3OKWA

Mouse semaphorin 6a, extracellular domains 1-2
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
549
structure length
540
Chain Sequence
FPEDSEPISISHGNYTKQYPVFVGHKPGRTQRHRLDIQMIMIMNRTLYVAARDHIYTVDIDTSHTEEIYCSKKLTWKSRQADVDTCRMKGKHKDECHNFIKVLLKKNDDTLFVCGTNAFNPSCRNYRVDTLETFGDEFSGMARCPYDAKHANIALFADGKLYSATVTDFLAIDAVIYRSLGDSPTLRTVKHDSKWLKEPYFVQAVDYGDYIYFFFREIAVEYNGKVVFPRVAQVCKNDMGGSQRVLEKQWTSFLKARLNCSVPGDSHFYFNILQAVTDVIRINGRDVVLATFSTPYNSIPGSAVCAYDMLDIANVFTGRFKEQKSPDSTWTPVPDERVPKPRPGCCAGSSSLEKYATSNEFPDDTLNFIKTHPLMDEAVPSIINRPWFLRTMVRYRLTKIAVDNAAGPYQNHTVVFLGSEKGIILKFLARIGSLNGSLFLEEMNVYNPEKCSYDGVEDKRIMGMQLDRASGSLYVAFSTCVIKVPLGRCERHGKCKKTCIASRDPYCGWVRESGSCAHLSPRLTFEQDIERGNTDGLGDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of semaphorin-plexin signalling.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords Semaphorin-6A
total genus 124
structure length 540
sequence length 549
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01403 Sema Sema domain
A PF01437 PSI Plexin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3okwA01
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 3okwA02
1TYQC 3CFVA 2EBSA 4ZOXA 2VDMB 1PGUA 3OKYA 2IUQA 3CFSB 4E54A 3IIWA 3RFGA 3PE7A 4NSXA 2PM7B 3IJ0A 3DSMA 4JSPC 2BBKH 2AH0A 4A08B 2W18A 2CO0A 5FQDA 3NIGB 3F3PA 3ZE0B 5GSAA 3MMYA 4GQ2P 1P22A 3DM0A 2YNOA 2OIZA 4J0XA 2H6QA 3RSEC 3EI1A 2HJ4A 2HJBA 4ZOZA 4CI8A 3MXXA 3OKTA 2Z2OA 4FHLA 5HQGA 2G9AA 5SXMA 1NEXB 4ZOYA 3IJ1A 5FLXg 2CN2A 2OK6A 3EI2B 2CO0C 3RN1D 3OW8A 1SSLA 2P9LC 1XHMA 2HESX 4J86A 2Q7QA 1L0QA 4ES0A 2B5MA 2P9KC 2CE9A 3PSLA 3EU7A 5A2Qg 4J87A 4JD2C 4WK4B 2H14A 4IMMA 5I5JA 1OLZA 3ZE1B 4L3GD 3AH8B 1XIPA 3UVLA 1XKSA 1U8CB 3MKQA 4A7JA 1ERJA 3I7KA 4E5ZA 3SWSD 1JMXB 3SXTD 3VA6A 4UM9D 4Z7QB 2XL2A 3AL8A 5CYKA 3I8EA 5CXCB 3IKOA 2H3XA 2GNQA 5TDHB 4PBZA 2PM9A 1JJUB 3SCYA 5K19A 5HE2B 4A09B 4K3ID 2AH1A 4Z7OB 5EMKB 3I89A 3EI4A 4CZXA 4XYIA 5EM2B 4YVDA 3B7FA 3C5MA 2J55H 3FM0A 3A0FA 5EMJB 1N6EA 2IAAA 3SLED 4CZYA 4FA9D 5HE0B 2VDNB 1GXRA 4A11B 3JROA 4AOWA 3PXWD 2B4EA 4FA5D 3PSCB 1FWXA 3ZE2B 3EG6A 4N14A 2QXVA 1PI6A 3N0EA 3I7NA 3CIKB 4X60B 2AGXA 2VDLB 4A0AA 3DWLC 4ERZA 4CZVA 2VDKB 1TYEB 5EAPA 2XYIA 4JSNC 2AQ5A 4X63B 5FXYA 3E0CA 3K27A 2B5LA 5I5IA 3GFCA 1RI6A 4HDJA 5CXBA 5KDOB 2H9LA 3J81g 2IUVA 2P9SC 4PBYA 4FWWA 5H14A 4J78A 3SJLD 4OWRA 3V7DB 2YNNA 4JSVC 2G99A 1YUKA 3NVNA 4JT5C 4A08A 3F3GA 3AFCA 4CC9A 4J8GA 4GQ1A 4FB1D 4O9DA 1N6FA 3I8CA 4BH6A 3IIYA 3JZHA 4H5IA 3SN6B 2I0SA 2VDRB 3HFQA 4E54B 4ZOVA 4UM8B 5EM2A 4J77A 2VDPB 2IURA 1MG3A 3GREA 3ZDXB 4X3EA 2AGLA 2P26A 2AGWA 1Q47A 4L9OA 3UVNA 2IWKA 3AL9A 1TBGA 5TEFA 4J73A 3BWSA 3UKRC 1MG2A 1R5MA 5EARA 3C75H 2J56H 3BG0A 2Z2PA 3I7PA 3PVWB 5CYKB 3AL8B 4A2MA 5IJ8E 3PVUB 3SBRA 3MZLA 4ZN4A 5HDBB 3ULEC 4XYHA 1JOFA 5HYNB 2P9NC 3NIDB 5IJ7E 2BCJB 2H9NA 2P9PC 5EMLB 5AJAA 2I0TA 3UR4A 4Y5RD 4ESGA 5K1CC 2PBIB 5TEEA 3RMZD 3SVWD 3JB9L 2Z2NA 4GM9A 5H17A 2OVPB 3RRMC 4Z7NB 2OK4A 4ERYA 4FA4D 5THAA 4QL1A 2UZXB 5HE3B 3JRPA 3ZWLB 1SQJA 5FKSA 5E6SB 5FKRA 1B9XA 5IGOA 3VI3B 4JT6C 4MK0B 4J79A 3I7OA 4GM3A 1A0RB 3N0DA 1U2VC 3FGBA 3FCUB 4AEZA 4R7AB 1OMWB 4Y7RA 2B5NA 3J80g 2I3SA 2GC7A 3NVQA 4CY2A 5FKTA 4L3HD 2H68A 5FKQA 4O1QD 3EI3B 2H6NA 3JPXA 5GXHA 4PXWA 3JZNA 4A2LA 4U1EI 4CI2A 3IJCA 1GOTB 3T3PB 4X61B 1JMZB 3K26A 5AFU3 4G56B 4WJKB 4CI1A 2I0RA 3ZDYB 4GGDA 4BL0A 5C2WB 3KRXB 2XU7A 4A11A 4LG9A 3PXSD 4J82A 3UVMA 4LG8A 4BUJC 4PSXB 2H9PA 3OL2A 4IA9A 3SMRA 4I79A 4O3UB 4TZ4A 4A09A 3DXKC 4WK0B 3VI4B 4QQEA 4EWRA 1QNIA 3OKWA 4FA1D 4A0BB 3V9FA 5E6UB 2YB8B 2H6KA 4CY1A 2H9MA 3OKYB 3I7HA 3UVOA 2OJYA 3L4OD 4O3TB 4O45A 3MKSB 5CXCA 5EALA 2O9KA 4A0BA 3EI4B 2CE8A 4E5ZB 4PC0A 3JAMg 3SHFA 3C99A 5EMMB 4UM9B 3U4YA 2YNPA 2H47A 3NVXA 