4JHNA

The crystal structure of the rpgr rcc1-like domain
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
362
structure length
361
Chain Sequence
MPDSGAVFTFGKSKFENNPGKFWFKNDVPVHLSCGDEHSAVVTGNNKLYMFGSNNWGQLGLGSKSAISKPTCVKALKPEKVKLAACGRNHTLVSTEGGNVYATGGNNEGQLGLGDTEERNTFHVISFFTSEHKIKQLSAGSNTSAALTEDGRLFMWGDNSEGQIGLKNVSNVCVPQQVTIGKPVSWISCGYYHSAFVTTDGELYVFGEPENGKLGLPNQLLGNHRTPQLVSEIPEKVIQVACGGEHTVVLTENAVYTFGLGQFGQLGLGTFLFETSEPKVIENIRDQTISYISCGENHTALITDIGLMYTFGDGRHGKLGLGLENFTNHFIPTLCSNFLRFIVKLVACGGCHMVVFAAPHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Unknown function
molecule keywords X-linked retinitis pigmentosa GTPase regulator
publication title The interplay between RPGR, PDE-delta and Arl2/3 regulate the ciliary targeting of farnesylated cargo.
pubmed doi rcsb
source organism Homo sapiens
total genus 98
structure length 361
sequence length 362
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00415 RCC1 Regulator of chromosome condensation (RCC1) repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.30 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Regulator of chromosome condensation 1/beta-lactamase-inhibitor protein II 4jhnA00
3OF7A 4O2WA 1I2MB 3QHYB 4JHPC 4DNVA 4NAAA 3QI0A 3MVDK 1JTDB 3KCIA 4QAMA 4DNUA 4NBMA 1A12A 4NC4A 4DNWA 4JHNA 4L1MA 4D9SA
chains in the Genus database with same CATH superfamily
2PM9B 4CY2A 3I7NA 5EMJB 4CZYA 2HU8A 5CXCA 4QL1A 5EARA 1PBYB 2IWFA 3I7LA 5JWZA 5GMKn 2P9SC 1RI6A 4O2WA 3VA6A 5HE0B 3RFHA 1T2XA 3IULA 5GXIA 2OK6A 2PM6B 4PBYA 3MVDK 3DM0A 3PSLA 2EIEA 2HKMA 1NR0A 2XL2A 2EBSA 1UTCA 2OVQB 3UVOA 2EIDA 3IURA 5EALA 4LG9A 2HJ4A 2YBAA 4JT6C 4QQEA 2PM9A 3RMZD 5C86A 4K3JB 3V5WB 4CI8A 3SBPA 5EMMB 2CN2A 2HU5A 2UZYB 3OL2B 2O9KA 2IAAA 3MUNA 5IGQA 3ZE2A 2AGZA 4OZUA 4JXMA 1U2VC 4G56B 2GC4A 3IUMA 3O4JA 4NBMA 4NC4A 4U7AA 3OKTA 3AL8B 2CNXA 1E5TA 2H6KA 4GMBA 4MMYA 2CO0A 2P9NC 3OL2A 1GG2B 4BH6A 5K19A 3PVUB 5M5UA 3PSCB 3PXTD 3T3MA 5E6UA 4ZOYA 5HE3B 5M5TA 1GOHA 1JOFA 4J0WA 5C2WB 4A0AA 4TZ4A 1VE7A 4JSNC 3C99A 3EI1B 3T3PA 3EWEA 3F3GA 3MKQA 4A09B 