4JHNA

The crystal structure of the rpgr rcc1-like domain
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
362
structure length
361
Chain Sequence
MPDSGAVFTFGKSKFENNPGKFWFKNDVPVHLSCGDEHSAVVTGNNKLYMFGSNNWGQLGLGSKSAISKPTCVKALKPEKVKLAACGRNHTLVSTEGGNVYATGGNNEGQLGLGDTEERNTFHVISFFTSEHKIKQLSAGSNTSAALTEDGRLFMWGDNSEGQIGLKNVSNVCVPQQVTIGKPVSWISCGYYHSAFVTTDGELYVFGEPENGKLGLPNQLLGNHRTPQLVSEIPEKVIQVACGGEHTVVLTENAVYTFGLGQFGQLGLGTFLFETSEPKVIENIRDQTISYISCGENHTALITDIGLMYTFGDGRHGKLGLGLENFTNHFIPTLCSNFLRFIVKLVACGGCHMVVFAAPHR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords X-linked retinitis pigmentosa GTPase regulator
publication title The interplay between RPGR, PDE-delta and Arl2/3 regulate the ciliary targeting of farnesylated cargo.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Unknown function
total genus 98
structure length 361
sequence length 362
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00415 RCC1 Regulator of chromosome condensation (RCC1) repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.30 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Regulator of chromosome condensation 1/beta-lactamase-inhibitor protein II 4jhnA00
3KCIA 4NBMA 1I2MB 3OF7A 4JHNA 1JTDB 4NAAA 4O2WA 4D9SA 4DNWA 3MVDK 1A12A 3QI0A 4L1MA 4QAMA 3QHYB 4DNVA 4DNUA 4NC4A 4JHPC
chains in the Genus database with same CATH superfamily
4O45A 5TEEA 3ZWLB 4OWRA 2IAAA 2IWKA 2HKMA 4PSXB 4PSWB 5C9ZB 5JWZA 3O4GA 5TF2A 3RN0D 4J82A 3FCSA 4IA9A 4IMMA 5FFOA 4XYIA 4K3ID 1VZ2A 3C9CA 3SXTD 1ERJA 4ZOXA 4A0AB 1GXRA 3EI3A 4DNVA 3OKYB 4BCDA 2UZXB 3UVMA 4ESGA 4GQ2P 3CFVA 5A2Qg 2GNQA 2BKLA 5EMKB 3SBPA 3AL9A 2B5LA 3P4FA 3DXKC 3VI4A 2HKRA 2EIBA 3V9FA 1JMXB 4FA4D 2AGZA 3OW8A 3ZDZA 3V4PA 1XIPA 3QI0A 4FAND 4J78A 5E6RA 4AOWA 4J87A 5EMMB 3MMYA 3RLMD 4E54B 3RFGA 4A2MA 4J79A 3I7OA 4U1EI 2P9KC 3T3MA 1UOPA 1JJUB 3SMRA 3MZKA 4JXMA 4ZOYA 4BUJC 2HJ4A 3I89A 5M61A 2B5NA 3OKTA 2I0RA 4A0BB 1B9XA 2HXCA 4PXWA 2HJBA 3JPXA 2OVRB 4AN1A 1PBYB 1UOQA 2YB8B 4GM9A 3EU7A 5GXHA 5FKSA 5HDBA 3EI1A 1L5GA 4IRZA 