3OKWA

Mouse semaphorin 6a, extracellular domains 1-2
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
549
structure length
540
Chain Sequence
FPEDSEPISISHGNYTKQYPVFVGHKPGRTQRHRLDIQMIMIMNRTLYVAARDHIYTVDIDTSHTEEIYCSKKLTWKSRQADVDTCRMKGKHKDECHNFIKVLLKKNDDTLFVCGTNAFNPSCRNYRVDTLETFGDEFSGMARCPYDAKHANIALFADGKLYSATVTDFLAIDAVIYRSLGDSPTLRTVKHDSKWLKEPYFVQAVDYGDYIYFFFREIAVEYNGKVVFPRVAQVCKNDMGGSQRVLEKQWTSFLKARLNCSVPGDSHFYFNILQAVTDVIRINGRDVVLATFSTPYNSIPGSAVCAYDMLDIANVFTGRFKEQKSPDSTWTPVPDERVPKPRPGCCAGSSSLEKYATSNEFPDDTLNFIKTHPLMDEAVPSIINRPWFLRTMVRYRLTKIAVDNAAGPYQNHTVVFLGSEKGIILKFLARIGSLNGSLFLEEMNVYNPEKCSYDGVEDKRIMGMQLDRASGSLYVAFSTCVIKVPLGRCERHGKCKKTCIASRDPYCGWVRESGSCAHLSPRLTFEQDIERGNTDGLGDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of semaphorin-plexin signalling.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
molecule keywords Semaphorin-6A
total genus 124
structure length 540
sequence length 549
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01403 Sema Sema domain
A PF01437 PSI Plexin repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3okwA01
3.30.1680.10 Alpha Beta 2-Layer Sandwich ligand-binding face of the semaphorins, domain 2 ligand-binding face of the semaphorins, domain 2 3okwA02
2P28A 4CY2A 1ERJA 1GOTB 5IGOA 4JSNC 4KFMB 3NIDB 3RN0D 1QNIA 3EI2A 5EARA 1NEXB 2GC4A 4CZXA 4O1QD 4CI2A 2H6QA 3GFCA 3CFSB 2AGXA 3P4FA 5TEEA 3UR4A 3EI1B 3SBRA 3CIKB 5FLXg 4WK2B 3AL8A 2IAAA 2AGLA 4UM8B 5AFU3 2VDOB 3UKUC 4A11B 4JD2C 1JMXB 5KDOB 4JXMA 4X63B 5EALA 2VDNB 4A7JA 2HJBA 4FAND 3SHFA 4GMBA 2VC2B 3VGZA 4MK0B 4ESGA 5GSAA 5H1MA 4PBYA 1YFQA 3RSEC 4CI3A 1YUKA 3IIWA 4E54A 3PVUB 3UVOA 4E54B 3L4MD 3ZWLB 2H68A 1Q47A 4IA9A 4HDJA 4FB1D 2P26A 5IC7A 2CN3A 4GZ8A 3SMRA 4Z7OB 4ERZA 3K26A 1TBGA 4E5ZB 1PBYB 1N6DA 3EU7A 4J81A 3DM0A 4D0KA 3I8EA 5C9ZB 3PE7A 4ERYA 2IWFA 3C99A 2AH1A 4A11A 3DXKC 5FKQA 3EI2B 2HESX 4FA9D 2IUVA 1MG2A 1SQJA 4Z7QB 1B9YA 4FAVD 3NIGB 3SWSD 3JPXA 3PXWD 5H17A 2AQ5A 4L1QD 1JMZB 2OVQB 2QC5A 5CXCA 3VI3B 3T3PB 3UVKA 3V7DB 1OLZA 3SJLD 3JZGA 3JAMg 1FWXA 2VDMB 3T3MB 2XU7A 3OW8A 4H5JA 1MDAH 2XL2A 5K1CC 2VDRB 2IUPA 4A0AA 5AMSA 2CO0C 3L4OD 4J82A 2I3TA 5TEFA 2VDPB 1SSLA 2H9PA 4WK4B 4CI1A 3AH8B 4J0XA 3GREA 3RFGA 3VA6A 3IJ1A 5FKRA 4CI8A 4GM3A 5HE1B 4TZ4A 5E6SB 3NIFB 3SVWD 3EWEA 2VDLB 4PBZA 3ZDXB 3UKRC 1R5MA 2P9UC 4R7AB 4I79A 4L3HD 3MXXA 4L9OA 5GMKn 1JJUB 3RFHA 2B4EA 2G99A 3I8CA 4UM9D 2CE9A 4IMMA 5C2VB 3K27A 4FA4D 4QL1A 5EMJB 5A2Qg 4A08A 3ZE2B 4GQ1A 2G9AA 5C2WB 2I0SA 4JSPC 5EM2A 1TYEB 4J0WA 3NVNA 3OL2B 2OVRB 2H6KA 1L0QA 4A09B 2CN2A 2QXVA 4A2LA 3BWSA 3SBPA 3E0CA 2H3XA 4XYIA 2YNPA 4FA1D 5HE2B 5I5IA 1B9XA 2BBKH 5GXHA 5THAA 4ERQA 4CC9A 3JZNA 4JT6C 3NVXA 3I7KA 4XEIC 2BCJB 2P9NC 4GQBB 3ZE1B 3F3FA 1PI6A 2OVPB 5IT9g 3C75H 2J57G 3B7FA 3C9CA 3FCUB 2O9KA 4D6VA 2XL3A 3C5MA 4UM9B 2GNQA 3JRPA 3UVLA 3I89A 5IGQA 5EAPA 1PGUA 2OK4A 5HQGA 4BL0A 4CZVA 4GGAA 4ZOXA 4AOWA 1U2VC 3MKQA 3OTTA 5FA5B 3W15A 4O3UB 2Z2NA 2OIZA 4ES0A 1N6EA 4XYHA 2J55H 2OJYA 2TRCB 3RLMD 1K32A 2B5LA 3V5WB 4CY3A 4K3JB 1N6FA 3VI4B 3VH0A 5FKTA 3ZDYB 3AL9A 5H14A 3KRWB 2Z2PA 4X61B 1XHMA 4GM8A 3BG1A 5IJ7E 2HYEA 3ZE0B 3FRXA 4J78A 2AGYA 2PM6B 3HFQA 4L3GD 4LG8A 4JT5C 4PC0A 3SBQA 3AL8B 4EWRA 3EMHA 5I5JA 1NR0A 3IIYA 5HE0B 4AEZA 4CY5A 5GXIA 3EI1A 3ODTA 5FXYA 3I7PA 3ULEC 1PEVA 5HYNB 3BG0A 2H9MA 3EG6A 3AFCA 2VDKB 4O3TB 2IUQA 3IKOA 3UVMA 4Z8LA 5CYKA 4OWRA 3JZHA 4YVDA 4U7AA 2J56H 5FQDA 2HJ4A 5HE3B 4JSXC 3DSMA 2H9NA 2P9KC 3I7LA 4LG9A 4N14A 5EM2B 3EI4B 3EI3A 4J73A 3JB9L 3PSLA 2UZYB 3CFVA 4A0BA 4FWWA 1JOFA 5HDBB 1A0RB 2P9PC 1VYHC 1K8KC 4A09A 4WJKB 4J87A 5CXBB 5I5MA 2H13A 3ZDZB 1SQ9A 4QQEA 3IJCA 3V9FA 4PSWB 4WK0B 4H5IA 2AH0A 3I2NA 4Z7NB 3OKTA 1P22A 1XKSA 4J84A 3MMYA 3JROA 4PXWA 