2P9UC 3OL2B 4GZ8A 4ERQA 2QC5A 3I2NA 3RLMD 5H1MA 5AMSA 3ZDZB 2TRCB 2IUPA 4CY3A 4JSXC 3SFZA 3RN0D 3SBQA 4D6VA 5FA5B 5C9ZB 4J8BA 4PSWB 3MZKA 5E6RB 3EWEA 3UKUC 4LGNA 2HYEA 4GM8A 5IT9g 3EI3A 5C2VB 3EMHA 5IC7A 2I3TA 1N6DA 3OTTA 2OVRB 4U7AA 4WK2B 4GMBA 2IWFA 2AGYA 4H5JA 3V5WB 2VDQB 3C9CA 5CXBB 3JZGA 4CY5A 4FAVD 2VC2B 4L1QD 2HKRA 4FAND 4GQBB 1U4CA 4QT8A 3EI1B 3ORVD 2YMUA 4GGCA 4KFMB 1K32A 2PM6B 3FRXA 4J81A 5IGQA 4J84A 3RFHA 4CI3A 2UZYB 1VYHC 4OZUA 2MTAH 4GGAA 2GC4A 3EI2A 2P9IC 3I7LA 5B4WA 2VDOB 4UI9R 5EAMA 2OVQB 5GMKn 3VGZA 3DXMC 4K3JB 1MDAH 5HE1B 4XEIC 3W15A 4JXMA 4A0AB 3NIFB 3SBPA 3L4MD 3KRWB 1NR0A 5JWZA 4PNKB 3F3FA 2HXCA 5GXIA 2XL3A 5I5MA 3VH0A 2HKMA 3UVKA 2YBAA 4QRJA 2CNXA 2PM9B 2H13A 3T3MB 1K8KC 5TF2A 1B9YA 3ODTA 3BG1A 1SHYB 4Z8LA 3P4FA 1PBYB 2CN3A 2J57G 1GG2B 2P28A 3PXTD 1PEVA 1S4UX 4D0KA 1SQ9A 1YFQA 1GP2B 2AGZA 4J0WA
chains in the Genus database with same CATH superfamily
1E8MA 1TYQC 3CFVA 2EBSA 1VE6A 3EQ8A 4ZOXA 2VDMB 1PGUA 1UTCA 3OKYA 2IUQA 3CFSB 4E54A 3IIWA 4AMYA 3RFGA 3PE7A 4NSXA 2PM7B 3IJ0A 3DSMA 4JSPC 2BBKH 5C92A 2AH0A 4A08B 2W18A 2VDQA 4G1MA 2CO0A 5FQDA 3NIGB 3F3PA 3ZE0B 5M61A 5GSAA 3MMYA 4GQ2P 2VDKA 1P22A 4BP9A 3DM0A 4UM8A 2YNOA 2OIZA 4J0XA 2EIDA 2H6QA 3RSEC 3EI1A 2HU5A 2HJ4A 2HJBA 4ZOZA 3K72A 4CI8A 3MXXA 3OKTA 2Z2OA 4L1MA 4FHLA 3O4IA 5HQGA 1GOFA 2G9AA 5SXMA 1NEXB 3GC3B 4ZOYA 2WQ8A 3IJ1A 5FLXg 2CN2A 2OK6A 3EI2B 2CO0C 3RN1D 1L5GA 3OW8A 4WK2A 1SSLA 3IJEA 2P9LC 1H2WA 1XHMA 2HESX 1E5TA 4J86A 1VZ2A 2Q7QA 4G1EA 1L0QA 4DNVA 2XE4A 1UOOA 4AN0A 4ES0A 2B5MA 2P9KC 2CE9A 3PSLA 3EU7A 3NIDA 5A2Qg 3EQ9A 5M5UA 4J87A 4AX4A 4JD2C 4WK4B 2H14A 4IMMA 5I5JA 1QFMA 1OLZA 3ZE1B 4NENA 4L3GD 3AH8B 1XIPA 3UVLA 1XKSA 3IUMA 4Z7QA 1U8CB 3EQ7A 3MKQA 4A7JA 1ERJA 4WK0A 3I7KA 4E5ZA 3SWSD 1JMXB 1H2XA 3SXTD 3VA6A 4UM9D 4Z7QB 2XL2A 3AL8A 5CYKA 1O6FA 3I8EA 5M5RA 4AMZA 5CXCB 3IKOA 2H3XA 2GNQA 2VDRA 2EICA 5TDHB 1YR2A 4PBZA 1GOHA 2PM9A 3T3MA 4WJKA 3IURA 1JJUB 3SCYA 5K19A 5HE2B 4A09B 4K3ID 2AH1A 4Z7OB 5EMKB 3I89A 3EI4A 4CZXA 4XYIA 5EM2B 4YVDA 5HDBA 3B7FA 3C5MA 5FFOA 2J55H 3FM0A 3A0FA 5EMJB 1N6EA 2IAAA 3SLED 4CZYA 4FA9D 5HE0B 2VDNB 1GXRA 3FCSA 4A11B 3JROA 4AOWA 3PXWD 2B4EA 4FA5D 3T3PA 3PSCB 1FWXA 1UOQA 3VI4A 3ZE2B 1K3IA 3EG6A 4MMYA 4N14A 2QXVA 1PI6A 3N0EA 4JHPC 5C86A 3I7NA 3CIKB 4X60B 5FFGA 2AGXA 4J0WA 2VDLB 3NIFA 3DWLC 4A0AA 4ERZA 4CZVA 2VDKB 1TYEB 5EAPA 2XYIA 3ZE0A 4JSNC 2AQ5A 4X63B 5FXYA 3E0CA 3K27A 2B5LA 5I5IA 3GFCA 1RI6A 4HDJA 5CXBA 5KDOB 2H9LA 3J81g 2IUVA 2P9SC 4PBYA 4FWWA 5H14A 4J78A 3SJLD 4OWRA 4RE6A 3O4GA 3V7DB 2YNNA 4JSVC 2G99A 1YUKA 3IVMA 3NVNA 3K6SA 4JT5C 2VC2A 4A08A 3F3GA 3AFCA 4CC9A 4J8GA 4GQ1A 4RE5A 4DNUA 4FB1D 4O9DA 3MUOA 1N6FA 2QR5A 3I8CA 4BH6A 3IIYA 3JZHA 3GD1I 4H5IA 3SN6B 2VDMA 1VE7A 4D9SA 2I0SA 2VDRB 3HFQA 4E54B 4ZOVA 4UM8B 5EM2A 4J77A 2VDPB 2IURA 5E6SA 1MG3A 3GREA 3ZDXB 4X3EA 2AGLA 2P26A 2AGWA 1Q47A 4L9OA 3UVNA 2IWKA 3AL9A 1TBGA 3MUNA 5TEFA 4J73A 1H2YA 3BWSA 1T2XA 2HU7A 3UKRC 1MG2A 1R5MA 5EARA 3C75H 2J56H 3BG0A 2Z2PA 3I7PA 3PVWB 3AL8B 4MMZA 5CYKB 4A2MA 3PVUB 3IUJA 5IJ8E 3SBRA 3MZLA 4ZN4A 5HDBB 3ULEC 1GOGA 3O4HA 4XYHA 1JOFA 5HYNB 2P9NC 3NIDB 5IJ7E 2BCJB 2H9NA 2P9PC 5EMLB 5AJAA 2I0TA 3UR4A 4Y5RD 4ESGA 2BKLA 5K1CC 3ZE1A 2PBIB 5TEEA 3RMZD 3SVWD 3JB9L 2Z2NA 3V4PA 4GM9A 5H17A 2OVPB 3RRMC 4Z7NB 2OK4A 4ERYA 2VDOA 4FA4D 5THAA 4QL1A 1E8NA 2UZXB 5HE3B 3JRPA 3ZWLB 1SQJA 5FKSA 5E6SB 5FKRA 1B9XA 5IGOA 3VI3B 4JT6C 1QFSA 4MK0B 4J79A 3I7OA 4IRZA 4GM3A 1A0RB 3N0DA 1U2VC 3FGBA 3FCUB 4AEZA 4R7AB 1OMWB 4Y7RA 2B5NA 3J80g 1H2ZA 2I3SA 2GC7A 3NVQA 4CY2A 5FKTA 4L3HD 4AN1A 2H68A 5FKQA 4O1QD 3EI3B 2H6NA 3JPXA 4O02A 1VZ3A 5GXHA 4PXWA 3JZNA 2XZGA 4A2LA 4U1EI 5E6RA 2JWHA 4CI2A 3IJCA 1GOTB 3T3PB 3OF7A 1M1XA 4G55A 1JMZB 4X61B 3K26A 