3OKWA

Mouse semaphorin 6a, extracellular domains 1-2
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
549
structure length
540
Chain Sequence
FPEDSEPISISHGNYTKQYPVFVGHKPGRTQRHRLDIQMIMIMNRTLYVAARDHIYTVDIDTSHTEEIYCSKKLTWKSRQADVDTCRMKGKHKDECHNFIKVLLKKNDDTLFVCGTNAFNPSCRNYRVDTLETFGDEFSGMARCPYDAKHANIALFADGKLYSATVTDFLAIDAVIYRSLGDSPTLRTVKHDSKWLKEPYFVQAVDYGDYIYFFFREIAVEYNGKVVFPRVAQVCKNDMGGSQRVLEKQWTSFLKARLNCSVPGDSHFYFNILQAVTDVIRINGRDVVLATFSTPYNSIPGSAVCAYDMLDIANVFTGRFKEQKSPDSTWTPVPDERVPKPRPGCCAGSSSLEKYATSNEFPDDTLNFIKTHPLMDEAVPSIINRPWFLRTMVRYRLTKIAVDNAAGPYQNHTVVFLGSEKGIILKFLARIGSLNGSLFLEEMNVYNPEKCSYDGVEDKRIMGMQLDRASGSLYVAFSTCVIKVPLGRCERHGKCKKTCIASRDPYCGWVRESGSCAHLSPRLTFEQDIERGNTDGLGDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of semaphorin-plexin signalling.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords Semaphorin-6A
total genus 124
structure length 540
sequence length 549
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01403 Sema Sema domain
A PF01437 PSI Plexin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3okwA01
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 3okwA02
2YB8B 5FA5B 4WJKB 5CXCB 3DSMA 4GGCA 3SN6B 3OKWA 4PNKB 5EAPA 5H1MA 3KRWB 4JT6C 2YNNA 5B4WA 5E6RB 2TRCB 3SLED 3VI4B 2OK4A 3NIFB 3EI2B 2VDNB 3MXXA 4IA9A 1PGUA 4J73A 1FWXA 3SBPA 2H13A 4O45A 3NVXA 3UVNA 5HE0B 4J79A 2BBKH 3K27A 4A11A 3OTTA 1B9XA 3I7LA 4A2LA 2VDOB 4CC9A 1QNIA 2HESX 2AGLA 1SQ9A 2J55H 3IIWA 4UM8B 5HE2B 4GM9A 5FXYA 1N6EA 4JSPC 3RFGA 2IUQA 2AH1A 3RFHA 3AH8B 3MKSB 3OKYA 5C2VB 3EG6A 3N0DA 4A09A 3DXMC 5EARA 2B5LA 2PM9B 4J8GA 3VGZA 2J57G 4FA5D 3FCUB 3ZE2B 4Z7NB 4A0AA 4CY3A 5C2WB 4E54B 4H5JA 3ZE0B 1U2VC 2OVPB 5HE3B 2P9PC 4G56B 4FB1D 3JROA 1GG2B 3ULEC 3I89A 5CYKB 3PE7A 3I2NA 3MZKA 4ERQA 3IJ1A 4D6VA 2B5NA 2J56H 4X3EA 5E6SB 4O3UB 4ZOXA 2VDLB 4A7JA 5EMKB 3PXSD 2Z2NA 4AEZA 4FA4D 4JSVC 1JOFA 2HKMA 3VA6A 3W15A 4QL1A 4CY2A 1TBGA 2PM7B 2UZXB 3IIYA 2GC7A 4CI2A 4GM3A 1N6DA 4J8BA 5EAMA 4Z7QB 3NVQA 4KFMB 2H9PA 1RI6A 4O1QD 4J0XA 2YMUA 4GMBA 5FQDA 5TDHB 4LG8A 3I7NA 2AGXA 2CE8A 4AOWA 3OKTA 5AFU3 2P9KC 4Y7RA 3DXKC 4U1EI 2VDRB 1VYHC 3DM0A 3IKOA 4J0WA 5K1CC 2I0TA 4N14A 4K3ID 3E0CA 3EI3A 1GP2B 3ORVD 3SWSD 5AJAA 2GC4A 3EI1B 3JZHA 3UVKA 4ZOYA 4CZXA 4ERYA 3P4FA 4EWRA 2P9NC 2YBAA 4E5ZB 3AL8B 4A08A 3BG0A 5HE1B 4ZOVA 5SXMA 4ES0A 3UVOA 4BH6A 1YUKA 1JJUB 5EMJB 5TF2A 3T3PB 4UM9D 4JD2C 3L4OD 2IURA 2AQ5A 3I7KA 4FWWA 2H6NA 5IGQA 4E54A 2G99A 3SXTD 4J82A 4XYHA 4A2MA 2PM9A 1SHYB 2AH0A 4CZYA 3I7HA 3B7FA 2P9UC 1K8KC 1OLZA 1NR0A 2I0SA 4X63B 4J84A 3V5WB 4JSXC 2PM6B 4X60B 1MG2A 3V7DB 3ODTA 4I79A 4JSNC 2O9KA 1B9YA 3ZDXB 4CI8A 4CI1A 4IMMA 5IGOA 5I5IA 3U4YA 4X61B 3PXTD 5C9ZB 2HJBA 3IJCA 5KDOB 2XL3A 3JRPA 2VDQB 5IT9g 3I7PA 2HJ4A 3AL8A 5GXHA 4D0KA 1PEVA 2H9LA 3CIKB 3PVWB 3NIDB 3FGBA 3EI2A 3JAMg 3RRMC 1P22A 3ZWLB 3SCYA 4ESGA 3RN0D 4Z8LA 3C9CA 3IJ0A 4JXMA 3EI4A 4CY1A 4MK0B 5EMLB 5I5MA 1N6FA 2HYEA 4WK4B 2CO0A 2CNXA 4GQ1A 1TYQC 3RN1D 3C5MA 3F3FA 3HFQA 1U4CA 3UVLA 3CFSB 4ERZA 4O9DA 3UR4A 1XIPA 3NVNA 4E5ZA 4A08B 3OL2B 5GSAA 3DWLC 3RSEC 3V9FA 3OL2A 3EI3B 3F3GA 4GM8A 5THAA 3I8EA 3JPXA 2XYIA 5CYKA 3J81g 5K19A 5CXCA 1L0QA 3CFVA 2IUPA 5EM2A 3AFCA 1ERJA 3N0EA 1GOTB 4U7AA 3F3PA 3SFZA 3J80g 4L3HD 2IWFA 4J77A 4NSXA 2AGZA 5EMMB 2IUVA 3I8CA 2OVRB 3SJLD 4L9OA 4FAND 4UI9R 4A0BB 3SVWD 1JMZB 5TEFA 3EU7A 3FRXA 5AMSA 3GFCA 1OMWB 2H9MA 4YVDA 3BWSA 2H6QA 4L1QD 4UM9B 3MZLA 3PVUB 1TYEB 2H14A 2MTAH 2P9SC 3EMHA 4GGAA 5CXBB 2VDPB 2Z2OA 4FA9D 4FA1D 2UZYB 3OW8A 3ZDZB 2PBIB 1NEXB 4R7AB 4JT5C 3SMRA 3PSCB 2QC5A 2YNOA 3ZE1B 5GMKn 2Q7QA 3SBQA 2Z2PA 4A0AB 3MKQA 4OWRA 1MDAH 2BCJB 2OVQB 3RLMD 2H9NA 2W18A 4LGNA 2EBSA 5IC7A 1GXRA 2CN3A 4J78A 2VDMB 5TEEA 3T3MB 1MG3A 2HXCA 4PBYA 