4JHNA

The crystal structure of the rpgr rcc1-like domain
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
362
structure length
361
Chain Sequence
MPDSGAVFTFGKSKFENNPGKFWFKNDVPVHLSCGDEHSAVVTGNNKLYMFGSNNWGQLGLGSKSAISKPTCVKALKPEKVKLAACGRNHTLVSTEGGNVYATGGNNEGQLGLGDTEERNTFHVISFFTSEHKIKQLSAGSNTSAALTEDGRLFMWGDNSEGQIGLKNVSNVCVPQQVTIGKPVSWISCGYYHSAFVTTDGELYVFGEPENGKLGLPNQLLGNHRTPQLVSEIPEKVIQVACGGEHTVVLTENAVYTFGLGQFGQLGLGTFLFETSEPKVIENIRDQTISYISCGENHTALITDIGLMYTFGDGRHGKLGLGLENFTNHFIPTLCSNFLRFIVKLVACGGCHMVVFAAPHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The interplay between RPGR, PDE-delta and Arl2/3 regulate the ciliary targeting of farnesylated cargo.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Unknown function
molecule keywords X-linked retinitis pigmentosa GTPase regulator
total genus 98
structure length 361
sequence length 362
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00415 RCC1 Regulator of chromosome condensation (RCC1) repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.30 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Regulator of chromosome condensation 1/beta-lactamase-inhibitor protein II 4jhnA00
3OF7A 3MVDK 4JHPC 4DNVA 4NAAA 4O2WA 4NC4A 4JHNA 4QAMA 4DNUA 4DNWA 1JTDB 4L1MA 1A12A 1I2MB 4D9SA 3QHYB 3KCIA 3QI0A 4NBMA
chains in the Genus database with same CATH superfamily
4A7JA 3RMZD 5C9ZB 4PC0A 3K27A 2UZXB 2AGYA 2AH1A 3O4JA 1Q47A 3I7OA 5CYKA 4D6VA 3PVWB 5EARA 3DXKC 4GM9A 1UOPA 3PVUB 5HQGA 1YFQA 5K1CC 3F3FA 4QL1A 4GQ1A 4BP9A 4A11B 4A09A 4CI2A 2H9NA 3EI2A 4ERQA 1RI6A 3SN6B 3T3MA 1JV2A 2HESX 4RE6A 3L4MD 3DSMA 4WK0A 3K26A 2EIDA 1NR0A 4Z7QA 1PEVA 3RSEC 4WJKA 4A2LA 2IAAA 2H6NA 3AL9A 4QQEA 3EI2B 2BKLA 4G56B 4JSVC 3SWSD 4CZYA 5FLXg 3VA6A 2Z2PA 4FA1D 2VDOA 3ZE0A 1XHMA 3VGZA 2XDWA 3C75H 2O9KA 3I2NA 5H1MA 2EICA 2H47A 1VYHC 3UR4A 5IT9g 3ZDYA 4A0AB 2IUQA 4O45A 5M5TA 2PM7B 3DWLC 3GREA 5HE0B 2H9LA 5CYKB 2CE8A 4FAND 2QR5A 1JJUB 3JRPA 3SJLD 3GC3B 3FRXA 2I3TA 1N6EA 4FA4D 3EI1B 3IURA 3F3PA 3JZNA 4J8BA 3QHYB 4U7AA 1TYQC 2CN2A 2BBKH 2H9PA 3RFGA 