3OKWA

Mouse semaphorin 6a, extracellular domains 1-2
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
549
structure length
540
Chain Sequence
FPEDSEPISISHGNYTKQYPVFVGHKPGRTQRHRLDIQMIMIMNRTLYVAARDHIYTVDIDTSHTEEIYCSKKLTWKSRQADVDTCRMKGKHKDECHNFIKVLLKKNDDTLFVCGTNAFNPSCRNYRVDTLETFGDEFSGMARCPYDAKHANIALFADGKLYSATVTDFLAIDAVIYRSLGDSPTLRTVKHDSKWLKEPYFVQAVDYGDYIYFFFREIAVEYNGKVVFPRVAQVCKNDMGGSQRVLEKQWTSFLKARLNCSVPGDSHFYFNILQAVTDVIRINGRDVVLATFSTPYNSIPGSAVCAYDMLDIANVFTGRFKEQKSPDSTWTPVPDERVPKPRPGCCAGSSSLEKYATSNEFPDDTLNFIKTHPLMDEAVPSIINRPWFLRTMVRYRLTKIAVDNAAGPYQNHTVVFLGSEKGIILKFLARIGSLNGSLFLEEMNVYNPEKCSYDGVEDKRIMGMQLDRASGSLYVAFSTCVIKVPLGRCERHGKCKKTCIASRDPYCGWVRESGSCAHLSPRLTFEQDIERGNTDGLGDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Semaphorin-6A
publication title Structural basis of semaphorin-plexin signalling.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 124
structure length 540
sequence length 549
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01403 Sema Sema domain
A PF01437 PSI Plexin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3okwA01
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 3okwA02
3P4FA 2VDOB 2QC5A 2VDQB 4O1QD 4GGCA 4QT8A 3ZE2B 2XL2A 5E6SB 1JOFA 2I0RA 5IT9g 3EI2A 4JT6C 2PBIB 1GP2B 4K3ID 2VDKB 3SBQA 3RSEC 4J84A 4J78A 4J82A 2J55H 4Z7OB 1JMXB 3DM0A 2HYEA 4ZOXA 3L4OD 2YMUA 3BG1A 5CXBA 5C2VB 5TF2A 3RLMD 3IIYA 4A09A 1JJUB 2OJYA 5GXHA 3OW8A 2B4EA 4EWRA 3VGZA 5C9ZB 4E54A 1YUKA 1XKSA 3KRWB 4A2LA 4O45A 2VDNB 3T3MB 3MKQA 2VDRB 3IIWA 4GM3A 4FA5D 5EALA 4QQEA 4WK0B 2H6KA 3J80g 4BH6A 1TYEB 5FQDA 2IURA 4E5ZA 3UKRC 1GXRA 4N14A 4JSXC 3DXKC 2YNOA 1XHMA 5FXYA 3CFVA 5K1CC 3UVNA 3C5MA 4PXWA 3JAMg 4IMMA 4J81A 1VYHC 2H9NA 5EARA 2PM9A 3EG6A 4CI8A 3NIFB 1L0QA 1GOTB 4J8GA 3IJ1A 1NR0A 4UM9D 2GC7A 4JSVC 5HQGA 3C9CA 4FWWA 5CXBB 3JROA 4J73A 5FKTA 3OKYA 1QNIA 1S4UX 5FKSA 3EI4A 3OKTA 3NVQA 4CI2A 1SSLA 4JSPC 3EMHA 5HDBB 4E54B 3J81g 5EAPA 2XL3A 3NVXA 3B7FA 4X60B 3SFZA 3KRXB 4GZ8A 4ES0A 2P9UC 5E6UB 3OTTA 2G99A 3ULEC 2H9PA 5FA5B 3SMRA 4J86A 2TRCB 4J8BA 3RN0D 5I5IA 4NSXA 3AFCA 4Y7RA 4FA9D 2AQ5A 4CZXA 3I7HA 4CY1A 3EWEA 5I5JA 5EM2B 2YNPA 2J57G 3ODTA 3ZE0B 2CNXA 2PM9B 4FHLA 4FA4D 4ERZA 2Z2NA 4UM8B 3CFSB 3F3FA 4XEIC 4K3JB 2AGXA 1U4CA 2AGYA 2P9IC 3W15A 4OWRA 3PVWB 5TEEA 5FKQA 2OIZA 5CXCA 3V9FA 5TEFA 3OKYB 4L3HD 2GC4A 3UVOA 1OLZA 2EBSA 3SLED 3I7KA 3NIGB 4X63B 2PM7B 3FCUB 3UKUC 3ZWLB 2HKMA 4J77A 5HE0B 3FGBA 1MG3A 3C75H 4U1EI 3EU7A 2HKRA 4CY3A 3E0CA 3PXSD 3U4YA 3PVUB 3SJLD 3BG0A 3AH8B 3N0DA 3UVKA 4AOWA 2B5LA 4A08A 5IJ7E 2H6NA 2AGZA 2XYIA 3MZKA 3PSLA 4J0WA 2P9KC 3C99A 3HFQA 4A2MA 3IKOA 4GGAA 3ZE1B 1JMZB 1SQ9A 4A11A 4GM9A 1K32A 4JT5C 3I7OA 3I7NA 4I79A 3VI4B 1A0RB 4PBZA 3OKWA 2YNNA 3RRMC 3OL2A 1TYQC 3DWLC 4D0KA 3DXMC 4CY2A 2CN3A 4KFMB 3EI1A 3VH0A 1PEVA 2J56H 4H5JA 1GG2B 2IUVA 3V5WB 2OVQB 4XYIA 5EMKB 3SCYA 3I7PA 3AL9A 3EI2B 1ERJA 1Q47A 2IUQA 4GQBB 4PSWB 4R7AB 2UZYB 5H1MA 4CC9A 1R5MA 3DSMA 5IJ8E 4A0BA 3SN6B 5HE3B 3AL8A 4ZN4A 3SVWD 3NIDB 4D6VA 2Z2PA 3UR4A 4A7JA 4A09B 3GFCA 5EAMA 5HYNB 4OZUA 1XIPA 4PC0A 5I5MA 2OVPB 1PI6A 2I3SA 3MXXA 4A0AA 3IJCA 4LG8A 3BWSA 5THAA 5EMJB 1RI6A 4UM9B 4CZYA 5C2WB 2CE8A 1TBGA 4Z7NB 4A11B 4GM8A 4U7AA 3SWSD 5IC7A 2HXCA 3UVLA 3K26A 2H68A 2CE9A 4E5ZB 1N6DA 4JXMA 4LGNA 4GGDA 3UVMA 3V7DB 3ORVD 3EI1B 4Z8LA 2HJ4A 4Z7QB 4FB1D 3MMYA 3ZDYB 2H9MA 2P9PC 4O3TB 3VI3B 4J87A 4GQ1A 5IGOA 5EMMB 4XYHA 3JZNA 4A0BB 2IWKA 4ESGA 3AL8B 3FRXA 4UI9R 2Q7QA 4X61B 2YB8B 2IWFA 4J0XA 2OVRB 1N6EA 2IAAA 3EI4B 2B5NA 4MK0B 2YBAA 2HJBA 2H13A 3PE7A 4YVDA 3PXWD 5GXIA 5TDHB 2VDLB 3PSCB 4A0AB 3F3GA 5FLXg 3EI3A 3T3PB 5CYKA 2H3XA 1YFQA 1SQJA 5E6RB 3PXTD 5AJAA 4LG9A 2H9LA 2CN2A 3NVNA 5JWZA 4JD2C 3RMZD 3SBRA 5SXMA 4CY5A 