3AL8A 4ZOXA 2WQ8A 3VGZA 2BCJB 4K3ID 2XU7A 3MMYA 4O02A 2CN3A 5HE1B 1P22A 2B4EA 4X3EA 1QNIA 3L4MD 4E54A 3L4OD 3CFSB 3JB9L 4AN1A 2H6NA 3K6SA 3IUJA 1OLZA 3IUNA 4O9DA 5C9ZB 3SFZA 3K26A 2P9IC 3EQ8A 4RE6A 4J81A 4DNWA 5GSAA 2HXCA 2OVPB 3NVQA 3V4VA 3HFQA 1JV2A 4GZ8A 3OW8A 2YNPA 4D0KA 5HE2B 3ZDXA 4GM8A 3NVXA 3AFCA 2XDWA 4G1EA 5A2Qg 2EIBA 2P9UC 3ZE0A 2H9PA 2VDOA 4NAAA 3ULEC 5C92A 4BCDA 2AGXA 4AEZA 4N14A 3KCIA 3NIFA 4NENA 3B7FA 4CY3A 4AOWA 4Z7NA 5H17A 4A7JA 2H13A 4EWRA 4D9SA 3SVWD 4IA9A 5EMKB 2PM7B 3DWLC 1L0QA 1B9XA 2J55H 3RSEC 4L3GD 3MUOA 1MG3A 2PBIB 2P9PC 1A0RB 3EQ9A 3PXSD 2IUPA 3SMRA 1R5MA 1UOPA 2XZGA 3C9CA 2HKRA 3E0CA 4A11A 5M5SA 2H14A 5M5VA 1YR2A 3SCYA 4BCBA 4MMXA 4J0XA 2H6QA 5EM2B 5I5MA 4DNUA 5EMLB 4J8BA 3FRXA 2VZ3A 1PGUA 3I7OA 3UKRC 5FA5B 3J80g 3EI2A 3O4HA 4PBZA 5FKSA 2P9KC 3FM0A 3GD1I 1JMXB 2G99A 1MDAH 5TEFA 3IJ0A 5AMSA 5FKQA 1H2YA 4L3HD 2H47A 3ZE1A 4ZOZA 1JMZB 2GC7A 4LGNA 2VDLA 2B5NA 4H5IA 4QRJA 1C9LA 4IMMA 3GFCA 4FA9D 2H9NA 4CY1A 4QAMA 5CXBB 3SN6B 5GXHA 5E6RA 4X63B 3EQ7A 4KFMB 5EAMA 2P9LC 3O4IA 5EAPA 3UVNA 2I3TA 3BG0A 3IIYA 4J86A 4O1QD 2AH1A 4GQBB 3AH8B 4PNKB 4AMYA 5AFU3 5IT9g 2XE4A 2BKLA 4JHPC 2YNNA 4J84A 4CI3A 5I5JA 4RE5A 4R7AB 4AN0A 4UM8A 4GQ1A 4ERZA 1SHYB 3F3FA 2H9MA 1TYQC 1OMWB 2H3XA 2MTAH 4Z8LA 1QFMA 1U8CA 4JSPC 3IKOA 2I0TA 3FCSA 3UVMA 2VDNA 5FXYA 2AGLA 1UOOA 4E5ZB 2UZXB 5TF2A 4A2MA 3BG1A 4CI2A 1VZ3A 3JZGA 3NVNA 4J73A 1M1XA 4H5JA 4ZOVA 3EI1A 1SQJA 3I7PA 1N6FA 2JKXA 2TRCB 1JTDB 4PXWA 4LG8A 4A09A 3MKSB 1H2WA 2OVRB 3VI4A 4ERQA 4A08B 3P4FA 4NSXA 3DXMC 4PSWB 4G55A 5TDHB 3RLMD 3KRWB 2XL3A 5FKRA 4MK0B 2OK4A 4Y5RD 3V4PA 4O3TB 4PC0A 5H1MA 1QFSA 5IJ8E 3MZKA 2QZPA 4L9OA 4FAND 2I0SA 4GGAA 2VZ1A 4DNVA 3FCUA 4XYHA 2IWKA 3JPXA 2CO0C 2B5LA 3I2NA 2CE9A 5CYKB 2IURA 2QC5A 4O3UB 5FKTA 3IVMA 3EI3B 2AQ5A 1TBGA 4I79A 3ZDYA 1GOTB 4MMZA 4PSXB 1N6EA 3K27A 5FFOA 2YB8B 5HYNB 2Z2OA 3SWSD 1GOGA 4G1MA 2HJBA 4FAVD 3GC3B 3VI3A 4X61B 5M5RA 1O6FA 2EICA 5IC7A 1ERJA 5B4WA 2J57G 5HQGA 4A0BB 1H2XA 5CYKA 3U4YA 4UI9R 3EI3A 4BP8A 1GP2B 5FFGA 3IJEA 3CFVA 4XEIC 2QR5A 3IIWA 3UVKA 3VH0A 2H68A 4BP9A 2QXVA 1SQ9A 2W18A 