3N0DA 4EWRA 3ZDZA 4ERYA 3KRWB 5M61A 5GMKn 1B9YA 4JSXC 5THAA 5E6RA 3MUNA 4JSNC 4E5ZA 3C99A 1GOGA 5AJAA 3MKSB 2YNPA 2HJ4A 5E6UA 2VDKA 2OK6A 2P9SC 5HDBA 3BG1A 1UOQA 2IUPA 1MG2A 3IIYA 2B5NA 4DNWA 3UKUC 2P9UC 1I2MB 3EI3A 2OJYA 2P9LC 4NSXA 4L3HD 2OVQB 3UVMA 5I5JA 3T3PA 1MDAH 3I7LA 3MVDK 4JT5C 3JPXA 2UZYB 3NVQA 4TZ4A 4HDJA 5IJ8E 4A09B 1S4UX 2CE9A 4GM8A 1C9IA 1H2XA 5TDHB 5M5UA 3KRXB 4Y7RA 4Z8LA 1QFSA 3OKYB 5FKSA 3P4FA 4X60B 3JZGA 4BCBA 2VC2A 2TRCB 4KFMB 5EMLB 1VZ2A 4CZXA 1E5TA 4A0BB 3UVNA 5M5SA 2YMUA 3V4PA 2HYEA 2VZ3A 4BUJC 1A12A 4UM9A 3AH8B 3IUMA 2I0TA 3ULEC 5A2Qg 5B4WA 3J80g 3F3GA 4N14A 4FA5D 3PXTD 3I7HA 1SQ9A 2CNXA 5FKQA 3I8EA 2H68A 3BWSA 3GD1I 3UVLA 4J8GA 3IVMA 3DXMC 1O6GA 3OW8A 4PSXB 5CXBB 4ZOVA 4J0WA 1PI6A 3CFSB 5K19A 2GC4A 2AH0A 4LG8A 2XU7A 3V4VA 3EI4B 3MXXA 2HJBA 3K71A 2HKMA 3OKWA 4LGNA 2Z2OA 3OL2A 3NVNA 3EI4A 3MKQA 4GGAA 4L9OA 3K72A 3EQ9A 3MZKA 5HE3B 1VE6A 4G1MA 5CXBA 2Q7QA 4NC4A 2WQ8A 5H14A 4IMMA 3SLED 5IGQA 4A0BA 3I7KA 4BH6A 3NVXA 4DNUA 4FHLA 3NIFA 3I7PA 4R7AB 2H14A 2P9PC 3O4HA 3IJ0A 3EI1A 3EQ8A 4GQ2P 1C9LA 2EBSA 3IUQA 2VDPA 3I8CA 5CXCA 5CXCB 2PM9A 1L0QA 3NIDA 3OTTA 4UI9R 5EMJB 2I0RA 4O2WA 4J87A 2JKXA 1B9XA 1VE7A 4IA9A 4A0AA 5GSAA 2IWKA 4CI1A 2QC5A 4JHPC 3V9FA 4CZVA 4CI8A 4BL0A 1JMZB 2VDQA 4O3UB 5TF2A 2H13A 3ORVD 4GZ8A 3RFHA 1XKSA 3ZE2A 3RRMC 2Z2NA 4A08B 4XYIA 3SMRA 1UTCA 1N6DA 3A0FA 4XEIC 5SXMA 1U8CA 3EWEA 3PXWD 1K8KC 4WK2A 2I0SA 2VDNA 2AGXA 3E0CA 1GOFA 2IWFA 4A11A 1PGUA 2G9AA 4CY2A 3SBQA 4PXWA 3KCIA 4X3EA 3JZHA 1UOOA 4J78A 2AQ5A 4E5ZB 5I5IA 3CFVA 3K6SA 4RE5A 4BP8A 1H2ZA 1QFMA 2QXVA 1PBYB 4GMBA 4GQBB 2I3SA 2EIBA 2XZGA 4J82A 1OLZA 2J55H 2P9NC 2J56H 5KDOB 3IKOA 4PBYA 2P9KC 3SHFA 3J81g 2H9MA 4D9SA 2P9IC 4UM8A 3SVWD 4AMZA 4NENA 4L3GD 4GGDA 4JXMA 5IC7A 3UVKA 3EQ7A 4CC9A 3I89A 4CY1A 3FCSA 3PSCB 3QI0A 3BG0A 4K3JB 2OIZA 1SHYB 4A08A 4FWWA 3L4OD 3EI3B 2AGWA 2B5MA 1U4CA 2BCJB 3PE7A 4U1EI 3MMYA 4ESGA 5C2VB 5IGOA 5M5VA 4JHNA 5FFOA 5FKTA 1BPOA 1P22A 4G55A 4BCDA 4BCCA 2EIEA 5GXHA 2GNQA 1GOTB 1MG3A 2OVRB 3SBPA 4D0KA 5M5RA 4AN0A 4QT8A 4I79A 5E6SA 4NBMA 4H5JA 2VDLA 2VDMA 3SXTD 3U4YA 2MTAH 