2H9LA 1MG3A 2P9IC 5TDHB 4PNKB 4A0AB 2XYIA 3I7HA 2I3SA 4FA5D 4J8BA 5FKSA 4K3ID 5JWZA 5CXBA 5B4WA 3RRMC 4O9DA 2CNXA 4GGCA 2B5NA 3EI3B 3A0FA 3EI4A 4FHLA 2GC7A 3MZLA 4U1EI 3FGBA 5EAMA 3OL2A 4ZOYA 5EMMB 4QT8A 4Y7RA 2H14A 5CYKB 4X3EA 2YMUA 3U4YA 5CXCB 4GQ2P 2PM9B 2YB8B 2YBAA 2YNNA 3N0DA 1U4CA 4A08B 5AJAA 5TF2A 3MKSB 5EMLB 3J80g 4X60B 4A0BB 2IURA 3J81g 2W18A 3F3GA 2H47A 2EBSA 3RMZD 3SN6B 2AGZA 4GM9A 2HXCA 5SXMA 2CO0A 2IWKA 5EMKB 3RN1D 1SHYB 3UVNA 2PM9A 4ZOVA 3N0EA 2B5MA 4LGNA 1GG2B 2OK6A 2HKRA 5E6RB 1TYQC 2P9SC 3PVWB 3OKYB 4JSVC 3SLED 1U8CB 2PBIB 4J86A 4NSXA 4OZUA 2PM7B 1GP2B 4O45A 5K19A 3ORVD 4PSXB 2I0TA 2CE8A 2Q7QA 4J79A 3DWLC 3KRXB 2H6NA 3FM0A 1RI6A 4J77A 4BUJC 3NVQA 1XIPA 3SXTD 3MZKA 3DXMC 2UZXB 3I7OA 2YNOA 2I0RA 3OKWA 3SCYA 4BH6A 4ZOZA 4CZYA 3IJ0A 4CY1A 2P9LC 4GGDA 2VDQB 4QRJA 3F3PA 4E5ZA 4Y5RD 5E6UB 1GXRA 5IJ8E 2MTAH 3PXSD 1S4UX 3PXTD 4ZN4A 4G56B 4UI9R 2HKMA 3PSCB 1OMWB 4J8GA 2AGWA 3OKYA 4A2MA 3I7NA 3SFZA 2Z2OA
chains in the Genus database with same CATH superfamily
2P28A 2HU8A 4CY2A 4RE6A 1ERJA 1GOTB 5IGOA 4WK4A 4JSNC 4KFMB 3NIDB 3RN0D 1QNIA 3EI2A 5EARA 4BP8A 3IUJA 1NEXB 2GC4A 4MMXA 4CZXA 4O1QD 4CI2A 2H6QA 3GFCA 3CFSB 2AGXA 3P4FA 5TEEA 3UR4A 3EI1B 3SBRA 3CIKB 5FLXg 4WK2B 1O6FA 3O4JA 3AL8A 2IAAA 2AGLA 4UM8B 5AFU3 2VDOB 1C9LA 3NIDA 5FFGA 3UKUC 4A11B 3NIGA 4JD2C 1JMXB 5KDOB 4JXMA 1QFMA 4X63B 2QZPA 5EALA 2VDNB 3MUOA 1UTCA 4A7JA 1TYEA 2HJBA 4FAND 3SHFA 4GMBA 2VC2B 3VGZA 4WK2A 4MK0B 4ESGA 4Z7OA 5GSAA 5H1MA 4PBYA 1YFQA 3RSEC 1T2XA 3V4VA 4CI3A 1YUKA 3IIWA 4WK0A 4E54A 3PVUB 4D9SA 3UVOA 4E54B 3L4MD 3ZWLB 2H68A 1Q47A 4IA9A 4HDJA 4FB1D 4O2WA 4G1MA 2P26A 3O4GA 2BKLA 5IC7A 2CN3A 4GZ8A 3SMRA 4Z7OB 4ERZA 2VDOA 3K26A 1TBGA 2VDPA 4E5ZB 5M5VA 1PBYB 1N6DA 3EU7A 4J81A 3DM0A 4D0KA 3I8EA 5C9ZB 3PE7A 3QHYB 4ERYA 2IWFA 1I2MB 3C99A 2AH1A 4A11A 3DXKC 5FKQA 3EI2B 2HESX 1H2XA 2EIBA 4FA9D 2IUVA 1MG2A 1SQJA 4Z7QB 1B9YA 1YR2A 4FAVD 3NIGB 3SWSD 3JPXA 3PXWD 5H17A 2AQ5A 4L1QD 1JMZB 2OVQB 4Z7QA 2QC5A 5CXCA 3VI3B 3T3PB 3UVKA 3V7DB 1OLZA 3SJLD 3JZGA 3JAMg 1FWXA 2VDMB 3T3MB 2XU7A 3OW8A 4H5JA 1MDAH 2XL2A 5K1CC 2VDRB 2IUPA 4O02A 4A0AA 5AMSA 4BCCA 3MUNA 2CO0C 3L4OD 4J82A 2I3TA 4NC4A 5TEFA 1O6GA 2VDPB 1SSLA 5M5UA 2H9PA 4WK4B 3KCIA 4CI1A 3AH8B 4J0XA 2JWHA 3GREA 2VDQA 3RFGA 3VA6A 3IJ1A 5M5TA 5FKRA 5M5RA 4WJKA 4CI8A 4GM3A 4Z7NA 5HE1B 3K72A 1VE6A 4TZ4A 5E6SB 2HU5A 4L1MA 3NIFB 3SVWD 3EWEA 2VDLB 4PBZA 1E8NA 3ZDXB 3UKRC 1R5MA 2EIDA 2P9UC 2VC2A 4R7AB 4I79A 5M5SA 4L3HD 3MXXA 1VE7A 3FCUA 4L9OA 5GMKn 1JJUB 3RFHA 2B4EA 2G99A 3I8CA 4UM9D 2CE9A 4IMMA 5C2VB 3K27A 4FA4D 4QL1A 1H2YA 3GC3B 3IJEA 5EMJB 5A2Qg 4A08A 2XE4A 3ZE2B 4GQ1A 2G9AA 5C2WB 2I0SA 4JSPC 5EM2A 1TYEB 4J0WA 3NVNA 3EQ7A 3EQ8A 3OL2B 2OVRB 3V4PA 1JV2A 2H6KA 5E6RA 1L0QA 4A09B 2CN2A 2QXVA 1GOFA 4A2LA 1A12A 3BWSA 3SBPA 4BP9A 3E0CA 2H3XA 4XYIA 2YNPA 4UM8A 4FA1D 5HE2B 5I5IA 1B9XA 2BBKH 3VI4A 5GXHA 5THAA 2JKXA 3IUQA 4ERQA 3FCSA 3JZNA 4CC9A 4JT6C 1C9IA 3NVXA 3I7KA 4GQBB 2BCJB 2P9NC 4XEIC 3ZE1B 3O4IA 3F3FA 1E5TA 2VZ1A 1PI6A 2OVPB 5IT9g 3C75H 3IUNA 2J57G 4DNUA 2VDKA 3OF7A 3B7FA 3C9CA 3FCUB 2O9KA 4D6VA 3ZE2A 2XL3A 3C5MA 1VZ2A 4UM9B 5M61A 3IULA 2GNQA 3JRPA 3UVLA 2WQ8A 3I89A 5IGQA 5EAPA 1PGUA 2OK4A 5HQGA 4BL0A 4MMZA 4CZVA 4GGAA 4ZOXA 4AOWA 1U2VC 3MKQA 3OTTA 5FA5B 3W15A 4O3UB 2EIEA 2Z2NA 2OIZA 4ES0A 1N6EA 4XYHA 2J55H 2OJYA 3ZDZA 3ZE0A 2TRCB 1BPOA 3RLMD 1K32A 2B5LA 3V5WB 4CY3A 4K3JB 1N6FA 3VI4B 3VH0A 5FKTA 3ZDYB 3AL9A 5H14A 3KRWB 2Z2PA 5C92A 4X61B 1XHMA 3O4HA 4GM8A 3BG1A 5IJ7E 2HYEA 3ZE0B 3FRXA 4BCDA 4J78A 2AGYA 2PM6B 3HFQA 1L5GA 4L3GD 4LG8A 4JT5C 4PC0A 3SBQA 3AL8B 4EWRA 3EMHA 5I5JA 3QI0A 1NR0A 3IIYA 4G1EA 5HE0B 4AEZA 4CY5A 5GXIA 1JTDB 3EI1A 3ODTA 5FXYA 3I7PA 3ULEC 1PEVA 5HYNB 3BG0A 1K3IA 5FFOA 2JWGA 2H9MA 1GOGA 