5M A;  1JMX B;  3KRX B;  4GZ8 A;  2AH1 A;  1JJU B;  2HJB A;  5FLX g;  5HDB B;  3K27 A;  4UI9 R;  3L4O D;  5EMJ B;  3AFC A;  2CO0 A;  2YNN A;  1K8K C;  5HQG A;  4J0W A;  2H6Q A;  5H17 A;  2H9P A;  4CZY A;  2P9P C;  5IJ8 E;  5E6R B;  3PVU B;  4FA4 D;  4ZN4 A;  3JZN A;  1R5M A;  4O3U B;  5C2W B;  3EU7 A;  2H13 A;  1NR0 A;  2IUP A;  2CO0 C;  3OKT A;  3DXM C;  3UKR C;  3ZDY B;  5H1M A;  1Q47 A;  2HKM A;  1YFQ A;  2OK4 A;  3C75 H;  4A2L A;  2YMU A;  3JZH A;  4GGD A;  3V9F A;  4CC9 A;  5EAR A;  2Z2N A;  4BUJ C;  1P22 A;  3SBQ A;  5EAM A;  4GGA A;  3P4F A;  5EAP A;  5CXC A;  3DM0 A;  4X60 B;  3E0C A;  3I2N A;  5IJ7 E;  4A08 B;  4Z7N B;  3F3F A;  1TYE B;  4J78 A;  2VC2 B;  2IUQ A;  3UVN A;  1JMZ B;  4AEZ A;  4QQE A;  4WK0 B;  3PVW B;  3MMY A;  5I5J A;  5K19 A;  3FM0 A;  3SFZ A;  2HJ4 A;  5HE0 B;  2VDN B;  3DXK C;  4XYI A;  3UR4 A;  2G99 A;  2PM9 B;  2HKR A;  5HE2 B;  2B4E A;  3MKQ A;  1GP2 B;  4A09 A;  3EI1 A;  3OKW A;  3JZG A;  3PXT D;  4L9O A;  3RN1 D;  5AFU 3;  3MKS B;  3ZDZ B;  1L0Q A;  4CI3 A;  2GNQ A;  2QC5 A;  3JRP A;  3PXW D;  1MG3 A;  3BG1 A;  4GGC A;  4O1Q D;  4UM8 B;  4JSV C;  2H9N A;  4ZOX A;  4OZU A;  5CYK A;  4K3J B;  4XEI C;  4A0B B;  3SCY A;  4WK4 B;  4L1Q D;  3OL2 A;  2AH0 A;  2P9L C;  3F3P A;  3C99 A;  4IA9 A;  4Y5R D;  3IKO A;  5C9Z B;  4UM9 D;  4J73 A;  5I5I A;  4U1E I;  3SN6 B;  3NIF B;  3AH8 B;  1MDA H;  4ZOY A;  2Z2P A;  4XYH A;  2P28 A;  2HES X;  4PBZ A;  2UZX B;  4JD2 C;  4GM9 A;  4Y7R A;  3VGZ A;  4AOW A;  4GQ1 A;  4CI2 A;  3DWL C;  4ERY A;  4CY1 A;  4A11 B;  2YNO A;  2VDO B;  5AMS A;  2JWG A;  3NID B;  2XYI A;  3IJ1 A;  3EMH A;  4FB1 D;  5FKT A;  2YNP A;  5TEE A;  4X61 B;  4MK0 B;  3CFS B;  5EM2 B;  4J82 A;  4UM9 B;  3T3M B;  4R7A B;  3IIW A;  4JT5 C;  3BWS A;  2IAA A;  5GSA A;  1N6E A;  4ESG A;  3EI4 B;  3SMR A;  2P26 A;  2I3T A;  4CY3 A;  3AL8 B;  3W15 A;  4E54 B;  4H5I A;  2P9K C;  3U4Y A;  4J84 A;  2P9U C;  1FWX A;  3ZDX B;  4GMB A;  4FA9 D;  2AQ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...