3OKWA

Mouse semaphorin 6a, extracellular domains 1-2
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
549
structure length
540
Chain Sequence
b'FPEDSEPISISHGNYTKQYPVFVGHKPGRTQRHRLDIQMIMIMNRTLYVAARDHIYTVDIDTSHTEEIYCSKKLTWKSRQADVDTCRMKGKHKDECHNFIKVLLKKNDDTLFVCGTNAFNPSCRNYRVDTLETFGDEFSGMARCPYDAKHANIALFADGKLYSATVTDFLAIDAVIYRSLGDSPTLRTVKHDSKWLKEPYFVQAVDYGDYIYFFFREIAVEYNGKVVFPRVAQVCKNDMGGSQRVLEKQWTSFLKARLNCSVPGDSHFYFNILQAVTDVIRINGRDVVLATFSTPYNSIPGSAVCAYDMLDIANVFTGRFKEQKSPDSTWTPVPDERVPKPRPGCCAGSSSLEKYATSNEFPDDTLNFIKTHPLMDEAVPSIINRPWFLRTMVRYRLTKIAVDNAAGPYQNHTVVFLGSEKGIILKFLARIGSLNGSLFLEEMNVYNPEKCSYDGVEDKRIMGMQLDRASGSLYVAFSTCVIKVPLGRCERHGKCKKTCIASRDPYCGWVRESGSCAHLSPRLTFEQDIERGNTDGLGDC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Semaphorin-6A
publication title Structural basis of semaphorin-plexin signalling.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 124
structure length 540
sequence length 549
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01403 Sema Sema domain
A PF01437 PSI Plexin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3okwA01
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 3okwA02
2H6NA 2GC4A 3ZE0B 1MG2A 3T3MB 3JROA 4L1QD 4Y5RD 5EARA 2CO0C 4ERYA 4FAND 3IKOA 5IJ7E 3ZDYB 4ZOXA 4Z7QB 4O9DA 3ZWLB 4GGDA 4JD2C 1B9YA 3K27A 4WK0B 2IURA 3I2NA 3NIFB 2B5MA 4CZVA 3DSMA 3J80g 3ZDZB 5GSAA 4AOWA 3I8EA 5AJAA 1ERJA 1GXRA 2OIZA 3L4MD 3N0EA 5GMKn 4UM9D 2CN3A 4Z7NB 2YNPA 4GGCA 4GMBA 3B7FA 3RLMD 4FAVD 2VDLB 2YMUA 3NIDB 2PM7B 3RN0D 3PSCB 2VDMB 4UM9B 4JSVC 5AFU3 2P9LC 2H14A 4J81A 2IWFA 2W18A 2UZYB 3CFVA 3EI2A 1FWXA 3I7OA 1TBGA 4A2LA 4QRJA 5IJ8E 2I0RA 2OK4A 2H6KA 2Z2OA 4K3JB 4J86A 1N6EA 1U2VC 5K19A 4J0XA 3RN1D 2HXCA 4QL1A 2H3XA 4FA1D 2AGXA 5JWZA 4BH6A 3C9CA 4I79A 2VC2B 2CE9A 3C75H 3AL8B 4Z8LA 3GFCA 3HFQA 5FQDA 2P9UC 4J78A 2VDRB 2OVPB 1SSLA 3IJCA 4GZ8A 3ODTA 2I3TA 3IIYA 5EMJB 4FB1D 2H68A 2GNQA 3EWEA 2TRCB 3DM0A 2I0TA 1GG2B 3GREA 3PXWD 4J77A 4JT6C 2HYEA 2XL2A 4GQ1A 3VI4B 3RFHA 1XHMA 1TYEB 2AH0A 2J55H 4UI9R 5IGOA 5THAA 3EG6A 4Z7OB 1YUKA 4ZOVA 2P9NC 5FKRA 4FA4D 5EAPA 4J87A 4J82A 4J73A 5CYKB 5FXYA 4JSXC 2H9LA 4ZOZA 3AL8A 4IA9A 4R7AB 3I89A 3OKYB 2J56H 5IC7A 4CY3A 3SXTD 2OK6A 4A09B 4GQ2P 1OMWB 3VH0A 4BUJC 3PSLA 4E5ZA 2IUVA 3OKWA 4GGAA 5HQGA 4CI2A 3VI3B 2VDKB 2VDNB 4QT8A 4K3ID 3RFGA 2H9NA 4CI3A 3N0DA 3BWSA 4PBZA 1R5MA 2PM6B 4PSWB 3UVKA 1U8CB 5CXBA 4O1QD 1JMXB 5C2WB 2AGLA 4CY5A 2AGWA 4YVDA 1VYHC 5I5MA 3JPXA 1S4UX 1GOTB 3I7NA 3I7KA 2HKMA 4H5IA 4X61B 5SXMA 5EMMB 5CYKA 5CXCB 2P28A 4PC0A 1JOFA 3CIKB 3OKYA 1N6DA 4KFMB 5A2Qg 4CZYA 4WK4B 4A09A 2I0SA 3SN6B 2VDOB 2B4EA 2G9AA 3UR4A 3IIWA 2IWKA 2P9SC 4U1EI 5GXIA 1OLZA 3UVLA 4X63B 1QNIA 3MMYA 3KRXB 3EI3B 2PM9B 4O3TB 5K1CC 5TF2A 2YB8B 5EAMA 2J57G 2P9IC 2BCJB 1SQ9A 4J8BA 3MKSB 4ESGA 4ZN4A 3J81g 4CC9A 4QQEA 5HE0B 3DXMC 3MKQA 4O3UB 3NIGB 3MXXA 4A7JA 5HE3B 5C9ZB 3EI4B 1NR0A 2QC5A 2IUPA 3OKTA 4N14A 3RMZD 3KRWB 4CI8A 5HE1B 4X3EA 4U7AA 2XU7A 5HE2B 3ZDXB 2Q7QA 5KDOB 2OVRB 1PI6A 4O45A 4A11B 5CXCA 1MG3A 3JZNA 4X60B 4PBYA 4HDJA 3PXTD 4CZXA 5FKQA 5HDBB 2YNOA 1SHYB 4LGNA 3IJ0A 3JZHA 4WJKB 3OW8A 4ZOYA 3FM0A 4OZUA 4XYHA 3SFZA 2XYIA 3CFSB 5H1MA 4FA5D 4L3HD 3EI3A 2PM9A 4D0KA 2IAAA 3C99A 5FLXg 3FCUB 5C2VB 5AMSA 2O9KA 2CN2A 2I3SA 5E6UB 2P9PC 4G56B 3K26A 4PNKB 4CI1A 5EM2B 4OWRA 2CO0A 5H17A 2H9PA 2CE8A 1NEXB 1P22A 2HJBA 3EU7A 3ZE2B 3EI4A 3PVWB 1YFQA 1A0RB 2QXVA 5E6SB 1K32A 3I8CA 3JAMg 3F3GA 4EWRA 4FA9D 5IGQA 1PGUA 4A08B 4A11A 3L4OD 3E0CA 5EALA 4JSPC 4XEIC 3EMHA 4A0AB 4CY2A 2UZXB 3BG1A 2HJ4A 2P26A 2IUQA 4J84A 3NVQA 4JSNC 4LG9A 1PBYB 3SBPA 4H5JA 5EMLB 4A0BB 5FKTA 3SLED 3I7LA 3PVUB 2HESX 3DWLC 3U4YA 3ZE1B 2OVQB 4Y7RA 3C5MA 4XYIA 3BG0A 3JZGA 3UVOA 5IT9g 1U4CA 5EM2A 