3DDUA 3EG6A 3AFCA 4AX4A 4O3TB 2VDKB 2IUQA 3IKOA 2VZ3A 3UVMA 4Z8LA 4AMYA 5CYKA 4OWRA 3JZHA 4YVDA 4U7AA 2J56H 5FQDA 2HJ4A 5HE3B 4JSXC 3DSMA 3ZDXA 2H9NA 2P9KC 3I7LA 4LG9A 1GOHA 4N14A 5EM2B 3EI4B 3EI3A 4J73A 3JB9L 3PSLA 2UZYB 3CFVA 4A0BA 1VZ3A 4FWWA 1JOFA 5HDBB 1A0RB 2P9PC 1K8KC 1VYHC 4A09A 4WJKB 2EICA 4J87A 5CXBB 5I5MA 3IVMA 2H13A 3ZDZB 1SQ9A 4QQEA 3IJCA 3ZDYA 4UM9A 3MVDK 3V9FA 1QFSA 4PSWB 4WK0B 4AN0A 4H5IA 2AH0A 3I2NA 4Z7NB 3OKTA 1P22A 1XKSA 3MMYA 4J84A 4AMZA 3JROA 4PXWA 2H9LA 1MG3A 2P9IC 5TDHB 4PNKB 4RE5A 3GD1I 4A0AB 2XYIA 3I7HA 2I3SA 4FA5D 4J8BA 5FKSA 4MMYA 4K3ID 5JWZA 5CXBA 5B4WA 3RRMC 4DNVA 4O9DA 2CNXA 4GGCA 2B5NA 3EI3B 3A0FA 3EI4A 4FHLA 3ZE1A 2GC7A 3MZLA 4U1EI 1H2WA 3FGBA 5EAMA 5HDBA 3OL2A 4ZOYA 5EMMB 4QT8A 4Y7RA 2H14A 4AN1A 5CYKB 4X3EA 1UOPA 2YMUA 3U4YA 5CXCB 4GQ2P 3VI3A 2PM9B 2YB8B 2YBAA 2YNNA 3N0DA 5C86A 1U4CA 2XZGA 4G55A 4A08B 1M1XA 5AJAA 5TF2A 3MKSB 4NBMA 5EMLB 3J80g 4BCBA 2VDNA 4X60B 4A0BB 2QR5A 2IURA 3J81g 2W18A 3F3GA 2H47A 2EBSA 3RMZD 1UOQA 3SN6B 2AGZA 4GM9A 2HXCA 5SXMA 3K71A 2CO0A 2IWKA 5EMKB 3RN1D 1SHYB 3UVNA 2PM9A 4ZOVA 3K6SA 3N0EA 2B5MA 4LGNA 2HU7A 1GG2B 2OK6A 2HKRA 5E6RB 1TYQC 2P9SC 3PVWB 3OKYB 4JSVC 3SLED 1U8CB 2PBIB 4J86A 4NSXA 4OZUA 2PM7B 3T3PA 1GP2B 2XDWA 4O45A 4QAMA 5K19A 3ORVD 3NIFA 4PSXB 2I0TA 2CE8A 2Q7QA 5E6UA 4J79A 3DWLC 3KRXB 2H6NA 2VDLA 3FM0A 3IURA 1RI6A 1H2ZA 3EQ9A 4IRZA 4J77A 4BUJC 3NVQA 1UOOA 1XIPA 3SXTD 3MZKA 3DXMC 3IUMA 2UZXB 3I7OA 2YNOA 2I0RA 3OKWA 4JHPC 3SCYA 4BH6A 4ZOZA 4CZYA 3IJ0A 4CY1A 2P9LC 4GGDA 4DNWA 2VDQB 4QRJA 2VDMA 3T3MA 3F3PA 4E5ZA 4Y5RD 5E6UB 1GXRA 5IJ8E 2MTAH 3PXSD 1E8MA 1S4UX 4NAAA 2VDRA 5E6SA 3PXTD 4ZN4A 4G56B 4UI9R 2HKMA 3PSCB 1OMWB 4J8GA 4NENA 2AGWA 1U8CA 3OKYA 4A2MA 4JHNA 3I7NA 3SFZA 2Z2OA
chains in the Genus database with same CATH topology
2P28A 4CY2A 1ERJA 1GOTB 5IGOA 4JSNC 4KFMB 3NIDB 3RN0D 1QNIA 3EI2A 5EARA 1NEXB 2GC4A 4CZXA 4O1QD 4CI2A 2H6QA 3GFCA 3CFSB 2AGXA 3P4FA 5TEEA 3UR4A 3EI1B 3SBRA 3CIKB 5FLXg 4WK2B 3AL8A 2IAAA 2AGLA 4UM8B 5AFU3 2VDOB 3UKUC 4A11B 4JD2C 1JMXB 5KDOB 4JXMA 4X63B 5EALA 2VDNB 4A7JA 2HJBA 4FAND 3SHFA 4GMBA 2VC2B 3VGZA 4MK0B 4ESGA 5GSAA 5H1MA 4PBYA 1YFQA 3RSEC 4CI3A 1YUKA 3IIWA 4E54A 3PVUB 3UVOA 4E54B 3L4MD 3ZWLB 2H68A 1Q47A 4IA9A 4HDJA 4FB1D 2P26A 5IC7A 2CN3A 4GZ8A 3SMRA 4Z7OB 4ERZA 3K26A 1TBGA 4E5ZB 1PBYB 1N6DA 3EU7A 4J81A 3DM0A 4D0KA 3I8EA 5C9ZB 3PE7A 4ERYA 2IWFA 3C99A 2AH1A 4A11A 3DXKC 5FKQA 3EI2B 2HESX 4FA9D 2IUVA 1MG2A 1SQJA 4Z7QB 1B9YA 4FAVD 3NIGB 3SWSD 3JPXA 3PXWD 5H17A 2AQ5A 4L1QD 1JMZB 2OVQB 2QC5A 5CXCA 3VI3B 3T3PB 3UVKA 3V7DB 1OLZA 3SJLD 3JZGA 3JAMg 1FWXA 2VDMB 3T3MB 2XU7A 3OW8A 4H5JA 1MDAH 2XL2A 5K1CC 2VDRB 2IUPA 4A0AA 5AMSA 2CO0C 3L4OD 4J82A 2I3TA 5TEFA 2VDPB 1SSLA 2H9PA 4WK4B 4CI1A 3AH8B 4J0XA 2JWHA 3GREA 3RFGA 3VA6A 3IJ1A 5FKRA 4CI8A 4GM3A 5HE1B 4TZ4A 5E6SB 3NIFB 3SVWD 3EWEA 2VDLB 4PBZA 3ZDXB 3UKRC 1R5MA 2P9UC 4R7AB 4I79A 4L3HD 3MXXA 4L9OA 5GMKn 1JJUB 3RFHA 2B4EA 2G99A 3I8CA 4UM9D 2CE9A 4IMMA 5C2VB 3K27A 4FA4D 4QL1A 5EMJB 5A2Qg 4A08A 3ZE2B 4GQ1A 2G9AA 5C2WB 2I0SA 4JSPC 5EM2A 1TYEB 4J0WA 3NVNA 3OL2B 2OVRB 2H6KA 1L0QA 4A09B 2CN2A 2QXVA 4A2LA 3BWSA 3SBPA 3E0CA 2H3XA 4XYIA 2YNPA 4FA1D 5HE2B 5I5IA 1B9XA 2BBKH 5GXHA 5THAA 4ERQA 4CC9A 3JZNA 4JT6C 3NVXA 3I7KA 4XEIC 2BCJB 2P9NC 4GQBB 3ZE1B 3F3FA 1PI6A 2OVPB 5IT9g 3C75H 2J57G 3B7FA 3C9CA 3FCUB 2O9KA 4D6VA 2XL3A 3C5MA 4UM9B 2GNQA 3JRPA 3UVLA 3I89A 5IGQA 5EAPA 1PGUA 2OK4A 5HQGA 4BL0A 4CZVA 4GGAA 4ZOXA 4AOWA 1U2VC 3MKQA 3OTTA 5FA5B 3W15A 4O3UB 2Z2NA 2OIZA 4ES0A 1N6EA 4XYHA 2J55H 2OJYA 2TRCB 3RLMD 1K32A 2B5LA 3V5WB 4CY3A 4K3JB 1N6FA 3VI4B 3VH0A 5FKTA 3ZDYB 3AL9A 5H14A 3KRWB 2Z2PA 4X61B 1XHMA 4GM8A 3BG1A 5IJ7E 2HYEA 3ZE0B 3FRXA 4J78A 2AGYA 2PM6B 3HFQA 4L3GD 4LG8A 4JT5C 4PC0A 3SBQA 