4JHNA

The crystal structure of the rpgr rcc1-like domain
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
362
structure length
361
Chain Sequence
MPDSGAVFTFGKSKFENNPGKFWFKNDVPVHLSCGDEHSAVVTGNNKLYMFGSNNWGQLGLGSKSAISKPTCVKALKPEKVKLAACGRNHTLVSTEGGNVYATGGNNEGQLGLGDTEERNTFHVISFFTSEHKIKQLSAGSNTSAALTEDGRLFMWGDNSEGQIGLKNVSNVCVPQQVTIGKPVSWISCGYYHSAFVTTDGELYVFGEPENGKLGLPNQLLGNHRTPQLVSEIPEKVIQVACGGEHTVVLTENAVYTFGLGQFGQLGLGTFLFETSEPKVIENIRDQTISYISCGENHTALITDIGLMYTFGDGRHGKLGLGLENFTNHFIPTLCSNFLRFIVKLVACGGCHMVVFAAPHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The interplay between RPGR, PDE-delta and Arl2/3 regulate the ciliary targeting of farnesylated cargo.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Unknown function
molecule keywords X-linked retinitis pigmentosa GTPase regulator
total genus 98
structure length 361
sequence length 362
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00415 RCC1 Regulator of chromosome condensation (RCC1) repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.30 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Regulator of chromosome condensation 1/beta-lactamase-inhibitor protein II 4jhnA00
3MVDK 1I2MB 4QAMA 1JTDB 4NC4A 4NAAA 4DNWA 3QHYB 4JHNA 4DNVA 1A12A 4L1MA 3QI0A 4D9SA 4JHPC 3KCIA 4DNUA 4NBMA 4O2WA 3OF7A
chains in the Genus database with same CATH superfamily
4JSXC 4WK0A 4CI1A 2P9IC 4J79A 4A09B 4J8BA 5EMLB 5EMMB 1E8MA 4O3TB 3JZNA 4JT6C 3PE7A 3OF7A 3GC3B 4A08A 4FA9D 2XDWA 5IJ8E 4A11A 3KCIA 4BCCA 2VDLA 1B9XA 2I3TA 2VDKA 3PXSD 2H47A 4QT8A 5EMKB 1JV2A 3SWSD 4PXWA 5FFGA 2Z2OA 4AN1A 4FA4D 3EI1A 2H9NA 2HKRA 3I7KA 2VDNA 5EM2B 3RMZD 4L9OA 1FWXA 3IJ1A 2XZGA 4J78A 4PNKB 2HKMA 3U4YA 3ULEC 1ERJA 4ZOZA 3MZKA 1O6FA 1NEXB 3VI3A 4J0WA 4J8GA 5AFU3 3NIDA 4GQBB 2PM9A 2B5LA 4DNUA 2H68A 3T3PA 2AGYA 1VZ2A 3O4JA 3I89A 2OIZA 3E0CA 3SMRA 1BPOA 3V4PA 2EBSA 3SLED 3UVOA 2IURA 1VYHC 3EI4A 4GGCA 3JROA 5H1MA 4IMMA 3RFHA 3V5WB 3JRPA 2IUVA 2BKLA 2VZ3A 4GQ2P 5THAA 5JWZA 5M5UA 2CNXA 4CI2A 1E5TA 2XU7A 4ERYA 5EAMA 3PSCB 5CXCA 4A2LA 3IJ0A 2CO0A 3DSMA 