4JHNA

The crystal structure of the rpgr rcc1-like domain
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
362
structure length
361
Chain Sequence
b'MPDSGAVFTFGKSKFENNPGKFWFKNDVPVHLSCGDEHSAVVTGNNKLYMFGSNNWGQLGLGSKSAISKPTCVKALKPEKVKLAACGRNHTLVSTEGGNVYATGGNNEGQLGLGDTEERNTFHVISFFTSEHKIKQLSAGSNTSAALTEDGRLFMWGDNSEGQIGLKNVSNVCVPQQVTIGKPVSWISCGYYHSAFVTTDGELYVFGEPENGKLGLPNQLLGNHRTPQLVSEIPEKVIQVACGGEHTVVLTENAVYTFGLGQFGQLGLGTFLFETSEPKVIENIRDQTISYISCGENHTALITDIGLMYTFGDGRHGKLGLGLENFTNHFIPTLCSNFLRFIVKLVACGGCHMVVFAAPHR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords X-linked retinitis pigmentosa GTPase regulator
molecule tags Unknown function
source organism Homo sapiens
publication title The interplay between RPGR, PDE-delta and Arl2/3 regulate the ciliary targeting of farnesylated cargo.
pubmed doi rcsb
total genus 98
structure length 361
sequence length 362
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00415 RCC1 Regulator of chromosome condensation (RCC1) repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.30 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Regulator of chromosome condensation 1/beta-lactamase-inhibitor protein II 4jhnA00
4NAAA 4L1MA 4QAMA 4NC4A 4DNVA 4DNWA 4NBMA 3QI0A 4D9SA 1A12A 4O2WA 4DNUA 1I2MB 3OF7A 4JHPC 1JTDB 4JHNA 3QHYB 3KCIA 3MVDK
chains in the Genus database with same CATH superfamily
4JSVC 4CY5A 3UVKA 4AEZA 2Z2PA 3EI2B 4BP9A 4Z7QA 3SJLD 4J82A 1O6GA 5E6RA 4CC9A 3VI4A 3FRXA 3SN6B 4ERYA 2IUQA 1PBYB 3IJ1A 3I7KA 5CXCA 4DNVA 4IMMA 4BP8A 3JPXA 3EI4B 5AMSA 3ZWLB 4BCBA 5HQGA 4BH6A 4O2WA 1NR0A 2H3XA 5TEEA 4NENA 3J80g 2W18A 3EQ7A 3K6SA 2HJBA 5HE1B 4ZOYA 5CXCB 5H17A 2XZGA 3CIKB 1VE6A 1C9IA 2OVPB 3F3FA 2OJYA 3EQ8A 4WK4A 5CYKA 2YMUA 4J87A 5IJ8E 4A08B 2WQ8A 3V4PA 4JSXC 2OK6A 3AL8A 3B7FA 4JHPC 4JSNC 3OKTA 3NVQA 2XL3A 4G55A 2PM9B 3AL9A 1TBGA 2YNNA 3IIYA 3IVMA 2EIBA 4TZ4A 2VDLA 3ZDXA 4AN1A 2VDNA 3VI3A 4ES0A 2XDWA 4GQBB 5IJ7E 3O4JA 5CYKB 4K3ID 4ERQA 2HU7A 3I7NA 3JZHA 4L1MA 3EI3A 4FA1D 2H9LA 1L0QA 3I8CA 2B4EA 3UVOA 2AGZA 2P9IC 4ZOVA 4L3HD 4GM3A 