3V5WB 4A2MA 3I7HA 2VDQB 3MZLA 1GP2B 3UKRC 3OL2B 3ORVD 1B9XA 3UVMA 3UKUC 5I5JA 1XIPA 3VA6A 4TZ4A 3RSEC 2H9MA 2AGYA 4J0WA 3SBRA 3W15A 3SVWD 3A0FA 3JRPA 2YNNA 4A08A 3NVXA 2PBIB 4GM9A 2GC7A 2B5NA 2AQ5A 4A0AA 2CNXA 1JJUB 3NVNA 4IMMA 4FWWA 2G99A 4PXWA 4A0BA 2VDPB 3DXKC 4J8GA 1RI6A 4MK0B 3ULEC 4L3GD 2BBKH 4L9OA 3IJ1A 3F3FA 3AH8B 4GM3A 4BL0A 4JXMA 3I7PA 1JMZB 5HYNB 2B5LA 4UM8B 3UVNA 2XL3A 2YBAA 3SWSD 3OL2A 4JT5C 3PE7A 2H13A 4E54B 4E5ZB 3SBQA 3F3PA 5FKSA 2Z2PA 1Q47A 3SMRA 4PSXB 3EI1B 5I5IA 1MDAH 4J79A 1XKSA 2EBSA 1N6FA 3VGZA 3FGBA 4GM8A 5FA5B 4D6VA 2Z2NA 4CY1A 3SHFA 5TDHB 4AEZA 3MZKA 2MTAH 5GXHA 1L0QA 1K8KC 5CXBB 3JB9L 3PXSD 3P4FA 1PEVA 4FHLA 1TYQC 2HKRA 5EMKB 4NSXA 2OJYA 3OTTA 5TEFA 2AH1A 2H6QA 5E6RB 3AFCA 4ERQA 5B4WA 4ES0A 3FRXA 2AGZA 3T3PB 3SJLD 1SQJA 3EI2B 2P9KC 4GQBB 3V9FA 2H47A 3V7DB 5TEEA 4E54A 4ERZA 5H14A 4LG8A 4WK2B 3AL9A 3RRMC 3SCYA 3EI1A
chains in the Genus database with same CATH superfamily
2H6NA 2GC4A 3IURA 3ZE0B 1MG2A 3IUJA 4AMYA 3T3MB 3JROA 4L1QD 4Y5RD 5EARA 2CO0C 4ERYA 4FAND 3IKOA 5M5SA 5IJ7E 3ZDYB 4NC4A 4ZOXA 4O9DA 4Z7QB 3ZWLB 2XE4A 3IULA 4GGDA 4JD2C 2JWHA 1B9YA 3K27A 4WK0B 2IURA 3MVDK 1BPOA 3I2NA 3NIFB 2B5MA 4CZVA 3DSMA 3J80g 3ZDZB 5GSAA 4AOWA 3I8EA 5AJAA 1ERJA 1GXRA 2OIZA 3L4MD 3N0EA 5GMKn 4UM9D 2CN3A 5E6SA 4Z7NB 2YNPA 4GGCA 4GMBA 3B7FA 3RLMD 4FAVD 2VDLB 2YMUA 3NIDB 2PM7B 3RN0D 5E6RA 3PSCB 2VDMB 4UM9B 4JSVC 3T3PA 5AFU3 2P9LC 2H14A 2WQ8A 4J81A 2IWFA 2W18A 2UZYB 3CFVA 3EI2A 3DDUA 1FWXA 1QFMA 3I7OA 1TBGA 4A2LA 4QRJA 5IJ8E 2I0RA 2XDWA 2OK4A 2H6KA 2Z2OA 4K3JB 4WK2A 4J86A 1N6EA 1U2VC 5K19A 4J0XA 3RN1D 2HXCA 5M61A 4QL1A 2H3XA 4FA1D 5M5RA 2AGXA 1I2MB 3ZE0A 5JWZA 4BH6A 3T3MA 3C9CA 4I79A 5FFGA 2VC2B 3IUQA 4QAMA 2CE9A 3C75H 3AL8B 4AN1A 4Z8LA 3GFCA 3HFQA 5FQDA 2P9UC 4J78A 2VDRB 2OVPB 4WK0A 4MMYA 1SSLA 3NIFA 3IJCA 4GZ8A 3ODTA 3ZDZA 2I3TA 3IIYA 5EMJB 4AN0A 4FB1D 2H68A 4Z7NA 2GNQA 3EWEA 2TRCB 3DM0A 3NIDA 2I0TA 1GG2B 3GREA 3PXWD 4J77A 4JT6C 2HYEA 2XL2A 3IUMA 1C9IA 4D9SA 4GQ1A 3VI4B 3RFHA 1XHMA 1TYEB 2AH0A 2J55H 4UI9R 5IGOA 5THAA 3EG6A 4Z7OB 1YUKA 4ZOVA 4RE5A 4L1MA 2P9NC 4BP8A 3EQ7A 5FKRA 4FA4D 4BCBA 5EAPA 4J87A 4J82A 3EQ9A 2VC2A 4J73A 5CYKB 5FXYA 4JSXC 2H9LA 4ZOZA 3AL8A 3MUNA 1H2ZA 4IA9A 4R7AB 3I89A 3OKYB 2J56H 5IC7A 4CY3A 3SXTD 2OK6A 2VDRA 4A09B 4GQ2P 4NBMA 2VZ1A 1OMWB 3VH0A 4BUJC 3PSLA 4E5ZA 3O4JA 2IUVA 3OKWA 4GGAA 5HQGA 4CI2A 3VI3B 1VE7A 2VDKB 2VDNB 4QT8A 4K3ID 3RFGA 2H9NA 4CI3A 3N0DA 3BWSA 4PBZA 3VI4A 1R5MA 2PM6B 4PSWB 3UVKA 1U8CB 1O6GA 5CXBA 4O1QD 1TYEA 1JMXB 5C2WB 2AGLA 2EIDA 4CY5A 2HU8A 4BP9A 4Z7OA 2AGWA 4YVDA 1JV2A 2EIEA 1VYHC 5I5MA 3JPXA 1S4UX 1GOTB 3I7NA 3I7KA 2HKMA 4H5IA 4X61B 5SXMA 5EMMB 5CYKA 1VZ2A 1E8NA 5CXCB 2P28A 4PC0A 1JOFA 2QZPA 3CIKB 1N6DA 2QR5A 3OKYA 4KFMB 5A2Qg 4CZYA 4WK4B 4A09A 2I0SA 3SN6B 2VDOB 2B4EA 2G9AA 3UR4A 3IIWA 2IWKA 2P9SC 4U1EI 5GXIA 1OLZA 3GC3B 3VI3A 2VDKA 3UVLA 4X63B 1QNIA 2VDNA 3MMYA 3KRXB 3EI3B 2PM9B 4O3TB 5K1CC 5TF2A 4NENA 2YB8B 4G1MA 5EAMA 4G1EA 2J57G 1K3IA 2P9IC 2BCJB 1SQ9A 4J8BA 3MKSB 3ZDYA 4ESGA 4ZN4A 3J81g 4CC9A 1U8CA 4Z7QA 4QQEA 5HE0B 4O02A 3IJEA 3DXMC 3MKQA 4O3UB 3NIGB 5M5UA 3MXXA 4A7JA 1C9LA 5HE3B 5C9ZB 3EI4B 1NR0A 3K71A 2QC5A 1H2XA 2IUPA 3OKTA 4N14A 3RMZD 3KRWB 4CI8A 5HE1B 4X3EA 4U7AA 2XU7A 5HE2B 3ZDXB 2Q7QA 5FFOA 5KDOB 1GOFA 2VDLA 2OVRB 1PI6A 4O45A 4A11B 5CXCA 1GOHA 2VDMA 4AX4A 1MG3A 3JZNA 4X60B 4PBYA 4UM9A 4HDJA 3PXTD 4CZXA 5FKQA 5HDBB 2YNOA 1SHYB 1M1XA 4LGNA 3IJ0A 2VDOA 1YR2A 3JZHA 4WJKB 3OW8A 4ZOYA 3FM0A 4OZUA 1H2YA 4XYHA 3SFZA 2XYIA 2HU7A 3CFSB 1T2XA 5H1MA 4FA5D 4L3HD 2EIBA 2PM9A 3EI3A 2IAAA 3C99A 4D0KA 5FLXg 5C2VB 3FCUB 5AMSA 2O9KA 2CN2A 2I3SA 5E6UB 2P9PC 4G56B 3K26A 4PNKB 4CI1A 5EM2B 4OWRA 4DNUA 2CO0A 5H17A 2H9PA 2CE8A 1NEXB 1P22A 1A12A 2HJBA 3NIGA 