3EQ7A 4ZOXA 2I0SA 5IJ7E 4JD2C 3QI0A 4GGAA 5FXYA 1GOGA 2CN3A 2YMUA 5GSAA 2VZ1A 3VA6A 4X60B 4E5ZB 5TDHB 1YR2A 3PVWB 3C99A 1JOFA 2P9PC 4O2WA 4OWRA 1P22A 4J86A 3OW8A 3BWSA 2OJYA 1UOQA 3UKUC 5CYKB 2I0TA 2H9LA 3JZGA 5TEFA 3PSLA 1RI6A 4J87A 1B9YA 3IUJA 4I79A 4NC4A 1H2XA 5A2Qg 4WJKA 3FCSA 4A08B 4XYHA 4H5IA 2CE8A 1PI6A 5HE0B 4AEZA 2HU8A 2I3SA 3MKQA 4AMYA 2HJBA 5IGOA 5FA5B 5C2VB 3MUNA 4O9DA 5EARA 4ESGA 3PXTD 4A0AB 2AH1A 3CIKB 3I2NA 3EI2B 5GXIA 4J82A 5AJAA 3NVQA 2J56H 3OKYB 3P4FA 4G1EA 5CXCB 1XHMA 1OMWB 1L5GA 3K27A 5IGQA 4CY5A 3C9CA 4HDJA 1L0QA 1XKSA 3NVXA 2WQ8A 3SHFA 2B4EA 2OVRB 3JAMg 2I0RA 4O1QD 3DXMC 4CI8A 4G55A 4NENA 1MDAH 1XIPA 5I5JA 3IUQA 4JSVC 5TEEA 2GNQA 3SBPA 4UM9A 5SXMA 3DWLC 1PGUA 3W15A 2P9NC 1GP2B 3SFZA 4ZN4A 3UVNA 2VDQA 2IWKA 3EI4B 1TBGA 2H6QA 5FKSA 3VI4A 2VDPA 2G99A 4JHNA 3EQ9A 3C5MA 2YB8B 4MMYA 3RSEC 5AMSA 1R5MA 1SQJA 3KRXB 1M1XA 1QFMA 2QR5A 3NIGA 3SXTD 4BCDA 4E54A 5HE3B 3EI3B 3EI2A 1QFSA 3L4OD 4EWRA 3MKSB 5E6SA 5E6UA 4CZYA 2XYIA 3IIWA 3KRWB 3N0DA 4UI9R 3SJLD 2UZXB 3OTTA 5C2WB 5H14A 3CFSB 3MVDK 4G56B 5FKTA 4D9SA 1NR0A 2AH0A 5IC7A 5CXBB 4PBYA 2IAAA 4QAMA 2P9SC 2CO0C 1H2WA 4Z7QA 1VE6A 3IIYA 3IURA 4AMZA 2UZYB 5FKQA 3IUNA 4A09A 4J84A 4LG9A 3IKOA 5TF2A 3N0EA 2Z2NA 3MZLA 4K3JB 3RRMC 4L1QD 1MG2A 2VDMA 4PC0A 2P9UC 3MXXA 1JMXB 4A2MA 5CYKA 1C9LA 4IA9A 4LGNA 4BH6A 4CC9A 2P9KC 4D6VA 4BL0A 4X3EA 3SBQA 5GMKn 1GOTB 2H9PA 4BP9A 1T2XA 5EAPA 1U2VC 4CZXA 1I2MB 1GOHA 2HJ4A 4E54B 4BP8A 3JPXA 3I7OA 3IJEA 2YNPA 4NSXA 3IULA 3FRXA 4Z8LA 1YFQA 5M61A 1K32A 4A0BA 4A0AA 4AOWA 3O4GA 4Y5RD 2YNNA 5E6RA 2J55H 4MK0B 1S4UX 2OVQB 4D0KA 2GC7A 3I7LA 2OK4A 2EIEA 3BG0A 3F3FA 3A0FA 3EI3A 4NAAA 1N6EA 2MTAH 4XYIA 2Z2PA 1A0RB 3GD1I 3JZHA 3O4HA 3PXWD 1UOPA 2W18A 3EWEA 5C9ZB 1GOFA 2AQ5A 3RLMD 5HE2B 3DDUA 2HYEA 2B5MA 4DNWA 5EM2A 2CN2A 3EMHA 5K1CC 5EMJB 3ORVD 4TZ4A 2J57G 2HXCA 2H9MA 2PBIB 4FAVD 3AH8B 4FA5D 3V7DB 3OL2B 3V9FA 2XL3A 2QZPA 5C92A 4J73A 4Y7RA 1UOOA 4O02A 3ZDXA 3SN6B 2AGZA 4CY3A 3CFVA 3UVLA 3ODTA 1H2YA 4JHPC 3UVMA 1C9IA 3MUOA 4OZUA 4JSNC 2CE9A 4CY2A 4GMBA 2JKXA 3UR4A 1E8NA 3AFCA 4RE5A 1OLZA 4CI3A 2EIBA 4E5ZA 4A0BB 2IUQA 4PBZA 3BG1A 3GFCA 2HU5A 3B7FA 4BUJC 1VZ3A 3VH0A 1VE7A 2H6NA 2XE4A 4GM3A 5GXHA 2VDRA 3I7HA 3IVMA 4ERZA 3ZE1A 2B5NA 5KDOB 1SQ9A 3PVUB 3T3MA 4NBMA 3ZWLB 3UVKA 2AGWA 4L1MA 1Q47A 2VDOA 1JMZB 4ES0A 5IT9g 1UTCA 3FM0A 5H17A 4UM8A 2H3XA 2IUPA 4X61B 4FA1D 1GG2B 3K6SA 2QC5A 4FAND 4G1MA 4U7AA 2AGLA 4FB1D 1MG3A 4J81A 3OKWA 1H2ZA 5M5VA 4DNVA 4BCBA 4A11B 2BCJB 5I5MA 4CY1A 2PM7B 3SCYA 3OL2A 2IWFA 3C75H 4U1EI 3DXKC 1N6FA 3IUMA 3F3GA 1GXRA 4JT5C 2GC4A 3ZDZA 5I5IA 3J81g 4CZVA 3L4MD 4YVDA 3MMYA 4GGDA 2YBAA 2H6KA 5B4WA 2AGXA 4K3ID 2OVPB 4J77A 5HDBA 4A7JA 3SVWD 4QL1A 4Z7NA 4PSXB 3VGZA 4Z7OA 3K71A 4H5JA 3UKRC 4RE6A 1PBYB 3ZE2A 3OKTA 2PM9B 4X63B 5CXBA 4R7AB 5M5RA 4WK2A 3HFQA 3ZE0A 1SHYB 5FFOA 3I7PA 3OKYA 2H13A 4L3GD 4O3UB 2QXVA 5HE1B 5FQDA 3EG6A 2YNOA 5FKRA 3I8CA 5M5SA 5M5TA 1JTDB 3I7NA 4WK4A 4IRZA 2BBKH 2TRCB 5EALA 3AL9A 3NIFA 4KFMB 4JSPC 2PM6B 3QHYB 1K8KC 4N14A 3NVNA 1TYQC 4FWWA 3O4IA 2Q7QA 4GM8A 3JB9L 3RN0D 3I8EA 3FCUA 1TYEA 2OK6A 2O9KA 2XL2A 4QRJA 2EICA 3EQ8A 3K72A 3GREA 2G9AA 3SBRA 1PEVA 4O45A 3EI1B 2H14A 4ZOYA 5FLXg 3IJCA 4PSWB 3RN1D 4AN0A 3F3PA 1O6GA 2HESX 1U4CA 4MMXA 1QNIA 4JXMA 4ZOVA 3RFGA 5C86A 3V4VA 2HU7A 3DM0A 1K3IA 3AL8A 4GQ1A 1N6DA 4XEIC 4FHLA 3ZDYA 1JJUB 4GM9A 2P9LC 3J80g 5HYNB 3FGBA 4QQEA 1A12A 3K26A 4AX4A 4L3HD 4MMZA 5K19A 4J0XA 3AL8B 4GZ8A 5HQGA 1U8CA 4ERQA 4LG8A 3EU7A 2VC2A 2EIDA
chains in the Genus database with same CATH topology
3MVDK 1I2MB 4QAMA 1JTDB 4NC4A 4NAAA 4DNWA 3QHYB 4JHNA 4DNVA 1A12A 4L1MA 3QI0A 4D9SA 4JHPC 3KCIA 4DNUA 4NBMA 4O2WA 3OF7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MVD K;  1I2M B;  4QAM A;  1JTD B;  4NC4 A;  4NAA A;  4DNW A;  3QHY B;  4JHN A;  4DNV A;  1A12 A;  4L1M A;  3QI0 A;  4D9S A;  4JHP C;  3KCI A;  4DNU A;  4NBM A;  4O2W A;  3OF7 A; 
#chains in the Genus database with same CATH topology