4Z7QA 2I3SA 2CE8A 5SXMA 2AGYA 3IUQA 1JJUB 3JZHA 3JAMg 4FA5D 5FQDA 4CY5A 4A0BA 3SLED 2AGWA 3SBRA 1K32A 3O4GA 5EM2A 1YFQA 3PVWB 1E8NA 4J78A 3BWSA 3V9FA 3ZDZA 4A2LA 1B9YA 4D6VA 3JRPA 2G9AA 2VDPA 1XKSA 1PEVA 4CI1A 4UM9A 5C2VB 4FA1D 4GGDA 4J77A 1H2ZA 3RFGA 3NIDA 1TYEA 4U1EI 1C9IA 5THAA 2AH0A 3CIKB 1L5GA 3I7HA 3N0DA 3C5MA 1K3IA 4A0AB 5E6SA 5M61A 2YNOA 2Z2NA 3DDUA 5CXBA 4ESGA 4YVDA 4GQ2P 4CC9A 3GREA 4GM3A 4GM9A 4CZVA 2I0RA 3DXKC 3JROA 3OKYB 5H14A 3MZLA 3K72A 4GGCA 2VC2A 4BUJC 3RRMC 5AJAA 3ODTA 4OWRA 4E54B 4ZN4A 3W15A 2OIZA 3EMHA 3OKWA 3I8EA 2Q7QA 5IGOA 2VDKA 4WK2A 1O6GA 1GXRA 3QHYB 4ERYA 4J79A 4BCCA 4XYIA 2GNQA 1U4CA 2VDRA 3RN1D 1VYHC 4FB1D 1N6DA 3SJLD 4FHLA 4BL0A 5K1CC 4ES0A 2H9LA 3I8CA 3A0FA 3JZNA 3V7DB 4FA4D 3SXTD 4O45A 1VE6A 3EI4B 4JD2C 1A12A 2IUQA 3RN0D 3UR4A 3OKYA 3MXXA 2HYEA 2VDQA 3SHFA 2J56H 3DSMA 2XYIA 3FGBA 4QT8A 4E5ZA 2OJYA 3EG6A 3I89A 1GOFA 4J82A 4JSVC 1E8MA 2YMUA 3AL9A 3OF7A 2BBKH 1Q47A 1NEXB 2B5MA 4JSXC 4Y7RA 3C75H 3IJCA 3NIGA 4AX4A 1XIPA 2HU7A 4J8GA 3EI4A 3UKUC 5KDOB 3SBQA 4AMZA 5HDBA 4A08A 4L1MA 3PE7A 4WJKA 3KRXB 3EU7A 5IJ7E 3F3PA 1PI6A 4WK0A 1XHMA 4L1QD 5I5IA 2IUVA 1BPOA 1FWXA 2Z2PA 4Z7OA 3I7KA 3K71A 2VDMA 5CXCB 1I2MB 4J87A 3ORVD 4HDJA 3J81g 3N0EA 4A11B 3OTTA 3QI0A 4WK4A 4X60B 3IJ1A 1K8KC 1UOQA 4CZXA 2HESX 4JT5C 1VZ2A 4JHNA 5FLXg 4IRZA 3UVLA 4FWWA 5TEEA 3ZWLB 3PXWD 3EI2B 1MG2A 1S4UX
chains in the Genus database with same CATH topology
3OF7A 4O2WA 1I2MB 3QHYB 4JHPC 4DNVA 4NAAA 3QI0A 3MVDK 1JTDB 3KCIA 4QAMA 4DNUA 4NBMA 1A12A 4NC4A 4DNWA 4JHNA 4L1MA 4D9SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OF7 A;  4O2W A;  1I2M B;  3QHY B;  4JHP C;  4DNV A;  4NAA A;  3QI0 A;  3MVD K;  1JTD B;  3KCI A;  4QAM A;  4DNU A;  4NBM A;  1A12 A;  4NC4 A;  4DNW A;  4JHN A;  4L1M A;  4D9S A; 
#chains in the Genus database with same CATH topology