4L3GD 2G9AA 4TZ4A 2P26A 2OJYA 4XYIA 5FKSA 1YFQA 2I3TA 4ZN4A 2CN2A 3SBRA 4A11B 1SSLA 2VDKB 4PSWB 1U8CB 5FKQA 4GQ2P 2AGWA 2VC2B 3JZNA 2XU7A 2GNQA 5CXBA 5FLXg 4OZUA 5GXIA 4K3JB 5E6UB 3EI1A 1S4UX 3BG1A 2OIZA 3UKRC 3KRXB 3VI3B 3L4MD 2I3SA 4Y5RD 2I0RA 4PC0A 2P28A 1R5MA 4O3TB 3C75H 5JWZA 1XKSA 4J87A 1JMXB 4A0BA 5IJ8E 4XEIC 2B4EA 5FKTA 4Z7OB 1SQJA 4J86A 2H47A 5A2Qg 3ZDYB 3UVMA 5HYNB 2YNPA 3EI4B 2HKRA 3JZGA 2H3XA 4CZVA 2B5MA 3PSLA 4A09B 1K32A 5I5JA 2AGYA 5EM2B 4WK2B 1PBYB 4ZOZA 5H17A 3OKYB 5H14A 2P9LC 3C99A 1Q47A 2P9IC 3JB9L 4PSXB 4CI3A 4H5IA 5EALA 1A0RB 4FHLA 3RMZD 3PXWD 3NIGB 4J81A 4GQBB 2IAAA 3VH0A 5HQGA 4WK0B 4BUJC 2XL2A 3A0FA 4PBZA 3FM0A 4GZ8A 4FAVD 2IWKA 5FKRA 5IJ7E 2QXVA 4GGDA 2H68A 5HDBB 4CY5A 3EWEA 2OK6A 4HDJA 4QQEA 3AL9A 4BL0A 2CE9A 2CO0C 3SHFA 3GREA 3I7OA 3UKUC 4PXWA 1XHMA 4QRJA 2H6KA 4QT8A 3MMYA 3K26A 1PI6A 4LG9A
chains in the Genus database with same CATH superfamily
4Z7OA 2YB8B 5FA5B 2EICA 4WJKB 5CXCB 4JHPC 3DSMA 4GGCA 3SN6B 3OKWA 4PNKB 5EAPA 5H1MA 3KRWB 4JT6C 4O2WA 2YNNA 5B4WA 4AMZA 5E6RB 2TRCB 3SLED 3VI4B 1GOHA 2VDOA 2OK4A 4BCBA 3NIFB 3EI2B 2VDNB 5E6UA 3MXXA 4IA9A 1PGUA 4J73A 1FWXA 4MMXA 2H13A 4O45A 3NVXA 3SBPA 3UVNA 5HE0B 4J79A 2BBKH 1C9LA 3K27A 4A11A 3OTTA 1B9XA 3I7LA 4A2LA 2VDOB 2EIDA 4CC9A 1QNIA 2HESX 1BPOA 2WQ8A 1YR2A 4BCCA 4D9SA 2AGLA 1SQ9A 1VE6A 1QFMA 2QR5A 4G55A 2J55H 3IIWA 4UM8B 5HE2B 1UOQA 4GM9A 5FXYA 1N6EA 4JSPC 3RFGA 2IUQA 2AH1A 3RFHA 3AH8B 3MKSB 3OKYA 5C2VB 3EG6A 3N0DA 4A09A 3DXMC 5EARA 3ZE2A 2B5LA 2PM9B 4J8GA 3VGZA 1E8NA 2J57G 4FA5D 3FCUB 5M5VA 3ZE2B 4Z7NB 4A0AA 4CY3A 2XDWA 5C2WB 4H5JA 4E54B 3ZE0B 1U2VC 2OVPB 5HE3B 3IUMA 3O4IA 2P9PC 4G56B 4FB1D 3JROA 1GG2B 3ULEC 3I89A 5CYKB 2HU8A 3PE7A 3I2NA 3IUJA 3MZKA 4ERQA 3IJ1A 2VDPA 4D6VA 2VDLA 3VI3A 3V4PA 2B5NA 2J56H 4X3EA 5E6SB 4O3UB 4ZOXA 2VDLB 4A7JA 5EMKB 3PXSD 2Z2NA 1H2ZA 4AEZA 4FA4D 4JSVC 1JOFA 2HKMA 3VA6A 3W15A 3NIFA 4QL1A 1TBGA 4CY2A 2PM7B 2UZXB 3IIYA 2GC7A 4CI2A 4GM3A 2XE4A 1N6DA 4J8BA 5EAMA 3V4VA 3NVQA 4KFMB 4Z7QB 3KCIA 2H9PA 4Z7NA 1RI6A 4WJKA 4O1QD 4J0XA 4NAAA 1E5TA 2YMUA 4GMBA 5FFOA 5FQDA 5TDHB 4LG8A 2EIEA 3I7NA 2AGXA 2CE8A 4L1MA 4AOWA 3OKTA 5AFU3 2P9KC 4Y7RA 3DXKC 3IULA 4U1EI 3K71A 2VDRB 1VYHC 5FFGA 3DM0A 3IKOA 4J0WA 5K1CC 2I0TA 4N14A 4BCDA 4K3ID 3E0CA 3EQ9A 3EI3A 1GP2B 3ORVD 1VE7A 3SWSD 5AJAA 2GC4A 3EI1B 3JZHA 3UVKA 4ZOYA 4CZXA 4ERYA 3P4FA 2VC2A 4EWRA 2P9NC 2YBAA 4E5ZB 3AL8B 5M61A 3BG0A 5HE1B 2VDKA 4A08A 4ZOVA 3FCSA 5SXMA 1O6GA 3DDUA 5E6RA 4ES0A 3O4GA 3UVOA 4BH6A 1YUKA 1JJUB 4NBMA 5EMJB 5TF2A 3T3PB 3ZDXA 4UM9D 4JD2C 3L4OD 2IURA 2AQ5A 3I7KA 4FWWA 3GD1I 5M5SA 1UTCA 2H6NA 3ZE0A 5IGQA 4E54A 2G99A 3SXTD 4J82A 4XYHA 4A2MA 2PM9A 1SHYB 5M5TA 2AH0A 4CZYA 3I7HA 3B7FA 2P9UC 1K8KC 1OLZA 1NR0A 2I0SA 4Z7QA 4X63B 4J84A 3V5WB 4JSXC 2PM6B 4X60B 1MG2A 3V7DB 3ODTA 4I79A 3ZE1A 4JSNC 2O9KA 5HDBA 4DNWA 1B9YA 1H2XA 4CI8A 4CI1A 3ZDXB 4AN0A 4IMMA 5IGOA 5I5IA 1GOGA 3U4YA 4X61B 3PXTD 3IUNA 2HJBA 3IJCA 5C9ZB 5KDOB 4NENA 1TYEA 2XL3A 3JRPA 2VDQB 5IT9g 3I7PA 2HJ4A 3AL8A 5GXHA 4D0KA 1PEVA 2H9LA 3CIKB 3MVDK 3PVWB 3NIDB 1K3IA 2EIBA 4RE5A 3FGBA 3EI2A 3JAMg 3RRMC 1VZ3A 4JHNA 1P22A 1O6FA 3ZWLB 5C86A 2JWGA 3SCYA 4ESGA 3RN0D 4Z8LA 3C9CA 3IJ0A 4JXMA 3EI4A 4CY1A 4MK0B 5EMLB 5I5MA 3EQ7A 1N6FA 2HYEA 4WK4B 2CO0A 3QHYB 2CNXA 1T2XA 4GQ1A 1TYQC 3RN1D 3C5MA 4MMZA 1A12A 3F3FA 3HFQA 1U4CA 3UVLA 3CFSB 4ERZA 4O9DA 3UR4A 1XIPA 3NVNA 4E5ZA 4A08B 3OL2B 3NIDA 5GSAA 3DWLC 3RSEC 3V9FA 1UOOA 3OL2A 2VDNA 3EI3B 3F3GA 4GM8A 5THAA 3I8EA 3JPXA 2XYIA 5CYKA 3J81g 5K19A 5M5RA 5CXCA 3K6SA 1QFSA 1L0QA 3CFVA 1M1XA 2IUPA 5EM2A 4NC4A 3AFCA 1H2YA 1ERJA 3N0EA 1GOTB 4U7AA 3F3PA 3SFZA 3J80g 4L3HD 2HU7A 2IWFA 4J77A 4NSXA 2AGZA 5EMMB 2IUVA 3I8CA 4QAMA 2OVRB 3SJLD 4L9OA 4FAND 4UI9R 4A0BB 