1R5MA 2PBIB 3HFQA 1TYEA 4XYHA 3RFGA 4I79A 2IAAA 4UI9R 3RSEC 4E54B 4JD2C 1UOOA 5HDBA 1U8CA 2XU7A 4CI1A 3MVDK 4MK0B 2HU8A 4L3GD 4RE6A 5AJAA 1S4UX 2EBSA 3OTTA 4G56B 4X63B 1PGUA 2HKRA 1JMZB 4IA9A 1B9XA 4KFMB 5EMLB 1Q47A 4J79A 4O1QD 1L5GA 2HXCA 3PE7A 1GP2B 2CN3A 4WJKA 4FA5D 3L4MD 4O45A 4J8BA 1FWXA 2VDRA 4A2LA 5M5RA 5TF2A 2CN2A 5TEFA 2YNPA 3V7DB 5I5JA 3AFCA 3NIDA 5GMKn 1JMXB 3JRPA 1GXRA 4OZUA 2AGLA 3C9CA 3CFSB 2H6KA 3P4FA 4J8GA 3K71A 2VZ1A 3QHYB 4J78A 5HYNB 3ZDZA 4MMYA 5FFOA 1PEVA 4XEIC 4BL0A 3PSLA 1XIPA 2B5MA 1SHYB 2VC2A 5C92A 3EI1A 4GM9A 1OLZA 2BCJB 3BG0A 2IUVA 5C2WB 1GOHA 1U2VC 3JZNA 2UZXB 3DXMC 4Z7OA 3T3MA 4O3TB 4E5ZB 4A0AB 4O3UB 2EICA 1QNIA 4N14A 2P9SC 5FA5B 5IC7A 3I8EA 1GOTB 1XHMA 2QC5A 3GREA 3UKUC 3U4YA 4UM8A 4CI3A 5H1MA 3N0EA 1YFQA 4FHLA 5I5MA 1O6FA 2O9KA 2EIDA 2H13A 2VDMA 1H2YA 1H2ZA 4J77A 3RLMD 3DWLC 3PXTD 3SLED 3I7HA 2YB8B 3OKYA 4E54A 3C5MA 5HE3B 4CZXA 1QFSA 3NIFA 4JSPC 4GGCA 5FKSA 3T3PA 4J81A 4BCCA 5SXMA 5GXHA 2VDOA 4D0KA 5TDHB 3NIGA 4A7JA 2YBAA 1VE7A 3E0CA 3K27A 3PVUB 1JJUB 3ZE0A 5M5SA 4CI2A 3UVNA 4ZOZA 1SQ9A 2VDKA 1K8KC 4J73A 3UVLA 3IUJA 5FFGA 3I7LA 3V9FA 5EM2B 4AX4A 5CXBA 1UTCA 3F3PA 2H9PA 2HU5A 3EMHA 2OVQB 3EWEA 4A09B 1TYQC 4ZN4A 2I3SA 2OVRB 4FB1D 1A12A 3MZKA 3KRWB 3VH0A 4NBMA 2IUPA 4A0BB 5EALA 4WK2A 1I2MB 2VZ3A 2H47A 4H5JA 4YVDA 5EMMB 5IGQA 4J86A 5E6UA 4GZ8A 3FGBA 2XE4A 3FCUA 5I5IA 1N6DA 4NC4A 4A11B 4EWRA 2QXVA 1OMWB 4FAVD 2Z2OA 1U4CA 2HKMA 3PXWD 2P9NC 3AH8B 2CNXA 3OKYB 3IJEA 2XYIA 4GQ1A 5JWZA 2H6QA 4L1QD 4AMZA 2QR5A 3IUMA 2BKLA 1E5TA 1GOFA 3L4OD 3BWSA 3RMZD 2GC4A 1XKSA 3EQ9A 5FKQA 4DNWA 5HE2B 1JTDB 1H2WA 4U7AA 2UZYB 2AGXA 3ZDYA 2G99A 1GOGA 1VZ3A 3GD1I 4CY1A 4GQ2P 2AH0A 4J84A 3EG6A 2MTAH 3KRXB 5GXIA 4AOWA 5EMJB 2VDQA 1YR2A 4ESGA 4LG8A 2QZPA 1MDAH 2B5NA 4PSXB 2HJ4A 4CY3A 2P9UC 5M5VA 2HESX 1SQJA 4QQEA 4K3JB 3ULEC 4H5IA 2P9KC 4NAAA 5A2Qg 3PVWB 1MG3A 3I2NA 2G9AA 3W15A 4WK0A 3OL2B 3SBPA 4NSXA 5FLXg 3JROA 4G1EA 5H14A 3ZE1A 1H2XA 4J0XA 4D9SA 3ZE2A 3BG1A 3DXKC 4D6VA 1B9YA 2I3TA 4L9OA 5K1CC 4PBYA 5IGOA 3RFHA 3RN1D 3QI0A 4FWWA 3IULA 1GG2B 2P9PC 3MZLA 4HDJA 2IWKA 2H68A 2J57G 