4GMBA 2I3TA 1FWXA 3JZGA 4O9DA 3CIKB 1PGUA 4PSXB 2P26A 2AH0A 3JPXA 2GNQA 5FKRA 1U2VC 3L4MD 2P9LC 3SHFA 5A2Qg 4FA1D 4G56B 1B9XA 2OK6A 4PBYA 2HESX 2PM6B 5AMSA 3ZDZB 4FAVD 5IGQA 3VA6A 1MDAH 4Y5RD 3RN1D 4WK2B 4ERYA 4CI3A 5CXCB 4GQ2P 2I0SA 5KDOB 2CO0A 3I2NA 3JZHA 5H17A 4JSNC 2I0TA 4PNKB 4QL1A 3F3PA 5H14A 3JRPA 2W18A 3EI3B 2Z2OA 5CYKB 2BBKH 1B9YA 4L3GD 4AEZA 3RFHA 1K8KC 5EM2A 3I8EA 3IJ0A 4TZ4A 4ZOVA 4BUJC 5AFU3 1NEXB 2H6QA 3GREA 4IA9A 4ERQA 3JB9L 2VC2B 5EMLB 4WK4B 4A08B 2AH1A 4QRJA 2G9AA 3N0EA 2XU7A 5B4WA 2UZXB 2AGWA 3ZDXB 1P22A 2AGLA 1U8CB 1OMWB 2VDPB 4CZVA 3OL2B 1N6FA 4HDJA 3MZLA 3SBPA 3SXTD 4BL0A 4L1QD 5GMKn 1PBYB 4WJKB 2P9NC 2P9SC 2QXVA 3I89A 2H14A 3FM0A 4H5IA 5GSAA 2B5MA 2BCJB 4O3UB 5K19A 4FAND 2MTAH 3I7LA 4X3EA 3RFGA 3I8CA 4ZOYA 2OK4A 4L9OA 5HE1B 3A0FA 2IUPA 2O9KA 1SHYB 3K27A 4ZOZA 2CO0C 2VDMB 4J79A 2H47A 4CI1A 5HE2B 1MG2A 2P28A 3MKSB
chains in the Genus database with same CATH superfamily
3P4FA 2VDOB 1UOPA 2QC5A 2VDQB 4O1QD 4GGCA 4QT8A 3ZE2B 2XL2A 5E6SB 1JOFA 2I0RA 5IT9g 3EI2A 4JT6C 2PBIB 3FCSA 1GP2B 1O6GA 4K3ID 2VDKB 3SBQA 3RSEC 4J84A 4D9SA 4J78A 4J82A 2J55H 4Z7OB 1JMXB 1M1XA 3DM0A 2HYEA 4ZOXA 3L4OD 2YMUA 3BG1A 5CXBA 5M61A 5C2VB 5TF2A 3RLMD 1JV2A 2JWGA 3IIYA 3KCIA 4A09A 1JJUB 2OJYA 5GXHA 3OW8A 2B4EA 5HDBA 3VGZA 4EWRA 5C9ZB 4E54A 1YUKA 1XKSA 3KRWB 4A2LA 4O45A 4UM9A 3IUNA 2VDNB 2XDWA 5E6UA 3MKQA 2VDRB 3IIWA 3T3MB 4GM3A 4G1MA 1H2XA 1E8NA 4FA5D 5EALA 4QQEA 4WK0B 2H6KA 2QZPA 3J80g 4BH6A 1TYEB 5FQDA 2IURA 4E5ZA 3UKRC 1GXRA 3DDUA 4N14A 4JSXC 3DXKC 2YNOA 1XHMA 4AX4A 5FXYA 3CFVA 4Z7QA 5K1CC 3UVNA 3C5MA 4PXWA 3ZDYA 3JAMg 4IMMA 4J81A 1VYHC 2H9NA 5EARA 2PM9A 3EG6A 4UM8A 4CI8A 3NIFB 1L0QA 1GOTB 4J8GA 3IJ1A 1NR0A 1T2XA 4UM9D 2GC7A 4JSVC 3IVMA 5HQGA 4AN1A 1E5TA 3C9CA 4FWWA 5CXBB 3JROA 4BP9A 1QFMA 4J73A 5FKTA 3OKYA 1QNIA 1S4UX 5FKSA 3EI4A 3OKTA 3NVQA 4CI2A 1SSLA 4JSPC 3EMHA 5HDBB 5M5VA 2VDLA 4E54B 3J81g 5FFOA 5EAPA 2XL3A 3NVXA 3B7FA 4X60B 3SFZA 2BKLA 3KRXB 4GZ8A 1H2ZA 4ES0A 2P9UC 5E6UB 3OTTA 2G99A 3ULEC 2H9PA 5FA5B 3SMRA 4J86A 3OF7A 1C9LA 2TRCB 1K3IA 4J8BA 3RN0D 5M5RA 5I5IA 4NSXA 3AFCA 4Y7RA 4FA9D 2AQ5A 4CZXA 3I7HA 2VZ3A 3EWEA 4CY1A 4NENA 3ZE1A 1VZ3A 1C9IA 5I5JA 5EM2B 2YNPA 5C92A 2J57G 3ODTA 3VI4A 3ZE0B 2CNXA 2PM9B 1GOHA 4FHLA 4FA4D 4ERZA 2Z2NA 4UM8B 3CFSB 3F3FA 4XEIC 3ZDZA 4K3JB 2AGXA 1U4CA 2AGYA 2P9IC 3W15A 4OWRA 3PVWB 5TEEA 5FKQA 2OIZA 5CXCA 3V9FA 5TEFA 3OKYB 4L3HD 3QHYB 4G1EA 1L5GA 2GC4A 3UVOA 4BCDA 1OLZA 2EBSA 3SLED 3I7KA 3IUQA 3NIGB 4X63B 2PM7B 3FCUB 3UKUC 3ZWLB 2HKMA 4J77A 4QAMA 5HE0B 3FGBA 1MG3A 3C75H 3NIDA 4U1EI 3EU7A 2HKRA 4CY3A 2EIEA 3E0CA 3PXSD 3V4VA 3PVUB 3SJLD 3U4YA 4O2WA 3BG0A 2JWHA 4L1MA 3AH8B 3N0DA 3UVKA 4AOWA 2B5LA 4A08A 5IJ7E 2H6NA 2AGZA 2XYIA 1H2WA 3MZKA 3PSLA 4J0WA 2P9KC 3C99A 3HFQA 4A2MA 3IKOA 4GGAA 3ZE1B 3K6SA 1JMZB 3ZDXA 1U8CA 4Z7NA 1SQ9A 2VDPA 4A11A 4GM9A 1K32A 4JT5C 3I7OA 3I7NA 4I79A 3VI4B 1A0RB 4PBZA 3OKWA 2YNNA 4G55A 3OL2A 3RRMC 1TYQC 3DWLC 4AMZA 4D0KA 3DXMC 4CY2A 2CN3A 4KFMB 3EI1A 3VH0A 1PEVA 2J56H 4H5JA 1GG2B 2IUVA 3V5WB 2OVQB 4XYIA 5EMKB 3SCYA 3MUNA 3GD1I 3I7PA 1GOFA 3AL9A 3EI2B 1ERJA 1VE7A 5M5UA 1Q47A 2IUQA 4GQBB 4PSWB 4R7AB 2UZYB 5H1MA 4CC9A 4DNVA 1R5MA 3K72A 3DSMA 3VI3A 2EICA 4O02A 3EQ7A 5IJ8E 4A0BA 3SN6B 3K71A 5HE3B 3AL8A 4BP8A 4BCCA 4ZN4A 3SVWD 2EIDA 2HU5A 3NIDB 4D6VA 2Z2PA 3UR4A 4A7JA 4A09B 3GFCA 5EAMA 3O4IA 5HYNB 4OZUA 1XIPA 4PC0A 5I5MA 2OVPB 1PI6A 2I3SA 3MXXA 4A0AA 2VDOA 3IJCA 4LG8A 3BWSA 5THAA 3T3PA 5EMJB 1RI6A 3ZE2A 4UM9B 5E6RA 5E6SA 4CZYA 5C2WB 2CE8A 1TBGA 4Z7NB 4A11B 4GM8A 4U7AA 3SWSD 5IC7A 2EIBA 2HXCA 3UVLA 3K26A 2H68A 4DNUA 2CE9A 4E5ZB 1N6DA 4JXMA 4Z7OA 4LGNA 4GGDA 3UVMA 3MVDK 2WQ8A 3V7DB 3ORVD 3EI1B 1A12A 4JHNA 4Z8LA 2HJ4A 4Z7QB 4RE6A 4FB1D 3MMYA 4IRZA 1GOGA 