3QHYB 5AFU3 4G56B 4WJKB 4CI1A 3IULA 2I0RA 2EIEA 3ZDYB 4GGDA 4BL0A 5C2WB 3KRXB 2XU7A 4A11A 4LG9A 3PXSD 4J82A 3UVMA 4LG8A 4BUJC 4PSXB 5M5TA 2H9PA 3OL2A 4IA9A 3SMRA 3MVDK 4I79A 4UM9A 4O3UB 4TZ4A 4A09A 3DXKC 3IUQA 4WK0B 3VI4B 4QQEA 4EWRA 3ZDXA 1UOPA 1QNIA 4NC4A 3OKWA 4FA1D 4A0BB 3V9FA 5E6UB 2YB8B 3V4VA 2H6KA 3K71A 4QAMA 4CY1A 2H9MA 2VZ1A 3OKYB 3I7HA 3UVOA 2OJYA 3L4OD 4O3TB 4O45A 3MKSB 5CXCA 2HU8A 5EALA 2O9KA 4A0BA 2JKXA 1O6GA 3EI4B 2CE8A 4E5ZB 4PC0A 2JWGA 3JAMg 3KCIA 3SHFA 4Z7OA 3C99A 5EMMB 4UM9B 3U4YA 2YNPA 4BCCA 2H47A 3NVXA 2P9UC 3OL2B 4GZ8A 1U8CA 4ERQA 2QC5A 3I2NA 3RLMD 3DDUA 5H1MA 5AMSA 3ZDZB 2TRCB 2IUPA 4CY3A 4JSXC 3SFZA 3RN0D 1JV2A 3SBQA 4D6VA 5FA5B 1GP2B 4J8BA 2EIBA 4JHNA 5C9ZB 5M5VA 4MMXA 4PSWB 3MZKA 5E6RB 1JTDB 1TYEA 3EWEA 3UKUC 4LGNA 2VZ3A 2HYEA 4GM8A 5IT9g 3EI3A 5C2VB 2QZPA 3EMHA 5IC7A 3ZDYA 2I3TA 4BCBA 1N6DA 3OTTA 2OVRB 4U7AA 4WK2B 4GMBA 2IWFA 2AGYA 4H5JA 3V5WB 2VDQB 3C9CA 5CXBB 3JZGA 4CY5A 4FAVD 2VC2B 4Z7NA 1BPOA 1C9LA 4L1QD 2HKRA 4FAND 4GQBB 1U4CA 4QT8A 3EI1B 3ORVD 4NBMA 2YMUA 4GGCA 4KFMB 5M5SA 1K32A 2PM6B 2VDLA 3FRXA 4J81A 5IGQA 4J84A 3RFHA 4CI3A 3NIGA 2UZYB 1VYHC 4OZUA 2MTAH 4GGAA 2GC4A 4BCDA 3EI2A 2P9IC 3I7LA 5B4WA 2VDOB 4UI9R 5EAMA 2OVQB 5GMKn 3ZDZA 3FCUA 3VGZA 3DXMC 4K3JB 1MDAH 2VDNA 5HE1B 2XDWA 4XEIC 3W15A 4JXMA 4A0AB 3NIFB 3SBPA 3O4JA 3L4MD 3KRWB 3VI3A 1NR0A 3QI0A 5JWZA 4BP8A 4PNKB 3F3FA 2HXCA 5GXIA 3ZE2A 1C9IA 2XL3A 5I5MA 3IUNA 4NAAA 2HKMA 3UVKA 2YBAA 3VH0A 4QRJA 2CNXA 2PM9B 2H13A 3T3MB 1K8KC 5TF2A 1B9YA 5E6UA 3ODTA 3BG1A 1SHYB 4Z8LA 3P4FA 4WK4A 1PBYB 2CN3A 2J57G 1GG2B 4DNWA 4O2WA 2P28A 3PXTD 1A12A 1PEVA 1S4UX 4D0KA 1SQ9A 1YFQA 2VDPA 2AGZA 1I2MB
chains in the Genus database with same CATH topology
1TYQC 3CFVA 2EBSA 4ZOXA 2VDMB 1PGUA 3OKYA 2IUQA 3CFSB 4E54A 3IIWA 3RFGA 3PE7A 4NSXA 2PM7B 3IJ0A 3DSMA 4JSPC 2BBKH 2AH0A 4A08B 2W18A 2CO0A 5FQDA 3NIGB 3F3PA 3ZE0B 5GSAA 3MMYA 4GQ2P 1P22A 3DM0A 2YNOA 2OIZA 4J0XA 2H6QA 3RSEC 3EI1A 2HJ4A 2HJBA 4ZOZA 4CI8A 3MXXA 3OKTA 2Z2OA 4FHLA 5HQGA 2G9AA 5SXMA 1NEXB 4ZOYA 3IJ1A 5FLXg 2CN2A 2OK6A 3EI2B 2CO0C 3RN1D 3OW8A 1SSLA 2P9LC 1XHMA 2HESX 4J86A 2Q7QA 1L0QA 4ES0A 2B5MA 2P9KC 2CE9A 3PSLA 3EU7A 5A2Qg 4J87A 4JD2C 4WK4B 2H14A 4IMMA 5I5JA 1OLZA 3ZE1B 4L3GD 3AH8B 1XIPA 3UVLA 1XKSA 1U8CB 3MKQA 4A7JA 1ERJA 3I7KA 4E5ZA 3SWSD 1JMXB 3SXTD 3VA6A 4UM9D 4Z7QB 2XL2A 3AL8A 5CYKA 3I8EA 5CXCB 3IKOA 2H3XA 2GNQA 5TDHB 4PBZA 2PM9A 1JJUB 3SCYA 5K19A 5HE2B 4A09B 4K3ID 2AH1A 4Z7OB 5EMKB 3I89A 3EI4A 4CZXA 4XYIA 5EM2B 4YVDA 3B7FA 3C5MA 2J55H 3FM0A 3A0FA 5EMJB 1N6EA 2IAAA 3SLED 4CZYA 4FA9D 5HE0B 2VDNB 1GXRA 4A11B 3JROA 4AOWA 3PXWD 2B4EA 4FA5D 3PSCB 1FWXA 3ZE2B 3EG6A 4N14A 2QXVA 1PI6A 3N0EA 3I7NA 3CIKB 4X60B 2AGXA 2VDLB 4A0AA 3DWLC 4ERZA 4CZVA 2VDKB 1TYEB 5EAPA 2XYIA 4JSNC 2AQ5A 4X63B 5FXYA 3E0CA 3K27A 2B5LA 5I5IA 3GFCA 1RI6A 4HDJA 5CXBA 5KDOB 2H9LA 3J81g 2IUVA 2P9SC 4PBYA 4FWWA 5H14A 4J78A 3SJLD 4OWRA 3V7DB 2YNNA 4JSVC 2G99A 1YUKA 3NVNA 4JT5C 4A08A 3F3GA 3AFCA 4CC9A 4J8GA 4GQ1A 4FB1D 4O9DA 1N6FA 3I8CA 4BH6A 3IIYA 3JZHA 4H5IA 3SN6B 2I0SA 2VDRB 3HFQA 4E54B 4ZOVA 4UM8B 5EM2A 4J77A 2VDPB 2IURA 1MG3A 3GREA 3ZDXB 4X3EA 2AGLA 2P26A 2AGWA 1Q47A 4L9OA 3UVNA 2IWKA 3AL9A 1TBGA 5TEFA 4J73A 3BWSA 3UKRC 1MG2A 1R5MA 5EARA 3C75H 2J56H 3BG0A 2Z2PA 3I7PA 3PVWB 5CYKB 3AL8B 4A2MA 5IJ8E 3PVUB 3SBRA 3MZLA 4ZN4A 5HDBB 3ULEC 4XYHA 1JOFA 5HYNB 2P9NC 3NIDB 5IJ7E 2BCJB 2H9NA 2P9PC 5EMLB 5AJAA 2I0TA 3UR4A 4Y5RD 4ESGA 5K1CC 2PBIB 5TEEA 3RMZD 3SVWD 3JB9L 2Z2NA 4GM9A 5H17A 2OVPB 3RRMC 4Z7NB 2OK4A 4ERYA 4FA4D 5THAA 4QL1A 2UZXB 5HE3B 3JRPA 3ZWLB 1SQJA 5FKSA 5E6SB 5FKRA 1B9XA 5IGOA 3VI3B 4JT6C 4MK0B 4J79A 3I7OA 4GM3A 1A0RB 3N0DA 1U2VC 3FGBA 3FCUB 4AEZA 4R7AB 1OMWB 4Y7RA 2B5NA 3J80g 2I3SA 2GC7A 3NVQA 4CY2A 