 2PM9 B;  4CY2 A;  3I7N A;  5EMJ B;  4CZY A;  2HU8 A;  5CXC A;  4QL1 A;  5EAR A;  1PBY B;  2IWF A;  3I7L A;  5JWZ A;  5GMK n;  2P9S C;  1RI6 A;  4O2W A;  3VA6 A;  5HE0 B;  3RFH A;  1T2X A;  3IUL A;  5GXI A;  2OK6 A;  2PM6 B;  4PBY A;  3MVD K;  3DM0 A;  3PSL A;  2EIE A;  2HKM A;  1NR0 A;  2XL2 A;  2EBS A;  1UTC A;  2OVQ B;  3UVO A;  2EID A;  3IUR A;  5EAL A;  4LG9 A;  2HJ4 A;  2YBA A;  4JT6 C;  4QQE A;  2PM9 A;  3RMZ D;  5C86 A;  4K3J B;  3V5W B;  4CI8 A;  3SBP A;  5EMM B;  2CN2 A;  2HU5 A;  2UZY B;  3OL2 B;  2O9K A;  2IAA A;  3MUN A;  5IGQ A;  3ZE2 A;  2AGZ A;  4OZU A;  4JXM A;  1U2V C;  4G56 B;  2GC4 A;  3IUM A;  3O4J A;  4NBM A;  4NC4 A;  4U7A A;  3OKT A;  3AL8 B;  2CNX A;  1E5T A;  2H6K A;  4GMB A;  4MMY A;  2CO0 A;  2P9N C;  3OL2 A;  1GG2 B;  4BH6 A;  5K19 A;  3PVU B;  5M5U A;  3PSC B;  3PXT D;  3T3M A;  5E6U A;  4ZOY A;  5HE3 B;  5M5T A;  1GOH A;  1JOF A;  4J0W A;  5C2W B;  4A0A A;  4TZ4 A;  1VE7 A;  4JSN C;  3C99 A;  3EI1 B;  3T3P A;  3EWE A;  3F3G A;  3MKQ A;  4A09 B;  3AL8 A;  4ZOX A;  2WQ8 A;  3VGZ A;  2BCJ B;  4K3I D;  2XU7 A;  3MMY A;  4O02 A;  2CN3 A;  5HE1 B;  1P22 A;  2B4E A;  4X3E A;  1QNI A;  3L4M D;  4E54 A;  3L4O D;  3CFS B;  3JB9 L;  4AN1 A;  2H6N A;  3K6S A;  3IUJ A;  1OLZ A;  3IUN A;  4O9D A;  5C9Z B;  3SFZ A;  3K26 A;  2P9I C;  3EQ8 A;  4RE6 A;  4J81 A;  4DNW A;  5GSA A;  2HXC A;  2OVP B;  3NVQ A;  3V4V A;  3HFQ A;  1JV2 A;  4GZ8 A;  3OW8 A;  2YNP A;  4D0K A;  5HE2 B;  3ZDX A;  4GM8 A;  3NVX A;  3AFC A;  2XDW A;  4G1E A;  5A2Q g;  2EIB A;  2P9U C;  3ZE0 A;  2H9P A;  2VDO A;  4NAA A;  3ULE C;  5C92 A;  4BCD A;  2AGX A;  4AEZ A;  4N14 A;  3KCI A;  3NIF A;  4NEN A;  3B7F A;  4CY3 A;  4AOW A;  4Z7N A;  5H17 A;  4A7J A;  2H13 A;  4EWR A;  4D9S A;  3SVW D;  4IA9 A;  5EMK B;  2PM7 B;  3DWL C;  1L0Q A;  1B9X A;  2J55 H;  3RSE C;  4L3G D;  3MUO A;  1MG3 A;  2PBI B;  2P9P C;  1A0R B;  3EQ9 A;  3PXS D;  2IUP A;  3SMR A;  1R5M A;  1UOP A;  2XZG A;  3C9C A;  2HKR A;  3E0C A;  4A11 A;  5M5S A;  2H14 A;  5M5V A;  1YR2 A;  3SCY A;  4BCB A;  4MMX A;  4J0X A;  2H6Q A;  5EM2 B;  5I5M A;  4DNU A;  5EML B;  4J8B A;  3FRX A;  2VZ3 A;  1PGU A;  3I7O A;  3UKR C;  5FA5 B;  3J80 g;  3EI2 A;  3O4H A;  4PBZ A;  5FKS A;  2P9K C;  3FM0 A;  3GD1 I;  1JMX B;  2G99 A;  1MDA H;  5TEF A;  3IJ0 A;  5AMS A;  5FKQ A;  1H2Y