3SVWD 1JMZB 3IURA 5TEFA 3IJEA 4BP8A 3EU7A 3FRXA 4G1EA 2QZPA 5AMSA 3GC3B 3GFCA 1OMWB 2H9MA 4YVDA 3BWSA 3O4HA 2H6QA 5E6SA 4L1QD 4UM9B 3MZLA 3PVUB 1TYEB 2H14A 4WK0A 2MTAH 2P9SC 3EMHA 4GGAA 5CXBB 2VDPB 2Z2OA 4FA9D 4FA1D 2UZYB 3OW8A 3ZDZB 3QI0A 1U8CA 2PBIB 1NEXB 4R7AB 4JT5C 1VZ2A 3SMRA 3PSCB 2QC5A 2YNOA 3ZE1B 5GMKn 3IVMA 2Q7QA 4DNUA 3SBQA 4WK2A 2Z2PA 4A0AB 4MMYA 2VDRA 3MKQA 4OWRA 1MDAH 2BCJB 2OVQB 3RLMD 2H9NA 2W18A 4LGNA 3T3MA 2HU5A 4AN1A 4DNVA 2EBSA 5IC7A 4AX4A 1GXRA 2CN3A 4J78A 2VDMB 5TEEA 3T3MB 1MG3A 2HXCA 4PBYA 4L3GD 2G9AA 4TZ4A 4UM8A 5C92A 2P26A 2OJYA 1L5GA 3EQ8A 4G1MA 4XYIA 5FKSA 1YFQA 1H2WA 2I3TA 4ZN4A 4BP9A 2CN2A 3SBRA 1C9IA 3O4JA 2JWHA 4A11B 1SSLA 2VDKB 4PSWB 3OF7A 1U8CB 3ZDZA 5FKQA 3IUQA 4GQ2P 2AGWA 2VC2B 3JZNA 2XU7A 1JTDB 2GNQA 5CXBA 4OZUA 5FLXg 5GXIA 4K3JB 5E6UB 3EI1A 1S4UX 2VDQA 3BG1A 2OIZA 4O02A 4UM9A 3UKRC 3KRXB 3VI3B 3VI4A 3L4MD 2I3SA 4Y5RD 2I0RA 4PC0A 2P28A 1R5MA 4O3TB 3C75H 5JWZA 1XKSA 1JV2A 4J87A 1GOFA 1JMXB 4A0BA 5IJ8E 4XEIC 2B4EA 5FKTA 4Z7OB 1SQJA 4WK4A 4J86A 2H47A 5A2Qg 3ZDYB 3UVMA 5HYNB 1E8MA 3FCUA 2YNPA 3EI4B 2HKRA 2XZGA 2H3XA 3JZGA 3MUOA 4CZVA 2B5MA 3PSLA 4A09B 1K32A 5I5JA 4AMYA 2AGYA 5EM2B 4WK2B 1PBYB 4ZOZA 5H17A 3ZDYA 3OKYB 5H14A 2VZ1A 4RE6A 2P9LC 2BKLA 3C99A 1Q47A 3T3PA 1UOPA 1I2MB 2P9IC 3JB9L 4PSXB 4CI3A 4H5IA 5EALA 1A0RB 4FHLA 3RMZD 3PXWD 3NIGB 4J81A 4GQBB 2IAAA 3VH0A 5HQGA 4WK0B 4BUJC 2XL2A 3A0FA 4PBZA 3FM0A 3NIGA 4GZ8A 4FAVD 2IWKA 5FKRA 4IRZA 5IJ7E 2VZ3A 2QXVA 4GGDA 2H68A 5HDBB 4CY5A 3MUNA 3EWEA 2OK6A 4HDJA 4QQEA 3AL9A 4BL0A 2CE9A 2CO0C 3SHFA 3GREA 3I7OA 3K72A 3UKUC 5M5UA 4PXWA 1XHMA 4QRJA 2H6KA 4QT8A 2VDMA 2JKXA 3MMYA 3K26A 1PI6A 4LG9A
chains in the Genus database with same CATH topology
2YB8B 5FA5B 4WJKB 5CXCB 3DSMA 4GGCA 3SN6B 3OKWA 4PNKB 5EAPA 5H1MA 3KRWB 4JT6C 2YNNA 5B4WA 5E6RB 2TRCB 3SLED 3VI4B 2OK4A 3NIFB 3EI2B 2VDNB 3MXXA 4IA9A 1PGUA 4J73A 1FWXA 3SBPA 2H13A 4O45A 3NVXA 3UVNA 5HE0B 4J79A 2BBKH 3K27A 4A11A 3OTTA 1B9XA 3I7LA 4A2LA 2VDOB 4CC9A 1QNIA 2HESX 2AGLA 1SQ9A 2J55H 3IIWA 4UM8B 5HE2B 4GM9A 5FXYA 1N6EA 4JSPC 3RFGA 2IUQA 2AH1A 3RFHA 3AH8B 3MKSB 3OKYA 5C2VB 3EG6A 3N0DA 4A09A 3DXMC 5EARA 2B5LA 2PM9B 4J8GA 3VGZA 2J57G 4FA5D 3FCUB 3ZE2B 4Z7NB 4A0AA 4CY3A 5C2WB 4E54B 4H5JA 3ZE0B 1U2VC 2OVPB 5HE3B 2P9PC 4G56B 4FB1D 3JROA 1GG2B 3ULEC 3I89A 5CYKB 3PE7A 3I2NA 3MZKA 4ERQA 3IJ1A 4D6VA 2B5NA 2J56H 4X3EA 5E6SB 4O3UB 4ZOXA 2VDLB 4A7JA 5EMKB 3PXSD 2Z2NA 4AEZA 4FA4D 4JSVC 1JOFA 2HKMA 3VA6A 3W15A 4QL1A 4CY2A 1TBGA 2PM7B 2UZXB 3IIYA 2GC7A 4CI2A 4GM3A 1N6DA 4J8BA 5EAMA 4Z7QB 3NVQA 4KFMB 2H9PA 1RI6A 4O1QD 4J0XA 2YMUA 4GMBA 5FQDA 5TDHB 4LG8A 3I7NA 2AGXA 2CE8A 4AOWA 3OKTA 5AFU3 2P9KC 4Y7RA 3DXKC 4U1EI 2VDRB 1VYHC 3DM0A 3IKOA 4J0WA 5K1CC 2I0TA 4N14A 4K3ID 3E0CA 3EI3A 1GP2B 3ORVD 3SWSD 5AJAA 2GC4A 3EI1B 3JZHA 3UVKA 4ZOYA 4CZXA 4ERYA 3P4FA 4EWRA 2P9NC 2YBAA 4E5ZB 3AL8B 4A08A 3BG0A 5HE1B 4ZOVA 5SXMA 4ES0A 3UVOA 4BH6A 1YUKA 1JJUB 5EMJB 5TF2A 3T3PB 4UM9D 4JD2C 3L4OD 2IURA 2AQ5A 3I7KA 4FWWA 2H6NA 5IGQA 4E54A 2G99A 3SXTD 4J82A 4XYHA 4A2MA 2PM9A 1SHYB 2AH0A 4CZYA 3I7HA 3B7FA 2P9UC 1K8KC 1OLZA 1NR0A 2I0SA 4X63B 4J84A 3V5WB 4JSXC 2PM6B 4X60B 1MG2A 3V7DB 3ODTA 4I79A 4JSNC 2O9KA 1B9YA 3ZDXB 4CI8A 4CI1A 4IMMA 5IGOA 5I5IA 3U4YA 4X61B 3PXTD 5C9ZB 2HJBA 3IJCA 5KDOB 2XL3A 3JRPA 2VDQB 5IT9g 3I7PA 2HJ4A 3AL8A 5GXHA 4D0KA 1PEVA 2H9LA 3CIKB 3PVWB 3NIDB 3FGBA 3EI2A 3JAMg 3RRMC 1P22A 3ZWLB 2JWGA 3SCYA 4ESGA 3RN0D 4Z8LA 3C9CA 3IJ0A 4JXMA 3EI4A 4CY1A 4MK0B 5EMLB 5I5MA 1N6FA 2HYEA 4WK4B 2CO0A 2CNXA 4GQ1A 1TYQC 3RN1D 3C5MA 3F3FA 3HFQA 1U4CA 3UVLA 3CFSB 4ERZA 4O9DA 3UR4A 1XIPA 3NVNA 4E5ZA 4A08B 3OL2B 5GSAA 3DWLC 3RSEC 3V9FA 3OL2A 3EI3B 3F3GA 4GM8A 5THAA 3I8EA 3JPXA 2XYIA 5CYKA 3J81g 5K19A 5CXCA 1L0QA 3CFVA 