3EU7A 3K72A 3OF7A 3ZE2B 3EI4A 3PVWB 1YFQA 3FCSA 1A0RB 2QXVA 5E6SB 1K32A 3I8CA 3JAMg 3F3GA 3ZDXA 4EWRA 3O4IA 3O4HA 4FA9D 4MMXA 5IGQA 1PGUA 4A08B 4A11A 3L4OD 4JHPC 3E0CA 5EALA 4JSPC 4XEIC 3EMHA 4A0AB 4CY2A 2UZXB 4G55A 3BG1A 5HDBA 3K6SA 2HJ4A 2P26A 2IUQA 4J84A 3NVQA 4WJKA 4JSNC 4LG9A 1PBYB 3SBPA 4H5JA 5EMLB 4A0BB 5FKTA 3SLED 1JTDB 4O2WA 3I7LA 3PVUB 2HESX 3DWLC 3U4YA 1GOGA 3FCUA 4BCDA 3ZE1B 2OVQB 4Y7RA 3C5MA 5E6UA 3QI0A 1UOPA 4XYIA 5M5TA 3BG0A 3JZGA 3UVOA 4MMZA 5IT9g 1U4CA 5EM2A 3V5WB 4A2MA 1O6FA 3I7HA 2VDQB 4BCCA 3MZLA 1GP2B 2EICA 4RE6A 3UKRC 3OL2B 3ORVD 1B9XA 3UVMA 3GD1I 3UKUC 3ZE2A 5I5JA 1XIPA 3VA6A 1E5TA 4TZ4A 3RSEC 2H9MA 2AGYA 3MUOA 4J0WA 3SBRA 3W15A 3A0FA 3SVWD 4DNVA 3JRPA 2YNNA 1QFSA 4A08A 3NVXA 2PBIB 4GM9A 2GC7A 2B5NA 2AQ5A 4A0AA 2CNXA 1UOOA 3IVMA 1JJUB 3NVNA 4IMMA 3V4PA 4FWWA 2G99A 4PXWA 4A0BA 2VDPB 3DXKC 2BKLA 1RI6A 2VZ3A 4J8GA 4MK0B 3ULEC 4L3GD 2BBKH 4L9OA 5C92A 3ZE1A 3IJ1A 3F3FA 3AH8B 2JWGA 4GM3A 4BL0A 4JXMA 3I7PA 1JMZB 5HYNB 2B5LA 4UM8B 3UVNA 2VDQA 2XL3A 2YBAA 4WK4A 3SWSD 3OL2A 4JT5C 3PE7A 2H13A 4E54B 3KCIA 4E5ZB 3SBQA 1VE6A 3F3PA 5FKSA 2Z2PA 1Q47A 3SMRA 4PSXB 1UOQA 3EI1B 1E8MA 5I5IA 1MDAH 4J79A 1UTCA 1XKSA 2EBSA 5M5VA 3EQ8A 1N6FA 3VGZA 3FGBA 4GM8A 5FA5B 4D6VA 2Z2NA 4CY1A 3SHFA 5TDHB 4AEZA 3MZKA 2MTAH 5GXHA 1L0QA 4DNWA 1K8KC 5CXBB 3JB9L 3PXSD 3P4FA 1PEVA 4FHLA 4IRZA 1TYQC 2HKRA 2VDPA 5EMKB 4AMZA 1H2WA 3O4GA 1VZ3A 4NSXA 2OJYA 2XZGA 4NAAA 3OTTA 5TEFA 2AH1A 2H6QA 2JKXA 5E6RB 3AFCA 4ERQA 5B4WA 4ES0A 3FRXA 4UM8A 1L5GA 2AGZA 3IUNA 3T3PB 3SJLD 1SQJA 3EI2B 2P9KC 4GQBB 4JHNA 3V9FA 2HU5A 5C86A 2H47A 3V7DB 5TEEA 4E54A 3QHYB 4ERZA 5H14A 4LG8A 3V4VA 3AL9A 4WK2B 3RRMC 3SCYA 3EI1A
chains in the Genus database with same CATH topology
2H6NA 2GC4A 3ZE0B 1MG2A 3T3MB 3JROA 4L1QD 4Y5RD 5EARA 2CO0C 4ERYA 4FAND 3IKOA 5IJ7E 3ZDYB 4ZOXA 4Z7QB 4O9DA 3ZWLB 4GGDA 4JD2C 2JWHA 1B9YA 3K27A 4WK0B 2IURA 3I2NA 3NIFB 2B5MA 4CZVA 3DSMA 3J80g 3ZDZB 5GSAA 4AOWA 3I8EA 5AJAA 1ERJA 1GXRA 2OIZA 3L4MD 3N0EA 5GMKn 4UM9D 2CN3A 4Z7NB 2YNPA 4GGCA 4GMBA 3B7FA 3RLMD 4FAVD 2VDLB 2YMUA 3NIDB 2PM7B 3RN0D 3PSCB 2VDMB 4UM9B 4JSVC 5AFU3 2P9LC 2H14A 4J81A 2IWFA 2W18A 2UZYB 3CFVA 3EI2A 1FWXA 3I7OA 1TBGA 4A2LA 4QRJA 5IJ8E 2I0RA 2OK4A 2H6KA 2Z2OA 4K3JB 4J86A 1N6EA 1U2VC 5K19A 4J0XA 3RN1D 2HXCA 4QL1A 2H3XA 4FA1D 2AGXA 5JWZA 4BH6A 3C9CA 4I79A 2VC2B 2CE9A 3C75H 3AL8B 4Z8LA 3GFCA 3HFQA 5FQDA 2P9UC 4J78A 2VDRB 2OVPB 1SSLA 3IJCA 4GZ8A 3ODTA 2I3TA 3IIYA 5EMJB 4FB1D 2H68A 2GNQA 3EWEA 2TRCB 3DM0A 2I0TA 1GG2B 3GREA 3PXWD 4J77A 4JT6C 2HYEA 2XL2A 4GQ1A 3VI4B 3RFHA 1XHMA 1TYEB 2AH0A 2J55H 4UI9R 5IGOA 5THAA 3EG6A 4Z7OB 1YUKA 4ZOVA 2P9NC 5FKRA 4FA4D 5EAPA 4J87A 4J82A 4J73A 5CYKB 5FXYA 4JSXC 2H9LA 4ZOZA 3AL8A 4IA9A 4R7AB 3I89A 3OKYB 2J56H 5IC7A 4CY3A 3SXTD 2OK6A 4A09B 4GQ2P 1OMWB 3VH0A 4BUJC 3PSLA 4E5ZA 2IUVA 3OKWA 4GGAA 5HQGA 4CI2A 3VI3B 2VDKB 2VDNB 4QT8A 4K3ID 3RFGA 2H9NA 4CI3A 3N0DA 3BWSA 4PBZA 1R5MA 2PM6B 4PSWB 3UVKA 1U8CB 5CXBA 4O1QD 1JMXB 5C2WB 2AGLA 4CY5A 2AGWA 4YVDA 1VYHC 5I5MA 3JPXA 1S4UX 1GOTB 3I7NA 3I7KA 2HKMA 4H5IA 4X61B 5SXMA 5EMMB 5CYKA 5CXCB 2P28A 4PC0A 1JOFA 3CIKB 3OKYA 1N6DA 4KFMB 5A2Qg 4CZYA 4WK4B 4A09A 2I0SA 3SN6B 2VDOB 2B4EA 2G9AA 3UR4A 3IIWA 2IWKA 2P9SC 4U1EI 5GXIA 1OLZA 3UVLA 4X63B 1QNIA 3MMYA 3KRXB 3EI3B 2PM9B 4O3TB 5K1CC 5TF2A 2YB8B 5EAMA 2J57G 2P9IC 2BCJB 1SQ9A 4J8BA 3MKSB 4ESGA 4ZN4A 3J81g 4CC9A 4QQEA 5HE0B 3DXMC 3MKQA 4O3UB 3NIGB 3MXXA 4A7JA 5HE3B 5C9ZB 3EI4B 1NR0A 2QC5A 2IUPA 3OKTA 4N14A 3RMZD 3KRWB 4CI8A 5HE1B 4X3EA 4U7AA 2XU7A 5HE2B 3ZDXB 2Q7QA 5KDOB 2OVRB 1PI6A 4O45A 4A11B 5CXCA 1MG3A 3JZNA 4X60B 4PBYA 4HDJA 3PXTD 4CZXA 5FKQA 5HDBB 2YNOA 1SHYB 4LGNA 3IJ0A 3JZHA 4WJKB 3OW8A 4ZOYA 3FM0A 4OZUA 4XYHA 3SFZA 2XYIA 3CFSB 5H1MA 