A;  4L3H D;  2H47 A;  3ZE1 A;  4ZOZ A;  1JMZ B;  2GC7 A;  4LGN A;  2VDL A;  2B5N A;  4H5I A;  4QRJ A;  1C9L A;  4IMM A;  3GFC A;  4FA9 D;  2H9N A;  4CY1 A;  4QAM A;  5CXB B;  3SN6 B;  5GXH A;  5E6R A;  4X63 B;  3EQ7 A;  4KFM B;  5EAM A;  2P9L C;  3O4I A;  5EAP A;  3UVN A;  2I3T A;  3BG0 A;  3IIY A;  4J86 A;  4O1Q D;  2AH1 A;  4GQB B;  3AH8 B;  4PNK B;  4AMY A;  5AFU 3;  5IT9 g;  2XE4 A;  2BKL A;  4JHP C;  2YNN A;  4J84 A;  4CI3 A;  5I5J A;  4RE5 A;  4R7A B;  4AN0 A;  4UM8 A;  4GQ1 A;  4ERZ A;  1SHY B;  3F3F A;  2H9M A;  1TYQ C;  1OMW B;  2H3X A;  2MTA H;  4Z8L A;  1QFM A;  1U8C A;  4JSP C;  3IKO A;  2I0T A;  3FCS A;  3UVM A;  2VDN A;  5FXY A;  2AGL A;  1UOO A;  4E5Z B;  2UZX B;  5TF2 A;  4A2M A;  3BG1 A;  4CI2 A;  1VZ3 A;  3JZG A;  3NVN A;  4J73 A;  1M1X A;  4H5J A;  4ZOV A;  3EI1 A;  1SQJ A;  3I7P A;  1N6F A;  2JKX A;  2TRC B;  1JTD B;  4PXW A;  4LG8 A;  4A09 A;  3MKS B;  1H2W A;  2OVR B;  3VI4 A;  4ERQ A;  4A08 B;  3P4F A;  4NSX A;  3DXM C;  4PSW B;  4G55 A;  5TDH B;  3RLM D;  3KRW B;  2XL3 A;  5FKR A;  4MK0 B;  2OK4 A;  4Y5R D;  3V4P A;  4O3T B;  4PC0 A;  5H1M A;  1QFS A;  5IJ8 E;  3MZK A;  2QZP A;  4L9O A;  4FAN D;  2I0S A;  4GGA A;  2VZ1 A;  4DNV A;  3FCU A;  4XYH A;  2IWK A;  3JPX A;  2CO0 C;  2B5L A;  3I2N A;  2CE9 A;  5CYK B;  2IUR A;  2QC5 A;  4O3U B;  5FKT A;  3IVM A;  3EI3 B;  2AQ5 A;  1TBG A;  4I79 A;  3ZDY A;  1GOT B;  4MMZ A;  4PSX B;  1N6E A;  3K27 A;  5FFO A;  2YB8 B;  5HYN B;  2Z2O A;  3SWS D;  1GOG A;  4G1M A;  2HJB A;  4FAV D;  3GC3 B;  3VI3 A;  4X61 B;  5M5R A;  1O6F A;  2EIC A;  5IC7 A;  1ERJ A;  5B4W A;  2J57 G;  5HQG A;  4A0B B;  1H2X A;  5CYK A;  3U4Y A;  4UI9 R;  3EI3 A;  4BP8 A;  1GP2 B;  5FFG A;  3IJE A;  3CFV A;  4XEI C;  2QR5 A;  3IIW A;  3UVK A;  3VH0 A;  2H68 A;  4BP9 A;  2QXV A;  1SQ9 A;  2W18 A;  4Z7Q A;  2I3S A;  2CE8 A;  5SXM A;  2AGY A;  3IUQ A;  1JJU B;  3JZH A;  3JAM g;  4FA5 D;  5FQD A;  4CY5 A;  4A0B A;  3SLE D;  2AGW A;  3SBR A;  1K32 A;  3O4G A;  5EM2 A;  1YFQ A;  3PVW B;  1E8N A;  4J78 A;  3BWS A;  3V9F A;  3ZDZ A;  4A2L A;  1B9Y