5FKTA 4L3HD 2H68A 5FKQA 4O1QD 3EI3B 2H6NA 3JPXA 5GXHA 4PXWA 3JZNA 4A2LA 4U1EI 2JWHA 4CI2A 3IJCA 1GOTB 3T3PB 4X61B 1JMZB 3K26A 5AFU3 4G56B 4WJKB 4CI1A 2I0RA 3ZDYB 4GGDA 4BL0A 5C2WB 3KRXB 2XU7A 4A11A 4LG9A 3PXSD 4J82A 3UVMA 4LG8A 4BUJC 4PSXB 2H9PA 3OL2A 4IA9A 3SMRA 4I79A 4O3UB 4TZ4A 4A09A 3DXKC 4WK0B 3VI4B 4QQEA 4EWRA 1QNIA 3OKWA 4FA1D 4A0BB 3V9FA 5E6UB 2YB8B 2H6KA 4CY1A 2H9MA 3OKYB 3I7HA 3UVOA 2OJYA 3L4OD 4O3TB 4O45A 3MKSB 5CXCA 5EALA 2O9KA 4A0BA 3EI4B 2CE8A 4E5ZB 4PC0A 2JWGA 3JAMg 3SHFA 3C99A 5EMMB 4UM9B 3U4YA 2YNPA 2H47A 3NVXA 2P9UC 3OL2B 4GZ8A 4ERQA 2QC5A 3I2NA 3RLMD 5H1MA 5AMSA 3ZDZB 2TRCB 2IUPA 4CY3A 4JSXC 3SFZA 3RN0D 3SBQA 4D6VA 5FA5B 5C9ZB 4J8BA 4PSWB 3MZKA 5E6RB 3EWEA 3UKUC 4LGNA 2HYEA 4GM8A 5IT9g 3EI3A 5C2VB 3EMHA 5IC7A 2I3TA 1N6DA 3OTTA 2OVRB 4U7AA 4WK2B 4GMBA 2IWFA 2AGYA 4H5JA 3V5WB 2VDQB 3C9CA 5CXBB 3JZGA 4CY5A 4FAVD 2VC2B 4L1QD 2HKRA 4FAND 4GQBB 1U4CA 4QT8A 3EI1B 3ORVD 2YMUA 4GGCA 4KFMB 1K32A 2PM6B 3FRXA 4J81A 5IGQA 4J84A 3RFHA 4CI3A 2UZYB 1VYHC 4OZUA 2MTAH 4GGAA 2GC4A 3EI2A 2P9IC 3I7LA 5B4WA 2VDOB 4UI9R 5EAMA 2OVQB 5GMKn 3VGZA 3DXMC 4K3JB 1MDAH 5HE1B 4XEIC 3W15A 4JXMA 4A0AB 3NIFB 3SBPA 3L4MD 3KRWB 1NR0A 5JWZA 4PNKB 3F3FA 2HXCA 5GXIA 2XL3A 5I5MA 3VH0A 2HKMA 3UVKA 2YBAA 4QRJA 2CNXA 2PM9B 2H13A 3T3MB 1K8KC 5TF2A 1B9YA 3ODTA 3BG1A 1SHYB 4Z8LA 3P4FA 1PBYB 2CN3A 2J57G 1GG2B 2P28A 3PXTD 1PEVA 1S4UX 4D0KA 1SQ9A 1YFQA 1GP2B 2AGZA 4J0WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TYQ C;  3CFV A;  2EBS A;  4ZOX A;  2VDM B;  1PGU A;  3OKY A;  2IUQ A;  3CFS B;  4E54 A;  3IIW A;  3RFG A;  3PE7 A;  4NSX A;  2PM7 B;  3IJ0 A;  3DSM A;  4JSP C;  2BBK H;  2AH0 A;  4A08 B;  2W18 A;  2CO0 A;  5FQD A;  3NIG B;  3F3P A;  3ZE0 B;  5GSA A;  3MMY A;  4GQ2 P;  1P22 A;  3DM0 A;  2YNO A;  2OIZ A;  4J0X A;  2H6Q A;  3RSE C;  3EI1 A;  2HJ4 A;  2HJB A;  4ZOZ A;  4CI8 A;  3MXX A;  3OKT A;  2Z2O A;  4FHL A;  5HQG A;  2G9A A;  5SXM A;  1NEX B;  4ZOY A;  3IJ1 A;  5FLX g;  2CN2 A;  2OK6 A;  3EI2 B;  2CO0 C;  3RN1 D;  3OW8 A;  1SSL A;  2P9L C;  1XHM A;  2HES X;  4J86 A;  2Q7Q A;  1L0Q A;  4ES0 A;  2B5M A;  2P9K C;  2CE9 A;  3PSL A;  3EU7 A;  5A2Q g;  4J87 A;  4JD2 C;  4WK4 B;  2H14 A;  4IMM A;  5I5J A;  1OLZ A;  3ZE1 B;  4L3G D;  3AH8 B;  1XIP A;  3UVL A;  1XKS A;  1U8C B;  3MKQ A;  4A7J A;  1ERJ A;  3I7K A;  4E5Z A;  3SWS D;  1JMX B;  3SXT D;  3VA6 A;  4UM9 D;  4Z7Q B;  2XL2 A;  3AL8 A;  5CYK A;  3I8E A;  5CXC B;  3IKO A;  2H3X A;  2GNQ A;  5TDH B;  4PBZ A;  2PM9 A;  1JJU B;  3SCY A;  5K19 A;  5HE2 B;  4A09 B;  4K3I D;  2AH1 A;  4Z7O B;  5EMK B;  3I89 A;  3EI4 A;  4CZX A;  4XYI A;  5EM2 B;  4YVD A;  3B7F A;  3C5M A;  2J55 H;  3FM0 A;  3A0F A;  5EMJ B;  1N6E A;  2IAA A;  3SLE D;  4CZY A;  4FA9 D;  5HE0 B;  2VDN B;  1GXR A;  4A11 B;  3JRO A;  4AOW A;  3PXW D;  2B4E A;  4FA5 D;  3PSC B;  1FWX A;  3ZE2 B;  3EG6 A;  4N14 A;  2QXV A;  1PI6 A;  3N0E A;  3I7N A;  3CIK B;  4X60 B;  2AGX A;  2VDL B;  4A0A A;  3DWL C;  4ERZ A;  4CZV A;  2VDK B;  1TYE B;  5EAP A;  2XYI A;  4JSN C;  2AQ5 A;  4X63 B;  5FXY A;  3E0C A;  3K27 A;  2B5L A;  5I5I A;  3GFC A;  1RI6 A;  4HDJ A;  5CXB A;  5KDO B;  2H9L A;  3J81 g;  2IUV A;  2P9S C;  4PBY A;  4FWW A;  5H14 A;  4J78 A;  3SJL D;  4OWR A;  3V7D B;  2YNN A;  4JSV C;  2G99 A;  1YUK A;  3NVN A;  4JT5 C;  4A08 A;  3F3G A;  3AFC A;  4CC9 A;  4J8G A;  4GQ1 A;  4FB1 D;  4O9D A;  1N6F A;  3I8C A;  4BH6 A;  3IIY A;  3JZH A;  4H5I A;  3SN6 B;  2I0S A;  2VDR B;  3HFQ A;  4E54 B;  4ZOV A;  4UM8 B;  5EM2 A;  4J77 A;  2VDP B;  2IUR A;  1MG3 A;  3GRE A;  3ZDX B;  4X3E A;  2AGL A;  2P26 A;  2AGW A;  1Q47 A;  4L9O A;  3UVN A;  2IWK A;  3AL9 A;  1TBG A;  5TEF A;  4J73 A;  3BWS A;  3UKR C;  1MG2 