3AL8B 4EWRA 3EMHA 5I5JA 1NR0A 3IIYA 5HE0B 4AEZA 4CY5A 5GXIA 3EI1A 3ODTA 5FXYA 3I7PA 3ULEC 1PEVA 5HYNB 3BG0A 2JWGA 2H9MA 3EG6A 3AFCA 2VDKB 4O3TB 2IUQA 3IKOA 3UVMA 4Z8LA 5CYKA 4OWRA 3JZHA 4YVDA 4U7AA 2J56H 5FQDA 2HJ4A 5HE3B 4JSXC 3DSMA 2H9NA 2P9KC 3I7LA 4LG9A 4N14A 5EM2B 3EI4B 3EI3A 4J73A 3JB9L 3PSLA 2UZYB 3CFVA 4A0BA 4FWWA 1JOFA 5HDBB 1A0RB 2P9PC 1VYHC 1K8KC 4A09A 4WJKB 4J87A 5CXBB 5I5MA 2H13A 3ZDZB 1SQ9A 4QQEA 3IJCA 3V9FA 4PSWB 4WK0B 4H5IA 2AH0A 3I2NA 4Z7NB 3OKTA 1P22A 1XKSA 4J84A 3MMYA 3JROA 4PXWA 2H9LA 1MG3A 2P9IC 5TDHB 4PNKB 4A0AB 2XYIA 3I7HA 2I3SA 4FA5D 4J8BA 5FKSA 4K3ID 5JWZA 5CXBA 5B4WA 3RRMC 4O9DA 2CNXA 4GGCA 2B5NA 3EI3B 3A0FA 3EI4A 4FHLA 2GC7A 3MZLA 4U1EI 3FGBA 5EAMA 3OL2A 4ZOYA 5EMMB 4QT8A 4Y7RA 2H14A 5CYKB 4X3EA 2YMUA 3U4YA 5CXCB 4GQ2P 2PM9B 2YB8B 2YBAA 2YNNA 3N0DA 1U4CA 4A08B 5AJAA 5TF2A 3MKSB 5EMLB 3J80g 4X60B 4A0BB 2IURA 3J81g 2W18A 3F3GA 2H47A 2EBSA 3RMZD 3SN6B 2AGZA 4GM9A 2HXCA 5SXMA 2CO0A 2IWKA 5EMKB 3RN1D 1SHYB 3UVNA 2PM9A 4ZOVA 3N0EA 2B5MA 4LGNA 1GG2B 2OK6A 2HKRA 5E6RB 1TYQC 2P9SC 3PVWB 3OKYB 4JSVC 3SLED 1U8CB 2PBIB 4J86A 4NSXA 4OZUA 2PM7B 1GP2B 4O45A 5K19A 3ORVD 4PSXB 2I0TA 2CE8A 2Q7QA 4J79A 3DWLC 3KRXB 2H6NA 3FM0A 1RI6A 4J77A 4BUJC 3NVQA 1XIPA 3SXTD 3MZKA 3DXMC 2UZXB 3I7OA 2YNOA 2I0RA 3OKWA 3SCYA 4BH6A 4ZOZA 4CZYA 3IJ0A 4CY1A 2P9LC 4GGDA 2VDQB 4QRJA 3F3PA 4E5ZA 4Y5RD 5E6UB 1GXRA 5IJ8E 2MTAH 3PXSD 1S4UX 3PXTD 4ZN4A 4G56B 4UI9R 2HKMA 3PSCB 1OMWB 4J8GA 2AGWA 3OKYA 4A2MA 3I7NA 3SFZA 2Z2OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P28 A;  4CY2 A;  1ERJ A;  1GOT B;  5IGO A;  4JSN C;  4KFM B;  3NID B;  3RN0 D;  1QNI A;  3EI2 A;  5EAR A;  1NEX B;  2GC4 A;  4CZX A;  4O1Q D;  4CI2 A;  2H6Q A;  3GFC A;  3CFS B;  2AGX A;  3P4F A;  5TEE A;  3UR4 A;  3EI1 B;  3SBR A;  3CIK B;  5FLX g;  4WK2 B;  3AL8 A;  2IAA A;  2AGL A;  4UM8 B;  5AFU 3;  2VDO B;  3UKU C;  4A11 B;  4JD2 C;  1JMX B;  5KDO B;  4JXM A;  4X63 B;  5EAL A;  2VDN B;  4A7J A;  2HJB A;  4FAN D;  3SHF A;  4GMB A;  2VC2 B;  3VGZ A;  4MK0 B;  4ESG A;  5GSA A;  5H1M A;  4PBY A;  1YFQ A;  3RSE C;  4CI3 A;  1YUK A;  3IIW A;  4E54 A;  3PVU B;  3UVO A;  4E54 B;  3L4M D;  3ZWL B;  2H68 A;  1Q47 A;  4IA9 A;  4HDJ A;  4FB1 D;  2P26 A;  5IC7 A;  2CN3 A;  4GZ8 A;  3SMR A;  4Z7O B;  4ERZ A;  3K26 A;  1TBG A;  4E5Z B;  1PBY B;  1N6D A;  3EU7 A;  4J81 A;  3DM0 A;  4D0K A;  3I8E A;  5C9Z B;  3PE7 A;  4ERY A;  2IWF A;  3C99 A;  2AH1 A;  4A11 A;  3DXK C;  5FKQ A;  3EI2 B;  2HES X;  4FA9 D;  2IUV A;  1MG2 A;  1SQJ A;  4Z7Q B;  1B9Y A;  4FAV D;  3NIG B;  3SWS D;  3JPX A;  3PXW D;  5H17 A;  2AQ5 A;  4L1Q D;  1JMZ B;  2OVQ B;  2QC5 A;  5CXC A;  3VI3 B;  3T3P B;  3UVK A;  3V7D B;  1OLZ A;  3SJL D;  3JZG A;  3JAM g;  1FWX A;  2VDM B;  3T3M B;  2XU7 A;  3OW8 A;  4H5J A;  1MDA H;  2XL2 A;  5K1C C;  2VDR B;  2IUP A;  4A0A A;  5AMS A;  2CO0 C;  3L4O D;  4J82 A;  2I3T A;  5TEF A;  2VDP B;  1SSL A;  2H9P A;  4WK4 B;  4CI1 A;  3AH8 B;  4J0X A;  3GRE A;  3RFG A;  3VA6 A;  3IJ1 A;  5FKR A;  4CI8 A;  4GM3 A;  5HE1 B;  4TZ4 A;  5E6S B;  3NIF B;  3SVW D;  3EWE A;  2VDL B;  4PBZ A;  3ZDX B;  3UKR C;  1R5M A;  2P9U C;  4R7A B;  4I79 A;  4L3H D;  3MXX A;  4L9O A;  5GMK n;  1JJU B;  3RFH A;  2B4E A;  2G99 A;  3I8C A;  4UM9 D;  2CE9 A;  4IMM A;  5C2V B;  3K27 A;  4FA4 D;  4QL1 A;  5EMJ B;  5A2Q g;  4A08 A;  3ZE2 B;  4GQ1 A;  2G9A A;  5C2W B;  2I0S A;  4JSP C;  5EM2 A;  1TYE B;  4J0W A;  3NVN A;  3OL2 B;  2OVR B;  2H6K A;  1L0Q A;  4A09 B;  2CN2 A;  2QXV A;  4A2L A;  3BWS A;  3SBP A;  3E0C A;  2H3X A;  4XYI A;  2YNP A;  4FA1 D;  5HE2 B;  5I5I A;  1B9X A;  2BBK H;  5GXH A;  5THA A;  4ERQ A;  4CC9 A;  3JZN A;  4JT6 C;  3NVX A;  3I7K A;  4XEI C;  2BCJ B;  2P9N C;  4GQB B;  