2HU5A 5IJ7E 4X63B 3V5WB 3IJEA 1GP2B 3O4IA 3JB9L 2GC7A 4K3ID 1GXRA 3ODTA 4FAVD 3OF7A 4CI3A 1K32A 3C5MA 3SCYA 5I5MA 4MMYA 3VI4A 1XIPA 1NEXB 3IUJA 3GFCA 2CO0C 2H6QA 2G99A 2VDRA 4LG9A 3N0EA 3ZDXA 1FWXA 4J77A 3OKTA 1TBGA 3VI3A 4ERZA 1YR2A 4E54A 3V7DB 3IJ1A 4AN1A 5EMMB 1ERJA 5HYNB 4J79A 4GGCA 4QRJA 4ZOYA 4XYHA 5C92A 4JD2C 4G1EA 2QZPA 4PSWB 3UVOA 4AOWA 2HXCA 4L1QD 4Z7OA 4CY3A 3AL8B 2H3XA 2HU8A 3PSLA 4AMYA 5FXYA 2PM9B 5EM2B 3DDUA 2XL3A 1R5MA 4DNVA 1VZ3A 3AFCA 3FGBA 4J81A 2XYIA 4NAAA 2IUVA 3OKYA 4JSPC 2IURA 2OVPB 4Y5RD 5EMKB 3EG6A 1GG2B 5EM2A 1K3IA 2CO0A 5C86A 3CIKB 2YNOA 4ZOZA 5TEFA 1H2YA 1E8MA 2XE4A 4CY5A 4J0XA 3I7NA 4JT6C 1O6FA 1SQJA 1QNIA 4OZUA 1M1XA 2VZ1A 4WK4A 4MMZA 4X61B 4QAMA 4AEZA 1JMXB 4O3TB 5FKRA 4ES0A 4AX4A 3IIWA 5JWZA 3MZLA 1JTDB 3ZE1A 4Z7NA 2PM6B 4MMXA 5GXIA 3HFQA 2YNNA 4PNKB 3FM0A 1N6FA 2W18A 3B7FA 5EALA 3PXSD 1U2VC 5TEEA 4GM3A 4J73A 5HE2B 5C2WB 3IJCA 5EAPA 3EU7A 2OK4A 4ZN4A 3JAMg 4IRZA 3SFZA 1E8NA 3JROA 2AGZA 5EAMA 3IULA 3W15A 4MK0B 2H6KA 5FQDA 1OMWB 4O02A 3ZWLB 4OWRA 2YBAA 2XL2A 2J57G 5FA5B 4FB1D 4A2MA 3AL8A 3IUNA 2HU7A 3O4GA 3C9CA 4PBZA 5FFGA 1T2XA 3NIGA 4YVDA 2HKRA 2AGLA 2B4EA 4FA9D 3DM0A 3RLMD 4H5IA 3MUOA 4J86A 5AMSA 4J84A 3SBRA 5H17A 3RN1D 1TYEA 3OL2B 4E54B 2YB8B 5HE1B 3EMHA 3RN0D 3UKRC 4ZOXA 5AFU3 1GOHA 1H2WA 1A0RB 1L5GA 4O1QD 2PBIB 2B5LA 3FCUA 4L1MA 3VH0A 2CN3A 4O9DA 1JOFA
chains in the Genus database with same CATH topology
3OF7A 3MVDK 4JHPC 4DNVA 4NAAA 4O2WA 4NC4A 4JHNA 4QAMA 4DNUA 4DNWA 1JTDB 4L1MA 1A12A 1I2MB 4D9SA 3QHYB 3KCIA 3QI0A 4NBMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OF7 A;  3MVD K;  4JHP C;  4DNV A;  4NAA A;  4O2W A;  4NC4 A;  4JHN A;  4QAM A;  4DNU A;  4DNW A;  1JTD B;  4L1M A;  1A12 A;  1I2M B;  4D9S A;  3QHY B;  3KCI A;  3QI0 A;  4NBM A; 
#chains in the Genus database with same CATH topology