5M5TA 3SHFA 1N6FA 1K3IA 2CE9A 4BUJC 4R7AB 5THAA 3MXXA 1C9LA 3K26A 1MG2A 3SXTD 3OKWA 1BPOA 3ORVD 3N0DA 4PNKB 3VGZA 2GNQA 2IWFA 1A0RB 3MUNA 2I0TA 2AGWA 2H14A 4FA4D 3O4IA 3J81g 3NVXA 2EIEA 3IIWA 4A2MA 1VYHC 2I0SA 1N6EA 5M61A 5CXBB 5FXYA 3DDUA 3O4GA 2B5LA 3SBQA 1E8NA 3JAMg 2GC7A 3UKRC 5IT9g 3GC3B 4QAMA 1T2XA 1RI6A 4IRZA 4PBZA 4JHNA 4AN0A 3KCIA 4G1MA 3O4HA 4QL1A 4GGAA 5AFU3 3OL2A 1E8MA 3IKOA 3JZGA 5HE0B 3IJCA 3IJ0A 4ERZA 5KDOB 4PC0A 5EARA 2AH1A 3UVMA 4Z8LA 4MMZA 2YNOA 2H9MA 2PM6B 4X61B 2AGYA 2OIZA 4A0BA 1QFMA 4PXWA 2J56H 4A0AA 4BCDA 4OWRA 4XYIA 2I0RA 4UM9A 3ODTA 2BBKH 3VA6A 3F3GA 3IUNA 3SCYA 4Z7NA 4CI8A 4X3EA 5C2VB 3K72A 3V4VA 3EI1B 4CY2A 3SFZA 3MUOA 4AMYA 2AQ5A 1K32A 5C9ZB 5B4WA 4PSWB 2PM9A 3C75H 2CO0C 4Y5RD 3MKQA 3UR4A 2IURA 3IUQA 3FM0A 4O02A 4GGDA 4DNUA 3AL8B 5M5UA 4Y7RA 4A08A 3MKSB 4JXMA 5FQDA 3PXSD 4CZVA 3GFCA 3I7OA 4JT5C 3SMRA 5EAMA 2Z2NA 2TRCB 4MMXA 4LG9A 4JT6C 1UOPA 3OF7A 3SVWD 2PM7B 4LGNA 4FA9D 3SBRA 3RRMC 3C99A 2VDPA 4U1EI 3EI4A 2OK4A 3JB9L 4X60B 3I7PA 4E5ZA 4O9DA 5FKRA 5C86A 1JOFA 5EMKB 3V5WB 3MMYA 2P9LC 4GM8A 1PI6A 1VZ2A 2JKXA 4A11A 1JV2A 3EI2A 3A0FA 4QRJA 3IURA 5EAPA 2Q7QA 5K19A 2HYEA 1UOQA 3FCSA 3NVNA 5GSAA 3RN0D 3DSMA 4FAND 1ERJA 3PSCB 5FKTA 3I89A 3OW8A 5E6SA 2CO0A 3DM0A 1M1XA 2H6NA 3EI3B 4A09A 2J55H 2CE8A 3CFVA 4RE5A 4GMBA 1NEXB 3SWSD 5EM2A 3EU7A 2H9NA 2XL2A 4QT8A 4ZOXA 4CZYA 1P22A 4J0WA
chains in the Genus database with same CATH topology
4NAAA 4L1MA 4QAMA 4NC4A 4DNVA 4DNWA 4NBMA 3QI0A 4D9SA 1A12A 4O2WA 4DNUA 1I2MB 3OF7A 4JHPC 1JTDB 4JHNA 3QHYB 3KCIA 3MVDK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NAA A;  4L1M A;  4QAM A;  4NC4 A;  4DNV A;  4DNW A;  4NBM A;  3QI0 A;  4D9S A;  1A12 A;  4O2W A;  4DNU A;  1I2M B;  3OF7 A;  4JHP C;  1JTD B;  4JHN A;  3QHY B;  3KCI A;  3MVD K; 
#chains in the Genus database with same CATH topology