3ZDYB 2H9MA 4NAAA 4DNWA 2P9PC 1UTCA 4O3TB 5C86A 3VI3B 3IULA 4J87A 2XZGA 4GQ1A 3IUMA 5IGOA 5EMMB 4XYHA 3JZNA 4A0BB 2IWKA 3EQ8A 4ESGA 3AL8B 3FRXA 4UI9R 2Q7QA 4X61B 2VDRA 2YB8B 4WK2A 2IWFA 2HU8A 4J0XA 2OVRB 4WK0A 1N6EA 4BCBA 2IAAA 3EI4B 2B5NA 4MK0B 2YBAA 2HJBA 2H13A 3PE7A 4YVDA 3PXWD 5GXIA 3QI0A 5TDHB 2VDLB 4AN0A 3PSCB 1YR2A 4A0AB 3F3GA 5FLXg 3EI3A 3V4PA 3T3PB 5CYKA 2H3XA 3O4GA 1YFQA 1I2MB 1SQJA 5E6RB 3PXTD 5AJAA 4LG9A 2H9LA 2CN2A 3NVNA 5M5TA 3NIFA 5JWZA 2VC2A 4JD2C 4WK4A 1QFSA 3RMZD 3SBRA 5SXMA 4CY5A 4GMBA 1VE6A 2I3TA 1FWXA 3JZGA 4O9DA 2XE4A 3CIKB 1PGUA 4PSXB 2P26A 2AH0A 3JPXA 2GNQA 3O4HA 5FKRA 1U2VC 3L4MD 2P9LC 3SHFA 5A2Qg 4FA1D 1O6FA 4G56B 4AMYA 1B9XA 2OK6A 1UOOA 2HESX 1E8MA 2VZ1A 4PBYA 2PM6B 5AMSA 3ZDZB 4FAVD 5IGQA 4WJKA 3VA6A 1MDAH 4Y5RD 3RN1D 4WK2B 4ERYA 4CI3A 5CXCB 1H2YA 4GQ2P 3MUOA 2I0SA 5KDOB 2CO0A 3I2NA 3JZHA 5H17A 4JSNC 2QR5A 2I0TA 4PNKB 1BPOA 4QL1A 3F3PA 5H14A 3JRPA 2W18A 3EI3B 2Z2OA 5CYKB 2BBKH 1B9YA 4L3GD 4AEZA 3RFHA 1K8KC 5EM2A 3I8EA 2JKXA 2VDMA 4RE5A 3IJ0A 4TZ4A 3ZE0A 4ZOVA 4BUJC 5AFU3 1NEXB 2H6QA 3GREA 3IURA 4IA9A 4MMZA 4ERQA 3JB9L 5EMLB 1VZ2A 2VC2B 4WK4B 4A08B 2AH1A 4QRJA 2G9AA 3N0EA 2VDQA 3GC3B 2XU7A 3O4JA 1UOQA 4JHPC 5B4WA 2UZXB 2AGWA 3ZDXB 1P22A 2AGLA 1U8CB 1OMWB 2VDPB 2VDKA 4CZVA 5M5SA 3OL2B 1N6FA 3NIGA 4HDJA 3MZLA 3SBPA 3FCUA 3SXTD 4BL0A 4NBMA 3IUJA 4L1QD 5GMKn 1PBYB 2HU7A 4WJKB 2P9NC 2P9SC 2QXVA 3I89A 2H14A 3FM0A 4H5IA 4MMYA 5GSAA 2B5MA 2BCJB 4O3UB 5K19A 4FAND 1JTDB 2MTAH 3I7LA 5FFGA 4NC4A 4X3EA 3RFGA 2VDNA 3T3MA 3I8CA 4ZOYA 2OK4A 4L9OA 5HE1B 3A0FA 2IUPA 2O9KA 1SHYB 3EQ9A 3K27A 4ZOZA 2CO0C 3IJEA 2VDMB 4J79A 2H47A 1TYEA 4CI1A 5HE2B 1MG2A 4MMXA 2P28A 3MKSB
chains in the Genus database with same CATH topology
3P4FA 2VDOB 2QC5A 2VDQB 4O1QD 4GGCA 4QT8A 3ZE2B 2XL2A 5E6SB 1JOFA 2I0RA 5IT9g 3EI2A 4JT6C 2PBIB 1GP2B 4K3ID 2VDKB 3SBQA 3RSEC 4J84A 4J78A 4J82A 2J55H 4Z7OB 1JMXB 3DM0A 2HYEA 4ZOXA 3L4OD 2YMUA 3BG1A 5CXBA 5C2VB 5TF2A 3RLMD 2JWGA 3IIYA 4A09A 1JJUB 2OJYA 5GXHA 3OW8A 2B4EA 4EWRA 3VGZA 5C9ZB 4E54A 1YUKA 1XKSA 3KRWB 4A2LA 4O45A 2VDNB 3T3MB 3MKQA 2VDRB 3IIWA 4GM3A 4FA5D 5EALA 4QQEA 4WK0B 2H6KA 3J80g 4BH6A 1TYEB 5FQDA 2IURA 4E5ZA 3UKRC 1GXRA 4N14A 4JSXC 3DXKC 2YNOA 1XHMA 5FXYA 3CFVA 5K1CC 3UVNA 3C5MA 4PXWA 3JAMg 4IMMA 4J81A 1VYHC 2H9NA 5EARA 2PM9A 3EG6A 4CI8A 3NIFB 1L0QA 1GOTB 4J8GA 3IJ1A 1NR0A 4UM9D 2GC7A 4JSVC 5HQGA 3C9CA 4FWWA 5CXBB 3JROA 4J73A 5FKTA 3OKYA 1QNIA 1S4UX 5FKSA 3EI4A 3OKTA 3NVQA 4CI2A 1SSLA 4JSPC 3EMHA 5HDBB 4E54B 3J81g 5EAPA 2XL3A 3NVXA 3B7FA 4X60B 3SFZA 3KRXB 4GZ8A 4ES0A 2P9UC 5E6UB 3OTTA 2G99A 3ULEC 2H9PA 5FA5B 3SMRA 4J86A 2TRCB 4J8BA 3RN0D 5I5IA 4NSXA 3AFCA 4Y7RA 4FA9D 2AQ5A 4CZXA 3I7HA 4CY1A 3EWEA 5I5JA 5EM2B 2YNPA 2J57G 3ODTA 3ZE0B 2CNXA 2PM9B 4FHLA 4FA4D 4ERZA 2Z2NA 4UM8B 3CFSB 3F3FA 4XEIC 4K3JB 2AGXA 1U4CA 2AGYA 2P9IC 3W15A 4OWRA 3PVWB 5TEEA 5FKQA 2OIZA 5CXCA 3V9FA 5TEFA 3OKYB 4L3HD 2GC4A 3UVOA 1OLZA 2EBSA 3SLED 3I7KA 3NIGB 4X63B 2PM7B 3FCUB 3UKUC 3ZWLB 2HKMA 4J77A 5HE0B 3FGBA 1MG3A 3C75H 4U1EI 3EU7A 2HKRA 4CY3A 3E0CA 3PXSD 3U4YA 3PVUB 3SJLD 3BG0A 2JWHA 3AH8B 3N0DA 3UVKA 4AOWA 2B5LA 4A08A 5IJ7E 2H6NA 2AGZA 2XYIA 3MZKA 3PSLA 4J0WA 2P9KC 3C99A 3HFQA 4A2MA 3IKOA 4GGAA 3ZE1B 1JMZB 1SQ9A 4A11A 4GM9A 1K32A 4JT5C 3I7OA 3I7NA 4I79A 3VI4B 1A0RB 4PBZA 3OKWA 2YNNA 3RRMC 3OL2A 1TYQC 3DWLC 4D0KA 3DXMC 4CY2A 2CN3A 4KFMB 3EI1A 3VH0A 1PEVA 2J56H 4H5JA 1GG2B 2IUVA 3V5WB 2OVQB 4XYIA 5EMKB 3SCYA 3I7PA 3AL9A 3EI2B 1ERJA 1Q47A 2IUQA 4GQBB 4PSWB 4R7AB 2UZYB 5H1MA 4CC9A 1R5MA 3DSMA 5IJ8E 4A0BA 3SN6B 5HE3B 3AL8A 4ZN4A 3SVWD 3NIDB 4D6VA 2Z2PA 3UR4A 4A7JA 4A09B 3GFCA 5EAMA 5HYNB 4OZUA 1XIPA 4PC0A 5I5MA 2OVPB 1PI6A 2I3SA 3MXXA 4A0AA 3IJCA 4LG8A 3BWSA 5THAA 5EMJB 1RI6A 4UM9B 4CZYA 