 4JSX C;  4WK0 A;  4CI1 A;  2P9I C;  4J79 A;  4A09 B;  4J8B A;  5EML B;  5EMM B;  1E8M A;  4O3T B;  3JZN A;  4JT6 C;  3PE7 A;  3OF7 A;  3GC3 B;  4A08 A;  4FA9 D;  2XDW A;  5IJ8 E;  4A11 A;  3KCI A;  4BCC A;  2VDL A;  1B9X A;  2I3T A;  2VDK A;  3PXS D;  2H47 A;  4QT8 A;  5EMK B;  1JV2 A;  3SWS D;  4PXW A;  5FFG A;  2Z2O A;  4AN1 A;  4FA4 D;  3EI1 A;  2H9N A;  2HKR A;  3I7K A;  2VDN A;  5EM2 B;  3RMZ D;  4L9O A;  1FWX A;  3IJ1 A;  2XZG A;  4J78 A;  4PNK B;  2HKM A;  3U4Y A;  3ULE C;  1ERJ A;  4ZOZ A;  3MZK A;  1O6F A;  1NEX B;  3VI3 A;  4J0W A;  4J8G A;  5AFU 3;  3NID A;  4GQB B;  2PM9 A;  2B5L A;  4DNU A;  2H68 A;  3T3P A;  2AGY A;  1VZ2 A;  3O4J A;  3I89 A;  2OIZ A;  3E0C A;  3SMR A;  1BPO A;  3V4P A;  2EBS A;  3SLE D;  3UVO A;  2IUR A;  1VYH C;  3EI4 A;  4GGC A;  3JRO A;  5H1M A;  4IMM A;  3RFH A;  3V5W B;  3JRP A;  2IUV A;  2BKL A;  2VZ3 A;  4GQ2 P;  5THA A;  5JWZ A;  5M5U A;  2CNX A;  4CI2 A;  1E5T A;  2XU7 A;  4ERY A;  5EAM A;  3PSC B;  5CXC A;  4A2L A;  3IJ0 A;  2CO0 A;  3DSM A;  3EQ7 A;  4ZOX A;  2I0S A;  5IJ7 E;  4JD2 C;  3QI0 A;  4GGA A;  5FXY A;  1GOG A;  2CN3 A;  2YMU A;  5GSA A;  2VZ1 A;  3VA6 A;  4X60 B;  4E5Z B;  5TDH B;  1YR2 A;  3PVW B;  3C99 A;  1JOF A;  2P9P C;  4O2W A;  4OWR A;  1P22 A;  4J86 A;  3OW8 A;  3BWS A;  2OJY A;  1UOQ A;  3UKU C;  5CYK B;  2I0T A;  2H9L A;  3JZG A;  5TEF A;  3PSL A;  1RI6 A;  4J87 A;  1B9Y A;  3IUJ A;  4I79 A;  4NC4 A;  1H2X A;  5A2Q g;  4WJK A;  3FCS A;  4A08 B;  4XYH A;  4H5I A;  2CE8 A;  1PI6 A;  5HE0 B;  4AEZ A;  2HU8 A;  2I3S A;  3MKQ A;  4AMY A;  2HJB A;  5IGO A;  5FA5 B;  5C2V B;  3MUN A;  4O9D A;  5EAR A;  4ESG A;  3PXT D;  4A0A B;  2AH1 A;  3CIK B;  3I2N A;  3EI2 B;  5GXI A;  4J82 A;  5AJA A;  3NVQ A;  2J56 H;  3OKY B;  3P4F A;  4G1E A;  5CXC B;  1XHM A;  1OMW B;  1L5G A;  3K27 A;  5IGQ A;  4CY5 A;  3C9C A;  4HDJ A;  1L0Q A;  1XKS A;  3NVX A;  2WQ8 A;  3SHF A;  2B4E A;  2OVR B;  3JAM g;  2I0R A;  4O1Q D;  3DXM C;  4CI8 A;  4G55 A;  4NEN A;  1MDA H;  1XIP A;  5I5J A;  3IUQ A;  4JSV C;  5TEE A;  2GNQ A;  3SBP A;  4UM9 A;  5SXM A;  3DWL C;  1PGU A;  3W15 A;  2P9N C;  1GP2 B;  3SFZ A;  4ZN4 A;  3UVN A;  2VDQ A;  2IWK A;  3EI4 B;  1TBG A;  2H6Q A;  5FKS A;  3VI4 A;  2VDP A;  2G99 A;  4JHN A;  3EQ9 A;  3C5M A;  2YB8 B;  4MMY A;  3RSE C;  5AMS A;  1R5M A;  1SQJ A;  3KRX B;  1M1X A;  1QFM A;  2QR5 A;  3NIG A;  3SXT D;  4BCD A;  4E54 A;  5HE3 B;  3EI3 B;  3EI2 A;  1QFS A;  3L4O D;  4EWR A;  3MKS B;  5E6S A;  5E6U A;  4CZY A;  2XYI A;  3IIW A;  3KRW B;  3N0D A;  4UI9 R;  3SJL D;  2UZX B;  3OTT A;  5C2W B;  5H14 A;  3CFS B;  3MVD K;  4G56 B;  5FKT A;  4D9S A;  1NR0 A;  2AH0 A;  5IC7 A;  5CXB B;  4PBY A;  2IAA A;  4QAM A;  2P9S C;  2CO0 C;  1H2W A;  4Z7Q A;  1VE6 A;  3IIY A;  3IUR A;  4AMZ A;  2UZY B;  5FKQ A;  3IUN A;  4A09 A;  4J84 A;  4LG9 A;  3IKO A;  5TF2 A;  3N0E A;  2Z2N A;  3MZL A;  4K3J B;  3RRM C;  4L1Q D;  1MG2 A;  2VDM A;  4PC0 A;  2P9U C;  3MXX A;  1JMX B;  4A2M A;  5CYK A;  1C9L A;  4IA9 A;  4LGN A;  4BH6 A;  4CC9 A;  2P9K C;  4D6V A;  4BL0 A;  4X3E A;  3SBQ A;  5GMK n;  1GOT B;  2H9P A;  4BP9 A;  1T2X A;  5EAP A;  1U2V C;  4CZX A;  1I2M B;  1GOH A;  2HJ4 A;  4E54 B;  4BP8 A;  3JPX A;  3I7O A;  3IJE A;  2YNP A;  4NSX A;  3IUL A;  3FRX A;  4Z8L A;  1YFQ A;  5M61 A;  1K32 A;  4A0B A;  4A0A A;  4AOW A;  3O4G A;  4Y5R D;  2YNN A;  5E6R A;  2J55 H;  4MK0 B;  1S4U X;  2OVQ B;  4D0K A;  2GC7 A;  3I7L A;  2OK4 A;  2EIE A;  3BG0 A;  3F3F A;  3A0F A;  3EI3 A;  4NAA A;  1N6E A;  2MTA H;  4XYI A;  2Z2P A;  1A0R B;  3GD1 I;  3JZH A;  3O4H A;  3PXW D;  1UOP A;  2W18 A;  3EWE A;  5C9Z B;  1GOF A;  2AQ5 A;  3RLM D;  5HE2 B;  3DDU A;  2HYE A;  2B5M A;  4DNW A;  5EM2 A;  2CN2 A;  3EMH A;  5K1C C;  5EMJ B;  3ORV D;  4TZ4 A;  2J57 G;  2HXC A;  2H9M A;  2PBI B;  4FAV D;  3AH8 B;  4FA5 D;  3V7D B;  3OL2 B;  3V9F A;  2XL3 A;  2QZP A;  5C92 A;  4J73 A;  4Y7R A;  1UOO A;  4O02 A;  3ZDX A;  3SN6 B;  2AGZ A;  4CY3 A;  3CFV A;  3UVL A;  3ODT A;  1H2Y A;  4JHP C;  3UVM A;  1C9I A;  3MUO A;  4OZU A;  4JSN C;  2CE9 A;  4CY2 A;  4GMB A;  2JKX A;  3UR4 A;  1E8N A;  3AFC A;  4RE5 A;  1OLZ A;  4CI3 A;  2EIB A;  4E5Z A;  4A0B B;  2IUQ A;  4PBZ A;  3BG1 A;  3GFC A;  2HU5 A;  3B7F A;  4BUJ C;  1VZ3 A;  3VH0 A;  1VE7 A;  2H6N A;  2XE4 A;  4GM3 A;  5GXH A;  2VDR A;  3I7H A;  3IVM A;  4ERZ A;  3ZE1 A;  2B5N A;  5KDO B;  1SQ9 A;  3PVU B;  3T3M A;  4NBM A;  3ZWL