5HYNB 2H14A 3DXMC 3I8EA 1N6FA 3IJCA 4BP8A 1R5MA 4I79A 1YR2A 2PM6B 4QRJA 2W18A 4A0BA 1BPOA 2CE8A 3AL8B 2XU7A 5SXMA 5I5JA 2VDMA 3IULA 3IKOA 3EI4A 3BG1A 5HE3B 3U4YA 4AEZA 4A08B 1GOTB 3NVXA 3SLED 5FA5B 4GM3A 3L4OD 5GXIA 4D0KA 5K1CC 4D6VA 4CY3A 4L3GD 1GP2B 5HE0B 2CE9A 3RRMC 3UVOA 1O6FA 3IUMA 4JHNA 3GD1I 3NVQA 2YNOA 4JD2C 4CY2A 3AL8A 4GGCA 5M5TA 4OZUA 4G1EA 4BCBA 2EICA 4NSXA 3V5WB 2VZ1A 4Y7RA 3MXXA 5GSAA 4X61B 4Z8LA 3EQ9A 3BG0A 4H5IA 1SHYB 3HFQA 3UR4A 5AJAA 3JB9L 5THAA 3EI3B 2VC2A 3MUNA 4JHPC 3RFHA 3SBQA 3E0CA 3JRPA 2XYIA 4MMYA 4PNKB 4FAVD 4Z7QA 4J0WA 4Z7OA 3B7FA 4L3HD 3F3GA 4FWWA 1PI6A 5H17A 4CZYA 3ZDXA 3EI2B 3ZE2A 2EBSA 3IIWA 1YFQA 2H47A 5IGQA 3BWSA 2P9NC 3O4JA 3I7NA 2HU7A 3NVNA 2H9MA 5HQGA 3UVKA 5EM2B 5H14A 4PBZA 1VE6A 2YNPA 5FKQA 4ERYA 4H5JA 3RSEC 1TYQC 5AMSA 3ZE1A 2H9NA 1JTDB 1JOFA 1UOOA 3SWSD 5IJ7E 4CY1A 1B9YA 5C86A 5FXYA 2TRCB 3A0FA 1H2YA 2I3SA 4QT8A 3CFSB 2I3TA 5M5RA 1VZ3A 2VDRA 3EI2A 4GGDA 1H2XA 1QFSA 4L9OA 1GOHA 1S4UX 3JZGA 1E8NA 4AMZA 2Z2NA 5I5MA 3F3PA 4JSVC 4NENA 1L0QA 5EM2A 2H6NA 3PE7A 3EI1B 3K27A 3IVMA 1C9IA 3DDUA 1NR0A 2AGYA 3PVWB 2AGLA 2IUPA 3SN6B 3GC3B 3KCIA 4A11B 3T3PA 3KRWB 4GQ1A 2HESX 3DSMA 2AGWA 4XYHA 3MUOA 4D9SA 2EIDA 2PM7B 2AGXA 5K19A 2H9LA 2IUQA 4X63B 3FM0A 1P22A 1NEXB 5TDHB 2B4EA 4G1MA 3EI4B 4PBYA 2XL2A 4J86A 3VI3A 4L1MA 3I7HA 4QL1A 2CO0A 4J0XA 1MG2A 3ULEC 2AH1A 3I2NA 5C92A 4CY5A 2UZYB 2BBKH 2O9KA 3ORVD 1GG2B 4A11A 4ES0A 1GOFA 3SVWD 4WK2A 5M5VA 4N14A 5FKRA 2YBAA 4O9DA 4WK0A 1H2WA 4BL0A 5CXBA 3CIKB 3UKRC 3J80g 3C99A 3VGZA 2H13A 5HE2B 2PBIB 1U4CA 4GMBA 2XE4A 4X3EA 4A09A 2VDPA 2QC5A 3EMHA 3V7DB 3AFCA 3MZLA 5FLXg 2YNNA 4J8BA 1I2MB 2J56H 3UVNA 2IUVA 2H6QA 3JZHA 4ZOZA 4JSPC 2IURA 4KFMB 1E8MA 4DNWA 1XHMA 4A7JA 2OIZA 4FA5D 1K8KC 1XKSA 1VE7A 3PSCB 2CN3A 3I7KA 1GOGA 1K32A 4CI3A 2VDOA 4MK0B 3IUQA 5EAPA 3PSLA 4JT5C 3EWEA 3DM0A 1E5TA 1U2VC 2Z2PA 4GZ8A 1O6GA 4AX4A 2XL3A 3OKWA 4BH6A 3C75H 3K72A 3ODTA 3IURA 2WQ8A 4J77A 4E5ZA 4UM8A 2OJYA 2VDKA 2PM9A 1PEVA 1UTCA 2OK4A 4EWRA 2JKXA 5H1MA 3MKQA 5M5UA 3JAMg 4LG9A 2VDLA 5HE1B 2I0TA 3OL2A 3K71A 5EMLB 