5C2WB 2CE8A 1TBGA 4Z7NB 4A11B 4GM8A 4U7AA 3SWSD 5IC7A 2HXCA 3UVLA 3K26A 2H68A 2CE9A 4E5ZB 1N6DA 4JXMA 4LGNA 4GGDA 3UVMA 3V7DB 3ORVD 3EI1B 4Z8LA 2HJ4A 4Z7QB 4FB1D 3MMYA 3ZDYB 2H9MA 2P9PC 4O3TB 3VI3B 4J87A 4GQ1A 5IGOA 5EMMB 4XYHA 3JZNA 4A0BB 2IWKA 4ESGA 3AL8B 3FRXA 4UI9R 2Q7QA 4X61B 2YB8B 2IWFA 4J0XA 2OVRB 1N6EA 2IAAA 3EI4B 2B5NA 4MK0B 2YBAA 2HJBA 2H13A 3PE7A 4YVDA 3PXWD 5GXIA 5TDHB 2VDLB 3PSCB 4A0AB 3F3GA 5FLXg 3EI3A 3T3PB 5CYKA 2H3XA 1YFQA 1SQJA 5E6RB 3PXTD 5AJAA 4LG9A 2H9LA 2CN2A 3NVNA 5JWZA 4JD2C 3RMZD 3SBRA 5SXMA 4CY5A 4GMBA 2I3TA 1FWXA 3JZGA 4O9DA 3CIKB 1PGUA 4PSXB 2P26A 2AH0A 3JPXA 2GNQA 5FKRA 1U2VC 3L4MD 2P9LC 3SHFA 5A2Qg 4FA1D 4G56B 1B9XA 2OK6A 4PBYA 2HESX 2PM6B 5AMSA 3ZDZB 4FAVD 5IGQA 3VA6A 1MDAH 4Y5RD 3RN1D 4WK2B 4ERYA 4CI3A 5CXCB 4GQ2P 2I0SA 5KDOB 2CO0A 3I2NA 3JZHA 5H17A 4JSNC 2I0TA 4PNKB 4QL1A 3F3PA 5H14A 3JRPA 2W18A 3EI3B 2Z2OA 5CYKB 2BBKH 1B9YA 4L3GD 4AEZA 3RFHA 1K8KC 5EM2A 3I8EA 3IJ0A 4TZ4A 4ZOVA 4BUJC 5AFU3 1NEXB 2H6QA 3GREA 4IA9A 4ERQA 3JB9L 2VC2B 5EMLB 4WK4B 4A08B 2AH1A 4QRJA 2G9AA 3N0EA 2XU7A 5B4WA 2UZXB 2AGWA 3ZDXB 1P22A 2AGLA 1U8CB 1OMWB 2VDPB 4CZVA 3OL2B 1N6FA 4HDJA 3MZLA 3SBPA 3SXTD 4BL0A 4L1QD 5GMKn 1PBYB 4WJKB 2P9NC 2P9SC 2QXVA 3I89A 2H14A 3FM0A 4H5IA 5GSAA 2B5MA 2BCJB 4O3UB 5K19A 4FAND 2MTAH 3I7LA 4X3EA 3RFGA 3I8CA 4ZOYA 2OK4A 4L9OA 5HE1B 3A0FA 2IUPA 2O9KA 1SHYB 3K27A 4ZOZA 2CO0C 2VDMB 4J79A 2H47A 4CI1A 5HE2B 1MG2A 2P28A 3MKSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P4F A;  2VDO B;  2QC5 A;  2VDQ B;  4O1Q D;  4GGC A;  4QT8 A;  3ZE2 B;  2XL2 A;  5E6S B;  1JOF A;  2I0R A;  5IT9 g;  3EI2 A;  4JT6 C;  2PBI B;  1GP2 B;  4K3I D;  2VDK B;  3SBQ A;  3RSE C;  4J84 A;  4J78 A;  4J82 A;  2J55 H;  4Z7O B;  1JMX B;  3DM0 A;  2HYE A;  4ZOX A;  3L4O D;  2YMU A;  3BG1 A;  5CXB A;  5C2V B;  5TF2 A;  3RLM D;  3IIY A;  4A09 A;  1JJU B;  2OJY A;  5GXH A;  3OW8 A;  2B4E A;  4EWR A;  3VGZ A;  5C9Z B;  4E54 A;  1YUK A;  1XKS A;  3KRW B;  4A2L A;  4O45 A;  2VDN B;  3T3M B;  3MKQ A;  2VDR B;  3IIW A;  4GM3 A;  4FA5 D;  5EAL A;  4QQE A;  4WK0 B;  2H6K A;  3J80 g;  4BH6 A;  1TYE B;  5FQD A;  2IUR A;  4E5Z A;  3UKR C;  1GXR A;  4N14 A;  4JSX C;  3DXK C;  2YNO A;  1XHM A;  5FXY A;  3CFV A;  5K1C C;  3UVN A;  3C5M A;  4PXW A;  3JAM g;  4IMM A;  4J81 A;  1VYH C;  2H9N A;  5EAR A;  2PM9 A;  3EG6 A;  4CI8 A;  3NIF B;  1L0Q A;  1GOT B;  4J8G A;  3IJ1 A;  1NR0 A;  4UM9 D;  2GC7 A;  4JSV C;  5HQG A;  3C9C A;  4FWW A;  5CXB B;  3JRO A;  4J73 A;  5FKT A;  3OKY A;  1QNI A;  1S4U X;  5FKS A;  3EI4 A;  3OKT A;  3NVQ A;  4CI2 A;  1SSL A;  4JSP C;  3EMH A;  5HDB B;  4E54 B;  3J81 g;  5EAP A;  2XL3 A;  3NVX A;  3B7F A;  4X60 B;  3SFZ A;  3KRX B;  4GZ8 A;  4ES0 A;  2P9U C;  5E6U B;  3OTT A;  2G99 A;  3ULE C;  2H9P A;  5FA5 B;  3SMR A;  4J86 A;  2TRC B;  4J8B A;  3RN0 D;  5I5I A;  4NSX A;  3AFC A;  4Y7R A;  4FA9 D;  2AQ5 A;  4CZX A;  3I7H A;  4CY1 A;  3EWE A;  5I5J A;  5EM2 B;  2YNP A;  2J57 G;  3ODT A;  3ZE0 B;  2CNX A;  2PM9 B;  4FHL A;  4FA4 D;  4ERZ A;  2Z2N A;  4UM8 B;  3CFS B;  3F3F A;  4XEI C;  4K3J B;  2AGX A;  1U4C A;  2AGY A;  2P9I C;  3W15 A;  4OWR A;  3PVW B;  5TEE A;  5FKQ A;  2OIZ A;  5CXC A;  3V9F A;  5TEF A;  3OKY B;  4L3H D;  2GC4 A;  3UVO A;  1OLZ A;  2EBS A;  3SLE D;  3I7K A;  3NIG B;  4X63 B;  2PM7 B;  3FCU B;  3UKU C;  3ZWL B;  2HKM A;  4J77 A;  5HE0 B;  3FGB A;  1MG3 A;  3C75 H;  4U1E I;  3EU7 A;  2HKR A;  4CY3 A;  3E0C A;  3PXS D;  3U4Y A;  3PVU B;  3SJL D;  3BG0 A;  3AH8 B;  3N0D A;  3UVK A;  4AOW A;  2B5L A;  4A08 A;  5IJ7 E;  2H6N A;  2AGZ A;  2XYI A;  3MZK A;  3PSL A;  4J0W A;  2P9K C;  3C99 A;  3HFQ A;  4A2M A;  3IKO A;  4GGA A;  3ZE1 B;  1JMZ B;  1SQ9 A;  4A11 A;  4GM9 