A;  1R5M A;  5EAR A;  3C75 H;  2J56 H;  3BG0 A;  2Z2P A;  3I7P A;  3PVW B;  5CYK B;  3AL8 B;  4A2M A;  5IJ8 E;  3PVU B;  3SBR A;  3MZL A;  4ZN4 A;  5HDB B;  3ULE C;  4XYH A;  1JOF A;  5HYN B;  2P9N C;  3NID B;  5IJ7 E;  2BCJ B;  2H9N A;  2P9P C;  5EML B;  5AJA A;  2I0T A;  3UR4 A;  4Y5R D;  4ESG A;  5K1C C;  2PBI B;  5TEE A;  3RMZ D;  3SVW D;  3JB9 L;  2Z2N A;  4GM9 A;  5H17 A;  2OVP B;  3RRM C;  4Z7N B;  2OK4 A;  4ERY A;  4FA4 D;  5THA A;  4QL1 A;  2UZX B;  5HE3 B;  3JRP A;  3ZWL B;  1SQJ A;  5FKS A;  5E6S B;  5FKR A;  1B9X A;  5IGO A;  3VI3 B;  4JT6 C;  4MK0 B;  4J79 A;  3I7O A;  4GM3 A;  1A0R B;  3N0D A;  1U2V C;  3FGB A;  3FCU B;  4AEZ A;  4R7A B;  1OMW B;  4Y7R A;  2B5N A;  3J80 g;  2I3S A;  2GC7 A;  3NVQ A;  4CY2 A;  5FKT A;  4L3H D;  2H68 A;  5FKQ A;  4O1Q D;  3EI3 B;  2H6N A;  3JPX A;  5GXH A;  4PXW A;  3JZN A;  4A2L A;  4U1E I;  4CI2 A;  3IJC A;  1GOT B;  3T3P B;  4X61 B;  1JMZ B;  3K26 A;  5AFU 3;  4G56 B;  4WJK B;  4CI1 A;  2I0R A;  3ZDY B;  4GGD A;  4BL0 A;  5C2W B;  3KRX B;  2XU7 A;  4A11 A;  4LG9 A;  3PXS D;  4J82 A;  3UVM A;  4LG8 A;  4BUJ C;  4PSX B;  2H9P A;  3OL2 A;  4IA9 A;  3SMR A;  4I79 A;  4O3U B;  4TZ4 A;  4A09 A;  3DXK C;  4WK0 B;  3VI4 B;  4QQE A;  4EWR A;  1QNI A;  3OKW A;  4FA1 D;  4A0B B;  3V9F A;  5E6U B;  2YB8 B;  2H6K A;  4CY1 A;  2H9M A;  3OKY B;  3I7H A;  3UVO A;  2OJY A;  3L4O D;  4O3T B;  4O45 A;  3MKS B;  5CXC A;  5EAL A;  2O9K A;  4A0B A;  3EI4 B;  2CE8 A;  4E5Z B;  4PC0 A;  3JAM g;  3SHF A;  3C99 A;  5EMM B;  4UM9 B;  3U4Y A;  2YNP A;  2H47 A;  3NVX A;  2P9U C;  3OL2 B;  4GZ8 A;  4ERQ A;  2QC5 A;  3I2N A;  3RLM D;  5H1M A;  5AMS A;  3ZDZ B;  2TRC B;  2IUP A;  4CY3 A;  4JSX C;  3SFZ A;  3RN0 D;  3SBQ A;  4D6V A;  5FA5 B;  5C9Z B;  4J8B A;  4PSW B;  3MZK A;  5E6R B;  3EWE A;  3UKU C;  4LGN A;  2HYE A;  4GM8 A;  5IT9 g;  3EI3 A;  5C2V B;  3EMH A;  5IC7 A;  2I3T A;  1N6D A;  3OTT A;  2OVR B;  4U7A A;  4WK2 B;  4GMB A;  2IWF A;  2AGY A;  4H5J A;  3V5W B;  2VDQ B;  3C9C A;  5CXB B;  3JZG A;  4CY5 A;  4FAV D;  2VC2 B;  4L1Q D;  2HKR A;  4FAN D;  4GQB B;  1U4C A;  4QT8 A;  3EI1 B;  3ORV D;  2YMU A;  4GGC A;  4KFM B;  1K32 A;  2PM6 B;  3FRX A;  4J81 A;  5IGQ A;  4J84 A;  3RFH A;  4CI3 A;  2UZY B;  1VYH C;  4OZU A;  2MTA H;  4GGA A;  2GC4 A;  3EI2 A;  2P9I C;  3I7L A;  5B4W A;  2VDO B;  4UI9 R;  5EAM A;  2OVQ B;  5GMK n;  3VGZ A;  3DXM C;  4K3J B;  1MDA H;  5HE1 B;  4XEI C;  3W15 A;  4JXM A;  4A0A B;  3NIF B;  3SBP A;  3L4M D;  3KRW B;  1NR0 A;  5JWZ A;  4PNK B;  3F3F A;  2HXC A;  5GXI A;  2XL3 A;  5I5M A;  3VH0 A;  2HKM A;  3UVK A;  2YBA A;  4QRJ A;  2CNX A;  2PM9 B;  2H13 A;  3T3M B;  1K8K C;  5TF2 A;  1B9Y A;  3ODT A;  3BG1 A;  1SHY B;  4Z8L A;  3P4F A;  1PBY B;  2CN3 A;  2J57 G;  1GG2 B;  2P28 A;  3PXT D;  1PEV A;  1S4U X;  4D0K A;  1SQ9 A;  1YFQ A;  1GP2 B;  2AGZ A;  4J0W A; 
#chains in the Genus database with same CATH topology
 1E8M A;  1TYQ C;  3CFV A;  2EBS A;  1VE6 A;  3EQ8 A;  4ZOX A;  2VDM B;  1PGU A;  1UTC A;  3OKY A;  2IUQ A;  3CFS B;  4E54 A;  3IIW A;  4AMY A;  3RFG A;  3PE7 A;  4NSX A;  2PM7 B;  3IJ0 A;  3DSM A;  4JSP C;  2BBK H;  5C92 A;  2AH0 A;  4A08 B;  2W18 A;  2VDQ A;  4G1M A;  2CO0 A;  5FQD A;  3NIG B;  3F3P A;  3ZE0 B;  5M61 A;  5GSA A;  3MMY A;  4GQ2 P;  2VDK A;  1P22 A;  4BP9 A;  3DM0 A;  4UM8 A;  2YNO A;  2OIZ A;  4J0X A;  2EID A;  2H6Q A;  3RSE C;  3EI1 A;  2HU5 A;  2HJ4 A;  2HJB A;  4ZOZ A;  3K72 A;  4CI8 A;  3MXX A;  3OKT A;  2Z2O A;  4L1M A;  4FHL A;  3O4I A;  5HQG A;  1GOF A;  2G9A A;  5SXM A;  1NEX B;  3GC3 B;  4ZOY A;  2WQ8 A;  3IJ1 A;  5FLX g;  2CN2 A;  2OK6 A;  3EI2 B;  2CO0 C;  3RN1 D;  1L5G A;  3OW8 A;  4WK2 A;  1SSL A;  3IJE