A;  4D6V A;  3JRP A;  2G9A A;  2VDP A;  1XKS A;  1PEV A;  4CI1 A;  4UM9 A;  5C2V B;  4FA1 D;  4GGD A;  4J77 A;  1H2Z A;  3RFG A;  3NID A;  1TYE A;  4U1E I;  1C9I A;  5THA A;  2AH0 A;  3CIK B;  1L5G A;  3I7H A;  3N0D A;  3C5M A;  1K3I A;  4A0A B;  5E6S A;  5M61 A;  2YNO A;  2Z2N A;  3DDU A;  5CXB A;  4ESG A;  4YVD A;  4GQ2 P;  4CC9 A;  3GRE A;  4GM3 A;  4GM9 A;  4CZV A;  2I0R A;  3DXK C;  3JRO A;  3OKY B;  5H14 A;  3MZL A;  3K72 A;  4GGC A;  2VC2 A;  4BUJ C;  3RRM C;  5AJA A;  3ODT A;  4OWR A;  4E54 B;  4ZN4 A;  3W15 A;  2OIZ A;  3EMH A;  3OKW A;  3I8E A;  2Q7Q A;  5IGO A;  2VDK A;  4WK2 A;  1O6G A;  1GXR A;  3QHY B;  4ERY A;  4J79 A;  4BCC A;  4XYI A;  2GNQ A;  1U4C A;  2VDR A;  3RN1 D;  1VYH C;  4FB1 D;  1N6D A;  3SJL D;  4FHL A;  4BL0 A;  5K1C C;  4ES0 A;  2H9L A;  3I8C A;  3A0F A;  3JZN A;  3V7D B;  4FA4 D;  3SXT D;  4O45 A;  1VE6 A;  3EI4 B;  4JD2 C;  1A12 A;  2IUQ A;  3RN0 D;  3UR4 A;  3OKY A;  3MXX A;  2HYE A;  2VDQ A;  3SHF A;  2J56 H;  3DSM A;  2XYI A;  3FGB A;  4QT8 A;  4E5Z A;  2OJY A;  3EG6 A;  3I89 A;  1GOF A;  4J82 A;  4JSV C;  1E8M A;  2YMU A;  3AL9 A;  3OF7 A;  2BBK H;  1Q47 A;  1NEX B;  2B5M A;  4JSX C;  4Y7R A;  3C75 H;  3IJC A;  3NIG A;  4AX4 A;  1XIP A;  2HU7 A;  4J8G A;  3EI4 A;  3UKU C;  5KDO B;  3SBQ A;  4AMZ A;  5HDB A;  4A08 A;  4L1M A;  3PE7 A;  4WJK A;  3KRX B;  3EU7 A;  5IJ7 E;  3F3P A;  1PI6 A;  4WK0 A;  1XHM A;  4L1Q D;  5I5I A;  2IUV A;  1BPO A;  1FWX A;  2Z2P A;  4Z7O A;  3I7K A;  3K71 A;  2VDM A;  5CXC B;  1I2M B;  4J87 A;  3ORV D;  4HDJ A;  3J81 g;  3N0E A;  4A11 B;  3OTT A;  3QI0 A;  4WK4 A;  4X60 B;  3IJ1 A;  1K8K C;  1UOQ A;  4CZX A;  2HES X;  4JT5 C;  1VZ2 A;  4JHN A;  5FLX g;  4IRZ A;  3UVL A;  4FWW A;  5TEE A;  3ZWL B;  3PXW D;  3EI2 B;  1MG2 A;  1S4U X; 
#chains in the Genus database with same CATH homology
 3OF7 A;  4O2W A;  1I2M B;  3QHY B;  4JHP C;  4DNV A;  4NAA A;  3QI0 A;  3MVD K;  1JTD B;  3KCI A;  4QAM A;  4DNU A;  4NBM A;  1A12 A;  4NC4 A;  4DNW A;  4JHN A;  4L1M A;  4D9S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...