4FA5D 4L3HD 3EI3A 2PM9A 4D0KA 2IAAA 3C99A 5FLXg 3FCUB 5C2VB 5AMSA 2O9KA 2CN2A 2I3SA 5E6UB 2P9PC 4G56B 3K26A 4PNKB 4CI1A 5EM2B 4OWRA 2CO0A 5H17A 2H9PA 2CE8A 1NEXB 1P22A 2HJBA 3EU7A 3ZE2B 3EI4A 3PVWB 1YFQA 1A0RB 2QXVA 5E6SB 1K32A 3I8CA 3JAMg 3F3GA 4EWRA 4FA9D 5IGQA 1PGUA 4A08B 4A11A 3L4OD 3E0CA 5EALA 4JSPC 4XEIC 3EMHA 4A0AB 4CY2A 2UZXB 3BG1A 2HJ4A 2P26A 2IUQA 4J84A 3NVQA 4JSNC 4LG9A 1PBYB 3SBPA 4H5JA 5EMLB 4A0BB 5FKTA 3SLED 3I7LA 3PVUB 2HESX 3DWLC 3U4YA 3ZE1B 2OVQB 4Y7RA 3C5MA 4XYIA 3BG0A 3JZGA 3UVOA 5IT9g 1U4CA 5EM2A 3V5WB 4A2MA 3I7HA 2VDQB 3MZLA 1GP2B 3UKRC 3OL2B 3ORVD 1B9XA 3UVMA 3UKUC 5I5JA 1XIPA 3VA6A 4TZ4A 3RSEC 2H9MA 2AGYA 4J0WA 3SBRA 3W15A 3SVWD 3A0FA 3JRPA 2YNNA 4A08A 3NVXA 2PBIB 4GM9A 2GC7A 2B5NA 2AQ5A 4A0AA 2CNXA 1JJUB 3NVNA 4IMMA 4FWWA 2G99A 4PXWA 4A0BA 2VDPB 3DXKC 4J8GA 1RI6A 4MK0B 3ULEC 4L3GD 2BBKH 4L9OA 3IJ1A 3F3FA 3AH8B 2JWGA 4GM3A 4BL0A 4JXMA 3I7PA 1JMZB 5HYNB 2B5LA 4UM8B 3UVNA 2XL3A 2YBAA 3SWSD 3OL2A 4JT5C 3PE7A 2H13A 4E54B 4E5ZB 3SBQA 3F3PA 5FKSA 2Z2PA 1Q47A 3SMRA 4PSXB 3EI1B 5I5IA 1MDAH 4J79A 1XKSA 2EBSA 1N6FA 3VGZA 3FGBA 4GM8A 5FA5B 4D6VA 2Z2NA 4CY1A 3SHFA 5TDHB 4AEZA 3MZKA 2MTAH 5GXHA 1L0QA 1K8KC 5CXBB 3JB9L 3PXSD 3P4FA 1PEVA 4FHLA 1TYQC 2HKRA 5EMKB 4NSXA 2OJYA 3OTTA 5TEFA 2AH1A 2H6QA 5E6RB 3AFCA 4ERQA 5B4WA 4ES0A 3FRXA 2AGZA 3T3PB 3SJLD 1SQJA 3EI2B 2P9KC 4GQBB 3V9FA 2H47A 3V7DB 5TEEA 4E54A 4ERZA 5H14A 4LG8A 4WK2B 3AL9A 3RRMC 3SCYA 3EI1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H6N A;  2GC4 A;  3ZE0 B;  1MG2 A;  3T3M B;  3JRO A;  4L1Q D;  4Y5R D;  5EAR A;  2CO0 C;  4ERY A;  4FAN D;  3IKO A;  5IJ7 E;  3ZDY B;  4ZOX A;  4Z7Q B;  4O9D A;  3ZWL B;  4GGD A;  4JD2 C;  1B9Y A;  3K27 A;  4WK0 B;  2IUR A;  3I2N A;  3NIF B;  2B5M A;  4CZV A;  3DSM A;  3J80 g;  3ZDZ B;  5GSA A;  4AOW A;  3I8E A;  5AJA A;  1ERJ A;  1GXR A;  2OIZ A;  3L4M D;  3N0E A;  5GMK n;  4UM9 D;  2CN3 A;  4Z7N B;  2YNP A;  4GGC A;  4GMB A;  3B7F A;  3RLM D;  4FAV D;  2VDL B;  2YMU A;  3NID B;  2PM7 B;  3RN0 D;  3PSC B;  2VDM B;  4UM9 B;  4JSV C;  5AFU 3;  2P9L C;  2H14 A;  4J81 A;  2IWF A;  2W18 A;  2UZY B;  3CFV A;  3EI2 A;  1FWX A;  3I7O A;  1TBG A;  4A2L A;  4QRJ A;  5IJ8 E;  2I0R A;  2OK4 A;  2H6K A;  2Z2O A;  4K3J B;  4J86 A;  1N6E A;  1U2V C;  5K19 A;  4J0X A;  3RN1 D;  2HXC A;  4QL1 A;  2H3X A;  4FA1 D;  2AGX A;  5JWZ A;  4BH6 A;  3C9C A;  4I79 A;  2VC2 B;  2CE9 A;  3C75 H;  3AL8 B;  4Z8L A;  3GFC A;  3HFQ A;  5FQD A;  2P9U C;  4J78 A;  2VDR B;  2OVP B;  1SSL A;  3IJC A;  4GZ8 A;  3ODT A;  2I3T A;  3IIY A;  5EMJ B;  4FB1 D;  2H68 A;  2GNQ A;  3EWE A;  2TRC B;  3DM0 A;  2I0T A;  1GG2 B;  3GRE A;  3PXW D;  4J77 A;  4JT6 C;  2HYE A;  2XL2 A;  4GQ1 A;  3VI4 B;  3RFH A;  1XHM A;  1TYE B;  2AH0 A;  2J55 H;  4UI9 R;  5IGO A;  5THA A;  3EG6 A;  4Z7O B;  1YUK A;  4ZOV A;  2P9N C;  5FKR A;  4FA4 D;  5EAP A;  4J87 A;  4J82 A;  4J73 A;  5CYK B;  5FXY A;  4JSX C;  2H9L A;  4ZOZ A;  3AL8 A;  4IA9 A;  4R7A B;  3I89 A;  3OKY B;  2J56 H;  5IC7 A;  4CY3 A;  3SXT D;  2OK6 A;  4A09 B;  4GQ2 P;  1OMW B;  3VH0 A;  4BUJ C;  3PSL A;  4E5Z A;  2IUV A;  3OKW A;  4GGA A;  5HQG A;  4CI2 A;  3VI3 B;  2VDK B;  2VDN B;  4QT8 A;  4K3I D;  3RFG A;  2H9N A;  4CI3 A;  3N0D A;  3BWS A;  4PBZ A;  1R5M A;  2PM6 B;  4PSW B;  3UVK A;  1U8C B;  5CXB A;  4O1Q D;  1JMX B;  5C2W B;  2AGL A;  4CY5 A;  2AGW A;  4YVD A;  1VYH C;  5I5M A;  3JPX A;  1S4U X;  1GOT B;  3I7N A;  3I7K A;  2HKM A;  4H5I A;  4X61 B;  5SXM A;  5EMM B;  5CYK A;  5CXC B;  2P28 A;  4PC0 A;  1JOF A;  3CIK B;  3OKY A;  1N6D A;  4KFM B;  5A2Q g;  4CZY A;  4WK4 B;  4A09 A;  2I0S A;  3SN6 B;  2VDO B;  2B4E A;  2G9A A;  3UR4 A;  3IIW A;  2IWK A;  2P9S C;  4U1E I;  5GXI A;  1OLZ A;  3UVL A;  4X63 B;  1QNI A;  3MMY A;  3KRX B;  3EI3 B;  2PM9 B;  4O3T B;  5K1C C;  5TF2 A;  2YB8 B;  5EAM A;  2J57 G;  2P9I C;  2BCJ B;  1SQ9 A;  4J8B A;  3MKS B;  4ESG A;  4ZN4 A;  3J81 g;  4CC9 A;  4QQE A;  5HE0 B;  3DXM C;  3MKQ A;  4O3U B;  3NIG B;  3MXX A;  4A7J A;  5HE3 B;  5C9Z B;  3EI4 B;  1NR0 A;  2QC5 A;  2IUP A;  3OKT A;  4N14 A;  3RMZ D;  3KRW B;  4CI8 A;  5HE1 B;  4X3E A;  4U7A A;  2XU7 A;  5HE2 B;  3ZDX B;  2Q7Q A;  5KDO B;  2OVR B;  1PI6 A;  4O45 A;  4A11 B;  5CXC A;  1MG3 A;  3JZN A;  4X60 B;  4PBY A;  4HDJ A;  3PXT D;  4CZX A;  5FKQ A;  5HDB B;  2YNO A;  1SHY B;  4LGN A;  3IJ0 A;  3JZH A;  4WJK B;  3OW8 A;  4ZOY A;  3FM0 A;  4OZU A;  4XYH A;  3SFZ A;  2XYI A;  3CFS B;  5H1M A;  4FA5 D;  4L3H D;  3EI3 A;  2PM9 A;  4D0K A;  2IAA A;  3C99 A;  5FLX g;  3FCU B;  5C2V B;  5AMS A;  2O9K A;  2CN2 A;  2I3S A;  5E6U B;  2P9P C;  4G56 B;  3K26 A;  4PNK B;  4CI1 A;  5EM2 B;  4OWR A;  2CO0 A;  5H17 A;  2H9P A;  2CE8 A;  1NEX B;  1P22 A;  2HJB A;  3EU7 A;  3ZE2 B;  3EI4 A;  3PVW B;  1YFQ A;  1A0R B;  2QXV A;  5E6S B;  1K32 A;  3I8C A;  3JAM g;  3F3G A;  4EWR A;  4FA9 D;  5IGQ A;  1PGU A;  4A08 B;  4A11 A;  3L4O D;  3E0C A;  5EAL A;  4JSP C;  4XEI C;  3EMH A;  4A0A B;  4CY2 A;  2UZX B;  3BG1 A;  2HJ4 A;  2P26 A;  2IUQ A;  4J84 A;  3NVQ A;  4JSN C;  4LG9 A;  1PBY B;  3SBP A;  4H5J A;  5EML B;  4A0B B;  5FKT A;  3SLE D;  3I7L A;  3PVU B;  2HES X;  3DWL C;  3U4Y A;  3ZE1 B;  2OVQ B;  4Y7R A;  3C5M A;  4XYI A;  3BG0 A;  3JZG A;  3UVO A;  5IT9 g;  1U4C A;  5EM2 A;  3V5W B;  4A2M A;  3I7H A;  2VDQ B;  3MZL A;  1GP2 B;  3UKR C;  3OL2 B;  3ORV D;  1B9X A;  3UVM A;  3UKU C;  5I5J A;  1XIP A;  3VA6 A;  4TZ4 A;  3RSE C;  2H9M A;  2AGY A;  4J0W A;  3SBR A;  3W15 A;  3SVW D;  3A0F A;  3JRP A;  2YNN A;  4A08 A;  3NVX A;  2PBI B;  4GM9 A;  2GC7 A;  2B5N A;  2AQ5 A;  4A0A A;  2CNX A;  1JJU B;  3NVN A;  4IMM A;  4FWW A;  2G99 A;  4PXW A;  4A0B A;  2VDP B;  3DXK C;  4J8G A;  1RI6 A;  4MK0 B;  3ULE C;  4L3G D;  2BBK H;  4L9O A;  3IJ1 A;  3F3F A;  3AH8 B;  4GM3 A;  4BL0 A;  4JXM A;  3I7P A;  1JMZ B;  5HYN B;  2B5L A;  4UM8 B;  3UVN A;  2XL3 A;  2YBA A;  3SWS D;  3OL2 A;  4JT5 C;  3PE7 A;  2H13 A;  4E54 B;  4E5Z B;  3SBQ A;  3F3P A;  5FKS A;  2Z2P A;  1Q47 A;  3SMR A;  4PSX B;  3EI1 B;  5I5I A;  1MDA H;  4J79 A;  1XKS A;  2EBS A;  1N6F A;  3VGZ A;  3FGB A;  4GM8 A;  5FA5 B;  4D6V A;  2Z2N A;  4CY1 A;  3SHF A;  5TDH B;  4AEZ A;  3MZK A;  2MTA H;  5GXH A;  1L0Q A;  1K8K C;  5CXB B;  3JB9 L;  3PXS D;  3P4F A;  1PEV A;  4FHL A;  1TYQ C;  2HKR A;  5EMK B;  4NSX A;  2OJY A;  3OTT A;  5TEF A;  2AH1 A;  2H6Q A;  5E6R B;  3AFC A;  4ERQ A;  5B4W A;  4ES0 A;  3FRX A;  2AGZ A;  3T3P B;  3SJL D;  1SQJ A;  3EI2 B;  2P9K C;  4GQB B;  3V9F A;  2H47 A;  3V7D B;  5TEE A;  4E54 A;  4ERZ A;  5H14 A;  4LG8 A;  4WK2 B;  3AL9 A;  3RRM C;  3SCY A;  3EI1 A; 
#chains in the Genus database with same CATH topology
 2H6N A;  2GC4 A;  3IUR A;  3ZE0 B;  1MG2 A;  3IUJ A;  4AMY A;  3T3M B;  3JRO A;  4L1Q D;  4Y5R D;  5EAR A;  2CO0 C;  4ERY A;  4FAN D;  3IKO A;  5M5S A;  5IJ7 E;  3ZDY B;  4NC4 A;  4ZOX A;  4O9D A;  4Z7Q B;  3ZWL B;  2XE4 A;  3IUL A;  4GGD A;  4JD2 C;  2JWH A;  1B9Y A;  3K27 A;  4WK0 B;  2IUR A;  3MVD K;  1BPO A;  3I2N A;  3NIF B;  2B5M A;  4CZV A;  3DSM A;  3J80 g;  3ZDZ B;  5GSA A;  4AOW A;  3I8E A;  5AJA A;  1ERJ A;  1GXR A;  2OIZ A;  3L4M D;  3N0E A;  5GMK n;  4UM9 D;  2CN3 A;  5E6S A;  4Z7N B;  2YNP A;  4GGC A;  4GMB A;  3B7F A;  3RLM D;  4FAV D;  2VDL B;  2YMU A;  3NID B;  2PM7 B;  3RN0 D;  5E6R A;  3PSC B;  2VDM B;  4UM9 B;  4JSV C;  3T3P A;  5AFU 3;  2P9L C;  2H14 A;  2WQ8 A;  4J81 A;  2IWF A;  2W18 A;  2UZY B;  3CFV