3ZE1 B;  3F3F A;  1PI6 A;  2OVP B;  5IT9 g;  3C75 H;  2J57 G;  3B7F A;  3C9C A;  3FCU B;  2O9K A;  4D6V A;  2XL3 A;  3C5M A;  4UM9 B;  2GNQ A;  3JRP A;  3UVL A;  3I89 A;  5IGQ A;  5EAP A;  1PGU A;  2OK4 A;  5HQG A;  4BL0 A;  4CZV A;  4GGA A;  4ZOX A;  4AOW A;  1U2V C;  3MKQ A;  3OTT A;  5FA5 B;  3W15 A;  4O3U B;  2Z2N A;  2OIZ A;  4ES0 A;  1N6E A;  4XYH A;  2J55 H;  2OJY A;  2TRC B;  3RLM D;  1K32 A;  2B5L A;  3V5W B;  4CY3 A;  4K3J B;  1N6F A;  3VI4 B;  3VH0 A;  5FKT A;  3ZDY B;  3AL9 A;  5H14 A;  3KRW B;  2Z2P A;  4X61 B;  1XHM A;  4GM8 A;  3BG1 A;  5IJ7 E;  2HYE A;  3ZE0 B;  3FRX A;  4J78 A;  2AGY A;  2PM6 B;  3HFQ A;  4L3G D;  4LG8 A;  4JT5 C;  4PC0 A;  3SBQ A;  3AL8 B;  4EWR A;  3EMH A;  5I5J A;  1NR0 A;  3IIY A;  5HE0 B;  4AEZ A;  4CY5 A;  5GXI A;  3EI1 A;  3ODT A;  5FXY A;  3I7P A;  3ULE C;  1PEV A;  5HYN B;  3BG0 A;  2H9M A;  3EG6 A;  3AFC A;  2VDK B;  4O3T B;  2IUQ A;  3IKO A;  3UVM A;  4Z8L A;  5CYK A;  4OWR A;  3JZH A;  4YVD A;  4U7A A;  2J56 H;  5FQD A;  2HJ4 A;  5HE3 B;  4JSX C;  3DSM A;  2H9N A;  2P9K C;  3I7L A;  4LG9 A;  4N14 A;  5EM2 B;  3EI4 B;  3EI3 A;  4J73 A;  3JB9 L;  3PSL A;  2UZY B;  3CFV A;  4A0B A;  4FWW A;  1JOF A;  5HDB B;  1A0R B;  2P9P C;  1VYH C;  1K8K C;  4A09 A;  4WJK B;  4J87 A;  5CXB B;  5I5M A;  2H13 A;  3ZDZ B;  1SQ9 A;  4QQE A;  3IJC A;  3V9F A;  4PSW B;  4WK0 B;  4H5I A;  2AH0 A;  3I2N A;  4Z7N B;  3OKT A;  1P22 A;  1XKS A;  4J84 A;  3MMY A;  3JRO A;  4PXW A;  2H9L A;  1MG3 A;  2P9I C;  5TDH B;  4PNK B;  4A0A B;  2XYI A;  3I7H A;  2I3S A;  4FA5 D;  4J8B A;  5FKS A;  4K3I D;  5JWZ A;  5CXB A;  5B4W A;  3RRM C;  4O9D A;  2CNX A;  4GGC A;  2B5N A;  3EI3 B;  3A0F A;  3EI4 A;  4FHL A;  2GC7 A;  3MZL A;  4U1E I;  3FGB A;  5EAM A;  3OL2 A;  4ZOY A;  5EMM B;  4QT8 A;  4Y7R A;  2H14 A;  5CYK B;  4X3E A;  2YMU A;  3U4Y A;  5CXC B;  4GQ2 P;  2PM9 B;  2YB8 B;  2YBA A;  2YNN A;  3N0D A;  1U4C A;  4A08 B;  5AJA A;  5TF2 A;  3MKS B;  5EML B;  3J80 g;  4X60 B;  4A0B B;  2IUR A;  3J81 g;  2W18 A;  3F3G A;  2H47 A;  2EBS A;  3RMZ D;  3SN6 B;  2AGZ A;  4GM9 A;  2HXC A;  5SXM A;  2CO0 A;  2IWK A;  5EMK B;  3RN1 D;  1SHY B;  3UVN A;  2PM9 A;  4ZOV A;  3N0E A;  2B5M A;  4LGN A;  1GG2 B;  2OK6 A;  2HKR A;  5E6R B;  1TYQ C;  2P9S C;  3PVW B;  3OKY B;  4JSV C;  3SLE D;  1U8C B;  2PBI B;  4J86 A;  4NSX A;  4OZU A;  2PM7 B;  1GP2 B;  4O45 A;  5K19 A;  3ORV D;  4PSX B;  2I0T A;  2CE8 A;  2Q7Q A;  4J79 A;  3DWL C;  3KRX B;  2H6N A;  3FM0 A;  1RI6 A;  4J77 A;  4BUJ C;  3NVQ A;  1XIP A;  3SXT D;  3MZK A;  3DXM C;  2UZX B;  3I7O A;  2YNO A;  2I0R A;  3OKW A;  3SCY A;  4BH6 A;  4ZOZ A;  4CZY A;  3IJ0 A;  4CY1 A;  2P9L C;  4GGD A;  2VDQ B;  4QRJ A;  3F3P A;  4E5Z A;  4Y5R D;  5E6U B;  1GXR A;  5IJ8 E;  2MTA H;  3PXS D;  1S4U X;  3PXT D;  4ZN4 A;  4G56 B;  4UI9 R;  2HKM A;  3PSC B;  1OMW B;  4J8G A;  2AGW A;  3OKY A;  4A2M A;  3I7N A;  3SFZ A;  2Z2O A; 
#chains in the Genus database with same CATH topology
 2P28 A;  2HU8 A;  4CY2 A;  4RE6 A;  1ERJ A;  1GOT B;  5IGO A;  4WK4 A;  4JSN C;  4KFM B;  3NID B;  3RN0 D;  1QNI A;  3EI2 A;  5EAR A;  4BP8 A;  3IUJ A;  1NEX B;  2GC4 A;  4MMX A;  4CZX A;  4O1Q D;  4CI2 A;  2H6Q A;  3GFC A;  3CFS B;  2AGX A;  3P4F A;  5TEE A;  3UR4 A;  3EI1 B;  3SBR A;  3CIK B;  5FLX g;  4WK2 B;  1O6F A;  3O4J A;  3AL8 A;  2IAA A;  2AGL A;  4UM8 B;  5AFU 3;  2VDO B;  1C9L A;  3NID A;  5FFG A;  3UKU C;  4A11 B;  3NIG A;  4JD2 C;  1JMX B;  5KDO B;  4JXM A;  1QFM A;  4X63 B;  2QZP A;  5EAL A;  2VDN B;  3MUO A;  1UTC A;  4A7J A;  1TYE A;  2HJB A;  4FAN D;  3SHF A;  4GMB A;  2VC2 B;  3VGZ A;  4WK2 A;  4MK0 B;  4ESG A;  4Z7O A;  5GSA A;  5H1M A;  4PBY A;  1YFQ A;  3RSE C;  1T2X A;  