A;  2P9L C;  1H2W A;  1XHM A;  2HES X;  1E5T A;  4J86 A;  1VZ2 A;  2Q7Q A;  4G1E A;  1L0Q A;  4DNV A;  2XE4 A;  1UOO A;  4AN0 A;  4ES0 A;  2B5M A;  2P9K C;  2CE9 A;  3PSL A;  3EU7 A;  3NID A;  5A2Q g;  3EQ9 A;  5M5U A;  4J87 A;  4AX4 A;  4JD2 C;  4WK4 B;  2H14 A;  4IMM A;  5I5J A;  1QFM A;  1OLZ A;  3ZE1 B;  4NEN A;  4L3G D;  3AH8 B;  1XIP A;  3UVL A;  1XKS A;  3IUM A;  4Z7Q A;  1U8C B;  3EQ7 A;  3MKQ A;  4A7J A;  1ERJ A;  4WK0 A;  3I7K A;  4E5Z A;  3SWS D;  1JMX B;  1H2X A;  3SXT D;  3VA6 A;  4UM9 D;  4Z7Q B;  2XL2 A;  3AL8 A;  5CYK A;  1O6F A;  3I8E A;  5M5R A;  4AMZ A;  5CXC B;  3IKO A;  2H3X A;  2GNQ A;  2VDR A;  2EIC A;  5TDH B;  1YR2 A;  4PBZ A;  1GOH A;  2PM9 A;  3T3M A;  4WJK A;  3IUR A;  1JJU B;  3SCY A;  5K19 A;  5HE2 B;  4A09 B;  4K3I D;  2AH1 A;  4Z7O B;  5EMK B;  3I89 A;  3EI4 A;  4CZX A;  4XYI A;  5EM2 B;  4YVD A;  5HDB A;  3B7F A;  3C5M A;  5FFO A;  2J55 H;  3FM0 A;  3A0F A;  5EMJ B;  1N6E A;  2IAA A;  3SLE D;  4CZY A;  4FA9 D;  5HE0 B;  2VDN B;  1GXR A;  3FCS A;  4A11 B;  3JRO A;  4AOW A;  3PXW D;  2B4E A;  4FA5 D;  3T3P A;  3PSC B;  1FWX A;  1UOQ A;  3VI4 A;  3ZE2 B;  1K3I A;  3EG6 A;  4MMY A;  4N14 A;  2QXV A;  1PI6 A;  3N0E A;  4JHP C;  5C86 A;  3I7N A;  3CIK B;  4X60 B;  5FFG A;  2AGX A;  4J0W A;  2VDL B;  3NIF A;  3DWL C;  4A0A A;  4ERZ A;  4CZV A;  2VDK B;  1TYE B;  5EAP A;  2XYI A;  3ZE0 A;  4JSN C;  2AQ5 A;  4X63 B;  5FXY A;  3E0C A;  3K27 A;  2B5L A;  5I5I A;  3GFC A;  1RI6 A;  4HDJ A;  5CXB A;  5KDO B;  2H9L A;  3J81 g;  2IUV A;  2P9S C;  4PBY A;  4FWW A;  5H14 A;  4J78 A;  3SJL D;  4OWR A;  4RE6 A;  3O4G A;  3V7D B;  2YNN A;  4JSV C;  2G99 A;  1YUK A;  3IVM A;  3NVN A;  3K6S A;  4JT5 C;  2VC2 A;  4A08 A;  3F3G A;  3AFC A;  4CC9 A;  4J8G A;  4GQ1 A;  4RE5 A;  4DNU A;  4FB1 D;  4O9D A;  3MUO A;  1N6F A;  2QR5 A;  3I8C A;  4BH6 A;  3IIY A;  3JZH A;  3GD1 I;  4H5I A;  3SN6 B;  2VDM A;  1VE7 A;  4D9S A;  2I0S A;  2VDR B;  3HFQ A;  4E54 B;  4ZOV A;  4UM8 B;  5EM2 A;  4J77 A;  2VDP B;  2IUR A;  5E6S A;  1MG3 A;  3GRE A;  3ZDX B;  4X3E A;  2AGL A;  2P26 A;  2AGW A;  1Q47 A;  4L9O A;  3UVN A;  2IWK A;  3AL9 A;  1TBG A;  3MUN A;  5TEF A;  4J73 A;  1H2Y A;  3BWS A;  1T2X A;  2HU7 A;  3UKR C;  1MG2 A;  1R5M A;  5EAR A;  3C75 H;  2J56 H;  3BG0 A;  2Z2P A;  3I7P A;  3PVW B;  3AL8 B;  4MMZ A;  5CYK B;  4A2M A;  3PVU B;  3IUJ A;  5IJ8 E;  3SBR A;  3MZL A;  4ZN4 A;  5HDB B;  3ULE C;  1GOG A;  3O4H A;  4XYH A;  1JOF A;  5HYN B;  2P9N C;  3NID B;  5IJ7 E;  2BCJ B;  2H9N A;  2P9P C;  5EML B;  5AJA A;  2I0T A;  3UR4 A;  4Y5R D;  4ESG A;  2BKL A;  5K1C C;  3ZE1 A;  2PBI B;  5TEE A;  3RMZ D;  3SVW D;  3JB9 L;  2Z2N A;  3V4P A;  4GM9 A;  5H17 A;  2OVP B;  3RRM C;  4Z7N B;  2OK4 A;  4ERY A;  2VDO A;  4FA4 D;  5THA A;  4QL1 A;  1E8N A;  2UZX B;  5HE3 B;  3JRP A;  3ZWL B;  1SQJ A;  5FKS A;  5E6S B;  5FKR A;  1B9X A;  5IGO A;  3VI3 B;  4JT6 C;  1QFS A;  4MK0 B;  4J79 A;  3I7O A;  4IRZ A;  4GM3 A;  1A0R B;  3N0D A;  1U2V C;  3FGB A;  3FCU B;  4AEZ A;  4R7A B;  1OMW B;  4Y7R A;  2B5N A;  3J80 g;  1H2Z A;  2I3S A;  2GC7 A;  3NVQ A;  4CY2 A;  5FKT A;  4L3H D;  4AN1 A;  2H68 A;  5FKQ A;  4O1Q D;  3EI3 B;  2H6N A;  3JPX A;  4O02 A;  1VZ3 A;  5GXH A;  4PXW A;  3JZN A;  2XZG A;  4A2L A;  4U1E I;  5E6R A;  2JWH A;  4CI2 A;  3IJC A;  1GOT B;  3T3P B;  3OF7 A;  1M1X A;  4G55 A;  1JMZ B;  4X61 B;  3K26 A;  3QHY B;  5AFU 3;  4G56 B;  4WJK B;  4CI1 A;  3IUL A;  2I0R A;  2EIE A;  3ZDY B;  4GGD A;  4BL0 A;  5C2W B;  3KRX B;  2XU7 A;  4A11 A;  4LG9 A;  3PXS D;  4J82 A;  3UVM A;  4LG8 A;  4BUJ C;  4PSX B;  5M5T A;  2H9P A;  3OL2 A;  4IA9 A;  3SMR A;  3MVD K;  4I79 A;  4UM9 A;  4O3U B;  4TZ4 A;  4A09 A;  