A;  3EI2 A;  3DDU A;  1FWX A;  1QFM A;  3I7O A;  1TBG A;  4A2L A;  4QRJ A;  5IJ8 E;  2I0R A;  2XDW A;  2OK4 A;  2H6K A;  2Z2O A;  4K3J B;  4WK2 A;  4J86 A;  1N6E A;  1U2V C;  5K19 A;  4J0X A;  3RN1 D;  2HXC A;  5M61 A;  4QL1 A;  2H3X A;  4FA1 D;  5M5R A;  2AGX A;  1I2M B;  3ZE0 A;  5JWZ A;  4BH6 A;  3T3M A;  3C9C A;  4I79 A;  5FFG A;  2VC2 B;  3IUQ A;  4QAM A;  2CE9 A;  3C75 H;  3AL8 B;  4AN1 A;  4Z8L A;  3GFC A;  3HFQ A;  5FQD A;  2P9U C;  4J78 A;  2VDR B;  2OVP B;  4WK0 A;  4MMY A;  1SSL A;  3NIF A;  3IJC A;  4GZ8 A;  3ODT A;  3ZDZ A;  2I3T A;  3IIY A;  5EMJ B;  4AN0 A;  4FB1 D;  2H68 A;  4Z7N A;  2GNQ A;  3EWE A;  2TRC B;  3DM0 A;  3NID A;  2I0T A;  1GG2 B;  3GRE A;  3PXW D;  4J77 A;  4JT6 C;  2HYE A;  2XL2 A;  3IUM A;  1C9I A;  4D9S A;  4GQ1 A;  3VI4 B;  3RFH A;  1XHM A;  1TYE B;  2AH0 A;  2J55 H;  4UI9 R;  5IGO A;  5THA A;  3EG6 A;  4Z7O B;  1YUK A;  4ZOV A;  4RE5 A;  4L1M A;  2P9N C;  4BP8 A;  3EQ7 A;  5FKR A;  4FA4 D;  4BCB A;  5EAP A;  4J87 A;  4J82 A;  3EQ9 A;  2VC2 A;  4J73 A;  5CYK B;  5FXY A;  4JSX C;  2H9L A;  4ZOZ A;  3AL8 A;  3MUN A;  1H2Z A;  4IA9 A;  4R7A B;  3I89 A;  3OKY B;  2J56 H;  5IC7 A;  4CY3 A;  3SXT D;  2OK6 A;  2VDR A;  4A09 B;  4GQ2 P;  4NBM A;  2VZ1 A;  1OMW B;  3VH0 A;  4BUJ C;  3PSL A;  4E5Z A;  3O4J A;  2IUV A;  3OKW A;  4GGA A;  5HQG A;  4CI2 A;  3VI3 B;  1VE7 A;  2VDK B;  2VDN B;  4QT8 A;  4K3I D;  3RFG A;  2H9N A;  4CI3 A;  3N0D A;  3BWS A;  4PBZ A;  3VI4 A;  1R5M A;  2PM6 B;  4PSW B;  3UVK A;  1U8C B;  1O6G A;  5CXB A;  4O1Q D;  1TYE A;  1JMX B;  5C2W B;  2AGL A;  2EID A;  4CY5 A;  2HU8 A;  4BP9 A;  4Z7O A;  2AGW A;  4YVD A;  1JV2 A;  2EIE A;  1VYH C;  5I5M A;  3JPX A;  1S4U X;  1GOT B;  3I7N A;  3I7K A;  2HKM A;  4H5I A;  4X61 B;  5SXM A;  5EMM B;  5CYK A;  1VZ2 A;  1E8N A;  5CXC B;  2P28 A;  4PC0 A;  1JOF A;  2QZP A;  3CIK B;  1N6D A;  2QR5 A;  3OKY A;  4KFM B;  5A2Q g;  4CZY A;  4WK4 B;  4A09 A;  2I0S A;  3SN6 B;  2VDO B;  2B4E A;  2G9A A;  3UR4 A;  3IIW A;  2IWK A;  2P9S C;  4U1E I;  5GXI A;  1OLZ A;  3GC3 B;  3VI3 A;  2VDK A;  3UVL A;  4X63 B;  1QNI A;  2VDN A;  3MMY A;  3KRX B;  3EI3 B;  2PM9 B;  4O3T B;  5K1C C;  5TF2 A;  4NEN A;  2YB8 B;  4G1M A;  5EAM A;  4G1E A;  2J57 G;  1K3I A;  2P9I C;  2BCJ B;  1SQ9 A;  4J8B A;  3MKS B;  3ZDY A;  4ESG A;  4ZN4 A;  3J81 g;  4CC9 A;  1U8C A;  4Z7Q A;  4QQE A;  5HE0 B;  4O02 A;  3IJE A;  3DXM C;  3MKQ A;  4O3U B;  3NIG B;  5M5U A;  3MXX A;  4A7J A;  1C9L A;  5HE3 B;  5C9Z B;  3EI4 B;  1NR0 A;  3K71 A;  2QC5 A;  1H2X A;  2IUP A;  3OKT A;  4N14 A;  3RMZ D;  3KRW B;  4CI8 A;  5HE1 B;  4X3E A;  4U7A A;  2XU7 A;  5HE2 B;  3ZDX B;  2Q7Q A;  5FFO A;  5KDO B;  1GOF A;  2VDL A;  2OVR B;  1PI6 A;  4O45 A;  4A11 B;  5CXC A;  1GOH A;  2VDM A;  4AX4 A;  1MG3 A;  3JZN A;  4X60 B;  4PBY A;  4UM9 A;  4HDJ A;  3PXT D;  4CZX A;  5FKQ A;  5HDB B;  2YNO A;  1SHY B;  1M1X A;  4LGN A;  3IJ0 A;  2VDO A;  1YR2 A;  3JZH A;  4WJK B;  3OW8 A;  4ZOY A;  3FM0 A;  4OZU A;  1H2Y A;  4XYH A;  3SFZ A;  2XYI A;  2HU7 A;  3CFS B;  1T2X A;  5H1M A;  4FA5 D;  4L3H D;  2EIB A;  2PM9 A;  3EI3 A;  2IAA A;  3C99 A;  4D0K A;  5FLX g;  5C2V B;  3FCU B;  5AMS A;  2O9K A;  2CN2 A;  2I3S A;  5E6U B;  2P9P C;  4G56 B;  3K26 A;  4PNK B;  4CI1 A;  5EM2 B;  4OWR A;  4DNU A;  2CO0 A;  5H17 A;  2H9P A;  2CE8 A;  1NEX B;  1P22 A;  1A12 A;  2HJB A;  3NIG A;  3EU7 A;  3K72 A;  3OF7 A;  3ZE2 B;  3EI4 A;  3PVW B;  1YFQ A;  3FCS A;  1A0R B;  2QXV A;  5E6S B;  1K32 A;  3I8C A;  3JAM g;  3F3G A;  3ZDX A;  4EWR A;  3O4I A;  3O4H A;  4FA9 D;  4MMX A;  5IGQ A;  1PGU A;  4A08 B;  4A11 A;  3L4O D;  4JHP C;  3E0C A;  5EAL A;  4JSP C;  4XEI C;  3EMH A;  4A0A B;  4CY2 A;  2UZX