3V4V A;  4CI3 A;  1YUK A;  3IIW A;  4WK0 A;  4E54 A;  3PVU B;  4D9S A;  3UVO A;  4E54 B;  3L4M D;  3ZWL B;  2H68 A;  1Q47 A;  4IA9 A;  4HDJ A;  4FB1 D;  4O2W A;  4G1M A;  2P26 A;  3O4G A;  2BKL A;  5IC7 A;  2CN3 A;  4GZ8 A;  3SMR A;  4Z7O B;  4ERZ A;  2VDO A;  3K26 A;  1TBG A;  2VDP A;  4E5Z B;  5M5V A;  1PBY B;  1N6D A;  3EU7 A;  4J81 A;  3DM0 A;  4D0K A;  3I8E A;  5C9Z B;  3PE7 A;  3QHY B;  4ERY A;  2IWF A;  1I2M B;  3C99 A;  2AH1 A;  4A11 A;  3DXK C;  5FKQ A;  3EI2 B;  2HES X;  1H2X A;  2EIB A;  4FA9 D;  2IUV A;  1MG2 A;  1SQJ A;  4Z7Q B;  1B9Y A;  1YR2 A;  4FAV D;  3NIG B;  3SWS D;  3JPX A;  3PXW D;  5H17 A;  2AQ5 A;  4L1Q D;  1JMZ B;  2OVQ B;  4Z7Q A;  2QC5 A;  5CXC A;  3VI3 B;  3T3P B;  3UVK A;  3V7D B;  1OLZ A;  3SJL D;  3JZG A;  3JAM g;  1FWX A;  2VDM B;  3T3M B;  2XU7 A;  3OW8 A;  4H5J A;  1MDA H;  2XL2 A;  5K1C C;  2VDR B;  2IUP A;  4O02 A;  4A0A A;  5AMS A;  4BCC A;  3MUN A;  2CO0 C;  3L4O D;  4J82 A;  2I3T A;  4NC4 A;  5TEF A;  1O6G A;  2VDP B;  1SSL A;  5M5U A;  2H9P A;  4WK4 B;  3KCI A;  4CI1 A;  3AH8 B;  4J0X A;  2JWH A;  3GRE A;  2VDQ A;  3RFG A;  3VA6 A;  3IJ1 A;  5M5T A;  5FKR A;  5M5R A;  4WJK A;  4CI8 A;  4GM3 A;  4Z7N A;  5HE1 B;  3K72 A;  1VE6 A;  4TZ4 A;  5E6S B;  2HU5 A;  4L1M A;  3NIF B;  3SVW D;  3EWE A;  2VDL B;  4PBZ A;  1E8N A;  3ZDX B;  3UKR C;  1R5M A;  2EID A;  2P9U C;  2VC2 A;  4R7A B;  4I79 A;  5M5S A;  4L3H D;  3MXX A;  1VE7 A;  3FCU A;  4L9O A;  5GMK n;  1JJU B;  3RFH A;  2B4E A;  2G99 A;  3I8C A;  4UM9 D;  2CE9 A;  4IMM A;  5C2V B;  3K27 A;  4FA4 D;  4QL1 A;  1H2Y A;  3GC3 B;  3IJE A;  5EMJ B;  5A2Q g;  4A08 A;  2XE4 A;  3ZE2 B;  4GQ1 A;  2G9A A;  5C2W B;  2I0S A;  4JSP C;  5EM2 A;  1TYE B;  4J0W A;  3NVN A;  3EQ7 A;  3EQ8 A;  3OL2 B;  2OVR B;  3V4P A;  1JV2 A;  2H6K A;  5E6R A;  1L0Q A;  4A09 B;  2CN2 A;  2QXV A;  1GOF A;  4A2L A;  1A12 A;  3BWS A;  3SBP A;  4BP9 A;  3E0C A;  2H3X A;  4XYI A;  2YNP A;  4UM8 A;  4FA1 D;  5HE2 B;  5I5I A;  1B9X A;  2BBK H;  3VI4 A;  5GXH A;  5THA A;  2JKX A;  3IUQ A;  4ERQ A;  3FCS A;  3JZN A;  4CC9 A;  4JT6 C;  1C9I A;  3NVX A;  3I7K A;  4GQB B;  2BCJ B;  2P9N C;  4XEI C;  3ZE1 B;  3O4I A;  3F3F A;  1E5T A;  2VZ1 A;  1PI6 A;  2OVP B;  5IT9 g;  3C75 H;  3IUN A;  2J57 G;  4DNU A;  2VDK A;  3OF7 A;  3B7F A;  3C9C A;  3FCU B;  2O9K A;  4D6V A;  3ZE2 A;  2XL3 A;  3C5M A;  1VZ2 A;  4UM9 B;  5M61 A;  3IUL A;  2GNQ A;  3JRP A;  3UVL A;  2WQ8 A;  3I89 A;  5IGQ A;  5EAP A;  1PGU A;  2OK4 A;  5HQG A;  4BL0 A;  4MMZ A;  4CZV A;  4GGA A;  4ZOX A;  4AOW A;  1U2V C;  3MKQ A;  3OTT A;  5FA5 B;  3W15 A;  4O3U B;  2EIE A;  2Z2N A;  2OIZ A;  4ES0 A;  1N6E A;  4XYH A;  2J55 H;  2OJY A;  3ZDZ A;  3ZE0 A;  2TRC B;  1BPO A;  3RLM D;  1K32 A;  2B5L A;  3V5W B;  4CY3 A;  4K3J B;  1N6F A;  3VI4 B;  3VH0 A;  5FKT A;  3ZDY B;  3AL9 A;  5H14 A;  3KRW B;  2Z2P A;  5C92 A;  4X61 B;  1XHM A;  3O4H A;  4GM8 A;  3BG1 A;  5IJ7 E;  2HYE A;  3ZE0 B;  3FRX A;  4BCD A;  4J78 A;  2AGY A;  2PM6 B;  3HFQ A;  1L5G A;  4L3G D;  4LG8 A;  4JT5 C;  4PC0 A;  3SBQ A;  3AL8 B;  4EWR A;  3EMH A;  5I5J A;  3QI0 A;  1NR0 A;  3IIY A;  4G1E A;  5HE0 B;  4AEZ A;  4CY5 A;  5GXI A;  1JTD B;  3EI1 A;  3ODT A;  5FXY A;  3I7P A;  3ULE C;  1PEV A;  5HYN B;  3BG0 A;  1K3I A;  5FFO A;  2JWG A;  2H9M A;  1GOG A;  3DDU A;  3EG6 A;  3AFC A;  4AX4 A;  4O3T B;  2VDK B;  2IUQ A;  3IKO A;  2VZ3 A;  3UVM A;  4Z8L A;  4AMY A;  5CYK A;  4OWR A;  3JZH A;  4YVD A;  4U7A A;  2J56 H;  5FQD A;  2HJ4 A;  5HE3 B;  4JSX C;  3DSM A;  3ZDX A;  2H9N A;  2P9K C;  3I7L A;  4LG9 A;  1GOH A;  4N14 A;  5EM2 B;  3EI4 B;  3EI3 A;  4J73 A;  3JB9 L;  3PSL A;  2UZY B;  3CFV A;  4A0B A;  1VZ3 A;  4FWW A;  1JOF A;  5HDB B;  1A0R B;  2P9P C;  1K8K C;  1VYH C;  4A09 A;  4WJK B;  2EIC A;  4J87 A;  5CXB B;  5I5M A;  3IVM A;  2H13 A;  3ZDZ B;  1SQ9 A;  4QQE A;  3IJC A;  3ZDY A;  4UM9 A;  3MVD K;  3V9F A;  1QFS A;  4PSW B;  4WK0 B;  4AN0 A;  4H5I A;  2AH0 A;  3I2N A;  4Z7N B;  3OKT A;  1P22 A;  1XKS A;  3MMY A;  4J84 A;  4AMZ A;  3JRO A;  4PXW A;  2H9L A;  1MG3 A;  2P9I C;  5TDH B;  4PNK B;  4RE5 A;  3GD1 I;  4A0A B;  2XYI A;  3I7H A;  2I3S A;  4FA5 D;  4J8B A;  5FKS A;  4MMY A;  4K3I D;  5JWZ A;  5CXB A;  5B4W A;  3RRM C;  4DNV A;  4O9D A;  2CNX A;  4GGC A;  2B5N A;  3EI3 B;  3A0F A;  3EI4 A;  4FHL A;  3ZE1 A;  2GC7 A;  3MZL A;  4U1E I;  1H2W A;  3FGB A;  5EAM A;  5HDB A;  3OL2 A;  4ZOY A;  5EMM B;  4QT8 A;  4Y7R A;  2H14 A;  4AN1 A;  5CYK B;  4X3E A;  1UOP A;  2YMU A;  3U4Y A;  5CXC B;  4GQ2 P;  3VI3 A;  2PM9 B;  2YB8 B;  2YBA A;  2YNN A;  3N0D A;  5C86 A;  1U4C A;  2XZG A;  4G55 A;  4A08 B;  1M1X A;  5AJA A;  5TF2 A;  3MKS B;  4NBM A;  5EML B;  3J80 g;  4BCB A;  2VDN A;  4X60 B;  4A0B B;  2QR5 A;  2IUR A;  3J81 g;  2W18 A;  3F3G A;  2H47 A;  2EBS A;  3RMZ D;  1UOQ A;  3SN6 B;  2AGZ A;  4GM9 A;  2HXC A;  5SXM A;  3K71 A;  2CO0 A;  2IWK A;  5EMK B;  3RN1 D;  1SHY B;  3UVN A;  2PM9 A;  4ZOV A;  3K6S A;  3N0E A;  2B5M A;  4LGN A;  2HU7 A;  1GG2 B;  2OK6 A;  2HKR A;  5E6R B;  1TYQ C;  2P9S C;  3PVW B;  3OKY B;  4JSV C;  3SLE D;  1U8C B;  2PBI B;  4J86 A;  4NSX A;  4OZU A;  2PM7 B;  3T3P A;  1GP2 B;  2XDW A;  4O45 A;  4QAM A;  5K19 A;  3ORV D;  3NIF A;  4PSX B;  2I0T A;  2CE8 A;  2Q7Q A;  5E6U A;  4J79 A;  3DWL C;  3KRX B;  2H6N A;  2VDL A;  3FM0 A;  3IUR A;  1RI6 A;  1H2Z A;  3EQ9 A;  4IRZ A;  4J77 A;  4BUJ C;  3NVQ A;  1UOO A;  1XIP A;  3SXT D;  3MZK A;  3DXM C;  3IUM A;  2UZX B;  3I7O A;  2YNO A;  2I0R A;  3OKW A;  4JHP C;  3SCY A;  4BH6 A;  4ZOZ A;  4CZY A;  3IJ0 A;  4CY1 A;  2P9L C;  4GGD A;  4DNW A;  2VDQ B;  4QRJ A;  2VDM A;  3T3M A;  3F3P A;  4E5Z A;  4Y5R D;  5E6U B;  1GXR A;  5IJ8 E;  2MTA H;  3PXS D;  1E8M A;  1S4U X;  4NAA A;  2VDR A;  5E6S A;  3PXT D;  4ZN4 A;  4G56 B;  4UI9 R;  2HKM A;  3PSC B;  1OMW B;  4J8G A;  4NEN A;  2AGW A;  1U8C A;  3OKY A;  4A2M A;  4JHN A;  3I7N A;  3SFZ A;  2Z2O A; 
#chains in the Genus database with same CATH homology
 2P28 A;  4CY2 A;  1ERJ A;  1GOT B;  5IGO A;  4JSN C;  4KFM B;  3NID B;  3RN0 D;  1QNI A;  3EI2 A;  5EAR A;  1NEX B;  2GC4 A;  4CZX A;  4O1Q D;  4CI2 A;  2H6Q A;  3GFC A;  3CFS B;  2AGX A;  3P4F A;  5TEE A;  3UR4 A;  3EI1 B;  3SBR A;  3CIK B;  5FLX g;  4WK2 B;  3AL8 A;  2IAA A;  2AGL A;  4UM8 B;  5AFU 3;  2VDO B;  3UKU C;  4A11 B;  4JD2 C;  1JMX B;  5KDO B;  4JXM A;  4X63 B;  5EAL A;  2VDN B;  4A7J A;  2HJB A;  4FAN D;  3SHF A;  4GMB A;  2VC2 B;  3VGZ A;  4MK0 B;  4ESG A;  5GSA A;  5H1M A;  4PBY A;  1YFQ A;  3RSE C;  4CI3 A;  1YUK A;  3IIW A;  4E54 A;  3PVU B;  3UVO A;  4E54 B;  3L4M D;  3ZWL B;  2H68 A;  1Q47 A;  4IA9 A;  4HDJ A;  4FB1 D;  2P26 A;  5IC7 A;  2CN3 A;  4GZ8 A;  3SMR A;  4Z7O B;  4ERZ A;  3K26 A;  1TBG A;  4E5Z B;  1PBY B;  1N6D A;  3EU7 A;  4J81 A;  3DM0 A;  4D0K A;  3I8E A;  5C9Z B;  3PE7 A;  4ERY A;  2IWF A;  3C99 A;  2AH1 A;  4A11 A;  3DXK C;  5FKQ A;  3EI2 B;  2HES X;  4FA9 D;  2IUV A;  1MG2 A;  1SQJ A;  4Z7Q B;  1B9Y A;  4FAV D;  3NIG B;  3SWS D;  3JPX A;  3PXW D;  5H17 A;  2AQ5 A;  4L1Q D;  1JMZ B;  2OVQ B;  2QC5 A;  5CXC A;  3VI3 B;  3T3P B;  3UVK A;  3V7D B;  1OLZ A;  3SJL D;  3JZG A;  3JAM g;  1FWX A;  2VDM B;  3T3M B;  2XU7 A;  3OW8 A;  4H5J A;  1MDA H;  2XL2 A;  5K1C C;  2VDR B;  2IUP A;  4A0A A;  5AMS A;  2CO0 C;  3L4O D;  4J82 A;  2I3T A;  5TEF A;  2VDP B;  1SSL A;  2H9P A;  4WK4 B;  4CI1 A;  3AH8 B;  4J0X A;  2JWH A;  3GRE A;  3RFG A;  3VA6 A;  3IJ1 