 4A7J A;  3RMZ D;  5C9Z B;  4PC0 A;  3K27 A;  2UZX B;  2AGY A;  2AH1 A;  3O4J A;  1Q47 A;  3I7O A;  5CYK A;  4D6V A;  3PVW B;  5EAR A;  3DXK C;  4GM9 A;  1UOP A;  3PVU B;  5HQG A;  1YFQ A;  5K1C C;  3F3F A;  4QL1 A;  4GQ1 A;  4BP9 A;  4A11 B;  4A09 A;  4CI2 A;  2H9N A;  3EI2 A;  4ERQ A;  1RI6 A;  3SN6 B;  3T3M A;  1JV2 A;  2HES X;  4RE6 A;  3L4M D;  3DSM A;  4WK0 A;  3K26 A;  2EID A;  1NR0 A;  4Z7Q A;  1PEV A;  3RSE C;  4WJK A;  4A2L A;  2IAA A;  2H6N A;  3AL9 A;  4QQE A;  3EI2 B;  2BKL A;  4G56 B;  4JSV C;  3SWS D;  4CZY A;  5FLX g;  3VA6 A;  2Z2P A;  4FA1 D;  2VDO A;  3ZE0 A;  1XHM A;  3VGZ A;  2XDW A;  3C75 H;  2O9K A;  3I2N A;  5H1M A;  2EIC A;  2H47 A;  1VYH C;  3UR4 A;  5IT9 g;  3ZDY A;  4A0A B;  2IUQ A;  4O45 A;  5M5T A;  2PM7 B;  3DWL C;  3GRE A;  5HE0 B;  2H9L A;  5CYK B;  2CE8 A;  4FAN D;  2QR5 A;  1JJU B;  3JRP A;  3SJL D;  3GC3 B;  3FRX A;  2I3T A;  1N6E A;  4FA4 D;  3EI1 B;  3IUR A;  3F3P A;  3JZN A;  4J8B A;  3QHY B;  4U7A A;  1TYQ C;  2CN2 A;  2BBK H;  2H9P A;  3RFG A;  3N0D A;  4EWR A;  3ZDZ A;  4ERY A;  3KRW B;  5M61 A;  5GMK n;  1B9Y A;  4JSX C;  5THA A;  5E6R A;  3MUN A;  4JSN C;  4E5Z A;  3C99 A;  1GOG A;  5AJA A;  3MKS B;  2YNP A;  2HJ4 A;  5E6U A;  2VDK A;  2OK6 A;  2P9S C;  5HDB A;  3BG1 A;  1UOQ A;  2IUP A;  1MG2 A;  3IIY A;  2B5N A;  4DNW A;  3UKU C;  2P9U C;  1I2M B;  3EI3 A;  2OJY A;  2P9L C;  4NSX A;  4L3H D;  2OVQ B;  3UVM A;  5I5J A;  3T3P A;  1MDA H;  3I7L A;  3MVD K;  4JT5 C;  3JPX A;  2UZY B;  3NVQ A;  4TZ4 A;  4HDJ A;  5IJ8 E;  4A09 B;  1S4U X;  2CE9 A;  4GM8 A;  1C9I A;  1H2X A;  5TDH B;  5M5U A;  3KRX B;  4Y7R A;  4Z8L A;  1QFS A;  3OKY B;  5FKS A;  3P4F A;  4X60 B;  3JZG A;  4BCB A;  2VC2 A;  2TRC B;  4KFM B;  5EML B;  1VZ2 A;  4CZX A;  1E5T A;  4A0B B;  3UVN A;  5M5S A;  2YMU A;  3V4P A;  2HYE A;  2VZ3 A;  4BUJ C;  1A12 A;  4UM9 A;  3AH8 B;  3IUM A;  2I0T A;  3ULE C;  5A2Q g;  5B4W A;  3J80 g;  3F3G A;  4N14 A;  4FA5 D;  3PXT D;  3I7H A;  1SQ9 A;  2CNX A;  5FKQ A;  3I8E A;  2H68 A;  3BWS A;  3GD1 I;  3UVL A;  4J8G A;  3IVM A;  3DXM C;  1O6G A;  3OW8 A;  4PSX B;  5CXB B;  4ZOV A;  4J0W A;  1PI6 A;  3CFS B;  5K19 A;  2GC4 A;  2AH0 A;  4LG8 A;  2XU7 A;  3V4V A;  3EI4 B;  3MXX A;  2HJB A;  3K71 A;  2HKM A;  3OKW A;  4LGN A;  2Z2O A;  3OL2 A;  3NVN A;  3EI4 A;  3MKQ A;  4GGA