A;  1K32 A;  4JT5 C;  3I7O A;  3I7N A;  4I79 A;  3VI4 B;  1A0R B;  4PBZ A;  3OKW A;  2YNN A;  3RRM C;  3OL2 A;  1TYQ C;  3DWL C;  4D0K A;  3DXM C;  4CY2 A;  2CN3 A;  4KFM B;  3EI1 A;  3VH0 A;  1PEV A;  2J56 H;  4H5J A;  1GG2 B;  2IUV A;  3V5W B;  2OVQ B;  4XYI A;  5EMK B;  3SCY A;  3I7P A;  3AL9 A;  3EI2 B;  1ERJ A;  1Q47 A;  2IUQ A;  4GQB B;  4PSW B;  4R7A B;  2UZY B;  5H1M A;  4CC9 A;  1R5M A;  3DSM A;  5IJ8 E;  4A0B A;  3SN6 B;  5HE3 B;  3AL8 A;  4ZN4 A;  3SVW D;  3NID B;  4D6V A;  2Z2P A;  3UR4 A;  4A7J A;  4A09 B;  3GFC A;  5EAM A;  5HYN B;  4OZU A;  1XIP A;  4PC0 A;  5I5M A;  2OVP B;  1PI6 A;  2I3S A;  3MXX A;  4A0A A;  3IJC A;  4LG8 A;  3BWS A;  5THA A;  5EMJ B;  1RI6 A;  4UM9 B;  4CZY A;  5C2W B;  2CE8 A;  1TBG A;  4Z7N B;  4A11 B;  4GM8 A;  4U7A A;  3SWS D;  5IC7 A;  2HXC A;  3UVL A;  3K26 A;  2H68 A;  2CE9 A;  4E5Z B;  1N6D A;  4JXM A;  4LGN A;  4GGD A;  3UVM A;  3V7D B;  3ORV D;  3EI1 B;  4Z8L A;  2HJ4 A;  4Z7Q B;  4FB1 D;  3MMY A;  3ZDY B;  2H9M A;  2P9P C;  4O3T B;  3VI3 B;  4J87 A;  4GQ1 A;  5IGO A;  5EMM B;  4XYH A;  3JZN A;  4A0B B;  2IWK A;  4ESG A;  3AL8 B;  3FRX A;  4UI9 R;  2Q7Q A;  4X61 B;  2YB8 B;  2IWF A;  4J0X A;  2OVR B;  1N6E A;  2IAA A;  3EI4 B;  2B5N A;  4MK0 B;  2YBA A;  2HJB A;  2H13 A;  3PE7 A;  4YVD A;  3PXW D;  5GXI A;  5TDH B;  2VDL B;  3PSC B;  4A0A B;  3F3G A;  5FLX g;  3EI3 A;  3T3P B;  5CYK A;  2H3X A;  1YFQ A;  1SQJ A;  5E6R B;  3PXT D;  5AJA A;  4LG9 A;  2H9L A;  2CN2 A;  3NVN A;  5JWZ A;  4JD2 C;  3RMZ D;  3SBR A;  5SXM A;  4CY5 A;  4GMB A;  2I3T A;  1FWX A;  3JZG A;  4O9D A;  3CIK B;  1PGU A;  4PSX B;  2P26 A;  2AH0 A;  3JPX A;  2GNQ A;  5FKR A;  1U2V C;  3L4M D;  2P9L C;  3SHF A;  5A2Q g;  4FA1 D;  4G56 B;  1B9X A;  2OK6 A;  4PBY A;  2HES X;  2PM6 B;  5AMS A;  3ZDZ B;  4FAV D;  5IGQ A;  3VA6 A;  1MDA H;  4Y5R D;  3RN1 D;  4WK2 B;  4ERY A;  4CI3 A;  5CXC B;  4GQ2 P;  2I0S A;  5KDO B;  2CO0 A;  3I2N A;  3JZH A;  5H17 A;  4JSN C;  2I0T A;  4PNK B;  4QL1 A;  3F3P A;  5H14 A;  3JRP A;  2W18 A;  3EI3 B;  2Z2O A;  5CYK B;  2BBK H;  1B9Y A;  4L3G D;  4AEZ A;  3RFH A;  1K8K C;  5EM2 A;  3I8E A;  3IJ0 A;  4TZ4 A;  4ZOV A;  4BUJ C;  5AFU 3;  1NEX B;  2H6Q A;  3GRE A;  4IA9 A;  4ERQ A;  3JB9 L;  2VC2 B;  5EML B;  4WK4 B;  4A08 B;  2AH1 A;  4QRJ A;  2G9A A;  3N0E A;  2XU7 A;  5B4W A;  2UZX B;  2AGW A;  3ZDX B;  1P22 A;  2AGL A;  1U8C B;  1OMW B;  2VDP B;  4CZV A;  3OL2 B;  1N6F A;  4HDJ A;  3MZL A;  3SBP A;  3SXT D;  4BL0 A;  4L1Q D;  5GMK n;  1PBY B;  4WJK B;  2P9N C;  2P9S C;  2QXV A;  3I89 A;  2H14 A;  3FM0 A;  4H5I A;  5GSA A;  2B5M A;  2BCJ B;  4O3U B;  5K19 A;  4FAN D;  2MTA H;  3I7L A;  4X3E A;  3RFG A;  3I8C A;  4ZOY A;  2OK4 A;  4L9O A;  5HE1 B;  3A0F A;  2IUP A;  2O9K A;  1SHY B;  3K27 A;  4ZOZ A;  2CO0 C;  2VDM B;  4J79 A;  2H47 A;  4CI1 A;  5HE2 B;  1MG2 A;  2P28 A;  3MKS B; 
#chains in the Genus database with same CATH topology
 3P4F A;  2VDO B;  1UOP A;  2QC5 A;  2VDQ B;  4O1Q D;  4GGC A;  4QT8 A;  3ZE2 B;  2XL2 A;  5E6S B;  1JOF A;  2I0R A;  5IT9 g;  3EI2 A;  4JT6 C;  2PBI B;  3FCS A;  1GP2 B;  1O6G A;  4K3I D;  2VDK B;  3SBQ A;  3RSE C;  4J84 A;  4D9S A;  4J78 A;  4J82 A;  2J55 H;  4Z7O B;  1JMX B;  1M1X A;  3DM0 A;  2HYE A;  4ZOX A;  3L4O D;  2YMU A;  3BG1 A;  5CXB A;  5M61 A;  5C2V B;  5TF2 A;  3RLM D;  1JV2 A;  2JWG A;  3IIY A;  3KCI A;  4A09 A;  1JJU B;  2OJY A;  5GXH A;  3OW8 A;  2B4E A;  5HDB A;  3VGZ A;  4EWR A;  5C9Z B;  4E54 A;  1YUK A;  1XKS A;  3KRW B;  4A2L A;  4O45 A;  4UM9 A;  3IUN A;  2VDN B;  2XDW A;  5E6U A;  3MKQ A;  2VDR B;  3IIW A;  3T3M B;  4GM3 A;  4G1M A;  1H2X A;  1E8N A;  4FA5 D;  5EAL A;  4QQE A;  4WK0 B;  2H6K A;  2QZP