3DXK C;  3IUQ A;  4WK0 B;  3VI4 B;  4QQE A;  4EWR A;  3ZDX A;  1UOP A;  1QNI A;  4NC4 A;  3OKW A;  4FA1 D;  4A0B B;  3V9F A;  5E6U B;  2YB8 B;  3V4V A;  2H6K A;  3K71 A;  4QAM A;  4CY1 A;  2H9M A;  2VZ1 A;  3OKY B;  3I7H A;  3UVO A;  2OJY A;  3L4O D;  4O3T B;  4O45 A;  3MKS B;  5CXC A;  2HU8 A;  5EAL A;  2O9K A;  4A0B A;  2JKX A;  1O6G A;  3EI4 B;  2CE8 A;  4E5Z B;  4PC0 A;  2JWG A;  3JAM g;  3KCI A;  3SHF A;  4Z7O A;  3C99 A;  5EMM B;  4UM9 B;  3U4Y A;  2YNP A;  4BCC A;  2H47 A;  3NVX A;  2P9U C;  3OL2 B;  4GZ8 A;  1U8C A;  4ERQ A;  2QC5 A;  3I2N A;  3RLM D;  3DDU A;  5H1M A;  5AMS A;  3ZDZ B;  2TRC B;  2IUP A;  4CY3 A;  4JSX C;  3SFZ A;  3RN0 D;  1JV2 A;  3SBQ A;  4D6V A;  5FA5 B;  1GP2 B;  4J8B A;  2EIB A;  4JHN A;  5C9Z B;  5M5V A;  4MMX A;  4PSW B;  3MZK A;  5E6R B;  1JTD B;  1TYE A;  3EWE A;  3UKU C;  4LGN A;  2VZ3 A;  2HYE A;  4GM8 A;  5IT9 g;  3EI3 A;  5C2V B;  2QZP A;  3EMH A;  5IC7 A;  3ZDY A;  2I3T A;  4BCB A;  1N6D A;  3OTT A;  2OVR B;  4U7A A;  4WK2 B;  4GMB A;  2IWF A;  2AGY A;  4H5J A;  3V5W B;  2VDQ B;  3C9C A;  5CXB B;  3JZG A;  4CY5 A;  4FAV D;  2VC2 B;  4Z7N A;  1BPO A;  1C9L A;  4L1Q D;  2HKR A;  4FAN D;  4GQB B;  1U4C A;  4QT8 A;  3EI1 B;  3ORV D;  4NBM A;  2YMU A;  4GGC A;  4KFM B;  5M5S A;  1K32 A;  2PM6 B;  2VDL A;  3FRX A;  4J81 A;  5IGQ A;  4J84 A;  3RFH A;  4CI3 A;  3NIG A;  2UZY B;  1VYH C;  4OZU A;  2MTA H;  4GGA A;  2GC4 A;  4BCD A;  3EI2 A;  2P9I C;  3I7L A;  5B4W A;  2VDO B;  4UI9 R;  5EAM A;  2OVQ B;  5GMK n;  3ZDZ A;  3FCU A;  3VGZ A;  3DXM C;  4K3J B;  1MDA H;  2VDN A;  5HE1 B;  2XDW A;  4XEI C;  3W15 A;  4JXM A;  4A0A B;  3NIF B;  3SBP A;  3O4J A;  3L4M D;  3KRW B;  3VI3 A;  1NR0 A;  3QI0 A;  5JWZ A;  4BP8 A;  4PNK B;  3F3F A;  2HXC A;  5GXI A;  3ZE2 A;  1C9I A;  2XL3 A;  5I5M A;  3IUN A;  4NAA A;  2HKM A;  3UVK A;  2YBA A;  3VH0 A;  4QRJ A;  2CNX A;  2PM9 B;  2H13 A;  3T3M B;  1K8K C;  5TF2 A;  1B9Y A;  5E6U A;  3ODT A;  3BG1 A;  1SHY B;  4Z8L A;  3P4F A;  4WK4 A;  1PBY B;  2CN3 A;  2J57 G;  1GG2 B;  4DNW A;  4O2W A;  2P28 A;  3PXT D;  1A12 A;  1PEV A;  1S4U X;  4D0K A;  1SQ9 A;  1YFQ A;  2VDP A;  2AGZ A;  1I2M B; 
#chains in the Genus database with same CATH homology
 1TYQ C;  3CFV A;  2EBS A;  4ZOX A;  2VDM B;  1PGU A;  3OKY A;  2IUQ A;  3CFS B;  4E54 A;  3IIW A;  3RFG A;  3PE7 A;  4NSX A;  2PM7 B;  3IJ0 A;  3DSM A;  4JSP C;  2BBK H;  2AH0 A;  4A08 B;  2W18 A;  2CO0 A;  5FQD A;  3NIG B;  3F3P A;  3ZE0 B;  5GSA A;  3MMY A;  4GQ2 P;  1P22 A;  3DM0 A;  2YNO A;  2OIZ A;  4J0X A;  2H6Q A;  3RSE C;  3EI1 A;  2HJ4 A;  2HJB A;  4ZOZ A;  4CI8 A;  3MXX A;  3OKT A;  2Z2O A;  4FHL A;  5HQG A;  2G9A A;  5SXM A;  1NEX B;  4ZOY A;  3IJ1 A;  5FLX g;  2CN2 A;  2OK6 A;  3EI2 B;  2CO0 C;  3RN1 D;  3OW8 A;  1SSL A;  2P9L C;  1XHM A;  2HES X;  4J86 A;  2Q7Q A;  1L0Q A;  4ES0 A;  2B5M A;  2P9K C;  2CE9 A;  3PSL A;  3EU7 A;  5A2Q g;  4J87 A;  4JD2 C;  4WK4 B;  2H14 A;  4IMM A;  5I5J A;  1OLZ A;  3ZE1 B;  4L3G D;  3AH8 B;  1XIP A;  3UVL A;  1XKS A;  1U8C B;  3MKQ A;  4A7J A;  1ERJ A;  3I7K A;  4E5Z A;  3SWS D;  1JMX B;  3SXT D;  3VA6 A;  4UM9 D;  4Z7Q B;  2XL2 A;  3AL8 A;  5CYK A;  3I8E A;  5CXC B;  3IKO A;  2H3X A;  2GNQ A;  5TDH B;  4PBZ A;  2PM9 A;  1JJU B;  3SCY A;  5K19 A;  5HE2 B;  4A09 B;  4K3I D;  2AH1 A;  4Z7O B;  5EMK B;  3I89 A;  3EI4 A;  4CZX A;  4XYI A;  5EM2 B;  4YVD A;  3B7F A;  3C5M A;  2J55 H;  3FM0 A;  3A0F A;  5EMJ B;  1N6E A;  2IAA A;  3SLE D;  4CZY A;  4FA9 D;  5HE0 B;  2VDN B;  1GXR A;  4A11 B;  3JRO A;  4AOW A;  3PXW D;  2B4E A;  4FA5 D;  3PSC B;  1FWX A;  3ZE2 B;  3EG6 A;  4N14 A;  2QXV A;  1PI6 A;  3N0E A;  3I7N A;  3CIK B;  4X60 B;  2AGX A;  2VDL B;  