A;  4L9O A;  3K72 A;  3EQ9 A;  3MZK A;  5HE3 B;  1VE6 A;  4G1M A;  5CXB A;  2Q7Q A;  4NC4 A;  2WQ8 A;  5H14 A;  4IMM A;  3SLE D;  5IGQ A;  4A0B A;  3I7K A;  4BH6 A;  3NVX A;  4DNU A;  4FHL A;  3NIF A;  3I7P A;  4R7A B;  2H14 A;  2P9P C;  3O4H A;  3IJ0 A;  3EI1 A;  3EQ8 A;  4GQ2 P;  1C9L A;  2EBS A;  3IUQ A;  2VDP A;  3I8C A;  5CXC A;  5CXC B;  2PM9 A;  1L0Q A;  3NID A;  3OTT A;  4UI9 R;  5EMJ B;  2I0R A;  4O2W A;  4J87 A;  2JKX A;  1B9X A;  1VE7 A;  4IA9 A;  4A0A A;  5GSA A;  2IWK A;  4CI1 A;  2QC5 A;  4JHP C;  3V9F A;  4CZV A;  4CI8 A;  4BL0 A;  1JMZ B;  2VDQ A;  4O3U B;  5TF2 A;  2H13 A;  3ORV D;  4GZ8 A;  3RFH A;  1XKS A;  3ZE2 A;  3RRM C;  2Z2N A;  4A08 B;  4XYI A;  3SMR A;  1UTC A;  1N6D A;  3A0F A;  4XEI C;  5SXM A;  1U8C A;  3EWE A;  3PXW D;  1K8K C;  4WK2 A;  2I0S A;  2VDN A;  2AGX A;  3E0C A;  1GOF A;  2IWF A;  4A11 A;  1PGU A;  2G9A A;  4CY2 A;  3SBQ A;  4PXW A;  3KCI A;  4X3E A;  3JZH A;  1UOO A;  4J78 A;  2AQ5 A;  4E5Z B;  5I5I A;  3CFV A;  3K6S A;  4RE5 A;  4BP8 A;  1H2Z A;  1QFM A;  2QXV A;  1PBY B;  4GMB A;  4GQB B;  2I3S A;  2EIB A;  2XZG A;  4J82 A;  1OLZ A;  2J55 H;  2P9N C;  2J56 H;  5KDO B;  3IKO A;  4PBY A;  2P9K C;  3SHF A;  3J81 g;  2H9M A;  4D9S A;  2P9I C;  4UM8 A;  3SVW D;  4AMZ A;  4NEN A;  4L3G D;  4GGD A;  4JXM A;  5IC7 A;  3UVK A;  3EQ7 A;  4CC9 A;  3I89 A;  4CY1 A;  3FCS A;  3PSC B;  3QI0 A;  3BG0 A;  4K3J B;  2OIZ A;  1SHY B;  4A08 A;  4FWW A;  3L4O D;  3EI3 B;  2AGW A;  2B5M A;  1U4C A;  2BCJ B;  3PE7 A;  4U1E I;  3MMY A;  4ESG A;  5C2V B;  5IGO A;  5M5V A;  4JHN A;  5FFO A;  5FKT A;  1BPO A;  1P22 A;  4G55 A;  4BCD A;  4BCC A;  2EIE A;  5GXH A;  2GNQ A;  1GOT B;  1MG3 A;  2OVR B;  3SBP A;  4D0K A;  5M5R A;  4AN0 A;  4QT8 A;  4I79 A;  5E6S A;  4NBM A;  4H5J A;  2VDL A;  2VDM A;  3SXT D;  3U4Y A;  2MTA H;  2HU5 A;  5IJ7 E;  4X63 B;  3V5W B;  3IJE A;  1GP2 B;  3O4I A;  3JB9 L;  2GC7 A;  4K3I D;  1GXR A;  3ODT A;  4FAV D;  3OF7 A;  4CI3 A;  1K32 A;  3C5M A;  3SCY A;  5I5M A;  4MMY A;  3VI4 A;  1XIP A;  1NEX B;  3IUJ A;  3GFC A;  2CO0 C;  2H6Q