 4JSV C;  4CY5 A;  3UVK A;  4AEZ A;  2Z2P A;  3EI2 B;  4BP9 A;  4Z7Q A;  3SJL D;  4J82 A;  1O6G A;  5E6R A;  4CC9 A;  3VI4 A;  3FRX A;  3SN6 B;  4ERY A;  2IUQ A;  1PBY B;  3IJ1 A;  3I7K A;  5CXC A;  4DNV A;  4IMM A;  4BP8 A;  3JPX A;  3EI4 B;  5AMS A;  3ZWL B;  4BCB A;  5HQG A;  4BH6 A;  4O2W A;  1NR0 A;  2H3X A;  5TEE A;  4NEN A;  3J80 g;  2W18 A;  3EQ7 A;  3K6S A;  2HJB A;  5HE1 B;  4ZOY A;  5CXC B;  5H17 A;  2XZG A;  3CIK B;  1VE6 A;  1C9I A;  2OVP B;  3F3F A;  2OJY A;  3EQ8 A;  4WK4 A;  5CYK A;  2YMU A;  4J87 A;  5IJ8 E;  4A08 B;  2WQ8 A;  3V4P A;  4JSX C;  2OK6 A;  3AL8 A;  3B7F A;  4JHP C;  4JSN C;  3OKT A;  3NVQ A;  2XL3 A;  4G55 A;  2PM9 B;  3AL9 A;  1TBG A;  2YNN A;  3IIY A;  3IVM A;  2EIB A;  4TZ4 A;  2VDL A;  3ZDX A;  4AN1 A;  2VDN A;  3VI3 A;  4ES0 A;  2XDW A;  4GQB B;  5IJ7 E;  3O4J A;  5CYK B;  4K3I D;  4ERQ A;  2HU7 A;  3I7N A;  3JZH A;  4L1M A;  3EI3 A;  4FA1 D;  2H9L A;  1L0Q A;  3I8C A;  2B4E A;  3UVO A;  2AGZ A;  2P9I C;  4ZOV A;  4L3H D;  4GM3 A;  1R5M A;  2PBI B;  3HFQ A;  1TYE A;  4XYH A;  3RFG A;  4I79 A;  2IAA A;  4UI9 R;  3RSE C;  4E54 B;  4JD2 C;  1UOO A;  5HDB A;  1U8C A;  2XU7 A;  4CI1 A;  3MVD K;  4MK0 B;  2HU8 A;  4L3G D;  4RE6 A;  5AJA A;  1S4U X;  2EBS A;  3OTT A;  4G56 B;  4X63 B;  1PGU A;  2HKR A;  1JMZ B;  4IA9 A;  1B9X A;  4KFM B;  5EML B;  1Q47 A;  4J79 A;  4O1Q D;  1L5G A;  2HXC A;  3PE7 A;  1GP2 B;  2CN3 A;  4WJK A;  4FA5 D;  3L4M D;  4O45 A;  4J8B A;  1FWX A;  2VDR A;  4A2L A;  5M5R A;  5TF2 A;  2CN2 A;  5TEF A;  2YNP A;  3V7D B;  5I5J A;  3AFC A;  3NID A;  5GMK n;  1JMX B;  3JRP A;  1GXR A;  4OZU A;  2AGL A;  3C9C A;  3CFS B;  2H6K A;  3P4F A;  4J8G A;  3K71 A;  2VZ1 A;  3QHY B;  4J78 A;  5HYN B;  3ZDZ A;  4MMY A;  5FFO A;  1PEV A;  4XEI C;  4BL0 A;  3PSL A;  1XIP A;  2B5M A;  1SHY B;  2VC2 A;  5C92 A;  3EI1 A;  4GM9 A;  1OLZ A;  2BCJ B;  3BG0 A;  2IUV A;  5C2W B;  1GOH A;  1U2V C;  3JZN A;  2UZX B;  3DXM C;  4Z7O A;  3T3M A;  4O3T B;  4E5Z B;  4A0A B;  4O3U B;  2EIC A;  1QNI A;  4N14 A;  2P9S C;  5FA5 B;  5IC7 A;  3I8E A;  1GOT B;  1XHM A;  2QC5 A;  3GRE A;  3UKU C;  3U4Y A;  4UM8 A;  4CI3 A;  5H1M A;  3N0E A;  1YFQ A;  4FHL A;  5I5M A;  1O6F A;  2O9K A;  2EID A;  2H13 A;  2VDM A;  1H2Y A;  1H2Z A;  4J77 A;  3RLM D;  3DWL C;  3PXT D;  3SLE D;  3I7H A;  2YB8 B;  3OKY