2IUPA 5EM2A 3AFCA 1ERJA 3N0EA 1GOTB 4U7AA 3F3PA 3SFZA 3J80g 4L3HD 2IWFA 4J77A 4NSXA 2AGZA 5EMMB 2IUVA 3I8CA 2OVRB 3SJLD 4L9OA 4FAND 4UI9R 4A0BB 3SVWD 1JMZB 5TEFA 3EU7A 3FRXA 5AMSA 3GFCA 1OMWB 2H9MA 4YVDA 3BWSA 2H6QA 4L1QD 4UM9B 3MZLA 3PVUB 1TYEB 2H14A 2MTAH 2P9SC 3EMHA 4GGAA 5CXBB 2VDPB 2Z2OA 4FA9D 4FA1D 2UZYB 3OW8A 3ZDZB 2PBIB 1NEXB 4R7AB 4JT5C 3SMRA 3PSCB 2QC5A 2YNOA 3ZE1B 5GMKn 2Q7QA 3SBQA 2Z2PA 4A0AB 3MKQA 4OWRA 1MDAH 2BCJB 2OVQB 3RLMD 2H9NA 2W18A 4LGNA 2EBSA 5IC7A 1GXRA 2CN3A 4J78A 2VDMB 5TEEA 3T3MB 1MG3A 2HXCA 4PBYA 4L3GD 2G9AA 4TZ4A 2P26A 2OJYA 4XYIA 5FKSA 1YFQA 2I3TA 4ZN4A 2CN2A 3SBRA 2JWHA 4A11B 1SSLA 2VDKB 4PSWB 1U8CB 5FKQA 4GQ2P 2AGWA 2VC2B 3JZNA 2XU7A 2GNQA 5CXBA 5FLXg 4OZUA 5GXIA 4K3JB 5E6UB 3EI1A 1S4UX 3BG1A 2OIZA 3UKRC 3KRXB 3VI3B 3L4MD 2I3SA 4Y5RD 2I0RA 4PC0A 2P28A 1R5MA 4O3TB 3C75H 5JWZA 1XKSA 4J87A 1JMXB 4A0BA 5IJ8E 4XEIC 2B4EA 5FKTA 4Z7OB 1SQJA 4J86A 2H47A 5A2Qg 3ZDYB 3UVMA 5HYNB 2YNPA 3EI4B 2HKRA 3JZGA 2H3XA 4CZVA 2B5MA 3PSLA 4A09B 1K32A 5I5JA 2AGYA 5EM2B 4WK2B 1PBYB 4ZOZA 5H17A 3OKYB 5H14A 2P9LC 3C99A 1Q47A 2P9IC 3JB9L 4PSXB 4CI3A 4H5IA 5EALA 1A0RB 4FHLA 3RMZD 3PXWD 3NIGB 4J81A 4GQBB 2IAAA 3VH0A 5HQGA 4WK0B 4BUJC 2XL2A 3A0FA 4PBZA 3FM0A 4GZ8A 4FAVD 2IWKA 5FKRA 5IJ7E 2QXVA 4GGDA 2H68A 5HDBB 4CY5A 3EWEA 2OK6A 4HDJA 4QQEA 3AL9A 4BL0A 2CE9A 2CO0C 3SHFA 3GREA 3I7OA 3UKUC 4PXWA 1XHMA 4QRJA 2H6KA 4QT8A 3MMYA 3K26A 1PI6A 4LG9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YB8 B;  5FA5 B;  4WJK B;  5CXC B;  3DSM A;  4GGC A;  3SN6 B;  3OKW A;  4PNK B;  5EAP A;  5H1M A;  3KRW B;  4JT6 C;  2YNN A;  5B4W A;  5E6R B;  2TRC B;  3SLE D;  3VI4 B;  2OK4 A;  3NIF B;  3EI2 B;  2VDN B;  3MXX A;  4IA9 A;  1PGU A;  4J73 A;  1FWX A;  3SBP A;  2H13 A;  4O45 A;  3NVX A;  3UVN A;  5HE0 B;  4J79 A;  2BBK H;  3K27 A;  4A11 A;  3OTT A;  1B9X A;  3I7L A;  4A2L A;  2VDO B;  4CC9 A;  1QNI A;  2HES X;  2AGL A;  1SQ9 A;  2J55 H;  3IIW A;  4UM8 B;  5HE2 B;  4GM9 A;  5FXY A;  1N6E A;  4JSP C;  3RFG A;  2IUQ A;  2AH1 A;  3RFH A;  3AH8 B;  3MKS B;  3OKY A;  5C2V B;  3EG6 A;  3N0D A;  4A09 A;  3DXM C;  5EAR A;  2B5L A;  2PM9 B;  4J8G A;  3VGZ A;  2J57 G;  4FA5 D;  3FCU B;  3ZE2 B;  4Z7N B;  4A0A A;  4CY3 A;  5C2W B;  4E54 B;  4H5J A;  3ZE0 B;  1U2V C;  2OVP B;  5HE3 B;  2P9P C;  4G56 B;  4FB1 D;  3JRO A;  1GG2 B;  3ULE C;  3I89 A;  5CYK B;  3PE7 A;  3I2N A;  3MZK A;  4ERQ A;  3IJ1 A;  4D6V A;  2B5N A;  2J56 H;  4X3E A;  5E6S B;  4O3U B;  4ZOX A;  2VDL B;  4A7J A;  5EMK B;  3PXS D;  2Z2N A;  4AEZ A;  4FA4 D;  4JSV C;  1JOF A;  2HKM A;  3VA6 A;  3W15 A;  4QL1 A;  4CY2 A;  1TBG A;  2PM7 B;  2UZX B;  3IIY A;  2GC7 A;  4CI2 A;  4GM3 A;  1N6D A;  4J8B A;  5EAM A;  4Z7Q B;  3NVQ A;  4KFM B;  2H9P A;  1RI6 A;  4O1Q D;  4J0X A;  2YMU A;  4GMB A;  5FQD A;  5TDH B;  4LG8 A;  3I7N A;  2AGX A;  2CE8 A;  4AOW A;  3OKT A;  5AFU 3;  2P9K C;  4Y7R A;  3DXK C;  4U1E I;  2VDR B;  1VYH C;  3DM0 A;  3IKO A;  4J0W A;  5K1C C;  2I0T A;  4N14 A;  4K3I D;  3E0C A;  3EI3 A;  1GP2 B;  3ORV D;  3SWS D;  5AJA A;  2GC4 A;  3EI1 B;  3JZH A;  3UVK A;  4ZOY A;  4CZX A;  4ERY A;  3P4F A;  4EWR A;  2P9N C;  2YBA A;  4E5Z B;  3AL8 B;  4A08 A;  3BG0 A;  5HE1 B;  4ZOV A;  5SXM A;  4ES0 A;  3UVO A;  4BH6 A;  1YUK A;  1JJU B;  5EMJ B;  5TF2 A;  3T3P B;  4UM9 D;  4JD2 C;  3L4O D;  2IUR A;  2AQ5 A;  3I7K A;  4FWW A;  2H6N A;  5IGQ A;  4E54 A;  2G99 A;  3SXT D;  4J82 A;  4XYH A;  4A2M A;  2PM9 A;  1SHY B;  2AH0 A;  4CZY A;  3I7H A;  3B7F A;  2P9U C;  1K8K C;  1OLZ A;  1NR0 A;  2I0S A;  4X63 B;  4J84 A;  3V5W B;  4JSX C;  2PM6 B;  4X60 B;  1MG2 A;  3V7D B;  3ODT A;  4I79 A;  4JSN C;  2O9K A;  1B9Y A;  3ZDX B;  4CI8 A;  4CI1 A;  4IMM A;  5IGO