A;  3J80 g;  4BH6 A;  1TYE B;  5FQD A;  2IUR A;  4E5Z A;  3UKR C;  1GXR A;  3DDU A;  4N14 A;  4JSX C;  3DXK C;  2YNO A;  1XHM A;  4AX4 A;  5FXY A;  3CFV A;  4Z7Q A;  5K1C C;  3UVN A;  3C5M A;  4PXW A;  3ZDY A;  3JAM g;  4IMM A;  4J81 A;  1VYH C;  2H9N A;  5EAR A;  2PM9 A;  3EG6 A;  4UM8 A;  4CI8 A;  3NIF B;  1L0Q A;  1GOT B;  4J8G A;  3IJ1 A;  1NR0 A;  1T2X A;  4UM9 D;  2GC7 A;  4JSV C;  3IVM A;  5HQG A;  4AN1 A;  1E5T A;  3C9C A;  4FWW A;  5CXB B;  3JRO A;  4BP9 A;  1QFM A;  4J73 A;  5FKT A;  3OKY A;  1QNI A;  1S4U X;  5FKS A;  3EI4 A;  3OKT A;  3NVQ A;  4CI2 A;  1SSL A;  4JSP C;  3EMH A;  5HDB B;  5M5V A;  2VDL A;  4E54 B;  3J81 g;  5FFO A;  5EAP A;  2XL3 A;  3NVX A;  3B7F A;  4X60 B;  3SFZ A;  2BKL A;  3KRX B;  4GZ8 A;  1H2Z A;  4ES0 A;  2P9U C;  5E6U B;  3OTT A;  2G99 A;  3ULE C;  2H9P A;  5FA5 B;  3SMR A;  4J86 A;  3OF7 A;  1C9L A;  2TRC B;  1K3I A;  4J8B A;  3RN0 D;  5M5R A;  5I5I A;  4NSX A;  3AFC A;  4Y7R A;  4FA9 D;  2AQ5 A;  4CZX A;  3I7H A;  2VZ3 A;  3EWE A;  4CY1 A;  4NEN A;  3ZE1 A;  1VZ3 A;  1C9I A;  5I5J A;  5EM2 B;  2YNP A;  5C92 A;  2J57 G;  3ODT A;  3VI4 A;  3ZE0 B;  2CNX A;  2PM9 B;  1GOH A;  4FHL A;  4FA4 D;  4ERZ A;  2Z2N A;  4UM8 B;  3CFS B;  3F3F A;  4XEI C;  3ZDZ A;  4K3J B;  2AGX A;  1U4C A;  2AGY A;  2P9I C;  3W15 A;  4OWR A;  3PVW B;  5TEE A;  5FKQ A;  2OIZ A;  5CXC A;  3V9F A;  5TEF A;  3OKY B;  4L3H D;  3QHY B;  4G1E A;  1L5G A;  2GC4 A;  3UVO A;  4BCD A;  1OLZ A;  2EBS A;  3SLE D;  3I7K A;  3IUQ A;  3NIG B;  4X63 B;  2PM7 B;  3FCU B;  3UKU C;  3ZWL B;  2HKM A;  4J77 A;  4QAM A;  5HE0 B;  3FGB A;  1MG3 A;  3C75 H;  3NID A;  4U1E I;  3EU7 A;  2HKR A;  4CY3 A;  2EIE A;  3E0C A;  3PXS D;  3V4V A;  3PVU B;  3SJL D;  3U4Y A;  4O2W A;  3BG0 A;  2JWH A;  4L1M A;  3AH8 B;  3N0D A;  3UVK A;  4AOW A;  2B5L A;  4A08 A;  5IJ7 E;  2H6N A;  2AGZ A;  2XYI A;  1H2W A;  3MZK A;  3PSL A;  4J0W A;  2P9K C;  3C99 A;  3HFQ A;  4A2M A;  3IKO A;  4GGA A;  3ZE1 B;  3K6S A;  1JMZ B;  3ZDX A;  1U8C A;  4Z7N A;  1SQ9 A;  2VDP A;  4A11 A;  4GM9 A;  1K32 A;  4JT5 C;  3I7O A;  3I7N A;  4I79 A;  3VI4 B;  1A0R B;  4PBZ A;  3OKW A;  2YNN A;  4G55 A;  3OL2 A;  3RRM C;  1TYQ C;  3DWL C;  4AMZ A;  4D0K A;  3DXM C;  4CY2 A;  2CN3 A;  4KFM B;  3EI1 A;  3VH0 A;  1PEV A;  2J56 H;  4H5J A;  1GG2 B;  2IUV A;  3V5W B;  2OVQ B;  4XYI A;  5EMK B;  3SCY A;  3MUN A;  3GD1 I;  3I7P A;  1GOF A;  3AL9 A;  3EI2 B;  1ERJ A;  1VE7 A;  5M5U A;  1Q47 A;  2IUQ A;  4GQB B;  4PSW B;  4R7A B;  2UZY B;  5H1M A;  4CC9 A;  4DNV A;  1R5M A;  3K72 A;  3DSM A;  3VI3 A;  2EIC A;  4O02 A;  3EQ7 A;  5IJ8 E;  4A0B A;  3SN6 B;  3K71 A;  5HE3 B;  3AL8 A;  4BP8 A;  4BCC A;  4ZN4 A;  3SVW D;  2EID A;  2HU5 A;  3NID B;  4D6V A;  2Z2P A;  3UR4 A;  4A7J A;  4A09 B;  3GFC A;  5EAM A;  3O4I A;  5HYN B;  4OZU A;  1XIP A;  4PC0 A;  5I5M A;  2OVP B;  1PI6 A;  2I3S A;  3MXX A;  4A0A A;  2VDO A;  3IJC A;  4LG8 A;  3BWS A;  5THA A;  3T3P A;  5EMJ B;  1RI6 A;  3ZE2 A;  4UM9 B;  5E6R A;  5E6S A;  4CZY A;  5C2W B;  2CE8 A;  1TBG A;  4Z7N B;  4A11 B;  4GM8 A;  4U7A A;  3SWS D;  5IC7 A;  2EIB A;  2HXC A;  3UVL A;  3K26 A;  2H68 A;  4DNU A;  2CE9 A;  4E5Z B;  1N6D A;  4JXM A;  4Z7O A;  4LGN A;  4GGD A;  3UVM A;  3MVD K;  2WQ8 A;  3V7D B;  3ORV D;  3EI1 B;  1A12 A;  4JHN A;  4Z8L A;  2HJ4 A;  4Z7Q B;  4RE6 A;  4FB1 D;  3MMY A;  4IRZ A;  1GOG A;  3ZDY B;  2H9M A;  4NAA A;  4DNW A;  2P9P C;  1UTC A;  4O3T B;  5C86 A;  3VI3 B;  3IUL A;  4J87 A;  2XZG A;  4GQ1 A;  3IUM A;  5IGO A;  5EMM B;  4XYH A;  3JZN A;  4A0B B;  2IWK A;  3EQ8 A;  4ESG A;  3AL8 B;  3FRX A;  4UI9 R;  2Q7Q A;  4X61 B;  2VDR A;  2YB8 B;  4WK2 A;  2IWF A;  2HU8 A;  4J0X A;  2OVR B;  4WK0 