4A0A A;  3DWL C;  4ERZ A;  4CZV A;  2VDK B;  1TYE B;  5EAP A;  2XYI A;  4JSN C;  2AQ5 A;  4X63 B;  5FXY A;  3E0C A;  3K27 A;  2B5L A;  5I5I A;  3GFC A;  1RI6 A;  4HDJ A;  5CXB A;  5KDO B;  2H9L A;  3J81 g;  2IUV A;  2P9S C;  4PBY A;  4FWW A;  5H14 A;  4J78 A;  3SJL D;  4OWR A;  3V7D B;  2YNN A;  4JSV C;  2G99 A;  1YUK A;  3NVN A;  4JT5 C;  4A08 A;  3F3G A;  3AFC A;  4CC9 A;  4J8G A;  4GQ1 A;  4FB1 D;  4O9D A;  1N6F A;  3I8C A;  4BH6 A;  3IIY A;  3JZH A;  4H5I A;  3SN6 B;  2I0S A;  2VDR B;  3HFQ A;  4E54 B;  4ZOV A;  4UM8 B;  5EM2 A;  4J77 A;  2VDP B;  2IUR A;  1MG3 A;  3GRE A;  3ZDX B;  4X3E A;  2AGL A;  2P26 A;  2AGW A;  1Q47 A;  4L9O A;  3UVN A;  2IWK A;  3AL9 A;  1TBG A;  5TEF A;  4J73 A;  3BWS A;  3UKR C;  1MG2 A;  1R5M A;  5EAR A;  3C75 H;  2J56 H;  3BG0 A;  2Z2P A;  3I7P A;  3PVW B;  5CYK B;  3AL8 B;  4A2M A;  5IJ8 E;  3PVU B;  3SBR A;  3MZL A;  4ZN4 A;  5HDB B;  3ULE C;  4XYH A;  1JOF A;  5HYN B;  2P9N C;  3NID B;  5IJ7 E;  2BCJ B;  2H9N A;  2P9P C;  5EML B;  5AJA A;  2I0T A;  3UR4 A;  4Y5R D;  4ESG A;  5K1C C;  2PBI B;  5TEE A;  3RMZ D;  3SVW D;  3JB9 L;  2Z2N A;  4GM9 A;  5H17 A;  2OVP B;  3RRM C;  4Z7N B;  2OK4 A;  4ERY A;  4FA4 D;  5THA A;  4QL1 A;  2UZX B;  5HE3 B;  3JRP A;  3ZWL B;  1SQJ A;  5FKS A;  5E6S B;  5FKR A;  1B9X A;  5IGO A;  3VI3 B;  4JT6 C;  4MK0 B;  4J79 A;  3I7O A;  4GM3 A;  1A0R B;  3N0D A;  1U2V C;  3FGB A;  3FCU B;  4AEZ A;  4R7A B;  1OMW B;  4Y7R A;  2B5N A;  3J80 g;  2I3S A;  2GC7 A;  3NVQ A;  4CY2 A;  5FKT A;  4L3H D;  2H68 A;  5FKQ A;  4O1Q D;  3EI3 B;  2H6N A;  3JPX A;  5GXH A;  4PXW A;  3JZN A;  4A2L A;  4U1E I;  2JWH A;  4CI2 A;  3IJC A;  1GOT B;  3T3P B;  4X61 B;  1JMZ B;  3K26 A;  5AFU 3;  4G56 B;  4WJK B;  4CI1 A;  2I0R A;  3ZDY B;  4GGD A;  4BL0 A;  5C2W B;  3KRX B;  2XU7 A;  4A11 A;  4LG9 A;  3PXS D;  4J82 A;  3UVM A;  4LG8 A;  4BUJ C;  4PSX B;  2H9P A;  3OL2 A;  4IA9 A;  3SMR A;  4I79 A;  4O3U B;  4TZ4 A;  4A09 A;  3DXK C;  4WK0 B;  3VI4 B;  4QQE A;  4EWR A;  1QNI A;  3OKW A;  4FA1 D;  4A0B B;  3V9F A;  5E6U B;  2YB8 B;  2H6K A;  4CY1 A;  2H9M A;  3OKY B;  3I7H A;  3UVO A;  2OJY A;  3L4O D;  4O3T B;  4O45 A;  3MKS B;  5CXC A;  5EAL A;  2O9K A;  4A0B A;  3EI4 B;  2CE8 A;  4E5Z B;  4PC0 A;  2JWG A;  3JAM g;  3SHF A;  3C99 A;  5EMM B;  4UM9 B;  3U4Y A;  2YNP A;  2H47 A;  3NVX A;  2P9U C;  3OL2 B;  4GZ8 A;  4ERQ A;  2QC5 A;  3I2N A;  3RLM D;  5H1M A;  5AMS A;  3ZDZ B;  2TRC B;  2IUP A;  4CY3 A;  4JSX C;  3SFZ A;  3RN0 D;  3SBQ A;  4D6V A;  5FA5 B;  5C9Z B;  4J8B A;  4PSW B;  3MZK A;  5E6R B;  3EWE A;  3UKU C;  4LGN A;  2HYE A;  4GM8 A;  5IT9 g;  3EI3 A;  5C2V B;  3EMH A;  5IC7 A;  2I3T A;  1N6D A;  3OTT A;  2OVR B;  4U7A A;  4WK2 B;  4GMB A;  2IWF A;  2AGY A;  4H5J A;  3V5W B;  2VDQ B;  3C9C A;  5CXB B;  3JZG A;  4CY5 A;  4FAV D;  2VC2 B;  4L1Q D;  2HKR A;  4FAN D;  4GQB B;  1U4C A;  4QT8 A;  3EI1 B;  3ORV D;  2YMU A;  4GGC A;  4KFM B;  1K32 A;  2PM6 B;  3FRX A;  4J81 A;  5IGQ A;  4J84 A;  3RFH A;  4CI3 A;  2UZY B;  1VYH C;  4OZU A;  2MTA H;  4GGA A;  2GC4 A;  3EI2 A;  2P9I C;  3I7L A;  5B4W A;  2VDO B;  4UI9 R;  5EAM A;  2OVQ B;  5GMK n;  3VGZ A;  3DXM C;  4K3J B;  1MDA H;  5HE1 B;  4XEI C;  3W15 A;  4JXM A;  4A0A B;  3NIF B;  3SBP A;  3L4M D;  3KRW B;  1NR0 A;  5JWZ A;  4PNK B;  3F3F A;  2HXC A;  5GXI A;  2XL3 A;  5I5M A;  3VH0 A;  2HKM A;  3UVK A;  2YBA A;  4QRJ A;  2CNX A;  2PM9 B;  2H13 A;  3T3M B;  1K8K C;  5TF2 A;  1B9Y A;  3ODT A;  3BG1 A;  1SHY B;  4Z8L A;  3P4F A;  1PBY B;  2CN3 A;  2J57 G;  1GG2 B;  2P28 A;  3PXT D;  1PEV A;  1S4U X;  4D0K A;  1SQ9 A;  1YFQ A;  1GP2 B;  2AGZ A;  4J0W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...