A;  5I5I A;  3U4Y A;  4X61 B;  3PXT D;  5C9Z B;  2HJB A;  3IJC A;  5KDO B;  2XL3 A;  3JRP A;  2VDQ B;  5IT9 g;  3I7P A;  2HJ4 A;  3AL8 A;  5GXH A;  4D0K A;  1PEV A;  2H9L A;  3CIK B;  3PVW B;  3NID B;  3FGB A;  3EI2 A;  3JAM g;  3RRM C;  1P22 A;  3ZWL B;  3SCY A;  4ESG A;  3RN0 D;  4Z8L A;  3C9C A;  3IJ0 A;  4JXM A;  3EI4 A;  4CY1 A;  4MK0 B;  5EML B;  5I5M A;  1N6F A;  2HYE A;  4WK4 B;  2CO0 A;  2CNX A;  4GQ1 A;  1TYQ C;  3RN1 D;  3C5M A;  3F3F A;  3HFQ A;  1U4C A;  3UVL A;  3CFS B;  4ERZ A;  4O9D A;  3UR4 A;  1XIP A;  3NVN A;  4E5Z A;  4A08 B;  3OL2 B;  5GSA A;  3DWL C;  3RSE C;  3V9F A;  3OL2 A;  3EI3 B;  3F3G A;  4GM8 A;  5THA A;  3I8E A;  3JPX A;  2XYI A;  5CYK A;  3J81 g;  5K19 A;  5CXC A;  1L0Q A;  3CFV A;  2IUP A;  5EM2 A;  3AFC A;  1ERJ A;  3N0E A;  1GOT B;  4U7A A;  3F3P A;  3SFZ A;  3J80 g;  4L3H D;  2IWF A;  4J77 A;  4NSX A;  2AGZ A;  5EMM B;  2IUV A;  3I8C A;  2OVR B;  3SJL D;  4L9O A;  4FAN D;  4UI9 R;  4A0B B;  3SVW D;  1JMZ B;  5TEF A;  3EU7 A;  3FRX A;  5AMS A;  3GFC A;  1OMW B;  2H9M A;  4YVD A;  3BWS A;  2H6Q A;  4L1Q D;  4UM9 B;  3MZL A;  3PVU B;  1TYE B;  2H14 A;  2MTA H;  2P9S C;  3EMH A;  4GGA A;  5CXB B;  2VDP B;  2Z2O A;  4FA9 D;  4FA1 D;  2UZY B;  3OW8 A;  3ZDZ B;  2PBI B;  1NEX B;  4R7A B;  4JT5 C;  3SMR A;  3PSC B;  2QC5 A;  2YNO A;  3ZE1 B;  5GMK n;  2Q7Q A;  3SBQ A;  2Z2P A;  4A0A B;  3MKQ A;  4OWR A;  1MDA H;  2BCJ B;  2OVQ B;  3RLM D;  2H9N A;  2W18 A;  4LGN A;  2EBS A;  5IC7 A;  1GXR A;  2CN3 A;  4J78 A;  2VDM B;  5TEE A;  3T3M B;  1MG3 A;  2HXC A;  4PBY A;  4L3G D;  2G9A A;  4TZ4 A;  2P26 A;  2OJY A;  4XYI A;  5FKS A;  1YFQ A;  2I3T A;  4ZN4 A;  2CN2 A;  3SBR A;  4A11 B;  1SSL A;  2VDK B;  4PSW B;  1U8C B;  5FKQ A;  4GQ2 P;  2AGW A;  2VC2 B;  3JZN A;  2XU7 A;  2GNQ A;  5CXB A;  5FLX g;  4OZU A;  5GXI A;  4K3J B;  5E6U B;  3EI1 A;  1S4U X;  3BG1 A;  2OIZ A;  3UKR C;  3KRX B;  3VI3 B;  3L4M D;  2I3S A;  4Y5R D;  2I0R A;  4PC0 A;  2P28 A;  1R5M A;  4O3T B;  3C75 H;  5JWZ A;  1XKS A;  4J87 A;  1JMX B;  4A0B A;  5IJ8 E;  4XEI C;  2B4E A;  5FKT A;  4Z7O B;  1SQJ A;  4J86 A;  2H47 A;  5A2Q g;  3ZDY B;  3UVM A;  5HYN B;  2YNP A;  3EI4 B;  2HKR A;  3JZG A;  2H3X A;  4CZV A;  2B5M A;  3PSL A;  4A09 B;  1K32 A;  5I5J A;  2AGY A;  5EM2 B;  4WK2 B;  1PBY B;  4ZOZ A;  5H17 A;  3OKY B;  5H14 A;  2P9L C;  3C99 A;  1Q47 A;  2P9I C;  3JB9 L;  4PSX B;  4CI3 A;  4H5I A;  5EAL A;  1A0R B;  4FHL A;  3RMZ D;  3PXW D;  3NIG B;  4J81 A;  4GQB B;  2IAA A;  3VH0 A;  5HQG A;  4WK0 B;  4BUJ C;  2XL2 A;  3A0F A;  4PBZ A;  3FM0 A;  4GZ8 A;  4FAV D;  2IWK A;  5FKR A;  5IJ7 E;  2QXV A;  4GGD A;  2H68 A;  5HDB B;  4CY5 A;  3EWE A;  2OK6 A;  4HDJ A;  4QQE A;  3AL9 A;  4BL0 A;  2CE9 A;  2CO0 C;  3SHF A;  3GRE A;  3I7O A;  3UKU C;  4PXW A;  1XHM A;  4QRJ A;  2H6K A;  4QT8 A;  3MMY A;  3K26 A;  1PI6 A;  4LG9 A; 
#chains in the Genus database with same CATH topology
 4Z7O A;  2YB8 B;  5FA5 B;  2EIC A;  4WJK B;  5CXC B;  4JHP C;  3DSM A;  4GGC A;  3SN6 B;  3OKW A;  4PNK B;  5EAP A;  5H1M A;  3KRW B;  4JT6 C;  4O2W A;  2YNN A;  5B4W A;  4AMZ A;  5E6R B;  2TRC B;  3SLE D;  3VI4 B;  1GOH A;  2VDO A;  2OK4 A;  4BCB A;  3NIF B;  3EI2 B;  2VDN B;  5E6U A;  3MXX A;  4IA9 A;  1PGU A;  4J73 A;  1FWX A;  4MMX A;  2H13 A;  4O45 A;  3NVX A;  3SBP A;  3UVN A;  5HE0 B;  4J79 A;  2BBK H;  1C9L A;  3K27 A;  4A11 A;  3OTT A;  1B9X A;  3I7L A;  4A2L A;  2VDO B;  2EID A;  4CC9 A;  1QNI A;  2HES X;  1BPO A;  2WQ8 A;  1YR2 A;  4BCC A;  4D9S A;  2AGL A;  1SQ9 A;  1VE6 A;  1QFM A;  2QR5 A;  4G55 A;  2J55 H;  3IIW A;  4UM8 B;  5HE2 B;  1UOQ A;  4GM9 A;  5FXY A;  1N6E A;  4JSP C;  3RFG A;  2IUQ A;  2AH1 A;  3RFH A;  3AH8 