A;  4E54 A;  3C5M A;  5HE3 B;  4CZX A;  1QFS A;  3NIF A;  4JSP C;  4GGC A;  5FKS A;  3T3P A;  4J81 A;  4BCC A;  5SXM A;  5GXH A;  2VDO A;  4D0K A;  5TDH B;  3NIG A;  4A7J A;  2YBA A;  1VE7 A;  3E0C A;  3K27 A;  3PVU B;  1JJU B;  3ZE0 A;  5M5S A;  4CI2 A;  3UVN A;  4ZOZ A;  1SQ9 A;  2VDK A;  1K8K C;  4J73 A;  3UVL A;  3IUJ A;  5FFG A;  3I7L A;  3V9F A;  5EM2 B;  4AX4 A;  5CXB A;  1UTC A;  3F3P A;  2H9P A;  2HU5 A;  3EMH A;  2OVQ B;  3EWE A;  4A09 B;  1TYQ C;  4ZN4 A;  2I3S A;  2OVR B;  4FB1 D;  1A12 A;  3MZK A;  3KRW B;  3VH0 A;  4NBM A;  2IUP A;  4A0B B;  5EAL A;  4WK2 A;  1I2M B;  2VZ3 A;  2H47 A;  4H5J A;  4YVD A;  5EMM B;  5IGQ A;  4J86 A;  5E6U A;  4GZ8 A;  3FGB A;  2XE4 A;  3FCU A;  5I5I A;  1N6D A;  4NC4 A;  4A11 B;  4EWR A;  2QXV A;  1OMW B;  4FAV D;  2Z2O A;  1U4C A;  2HKM A;  3PXW D;  2P9N C;  3AH8 B;  2CNX A;  3OKY B;  3IJE A;  2XYI A;  4GQ1 A;  5JWZ A;  2H6Q A;  4L1Q D;  4AMZ A;  2QR5 A;  3IUM A;  2BKL A;  1E5T A;  1GOF A;  3L4O D;  3BWS A;  3RMZ D;  2GC4 A;  1XKS A;  3EQ9 A;  5FKQ A;  4DNW A;  5HE2 B;  1JTD B;  1H2W A;  4U7A A;  2UZY B;  2AGX A;  3ZDY A;  2G99 A;  1GOG A;  1VZ3 A;  3GD1 I;  4CY1 A;  4GQ2 P;  2AH0 A;  4J84 A;  3EG6 A;  2MTA H;  3KRX B;  5GXI A;  4AOW A;  5EMJ B;  2VDQ A;  1YR2 A;  4ESG A;  4LG8 A;  2QZP A;  1MDA H;  2B5N A;  4PSX B;  2HJ4 A;  4CY3 A;  2P9U C;  5M5V A;  2HES X;  1SQJ A;  4QQE A;  4K3J B;  3ULE C;  4H5I A;  2P9K C;  4NAA A;  5A2Q g;  3PVW B;  1MG3 A;  3I2N A;  2G9A A;  3W15 A;  4WK0 A;  3OL2 B;  3SBP A;  4NSX A;  5FLX g;  3JRO A;  4G1E A;  5H14 A;  3ZE1 A;  1H2X A;  4J0X A;  4D9S A;  3ZE2 A;  3BG1 A;  3DXK C;  4D6V A;  1B9Y A;  2I3T A;  4L9O A;  5K1C C;  4PBY A;  5IGO A;  3RFH A;  3RN1 D;  3QI0 A;  4FWW A;  3IUL A;  1GG2 B;  2P9P C;  3MZL A;  4HDJ A;  2IWK A;  2H68 A;  2J57 G;  5M5T A;  3SHF A;  1N6F A;  1K3I A;  2CE9 A;  4BUJ C;  4R7A B;  5THA A;  3MXX A;  1C9L A;  3K26 A;  1MG2 A;  3SXT D;  3OKW A;  1BPO A;  3ORV D;  3N0D A;  4PNK B;  3VGZ A;  2GNQ A;  2IWF A;  1A0R B;  3MUN A;  2I0T A;  2AGW A;  2H14 A;  4FA4 D;  3O4I A;  3J81 