A;  2G99 A;  2VDR A;  4LG9 A;  3N0E A;  3ZDX A;  1FWX A;  4J77 A;  3OKT A;  1TBG A;  3VI3 A;  4ERZ A;  1YR2 A;  4E54 A;  3V7D B;  3IJ1 A;  4AN1 A;  5EMM B;  1ERJ A;  5HYN B;  4J79 A;  4GGC A;  4QRJ A;  4ZOY A;  4XYH A;  5C92 A;  4JD2 C;  4G1E A;  2QZP A;  4PSW B;  3UVO A;  4AOW A;  2HXC A;  4L1Q D;  4Z7O A;  4CY3 A;  3AL8 B;  2H3X A;  2HU8 A;  3PSL A;  4AMY A;  5FXY A;  2PM9 B;  5EM2 B;  3DDU A;  2XL3 A;  1R5M A;  4DNV A;  1VZ3 A;  3AFC A;  3FGB A;  4J81 A;  2XYI A;  4NAA A;  2IUV A;  3OKY A;  4JSP C;  2IUR A;  2OVP B;  4Y5R D;  5EMK B;  3EG6 A;  1GG2 B;  5EM2 A;  1K3I A;  2CO0 A;  5C86 A;  3CIK B;  2YNO A;  4ZOZ A;  5TEF A;  1H2Y A;  1E8M A;  2XE4 A;  4CY5 A;  4J0X A;  3I7N A;  4JT6 C;  1O6F A;  1SQJ A;  1QNI A;  4OZU A;  1M1X A;  2VZ1 A;  4WK4 A;  4MMZ A;  4X61 B;  4QAM A;  4AEZ A;  1JMX B;  4O3T B;  5FKR A;  4ES0 A;  4AX4 A;  3IIW A;  5JWZ A;  3MZL A;  1JTD B;  3ZE1 A;  4Z7N A;  2PM6 B;  4MMX A;  5GXI A;  3HFQ A;  2YNN A;  4PNK B;  3FM0 A;  1N6F A;  2W18 A;  3B7F A;  5EAL A;  3PXS D;  1U2V C;  5TEE A;  4GM3 A;  4J73 A;  5HE2 B;  5C2W B;  3IJC A;  5EAP A;  3EU7 A;  2OK4 A;  4ZN4 A;  3JAM g;  4IRZ A;  3SFZ A;  1E8N A;  3JRO A;  2AGZ A;  5EAM A;  3IUL A;  3W15 A;  4MK0 B;  2H6K A;  5FQD A;  1OMW B;  4O02 A;  3ZWL B;  4OWR A;  2YBA A;  2XL2 A;  2J57 G;  5FA5 B;  4FB1 D;  4A2M A;  3AL8 A;  3IUN A;  2HU7 A;  3O4G A;  3C9C A;  4PBZ A;  5FFG A;  1T2X A;  3NIG A;  4YVD A;  2HKR A;  2AGL A;  2B4E A;  4FA9 D;  3DM0 A;  3RLM D;  4H5I A;  3MUO A;  4J86 A;  5AMS A;  4J84 A;  3SBR A;  5H17 A;  3RN1 D;  1TYE A;  3OL2 B;  4E54 B;  2YB8 B;  5HE1 B;  3EMH A;  3RN0 D;  3UKR C;  4ZOX A;  5AFU 3;  1GOH A;  1H2W A;  1A0R B;  1L5G A;  4O1Q D;  2PBI B;  2B5L A;  3FCU A;  4L1M A;  3VH0 A;  2CN3 A;  4O9D A;  1JOF A; 
#chains in the Genus database with same CATH homology
 3OF7 A;  3MVD K;  4JHP C;  4DNV A;  4NAA A;  4O2W A;  4NC4 A;  4JHN A;  4QAM A;  4DNU A;  4DNW A;  1JTD B;  4L1M A;  1A12 A;  1I2M B;  4D9S A;  3QHY B;  3KCI A;  3QI0 A;  4NBM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...