A;  1N6E A;  4BCB A;  2IAA A;  3EI4 B;  2B5N A;  4MK0 B;  2YBA A;  2HJB A;  2H13 A;  3PE7 A;  4YVD A;  3PXW D;  5GXI A;  3QI0 A;  5TDH B;  2VDL B;  4AN0 A;  3PSC B;  1YR2 A;  4A0A B;  3F3G A;  5FLX g;  3EI3 A;  3V4P A;  3T3P B;  5CYK A;  2H3X A;  3O4G A;  1YFQ A;  1I2M B;  1SQJ A;  5E6R B;  3PXT D;  5AJA A;  4LG9 A;  2H9L A;  2CN2 A;  3NVN A;  5M5T A;  3NIF A;  5JWZ A;  2VC2 A;  4JD2 C;  4WK4 A;  1QFS A;  3RMZ D;  3SBR A;  5SXM A;  4CY5 A;  4GMB A;  1VE6 A;  2I3T A;  1FWX A;  3JZG A;  4O9D A;  2XE4 A;  3CIK B;  1PGU A;  4PSX B;  2P26 A;  2AH0 A;  3JPX A;  2GNQ A;  3O4H A;  5FKR A;  1U2V C;  3L4M D;  2P9L C;  3SHF A;  5A2Q g;  4FA1 D;  1O6F A;  4G56 B;  4AMY A;  1B9X A;  2OK6 A;  1UOO A;  2HES X;  1E8M A;  2VZ1 A;  4PBY A;  2PM6 B;  5AMS A;  3ZDZ B;  4FAV D;  5IGQ A;  4WJK A;  3VA6 A;  1MDA H;  4Y5R D;  3RN1 D;  4WK2 B;  4ERY A;  4CI3 A;  5CXC B;  1H2Y A;  4GQ2 P;  3MUO A;  2I0S A;  5KDO B;  2CO0 A;  3I2N A;  3JZH A;  5H17 A;  4JSN C;  2QR5 A;  2I0T A;  4PNK B;  1BPO A;  4QL1 A;  3F3P A;  5H14 A;  3JRP A;  2W18 A;  3EI3 B;  2Z2O A;  5CYK B;  2BBK H;  1B9Y A;  4L3G D;  4AEZ A;  3RFH A;  1K8K C;  5EM2 A;  3I8E A;  2JKX A;  2VDM A;  4RE5 A;  3IJ0 A;  4TZ4 A;  3ZE0 A;  4ZOV A;  4BUJ C;  5AFU 3;  1NEX B;  2H6Q A;  3GRE A;  3IUR A;  4IA9 A;  4MMZ A;  4ERQ A;  3JB9 L;  5EML B;  1VZ2 A;  2VC2 B;  4WK4 B;  4A08 B;  2AH1 A;  4QRJ A;  2G9A A;  3N0E A;  2VDQ A;  3GC3 B;  2XU7 A;  3O4J A;  1UOQ A;  4JHP C;  5B4W A;  2UZX B;  2AGW A;  3ZDX B;  1P22 A;  2AGL A;  1U8C B;  1OMW B;  2VDP B;  2VDK A;  4CZV A;  5M5S A;  3OL2 B;  1N6F A;  3NIG A;  4HDJ A;  3MZL A;  3SBP A;  3FCU A;  3SXT D;  4BL0 A;  4NBM A;  3IUJ A;  4L1Q D;  5GMK n;  1PBY B;  2HU7 A;  4WJK B;  2P9N C;  2P9S C;  2QXV A;  3I89 A;  2H14 A;  3FM0 A;  4H5I A;  4MMY A;  5GSA A;  2B5M A;  2BCJ B;  4O3U B;  5K19 A;  4FAN D;  1JTD B;  2MTA H;  3I7L A;  5FFG A;  4NC4 A;  4X3E A;  3RFG A;  2VDN A;  3T3M A;  3I8C A;  4ZOY A;  2OK4 A;  4L9O A;  5HE1 B;  3A0F A;  2IUP A;  2O9K A;  1SHY B;  3EQ9 A;  3K27 A;  4ZOZ A;  2CO0 C;  3IJE A;  2VDM B;  4J79 A;  2H47 A;  1TYE A;  4CI1 A;  5HE2 B;  1MG2 A;  4MMX A;  2P28 A;  3MKS B; 
#chains in the Genus database with same CATH homology
 3P4F A;  2VDO B;  2QC5 A;  2VDQ B;  4O1Q D;  4GGC A;  4QT8 A;  3ZE2 B;  2XL2 A;  5E6S B;  1JOF A;  2I0R A;  5IT9 g;  3EI2 A;  4JT6 C;  2PBI B;  1GP2 B;  4K3I D;  2VDK B;  3SBQ A;  3RSE C;  4J84 A;  4J78 A;  4J82 A;  2J55 H;  4Z7O B;  1JMX B;  3DM0 A;  2HYE A;  4ZOX A;  3L4O D;  2YMU A;  3BG1 A;  5CXB A;  5C2V B;  5TF2 A;  3RLM D;  2JWG A;  3IIY A;  4A09 A;  1JJU B;  2OJY A;  5GXH A;  3OW8 A;  2B4E A;  4EWR A;  3VGZ A;  5C9Z B;  4E54 A;  1YUK A;  1XKS A;  3KRW B;  4A2L A;  4O45 A;  2VDN B;  3T3M B;  3MKQ A;  2VDR B;  3IIW A;  4GM3 A;  4FA5 D;  5EAL A;  4QQE A;  4WK0 B;  2H6K A;  3J80 g;  4BH6 A;  1TYE B;  5FQD A;  2IUR A;  4E5Z A;  3UKR C;  1GXR A;  4N14 A;  4JSX C;  3DXK C;  2YNO A;  1XHM A;  5FXY A;  3CFV A;  5K1C C;  3UVN A;  3C5M A;  4PXW A;  3JAM g;  4IMM A;  4J81 A;  1VYH C;  2H9N A;  5EAR A;  2PM9 A;  3EG6 A;  4CI8 A;  3NIF B;  1L0Q A;  1GOT B;  4J8G A;  3IJ1 A;  1NR0 A;  4UM9 D;  2GC7 A;  4JSV C;  5HQG A;  3C9C A;  4FWW A;  5CXB B;  3JRO A;  4J73 A;  5FKT A;  3OKY A;  1QNI A;  1S4U X;  5FKS A;  3EI4 A;  3OKT A;  3NVQ A;  4CI2 A;  1SSL A;  4JSP C;  3EMH A;  5HDB B;  4E54 B;  3J81 g;  5EAP A;  2XL3 A;  3NVX A;  3B7F A;  4X60 B;  3SFZ A;  3KRX B;  4GZ8 A;  4ES0 A;  2P9U C;  5E6U B;  3OTT A;  2G99 A;  3ULE C;  2H9P A;  5FA5 B;  3SMR A;  4J86 A;  2TRC B;  4J8B A;  3RN0 D;  5I5I A;  4NSX A;  3AFC A;  4Y7R A;  4FA9 D;  2AQ5 A;  4CZX A;  3I7H A;  4CY1 A;  3EWE A;  5I5J A;  5EM2 B;  2YNP