B;  4G55 A;  3BG1 A;  5HDB A;  3K6S A;  2HJ4 A;  2P26 A;  2IUQ A;  4J84 A;  3NVQ A;  4WJK A;  4JSN C;  4LG9 A;  1PBY B;  3SBP A;  4H5J A;  5EML B;  4A0B B;  5FKT A;  3SLE D;  1JTD B;  4O2W A;  3I7L A;  3PVU B;  2HES X;  3DWL C;  3U4Y A;  1GOG A;  3FCU A;  4BCD A;  3ZE1 B;  2OVQ B;  4Y7R A;  3C5M A;  5E6U A;  3QI0 A;  1UOP A;  4XYI A;  5M5T A;  3BG0 A;  3JZG A;  3UVO A;  4MMZ A;  5IT9 g;  1U4C A;  5EM2 A;  3V5W B;  4A2M A;  1O6F A;  3I7H A;  2VDQ B;  4BCC A;  3MZL A;  1GP2 B;  2EIC A;  4RE6 A;  3UKR C;  3OL2 B;  3ORV D;  1B9X A;  3UVM A;  3GD1 I;  3UKU C;  3ZE2 A;  5I5J A;  1XIP A;  3VA6 A;  1E5T A;  4TZ4 A;  3RSE C;  2H9M A;  2AGY A;  3MUO A;  4J0W A;  3SBR A;  3W15 A;  3A0F A;  3SVW D;  4DNV A;  3JRP A;  2YNN A;  1QFS A;  4A08 A;  3NVX A;  2PBI B;  4GM9 A;  2GC7 A;  2B5N A;  2AQ5 A;  4A0A A;  2CNX A;  1UOO A;  3IVM A;  1JJU B;  3NVN A;  4IMM A;  3V4P A;  4FWW A;  2G99 A;  4PXW A;  4A0B A;  2VDP B;  3DXK C;  2BKL A;  1RI6 A;  2VZ3 A;  4J8G A;  4MK0 B;  3ULE C;  4L3G D;  2BBK H;  4L9O A;  5C92 A;  3ZE1 A;  3IJ1 A;  3F3F A;  3AH8 B;  2JWG A;  4GM3 A;  4BL0 A;  4JXM A;  3I7P A;  1JMZ B;  5HYN B;  2B5L A;  4UM8 B;  3UVN A;  2VDQ A;  2XL3 A;  2YBA A;  4WK4 A;  3SWS D;  3OL2 A;  4JT5 C;  3PE7 A;  2H13 A;  4E54 B;  3KCI A;  4E5Z B;  3SBQ A;  1VE6 A;  3F3P A;  5FKS A;  2Z2P A;  1Q47 A;  3SMR A;  4PSX B;  1UOQ A;  3EI1 B;  1E8M A;  5I5I A;  1MDA H;  4J79 A;  1UTC A;  1XKS A;  2EBS A;  5M5V A;  3EQ8 A;  1N6F A;  3VGZ A;  3FGB A;  4GM8 A;  5FA5 B;  4D6V A;  2Z2N A;  4CY1 A;  3SHF A;  5TDH B;  4AEZ A;  3MZK A;  2MTA H;  5GXH A;  1L0Q A;  4DNW A;  1K8K C;  5CXB B;  3JB9 L;  3PXS D;  3P4F A;  1PEV A;  4FHL A;  4IRZ A;  1TYQ C;  2HKR A;  2VDP A;  5EMK B;  4AMZ A;  1H2W A;  3O4G A;  1VZ3 A;  4NSX A;  2OJY A;  2XZG A;  4NAA A;  3OTT A;  5TEF A;  2AH1 A;  2H6Q A;  2JKX A;  5E6R B;  3AFC A;  4ERQ A;  5B4W A;  4ES0 A;  3FRX A;  4UM8 A;  1L5G A;  2AGZ A;  3IUN A;  3T3P B;  3SJL D;  1SQJ A;  3EI2 B;  2P9K C;  4GQB B;  4JHN A;  3V9F A;  2HU5 A;  5C86 A;  2H47 A;  3V7D B;  5TEE A;  4E54 A;  3QHY B;  4ERZ A;  5H14 A;  4LG8 A;  3V4V A;  3AL9 A;  4WK2 B;  3RRM C;  3SCY A;  3EI1 A; 
#chains in the Genus database with same CATH homology
 2H6N A;  2GC4 A;  3ZE0 B;  1MG2 A;  3T3M B;  3JRO A;  4L1Q D;  4Y5R D;  5EAR A;  2CO0 C;  4ERY A;  4FAN D;  3IKO A;  5IJ7 E;  3ZDY B;  4ZOX A;  4Z7Q B;  4O9D A;  3ZWL B;  4GGD A;  4JD2 C;  2JWH A;  1B9Y A;  3K27 A;  4WK0 B;  2IUR A;  3I2N A;  3NIF B;  2B5M A;  4CZV A;  3DSM A;  3J80 g;  3ZDZ B;  5GSA A;  4AOW A;  3I8E A;  5AJA A;  1ERJ A;  1GXR A;  2OIZ A;  3L4M D;  3N0E A;  5GMK n;  4UM9 D;  2CN3 A;  4Z7N B;  2YNP A;  4GGC A;  4GMB A;  3B7F A;  3RLM D;  4FAV D;  2VDL B;  2YMU A;  3NID B;  2PM7 B;  3RN0 D;  3PSC B;  2VDM B;  4UM9 B;  4JSV C;  5AFU 3;  2P9L C;  2H14 A;  4J81 A;  2IWF A;  2W18 A;  2UZY B;  3CFV A;  3EI2 A;  1FWX A;  3I7O A;  1TBG A;  4A2L A;  4QRJ A;  5IJ8 E;  2I0R A;  2OK4 A;  2H6K A;  2Z2O A;  4K3J B;  4J86 A;  1N6E A;  1U2V C;  5K19 A;  4J0X A;  3RN1 D;  2HXC A;  4QL1 A;  2H3X A;  4FA1 D;  2AGX A;  5JWZ A;  4BH6 A;  3C9C A;  4I79 A;  2VC2 B;  2CE9 A;  3C75 H;  3AL8 B;  4Z8L A;  3GFC A;  3HFQ A;  5FQD A;  2P9U C;  4J78 A;  2VDR B;  2OVP B;  1SSL A;  3IJC A;  4GZ8 A;  3ODT A;  2I3T A;  3IIY A;  5EMJ B;  4FB1 D;  2H68 A;  2GNQ A;  3EWE A;  2TRC B;  3DM0 A;  2I0T A;  1GG2 B;  3GRE A;  3PXW D;  4J77 A;  4JT6 C;  2HYE A;  2XL2 A;  4GQ1 A;  3VI4 B;  3RFH A;  1XHM A;  1TYE B;  2AH0 A;  2J55 H;  4UI9 R;  5IGO A;  5THA A;  3EG6 A;  4Z7O B;  1YUK A;  4ZOV A;  2P9N C;  5FKR A;  4FA4 D;  5EAP A;  4J87 A;  4J82 A;  4J73 A;  5CYK B;  5FXY A;  4JSX C;  2H9L A;  4ZOZ A;  3AL8 A;  4IA9 