B;  3MKS B;  3OKY A;  5C2V B;  3EG6 A;  3N0D A;  4A09 A;  3DXM C;  5EAR A;  3ZE2 A;  2B5L A;  2PM9 B;  4J8G A;  3VGZ A;  1E8N A;  2J57 G;  4FA5 D;  3FCU B;  5M5V A;  3ZE2 B;  4Z7N B;  4A0A A;  4CY3 A;  2XDW A;  5C2W B;  4H5J A;  4E54 B;  3ZE0 B;  1U2V C;  2OVP B;  5HE3 B;  3IUM A;  3O4I A;  2P9P C;  4G56 B;  4FB1 D;  3JRO A;  1GG2 B;  3ULE C;  3I89 A;  5CYK B;  2HU8 A;  3PE7 A;  3I2N A;  3IUJ A;  3MZK A;  4ERQ A;  3IJ1 A;  2VDP A;  4D6V A;  2VDL A;  3VI3 A;  3V4P A;  2B5N A;  2J56 H;  4X3E A;  5E6S B;  4O3U B;  4ZOX A;  2VDL B;  4A7J A;  5EMK B;  3PXS D;  2Z2N A;  1H2Z A;  4AEZ A;  4FA4 D;  4JSV C;  1JOF A;  2HKM A;  3VA6 A;  3W15 A;  3NIF A;  4QL1 A;  1TBG A;  4CY2 A;  2PM7 B;  2UZX B;  3IIY A;  2GC7 A;  4CI2 A;  4GM3 A;  2XE4 A;  1N6D A;  4J8B A;  5EAM A;  3V4V A;  3NVQ A;  4KFM B;  4Z7Q B;  3KCI A;  2H9P A;  4Z7N A;  1RI6 A;  4WJK A;  4O1Q D;  4J0X A;  4NAA A;  1E5T A;  2YMU A;  4GMB A;  5FFO A;  5FQD A;  5TDH B;  4LG8 A;  2EIE A;  3I7N A;  2AGX A;  2CE8 A;  4L1M A;  4AOW A;  3OKT A;  5AFU 3;  2P9K C;  4Y7R A;  3DXK C;  3IUL A;  4U1E I;  3K71 A;  2VDR B;  1VYH C;  5FFG A;  3DM0 A;  3IKO A;  4J0W A;  5K1C C;  2I0T A;  4N14 A;  4BCD A;  4K3I D;  3E0C A;  3EQ9 A;  3EI3 A;  1GP2 B;  3ORV D;  1VE7 A;  3SWS D;  5AJA A;  2GC4 A;  3EI1 B;  3JZH A;  3UVK A;  4ZOY A;  4CZX A;  4ERY A;  3P4F A;  2VC2 A;  4EWR A;  2P9N C;  2YBA A;  4E5Z B;  3AL8 B;  5M61 A;  3BG0 A;  5HE1 B;  2VDK A;  4A08 A;  4ZOV A;  3FCS A;  5SXM A;  1O6G A;  3DDU A;  5E6R A;  4ES0 A;  3O4G A;  3UVO A;  4BH6 A;  1YUK A;  1JJU B;  4NBM A;  5EMJ B;  5TF2 A;  3T3P B;  3ZDX A;  4UM9 D;  4JD2 C;  3L4O D;  2IUR A;  2AQ5 A;  3I7K A;  4FWW A;  3GD1 I;  5M5S A;  1UTC A;  2H6N A;  3ZE0 A;  5IGQ A;  4E54 A;  2G99 A;  3SXT D;  4J82 A;  4XYH A;  4A2M A;  2PM9 A;  1SHY B;  5M5T A;  2AH0 A;  4CZY A;  3I7H A;  3B7F A;  2P9U C;  1K8K C;  1OLZ A;  1NR0 A;  2I0S A;  4Z7Q A;  4X63 B;  4J84 A;  3V5W B;  4JSX C;  2PM6 B;  4X60 B;  1MG2 A;  3V7D B;  3ODT A;  4I79 A;  3ZE1 A;  4JSN C;  2O9K A;  5HDB A;  4DNW A;  1B9Y A;  1H2X A;  4CI8 A;  4CI1 A;  3ZDX B;  4AN0 A;  4IMM A;  5IGO A;  5I5I A;  1GOG A;  3U4Y A;  4X61 B;  3PXT D;  3IUN A;  2HJB A;  3IJC A;  5C9Z B;  5KDO B;  4NEN A;  1TYE A;  2XL3 A;  3JRP A;  2VDQ B;  5IT9 g;  3I7P A;  2HJ4 A;  3AL8 A;  5GXH A;  4D0K A;  1PEV A;  2H9L A;  3CIK B;  3MVD K;  3PVW B;  3NID B;  1K3I A;  2EIB A;  4RE5 A;  3FGB A;  3EI2 A;  3JAM g;  3RRM C;  1VZ3 A;  4JHN A;  1P22 A;  1O6F A;  3ZWL B;  5C86 A;  2JWG A;  3SCY A;  4ESG A;  3RN0 D;  4Z8L A;  3C9C A;  3IJ0 A;  4JXM A;  3EI4 A;  4CY1 A;  4MK0 B;  5EML B;  5I5M A;  3EQ7 A;  1N6F A;  2HYE A;  4WK4 B;  2CO0 A;  3QHY B;  2CNX A;  1T2X A;  4GQ1 A;  1TYQ C;  3RN1 D;  3C5M A;  4MMZ A;  1A12 A;  3F3F A;  3HFQ A;  1U4C A;  3UVL A;  3CFS B;  4ERZ A;  4O9D A;  3UR4 A;  1XIP A;  3NVN A;  4E5Z A;  4A08 B;  3OL2 B;  3NID A;  5GSA A;  3DWL C;  3RSE C;  3V9F A;  1UOO A;  3OL2 A;  2VDN A;  3EI3 B;  3F3G A;  4GM8 A;  5THA A;  3I8E A;  3JPX A;  2XYI A;  5CYK A;  3J81 g;  5K19 A;  5M5R A;  5CXC A;  3K6S A;  1QFS A;  1L0Q A;  3CFV A;  1M1X A;  2IUP A;  5EM2 A;  4NC4 A;  3AFC A;  1H2Y A;  1ERJ A;  3N0E A;  1GOT B;  4U7A A;  3F3P A;  3SFZ A;  3J80 g;  4L3H D;  2HU7 A;  2IWF A;  4J77 A;  4NSX A;  2AGZ A;  5EMM B;  2IUV A;  3I8C A;  4QAM A;  2OVR B;  3SJL D;  4L9O A;  4FAN D;  4UI9 R;  4A0B B;  3SVW D;  1JMZ B;  3IUR A;  5TEF A;  3IJE A;  4BP8 A;  3EU7 A;  3FRX A;  4G1E A;  2QZP A;  5AMS A;  3GC3 B;  3GFC A;  1OMW B;  2H9M A;  4YVD A;  3BWS A;  3O4H A;  2H6Q A;  5E6S A;  4L1Q D;  4UM9 B;  3MZL A;  3PVU B;  1TYE B;  2H14 A;  4WK0 A;  2MTA H;  2P9S C;  3EMH A;  4GGA A;  5CXB B;  2VDP B;  