g;  3NVX A;  2EIE A;  3IIW A;  4A2M A;  1VYH C;  2I0S A;  1N6E A;  5M61 A;  5CXB B;  5FXY A;  3DDU A;  3O4G A;  2B5L A;  3SBQ A;  1E8N A;  3JAM g;  2GC7 A;  3UKR C;  5IT9 g;  3GC3 B;  4QAM A;  1T2X A;  1RI6 A;  4IRZ A;  4PBZ A;  4JHN A;  4AN0 A;  3KCI A;  4G1M A;  3O4H A;  4QL1 A;  4GGA A;  5AFU 3;  3OL2 A;  1E8M A;  3IKO A;  3JZG A;  5HE0 B;  3IJC A;  3IJ0 A;  4ERZ A;  5KDO B;  4PC0 A;  5EAR A;  2AH1 A;  3UVM A;  4Z8L A;  4MMZ A;  2YNO A;  2H9M A;  2PM6 B;  4X61 B;  2AGY A;  2OIZ A;  4A0B A;  1QFM A;  4PXW A;  2J56 H;  4A0A A;  4BCD A;  4OWR A;  4XYI A;  2I0R A;  4UM9 A;  3ODT A;  2BBK H;  3VA6 A;  3F3G A;  3IUN A;  3SCY A;  4Z7N A;  4CI8 A;  4X3E A;  5C2V B;  3K72 A;  3V4V A;  3EI1 B;  4CY2 A;  3SFZ A;  3MUO A;  4AMY A;  2AQ5 A;  1K32 A;  5C9Z B;  5B4W A;  4PSW B;  2PM9 A;  3C75 H;  2CO0 C;  4Y5R D;  3MKQ A;  3UR4 A;  2IUR A;  3IUQ A;  3FM0 A;  4O02 A;  4GGD A;  4DNU A;  3AL8 B;  5M5U A;  4Y7R A;  4A08 A;  3MKS B;  4JXM A;  5FQD A;  3PXS D;  4CZV A;  3GFC A;  3I7O A;  4JT5 C;  3SMR A;  5EAM A;  2Z2N A;  2TRC B;  4MMX A;  4LG9 A;  4JT6 C;  1UOP A;  3OF7 A;  3SVW D;  2PM7 B;  4LGN A;  4FA9 D;  3SBR A;  3RRM C;  3C99 A;  2VDP A;  4U1E I;  3EI4 A;  2OK4 A;  3JB9 L;  4X60 B;  3I7P A;  4E5Z A;  4O9D A;  5FKR A;  5C86 A;  1JOF A;  5EMK B;  3V5W B;  3MMY A;  2P9L C;  4GM8 A;  1PI6 A;  1VZ2 A;  2JKX A;  4A11 A;  1JV2 A;  3EI2 A;  3A0F A;  4QRJ A;  3IUR A;  5EAP A;  2Q7Q A;  5K19 A;  2HYE A;  1UOQ A;  3FCS A;  3NVN A;  5GSA A;  3RN0 D;  3DSM A;  4FAN D;  1ERJ A;  3PSC B;  5FKT A;  3I89 A;  3OW8 A;  5E6S A;  2CO0 A;  3DM0 A;  1M1X A;  2H6N A;  3EI3 B;  4A09 A;  2J55 H;  2CE8 A;  3CFV A;  4RE5 A;  4GMB A;  1NEX B;  3SWS D;  5EM2 A;  3EU7 A;  2H9N A;  2XL2 A;  4QT8 A;  4ZOX A;  4CZY A;  1P22 A;  4J0W A; 
#chains in the Genus database with same CATH homology
 4NAA A;  4L1M A;  4QAM A;  4NC4 A;  4DNV A;  4DNW A;  4NBM A;  3QI0 A;  4D9S A;  1A12 A;  4O2W A;  4DNU A;  1I2M B;  3OF7 A;  4JHP C;  1JTD B;  4JHN A;  3QHY B;  3KCI A;  3MVD K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...