A;  2J57 G;  3ODT A;  3ZE0 B;  2CNX A;  2PM9 B;  4FHL A;  4FA4 D;  4ERZ A;  2Z2N A;  4UM8 B;  3CFS B;  3F3F A;  4XEI C;  4K3J B;  2AGX A;  1U4C A;  2AGY A;  2P9I C;  3W15 A;  4OWR A;  3PVW B;  5TEE A;  5FKQ A;  2OIZ A;  5CXC A;  3V9F A;  5TEF A;  3OKY B;  4L3H D;  2GC4 A;  3UVO A;  1OLZ A;  2EBS A;  3SLE D;  3I7K A;  3NIG B;  4X63 B;  2PM7 B;  3FCU B;  3UKU C;  3ZWL B;  2HKM A;  4J77 A;  5HE0 B;  3FGB A;  1MG3 A;  3C75 H;  4U1E I;  3EU7 A;  2HKR A;  4CY3 A;  3E0C A;  3PXS D;  3U4Y A;  3PVU B;  3SJL D;  3BG0 A;  2JWH A;  3AH8 B;  3N0D A;  3UVK A;  4AOW A;  2B5L A;  4A08 A;  5IJ7 E;  2H6N A;  2AGZ A;  2XYI A;  3MZK A;  3PSL A;  4J0W A;  2P9K C;  3C99 A;  3HFQ A;  4A2M A;  3IKO A;  4GGA A;  3ZE1 B;  1JMZ B;  1SQ9 A;  4A11 A;  4GM9 A;  1K32 A;  4JT5 C;  3I7O A;  3I7N A;  4I79 A;  3VI4 B;  1A0R B;  4PBZ A;  3OKW A;  2YNN A;  3RRM C;  3OL2 A;  1TYQ C;  3DWL C;  4D0K A;  3DXM C;  4CY2 A;  2CN3 A;  4KFM B;  3EI1 A;  3VH0 A;  1PEV A;  2J56 H;  4H5J A;  1GG2 B;  2IUV A;  3V5W B;  2OVQ B;  4XYI A;  5EMK B;  3SCY A;  3I7P A;  3AL9 A;  3EI2 B;  1ERJ A;  1Q47 A;  2IUQ A;  4GQB B;  4PSW B;  4R7A B;  2UZY B;  5H1M A;  4CC9 A;  1R5M A;  3DSM A;  5IJ8 E;  4A0B A;  3SN6 B;  5HE3 B;  3AL8 A;  4ZN4 A;  3SVW D;  3NID B;  4D6V A;  2Z2P A;  3UR4 A;  4A7J A;  4A09 B;  3GFC A;  5EAM A;  5HYN B;  4OZU A;  1XIP A;  4PC0 A;  5I5M A;  2OVP B;  1PI6 A;  2I3S A;  3MXX A;  4A0A A;  3IJC A;  4LG8 A;  3BWS A;  5THA A;  5EMJ B;  1RI6 A;  4UM9 B;  4CZY A;  5C2W B;  2CE8 A;  1TBG A;  4Z7N B;  4A11 B;  4GM8 A;  4U7A A;  3SWS D;  5IC7 A;  2HXC A;  3UVL A;  3K26 A;  2H68 A;  2CE9 A;  4E5Z B;  1N6D A;  4JXM A;  4LGN A;  4GGD A;  3UVM A;  3V7D B;  3ORV D;  3EI1 B;  4Z8L A;  2HJ4 A;  4Z7Q B;  4FB1 D;  3MMY A;  3ZDY B;  2H9M A;  2P9P C;  4O3T B;  3VI3 B;  4J87 A;  4GQ1 A;  5IGO A;  5EMM B;  4XYH A;  3JZN A;  4A0B B;  2IWK A;  4ESG A;  3AL8 B;  3FRX A;  4UI9 R;  2Q7Q A;  4X61 B;  2YB8 B;  2IWF A;  4J0X A;  2OVR B;  1N6E A;  2IAA A;  3EI4 B;  2B5N A;  4MK0 B;  2YBA A;  2HJB A;  2H13 A;  3PE7 A;  4YVD A;  3PXW D;  5GXI A;  5TDH B;  2VDL B;  3PSC B;  4A0A B;  3F3G A;  5FLX g;  3EI3 A;  3T3P B;  5CYK A;  2H3X A;  1YFQ A;  1SQJ A;  5E6R B;  3PXT D;  5AJA A;  4LG9 A;  2H9L A;  2CN2 A;  3NVN A;  5JWZ A;  4JD2 C;  3RMZ D;  3SBR A;  5SXM A;  4CY5 A;  4GMB A;  2I3T A;  1FWX A;  3JZG A;  4O9D A;  3CIK B;  1PGU A;  4PSX B;  2P26 A;  2AH0 A;  3JPX A;  2GNQ A;  5FKR A;  1U2V C;  3L4M D;  2P9L C;  3SHF A;  5A2Q g;  4FA1 D;  4G56 B;  1B9X A;  2OK6 A;  4PBY A;  2HES X;  2PM6 B;  5AMS A;  3ZDZ B;  4FAV D;  5IGQ A;  3VA6 A;  1MDA H;  4Y5R D;  3RN1 D;  4WK2 B;  4ERY A;  4CI3 A;  5CXC B;  4GQ2 P;  2I0S A;  5KDO B;  2CO0 A;  3I2N A;  3JZH A;  5H17 A;  4JSN C;  2I0T A;  4PNK B;  4QL1 A;  3F3P A;  5H14 A;  3JRP A;  2W18 A;  3EI3 B;  2Z2O A;  5CYK B;  2BBK H;  1B9Y A;  4L3G D;  4AEZ A;  3RFH A;  1K8K C;  5EM2 A;  3I8E A;  3IJ0 A;  4TZ4 A;  4ZOV A;  4BUJ C;  5AFU 3;  1NEX B;  2H6Q A;  3GRE A;  4IA9 A;  4ERQ A;  3JB9 L;  2VC2 B;  5EML B;  4WK4 B;  4A08 B;  2AH1 A;  4QRJ A;  2G9A A;  3N0E A;  2XU7 A;  5B4W A;  2UZX B;  2AGW A;  3ZDX B;  1P22 A;  2AGL A;  1U8C B;  1OMW B;  2VDP B;  4CZV A;  3OL2 B;  1N6F A;  4HDJ A;  3MZL A;  3SBP A;  3SXT D;  4BL0 A;  4L1Q D;  5GMK n;  1PBY B;  4WJK B;  2P9N C;  2P9S C;  2QXV A;  3I89 A;  2H14 A;  3FM0 A;  4H5I A;  5GSA A;  2B5M A;  2BCJ B;  4O3U B;  5K19 A;  4FAN D;  2MTA H;  3I7L A;  4X3E A;  3RFG A;  3I8C A;  4ZOY A;  2OK4 A;  4L9O A;  5HE1 B;  3A0F A;  2IUP A;  2O9K A;  1SHY B;  3K27 A;  4ZOZ A;  2CO0 C;  2VDM B;  4J79 A;  2H47 A;  4CI1 A;  5HE2 B;  1MG2 A;  2P28 A;  3MKS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...