2Z2O A;  4FA9 D;  4FA1 D;  2UZY B;  3OW8 A;  3ZDZ B;  3QI0 A;  1U8C A;  2PBI B;  1NEX B;  4R7A B;  4JT5 C;  1VZ2 A;  3SMR A;  3PSC B;  2QC5 A;  2YNO A;  3ZE1 B;  5GMK n;  3IVM A;  2Q7Q A;  4DNU A;  3SBQ A;  4WK2 A;  2Z2P A;  4A0A B;  4MMY A;  2VDR A;  3MKQ A;  4OWR A;  1MDA H;  2BCJ B;  2OVQ B;  3RLM D;  2H9N A;  2W18 A;  4LGN A;  3T3M A;  2HU5 A;  4AN1 A;  4DNV A;  2EBS A;  5IC7 A;  4AX4 A;  1GXR A;  2CN3 A;  4J78 A;  2VDM B;  5TEE A;  3T3M B;  1MG3 A;  2HXC A;  4PBY A;  4L3G D;  2G9A A;  4TZ4 A;  4UM8 A;  5C92 A;  2P26 A;  2OJY A;  1L5G A;  3EQ8 A;  4G1M A;  4XYI A;  5FKS A;  1YFQ A;  1H2W A;  2I3T A;  4ZN4 A;  4BP9 A;  2CN2 A;  3SBR A;  1C9I A;  3O4J A;  2JWH A;  4A11 B;  1SSL A;  2VDK B;  4PSW B;  3OF7 A;  1U8C B;  3ZDZ A;  5FKQ A;  3IUQ A;  4GQ2 P;  2AGW A;  2VC2 B;  3JZN A;  2XU7 A;  1JTD B;  2GNQ A;  5CXB A;  4OZU A;  5FLX g;  5GXI A;  4K3J B;  5E6U B;  3EI1 A;  1S4U X;  2VDQ A;  3BG1 A;  2OIZ A;  4O02 A;  4UM9 A;  3UKR C;  3KRX B;  3VI3 B;  3VI4 A;  3L4M D;  2I3S A;  4Y5R D;  2I0R A;  4PC0 A;  2P28 A;  1R5M A;  4O3T B;  3C75 H;  5JWZ A;  1XKS A;  1JV2 A;  4J87 A;  1GOF A;  1JMX B;  4A0B A;  5IJ8 E;  4XEI C;  2B4E A;  5FKT A;  4Z7O B;  1SQJ A;  4WK4 A;  4J86 A;  2H47 A;  5A2Q g;  3ZDY B;  3UVM A;  5HYN B;  1E8M A;  3FCU A;  2YNP A;  3EI4 B;  2HKR A;  2XZG A;  2H3X A;  3JZG A;  3MUO A;  4CZV A;  2B5M A;  3PSL A;  4A09 B;  1K32 A;  5I5J A;  4AMY A;  2AGY A;  5EM2 B;  4WK2 B;  1PBY B;  4ZOZ A;  5H17 A;  3ZDY A;  3OKY B;  5H14 A;  2VZ1 A;  4RE6 A;  2P9L C;  2BKL A;  3C99 A;  1Q47 A;  3T3P A;  1UOP A;  1I2M B;  2P9I C;  3JB9 L;  4PSX B;  4CI3 A;  4H5I A;  5EAL A;  1A0R B;  4FHL A;  3RMZ D;  3PXW D;  3NIG B;  4J81 A;  4GQB B;  2IAA A;  3VH0 A;  5HQG A;  4WK0 B;  4BUJ C;  2XL2 A;  3A0F A;  4PBZ A;  3FM0 A;  3NIG A;  4GZ8 A;  4FAV D;  2IWK A;  5FKR A;  4IRZ A;  5IJ7 E;  2VZ3 A;  2QXV A;  4GGD A;  2H68 A;  5HDB B;  4CY5 A;  3MUN A;  3EWE A;  2OK6 A;  4HDJ A;  4QQE A;  3AL9 A;  4BL0 A;  2CE9 A;  2CO0 C;  3SHF A;  3GRE A;  3I7O A;  3K72 A;  3UKU C;  5M5U A;  4PXW A;  1XHM A;  4QRJ A;  2H6K A;  4QT8 A;  2VDM A;  2JKX A;  3MMY A;  3K26 A;  1PI6 A;  4LG9 A; 
#chains in the Genus database with same CATH homology
 2YB8 B;  5FA5 B;  4WJK B;  5CXC B;  3DSM A;  4GGC A;  3SN6 B;  3OKW A;  4PNK B;  5EAP A;  5H1M A;  3KRW B;  4JT6 C;  2YNN A;  5B4W A;  5E6R B;  2TRC B;  3SLE D;  3VI4 B;  2OK4 A;  3NIF B;  3EI2 B;  2VDN B;  3MXX A;  4IA9 A;  1PGU A;  4J73 A;  1FWX A;  3SBP A;  2H13 A;  4O45 A;  3NVX A;  3UVN A;  5HE0 B;  4J79 A;  2BBK H;  3K27 A;  4A11 A;  3OTT A;  1B9X A;  3I7L A;  4A2L A;  2VDO B;  4CC9 A;  1QNI A;  2HES X;  2AGL A;  1SQ9 A;  2J55 H;  3IIW A;  4UM8 B;  5HE2 B;  4GM9 A;  5FXY A;  1N6E A;  4JSP C;  3RFG A;  2IUQ A;  2AH1 A;  3RFH A;  3AH8 B;  3MKS B;  3OKY A;  5C2V B;  3EG6 A;  3N0D A;  4A09 A;  3DXM C;  5EAR A;  2B5L A;  2PM9 B;  4J8G A;  3VGZ A;  2J57 G;  4FA5 D;  3FCU B;  3ZE2 B;  4Z7N B;  4A0A A;  4CY3 A;  5C2W B;  4E54 B;  4H5J A;  3ZE0 B;  1U2V C;  2OVP B;  5HE3 B;  2P9P C;  4G56 B;  4FB1 D;  3JRO A;  1GG2 B;  3ULE C;  3I89 A;  5CYK B;  3PE7 A;  3I2N A;  3MZK A;  4ERQ A;  3IJ1 A;  4D6V A;  2B5N A;  2J56 H;  4X3E A;  5E6S B;  4O3U B;  4ZOX A;  2VDL B;  4A7J A;  5EMK B;  3PXS D;  2Z2N A;  4AEZ A;  4FA4 D;  4JSV C;  1JOF A;  2HKM A;  3VA6 A;  3W15 A;  4QL1 A;  4CY2 A;  1TBG A;  2PM7 B;  2UZX B;  3IIY A;  2GC7 A;  4CI2 A;  4GM3 A;  1N6D A;  4J8B A;  5EAM A;  4Z7Q B;  3NVQ A;  4KFM B;  2H9P A;  1RI6 A;  4O1Q D;  4J0X A;  2YMU A;  4GMB A;  5FQD A;  5TDH B;  4LG8 A;  3I7N A;  2AGX A;  2CE8 A;  4AOW A;  3OKT A;  5AFU 3;  2P9K C;  4Y7R A;  3DXK C;  4U1E I;  2VDR B;  1VYH C;  3DM0 A;  3IKO A;  