A;  5FKR A;  4CI8 A;  4GM3 A;  5HE1 B;  4TZ4 A;  5E6S B;  3NIF B;  3SVW D;  3EWE A;  2VDL B;  4PBZ A;  3ZDX B;  3UKR C;  1R5M A;  2P9U C;  4R7A B;  4I79 A;  4L3H D;  3MXX A;  4L9O A;  5GMK n;  1JJU B;  3RFH A;  2B4E A;  2G99 A;  3I8C A;  4UM9 D;  2CE9 A;  4IMM A;  5C2V B;  3K27 A;  4FA4 D;  4QL1 A;  5EMJ B;  5A2Q g;  4A08 A;  3ZE2 B;  4GQ1 A;  2G9A A;  5C2W B;  2I0S A;  4JSP C;  5EM2 A;  1TYE B;  4J0W A;  3NVN A;  3OL2 B;  2OVR B;  2H6K A;  1L0Q A;  4A09 B;  2CN2 A;  2QXV A;  4A2L A;  3BWS A;  3SBP A;  3E0C A;  2H3X A;  4XYI A;  2YNP A;  4FA1 D;  5HE2 B;  5I5I A;  1B9X A;  2BBK H;  5GXH A;  5THA A;  4ERQ A;  4CC9 A;  3JZN A;  4JT6 C;  3NVX A;  3I7K A;  4XEI C;  2BCJ B;  2P9N C;  4GQB B;  3ZE1 B;  3F3F A;  1PI6 A;  2OVP B;  5IT9 g;  3C75 H;  2J57 G;  3B7F A;  3C9C A;  3FCU B;  2O9K A;  4D6V A;  2XL3 A;  3C5M A;  4UM9 B;  2GNQ A;  3JRP A;  3UVL A;  3I89 A;  5IGQ A;  5EAP A;  1PGU A;  2OK4 A;  5HQG A;  4BL0 A;  4CZV A;  4GGA A;  4ZOX A;  4AOW A;  1U2V C;  3MKQ A;  3OTT A;  5FA5 B;  3W15 A;  4O3U B;  2Z2N A;  2OIZ A;  4ES0 A;  1N6E A;  4XYH A;  2J55 H;  2OJY A;  2TRC B;  3RLM D;  1K32 A;  2B5L A;  3V5W B;  4CY3 A;  4K3J B;  1N6F A;  3VI4 B;  3VH0 A;  5FKT A;  3ZDY B;  3AL9 A;  5H14 A;  3KRW B;  2Z2P A;  4X61 B;  1XHM A;  4GM8 A;  3BG1 A;  5IJ7 E;  2HYE A;  3ZE0 B;  3FRX A;  4J78 A;  2AGY A;  2PM6 B;  3HFQ A;  4L3G D;  4LG8 A;  4JT5 C;  4PC0 A;  3SBQ A;  3AL8 B;  4EWR A;  3EMH A;  5I5J A;  1NR0 A;  3IIY A;  5HE0 B;  4AEZ A;  4CY5 A;  5GXI A;  3EI1 A;  3ODT A;  5FXY A;  3I7P A;  3ULE C;  1PEV A;  5HYN B;  3BG0 A;  2JWG A;  2H9M A;  3EG6 A;  3AFC A;  2VDK B;  4O3T B;  2IUQ A;  3IKO A;  3UVM A;  4Z8L A;  5CYK A;  4OWR A;  3JZH A;  4YVD A;  4U7A A;  2J56 H;  5FQD A;  2HJ4 A;  5HE3 B;  4JSX C;  3DSM A;  2H9N A;  2P9K C;  3I7L A;  4LG9 A;  4N14 A;  5EM2 B;  3EI4 B;  3EI3 A;  4J73 A;  3JB9 L;  3PSL A;  2UZY B;  3CFV A;  4A0B A;  4FWW A;  1JOF A;  5HDB B;  1A0R B;  2P9P C;  1VYH C;  1K8K C;  4A09 A;  4WJK B;  4J87 A;  5CXB B;  5I5M A;  2H13 A;  3ZDZ B;  1SQ9 A;  4QQE A;  3IJC A;  3V9F A;  4PSW B;  4WK0 B;  4H5I A;  2AH0 A;  3I2N A;  4Z7N B;  3OKT A;  1P22 A;  1XKS A;  4J84 A;  3MMY A;  3JRO A;  4PXW A;  2H9L A;  1MG3 A;  2P9I C;  5TDH B;  4PNK B;  4A0A B;  2XYI A;  3I7H A;  2I3S A;  4FA5 D;  4J8B A;  5FKS A;  4K3I D;  5JWZ A;  5CXB A;  5B4W A;  3RRM C;  4O9D A;  2CNX A;  4GGC A;  2B5N A;  3EI3 B;  3A0F A;  3EI4 A;  4FHL A;  2GC7 A;  3MZL A;  4U1E I;  3FGB A;  5EAM A;  3OL2 A;  4ZOY A;  5EMM B;  4QT8 A;  4Y7R A;  2H14 A;  5CYK B;  4X3E A;  2YMU A;  3U4Y A;  5CXC B;  4GQ2 P;  2PM9 B;  2YB8 B;  2YBA A;  2YNN A;  3N0D A;  1U4C A;  4A08 B;  5AJA A;  5TF2 A;  3MKS B;  5EML B;  3J80 g;  4X60 B;  4A0B B;  2IUR A;  3J81 g;  2W18 A;  3F3G A;  2H47 A;  2EBS A;  3RMZ D;  3SN6 B;  2AGZ A;  4GM9 A;  2HXC A;  5SXM A;  2CO0 A;  2IWK A;  5EMK B;  3RN1 D;  1SHY B;  3UVN A;  2PM9 A;  4ZOV A;  3N0E A;  2B5M A;  4LGN A;  1GG2 B;  2OK6 A;  2HKR A;  5E6R B;  1TYQ C;  2P9S C;  3PVW B;  3OKY B;  4JSV C;  3SLE D;  1U8C B;  2PBI B;  4J86 A;  4NSX A;  4OZU A;  2PM7 B;  1GP2 B;  4O45 A;  5K19 A;  3ORV D;  4PSX B;  2I0T A;  2CE8 A;  2Q7Q A;  4J79 A;  3DWL C;  3KRX B;  2H6N A;  3FM0 A;  1RI6 A;  4J77 A;  4BUJ C;  3NVQ A;  1XIP A;  3SXT D;  3MZK A;  3DXM C;  2UZX B;  3I7O A;  2YNO A;  2I0R A;  3OKW A;  3SCY A;  4BH6 A;  4ZOZ A;  4CZY A;  3IJ0 A;  4CY1 A;  2P9L C;  4GGD A;  2VDQ B;  4QRJ A;  3F3P A;  4E5Z A;  4Y5R D;  5E6U B;  1GXR A;  5IJ8 E;  2MTA H;  3PXS D;  1S4U X;  3PXT D;  4ZN4 A;  4G56 B;  4UI9 R;  2HKM A;  3PSC B;  1OMW B;  4J8G A;  2AGW A;  3OKY A;  4A2M A;  3I7N A;  3SFZ A;  2Z2O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...