B;  3UVK A;  2AGW A;  4L1M A;  1Q47 A;  2VDO A;  1JMZ B;  4ES0 A;  5IT9 g;  1UTC A;  3FM0 A;  5H17 A;  4UM8 A;  2H3X A;  2IUP A;  4X61 B;  4FA1 D;  1GG2 B;  3K6S A;  2QC5 A;  4FAN D;  4G1M A;  4U7A A;  2AGL A;  4FB1 D;  1MG3 A;  4J81 A;  3OKW A;  1H2Z A;  5M5V A;  4DNV A;  4BCB A;  4A11 B;  2BCJ B;  5I5M A;  4CY1 A;  2PM7 B;  3SCY A;  3OL2 A;  2IWF A;  3C75 H;  4U1E I;  3DXK C;  1N6F A;  3IUM A;  3F3G A;  1GXR A;  4JT5 C;  2GC4 A;  3ZDZ A;  5I5I A;  3J81 g;  4CZV A;  3L4M D;  4YVD A;  3MMY A;  4GGD A;  2YBA A;  2H6K A;  5B4W A;  2AGX A;  4K3I D;  2OVP B;  4J77 A;  5HDB A;  4A7J A;  3SVW D;  4QL1 A;  4Z7N A;  4PSX B;  3VGZ A;  4Z7O A;  3K71 A;  4H5J A;  3UKR C;  4RE6 A;  1PBY B;  3ZE2 A;  3OKT A;  2PM9 B;  4X63 B;  5CXB A;  4R7A B;  5M5R A;  4WK2 A;  3HFQ A;  3ZE0 A;  1SHY B;  5FFO A;  3I7P A;  3OKY A;  2H13 A;  4L3G D;  4O3U B;  2QXV A;  5HE1 B;  5FQD A;  3EG6 A;  2YNO A;  5FKR A;  3I8C A;  5M5S A;  5M5T A;  1JTD B;  3I7N A;  4WK4 A;  4IRZ A;  2BBK H;  2TRC B;  5EAL A;  3AL9 A;  3NIF A;  4KFM B;  4JSP C;  2PM6 B;  3QHY B;  1K8K C;  4N14 A;  3NVN A;  1TYQ C;  4FWW A;  3O4I A;  2Q7Q A;  4GM8 A;  3JB9 L;  3RN0 D;  3I8E A;  3FCU A;  1TYE A;  2OK6 A;  2O9K A;  2XL2 A;  4QRJ A;  2EIC A;  3EQ8 A;  3K72 A;  3GRE A;  2G9A A;  3SBR A;  1PEV A;  4O45 A;  3EI1 B;  2H14 A;  4ZOY A;  5FLX g;  3IJC A;  4PSW B;  3RN1 D;  4AN0 A;  3F3P A;  1O6G A;  2HES X;  1U4C A;  4MMX A;  1QNI A;  4JXM A;  4ZOV A;  3RFG A;  5C86 A;  3V4V A;  2HU7 A;  3DM0 A;  1K3I A;  3AL8 A;  4GQ1 A;  1N6D A;  4XEI C;  4FHL A;  3ZDY A;  1JJU B;  4GM9 A;  2P9L C;  3J80 g;  5HYN B;  3FGB A;  4QQE A;  1A12 A;  3K26 A;  4AX4 A;  4L3H D;  4MMZ A;  5K19 A;  4J0X A;  3AL8 B;  4GZ8 A;  5HQG A;  1U8C A;  4ERQ A;  4LG8 A;  3EU7 A;  2VC2 A;  2EID A; 
#chains in the Genus database with same CATH homology
 3MVD K;  1I2M B;  4QAM A;  1JTD B;  4NC4 A;  4NAA A;  4DNW A;  3QHY B;  4JHN A;  4DNV A;  1A12 A;  4L1M A;  3QI0 A;  4D9S A;  4JHP C;  3KCI A;  4DNU A;  4NBM A;  4O2W A;  3OF7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...