4J0W A;  5K1C C;  2I0T A;  4N14 A;  4K3I D;  3E0C A;  3EI3 A;  1GP2 B;  3ORV D;  3SWS D;  5AJA A;  2GC4 A;  3EI1 B;  3JZH A;  3UVK A;  4ZOY A;  4CZX A;  4ERY A;  3P4F A;  4EWR A;  2P9N C;  2YBA A;  4E5Z B;  3AL8 B;  4A08 A;  3BG0 A;  5HE1 B;  4ZOV A;  5SXM A;  4ES0 A;  3UVO A;  4BH6 A;  1YUK A;  1JJU B;  5EMJ B;  5TF2 A;  3T3P B;  4UM9 D;  4JD2 C;  3L4O D;  2IUR A;  2AQ5 A;  3I7K A;  4FWW A;  2H6N A;  5IGQ A;  4E54 A;  2G99 A;  3SXT D;  4J82 A;  4XYH A;  4A2M A;  2PM9 A;  1SHY B;  2AH0 A;  4CZY A;  3I7H A;  3B7F A;  2P9U C;  1K8K C;  1OLZ A;  1NR0 A;  2I0S A;  4X63 B;  4J84 A;  3V5W B;  4JSX C;  2PM6 B;  4X60 B;  1MG2 A;  3V7D B;  3ODT A;  4I79 A;  4JSN C;  2O9K A;  1B9Y A;  3ZDX B;  4CI8 A;  4CI1 A;  4IMM A;  5IGO A;  5I5I A;  3U4Y A;  4X61 B;  3PXT D;  5C9Z B;  2HJB A;  3IJC A;  5KDO B;  2XL3 A;  3JRP A;  2VDQ B;  5IT9 g;  3I7P A;  2HJ4 A;  3AL8 A;  5GXH A;  4D0K A;  1PEV A;  2H9L A;  3CIK B;  3PVW B;  3NID B;  3FGB A;  3EI2 A;  3JAM g;  3RRM C;  1P22 A;  3ZWL B;  2JWG A;  3SCY A;  4ESG A;  3RN0 D;  4Z8L A;  3C9C A;  3IJ0 A;  4JXM A;  3EI4 A;  4CY1 A;  4MK0 B;  5EML B;  5I5M A;  1N6F A;  2HYE A;  4WK4 B;  2CO0 A;  2CNX A;  4GQ1 A;  1TYQ C;  3RN1 D;  3C5M A;  3F3F A;  3HFQ A;  1U4C A;  3UVL A;  3CFS B;  4ERZ A;  4O9D A;  3UR4 A;  1XIP A;  3NVN A;  4E5Z A;  4A08 B;  3OL2 B;  5GSA A;  3DWL C;  3RSE C;  3V9F A;  3OL2 A;  3EI3 B;  3F3G A;  4GM8 A;  5THA A;  3I8E A;  3JPX A;  2XYI A;  5CYK A;  3J81 g;  5K19 A;  5CXC A;  1L0Q A;  3CFV A;  2IUP A;  5EM2 A;  3AFC A;  1ERJ A;  3N0E A;  1GOT B;  4U7A A;  3F3P A;  3SFZ A;  3J80 g;  4L3H D;  2IWF A;  4J77 A;  4NSX A;  2AGZ A;  5EMM B;  2IUV A;  3I8C A;  2OVR B;  3SJL D;  4L9O A;  4FAN D;  4UI9 R;  4A0B B;  3SVW D;  1JMZ B;  5TEF A;  3EU7 A;  3FRX A;  5AMS A;  3GFC A;  1OMW B;  2H9M A;  4YVD A;  3BWS A;  2H6Q A;  4L1Q D;  4UM9 B;  3MZL A;  3PVU B;  1TYE B;  2H14 A;  2MTA H;  2P9S C;  3EMH A;  4GGA A;  5CXB B;  2VDP B;  2Z2O A;  4FA9 D;  4FA1 D;  2UZY B;  3OW8 A;  3ZDZ B;  2PBI B;  1NEX B;  4R7A B;  4JT5 C;  3SMR A;  3PSC B;  2QC5 A;  2YNO A;  3ZE1 B;  5GMK n;  2Q7Q A;  3SBQ A;  2Z2P A;  4A0A B;  3MKQ A;  4OWR A;  1MDA H;  2BCJ B;  2OVQ B;  3RLM D;  2H9N A;  2W18 A;  4LGN A;  2EBS A;  5IC7 A;  1GXR A;  2CN3 A;  4J78 A;  2VDM B;  5TEE A;  3T3M B;  1MG3 A;  2HXC A;  4PBY A;  4L3G D;  2G9A A;  4TZ4 A;  2P26 A;  2OJY A;  4XYI A;  5FKS A;  1YFQ A;  2I3T A;  4ZN4 A;  2CN2 A;  3SBR A;  2JWH A;  4A11 B;  1SSL A;  2VDK B;  4PSW B;  1U8C B;  5FKQ A;  4GQ2 P;  2AGW A;  2VC2 B;  3JZN A;  2XU7 A;  2GNQ A;  5CXB A;  5FLX g;  4OZU A;  5GXI A;  4K3J B;  5E6U B;  3EI1 A;  1S4U X;  3BG1 A;  2OIZ A;  3UKR C;  3KRX B;  3VI3 B;  3L4M D;  2I3S A;  4Y5R D;  2I0R A;  4PC0 A;  2P28 A;  1R5M A;  4O3T B;  3C75 H;  5JWZ A;  1XKS A;  4J87 A;  1JMX B;  4A0B A;  5IJ8 E;  4XEI C;  2B4E A;  5FKT A;  4Z7O B;  1SQJ A;  4J86 A;  2H47 A;  5A2Q g;  3ZDY B;  3UVM A;  5HYN B;  2YNP A;  3EI4 B;  2HKR A;  3JZG A;  2H3X A;  4CZV A;  2B5M A;  3PSL A;  4A09 B;  1K32 A;  5I5J A;  2AGY A;  5EM2 B;  4WK2 B;  1PBY B;  4ZOZ A;  5H17 A;  3OKY B;  5H14 A;  2P9L C;  3C99 A;  1Q47 A;  2P9I C;  3JB9 L;  4PSX B;  4CI3 A;  4H5I A;  5EAL A;  1A0R B;  4FHL A;  3RMZ D;  3PXW D;  3NIG B;  4J81 A;  4GQB B;  2IAA A;  3VH0 A;  5HQG A;  4WK0 B;  4BUJ C;  2XL2 A;  3A0F A;  4PBZ A;  3FM0 A;  4GZ8 A;  4FAV D;  2IWK A;  5FKR A;  5IJ7 E;  2QXV A;  4GGD A;  2H68 A;  5HDB B;  4CY5 A;  3EWE A;  2OK6 A;  4HDJ A;  4QQE A;  3AL9 A;  4BL0 A;  2CE9 A;  2CO0 C;  3SHF A;  3GRE A;  3I7O A;  3UKU C;  4PXW A;  1XHM A;  4QRJ A;  2H6K A;  4QT8 A;  3MMY A;  3K26 A;  1PI6 A;  4LG9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...