A;  4R7A B;  3I89 A;  3OKY B;  2J56 H;  5IC7 A;  4CY3 A;  3SXT D;  2OK6 A;  4A09 B;  4GQ2 P;  1OMW B;  3VH0 A;  4BUJ C;  3PSL A;  4E5Z A;  2IUV A;  3OKW A;  4GGA A;  5HQG A;  4CI2 A;  3VI3 B;  2VDK B;  2VDN B;  4QT8 A;  4K3I D;  3RFG A;  2H9N A;  4CI3 A;  3N0D A;  3BWS A;  4PBZ A;  1R5M A;  2PM6 B;  4PSW B;  3UVK A;  1U8C B;  5CXB A;  4O1Q D;  1JMX B;  5C2W B;  2AGL A;  4CY5 A;  2AGW A;  4YVD A;  1VYH C;  5I5M A;  3JPX A;  1S4U X;  1GOT B;  3I7N A;  3I7K A;  2HKM A;  4H5I A;  4X61 B;  5SXM A;  5EMM B;  5CYK A;  5CXC B;  2P28 A;  4PC0 A;  1JOF A;  3CIK B;  3OKY A;  1N6D A;  4KFM B;  5A2Q g;  4CZY A;  4WK4 B;  4A09 A;  2I0S A;  3SN6 B;  2VDO B;  2B4E A;  2G9A A;  3UR4 A;  3IIW A;  2IWK A;  2P9S C;  4U1E I;  5GXI A;  1OLZ A;  3UVL A;  4X63 B;  1QNI A;  3MMY A;  3KRX B;  3EI3 B;  2PM9 B;  4O3T B;  5K1C C;  5TF2 A;  2YB8 B;  5EAM A;  2J57 G;  2P9I C;  2BCJ B;  1SQ9 A;  4J8B A;  3MKS B;  4ESG A;  4ZN4 A;  3J81 g;  4CC9 A;  4QQE A;  5HE0 B;  3DXM C;  3MKQ A;  4O3U B;  3NIG B;  3MXX A;  4A7J A;  5HE3 B;  5C9Z B;  3EI4 B;  1NR0 A;  2QC5 A;  2IUP A;  3OKT A;  4N14 A;  3RMZ D;  3KRW B;  4CI8 A;  5HE1 B;  4X3E A;  4U7A A;  2XU7 A;  5HE2 B;  3ZDX B;  2Q7Q A;  5KDO B;  2OVR B;  1PI6 A;  4O45 A;  4A11 B;  5CXC A;  1MG3 A;  3JZN A;  4X60 B;  4PBY A;  4HDJ A;  3PXT D;  4CZX A;  5FKQ A;  5HDB B;  2YNO A;  1SHY B;  4LGN A;  3IJ0 A;  3JZH A;  4WJK B;  3OW8 A;  4ZOY A;  3FM0 A;  4OZU A;  4XYH A;  3SFZ A;  2XYI A;  3CFS B;  5H1M A;  4FA5 D;  4L3H D;  3EI3 A;  2PM9 A;  4D0K A;  2IAA A;  3C99 A;  5FLX g;  3FCU B;  5C2V B;  5AMS A;  2O9K A;  2CN2 A;  2I3S A;  5E6U B;  2P9P C;  4G56 B;  3K26 A;  4PNK B;  4CI1 A;  5EM2 B;  4OWR A;  2CO0 A;  5H17 A;  2H9P A;  2CE8 A;  1NEX B;  1P22 A;  2HJB A;  3EU7 A;  3ZE2 B;  3EI4 A;  3PVW B;  1YFQ A;  1A0R B;  2QXV A;  5E6S B;  1K32 A;  3I8C A;  3JAM g;  3F3G A;  4EWR A;  4FA9 D;  5IGQ A;  1PGU A;  4A08 B;  4A11 A;  3L4O D;  3E0C A;  5EAL A;  4JSP C;  4XEI C;  3EMH A;  4A0A B;  4CY2 A;  2UZX B;  3BG1 A;  2HJ4 A;  2P26 A;  2IUQ A;  4J84 A;  3NVQ A;  4JSN C;  4LG9 A;  1PBY B;  3SBP A;  4H5J A;  5EML B;  4A0B B;  5FKT A;  3SLE D;  3I7L A;  3PVU B;  2HES X;  3DWL C;  3U4Y A;  3ZE1 B;  2OVQ B;  4Y7R A;  3C5M A;  4XYI A;  3BG0 A;  3JZG A;  3UVO A;  5IT9 g;  1U4C A;  5EM2 A;  3V5W B;  4A2M A;  3I7H A;  2VDQ B;  3MZL A;  1GP2 B;  3UKR C;  3OL2 B;  3ORV D;  1B9X A;  3UVM A;  3UKU C;  5I5J A;  1XIP A;  3VA6 A;  4TZ4 A;  3RSE C;  2H9M A;  2AGY A;  4J0W A;  3SBR A;  3W15 A;  3SVW D;  3A0F A;  3JRP A;  2YNN A;  4A08 A;  3NVX A;  2PBI B;  4GM9 A;  2GC7 A;  2B5N A;  2AQ5 A;  4A0A A;  2CNX A;  1JJU B;  3NVN A;  4IMM A;  4FWW A;  2G99 A;  4PXW A;  4A0B A;  2VDP B;  3DXK C;  4J8G A;  1RI6 A;  4MK0 B;  3ULE C;  4L3G D;  2BBK H;  4L9O A;  3IJ1 A;  3F3F A;  3AH8 B;  2JWG A;  4GM3 A;  4BL0 A;  4JXM A;  3I7P A;  1JMZ B;  5HYN B;  2B5L A;  4UM8 B;  3UVN A;  2XL3 A;  2YBA A;  3SWS D;  3OL2 A;  4JT5 C;  3PE7 A;  2H13 A;  4E54 B;  4E5Z B;  3SBQ A;  3F3P A;  5FKS A;  2Z2P A;  1Q47 A;  3SMR A;  4PSX B;  3EI1 B;  5I5I A;  1MDA H;  4J79 A;  1XKS A;  2EBS A;  1N6F A;  3VGZ A;  3FGB A;  4GM8 A;  5FA5 B;  4D6V A;  2Z2N A;  4CY1 A;  3SHF A;  5TDH B;  4AEZ A;  3MZK A;  2MTA H;  5GXH A;  1L0Q A;  1K8K C;  5CXB B;  3JB9 L;  3PXS D;  3P4F A;  1PEV A;  4FHL A;  1TYQ C;  2HKR A;  5EMK B;  4NSX A;  2OJY A;  3OTT A;  5TEF A;  2AH1 A;  2H6Q A;  5E6R B;  3AFC A;  4ERQ A;  5B4W A;  4ES0 A;  3FRX A;  2AGZ A;  3T3P B;  3SJL D;  1SQJ A;  3EI2 B;  2P9K C;  4GQB B;  3V9F A;  2H47 A;  3V7D B;  5TEE A;  4E54 A;  4ERZ A;  5H14 A;  4LG8 A;  4WK2 B;  3AL9 A;  3RRM C;  3SCY A;  3EI1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...