2AQ5A 1SQ9A 3SHFA 3C5MA 4J84A 3N0EA 2QXVA 2Q7QA 5C2VB 1C9LA 4MMZA 1RI6A 3IUNA 3W15A 2IWFA 4QQEA 3SJLD 4TZ4A 4LGNA 2CN2A 3F3FA 2P9IC 3V4VA 4JSXC 4Z7NA 2BCJB 4JT6C 1TBGA 1VYHC 4RE6A 4QAMA 5AFU3 3EQ7A 2QZPA 1H2ZA 2HU8A 4JSNC 5CYKB 4J81A 2VZ3A 5E6UA 2GC7A 4DNUA 1A0RB 2VDQA 4RE5A 4NC4A 3PXWD 3PXSD 3KRXB 4ERQA 3VA6A 4CI8A 3O4IA 4O2WA 3JZNA 3IIYA 1T2XA 3PVUB 4O3TB 2P9UC 3RMZD 2AH0A 3EG6A 4L1QD 5CXBB 4AMYA 3MVDK 2J57G 4U7AA 4G56B 4GGAA 4A0AA 3GREA 4CZVA 3NIDA 5KDOB 4PC0A 5GMKn 3OKYA 4G55A 2HYEA 1QNIA 4XEIC 5CYKA 3SCYA 1SQJA 4LG8A 5EMJB 5FFGA 4FA9D 4A09B 2I0SA 1Q47A 2H3XA 3NIGA 3ZE0A 4FHLA 2QR5A 2OVQB 4NAAA 3FCUA 2G99A 2OVPB 3I7PA 3O4HA 1MDAH 4BP9A 3OTTA 5EAMA 4K3JB 1U8CA 4Y5RD 5IT9g 3IUJA 4R7AB 4E54A 5IGOA 3L4MD 3QHYB 5B4WA 3VH0A 2H6KA 2Z2OA 3IJEA 1N6EA 4O3UB 4GQBB 3ZDYA 4ZN4A 5IJ8E 4CI1A 2XZGA 1PGUA 4NBMA 3NIFA 3OF7A 4WK4A 4ERZA 3IJ1A 1OMWB 2VDNA 4UI9R 5CXCB 5EALA 3MKSB 4CZXA 3JROA 3IJ0A 2OK6A 1TYEA 2P9SC 3FGBA 4O1QD 4E5ZB 4YVDA 1JMZB 3EQ8A 2PM9B 1A12A 3J81g 2H68A 1MG3A 4UM9A 4BCCA 3GFCA 3AH8B 4FB1D 2EIEA 2XDWA 3I8CA 4O02A 4WJKA 5EARA 4CC9A 2H9PA 2P9PC 2YMUA 3K26A 3OL2B 4X60B 3UKUC 5FQDA 5IC7A 1JV2A 3FRXA 4AN0A 2P9LC 4CI2A 2HU5A 3K6SA 1OLZA 4A2LA 5M5SA 1QFMA 4J73A 5CXCA 1FWXA 5E6SA 2G9AA 2B5MA 1M1XA 5FKTA 3UVLA 5C2WB 4FA1D 3PXTD 1K3IA 2MTAH 4HDJA 3I7LA 4MMXA 3RN1D 4A08A 4J8GA 4GM8A 3N0DA 5TEFA 2GC4A 1N6DA 3SBRA 2CNXA 3DWLC 5I5IA 3SFZA 2CO0C 4ZOVA 2J55H
chains in the Genus database with same CATH topology
3KCIA 4NBMA 1I2MB 3OF7A 4JHNA 1JTDB 4NAAA 4O2WA 4D9SA 4DNWA 3MVDK 1A12A 3QI0A 4L1MA 4QAMA 3QHYB 4DNVA 4DNUA 4NC4A 4JHPC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KCI A;  4NBM A;  1I2M B;  3OF7 A;  4JHN A;  1JTD B;  4NAA A;  4O2W A;  4D9S A;  4DNW A;  3MVD K;  1A12 A;  3QI0 A;  4L1M A;  4QAM A;  3QHY B;  4DNV A;  4DNU A;  4NC4 A;  4JHP C; 
#chains in the Genus database with same CATH topology
 4O45 A;  5TEE A;  3ZWL B;  4OWR A;  2IAA A;  2IWK A;  2HKM A;  4PSX B;  4PSW B;  5C9Z B;  5JWZ A;  3O4G A;  5TF2 A;  3RN0 D;  4J82 A;  3FCS A;  4IA9 A;  4IMM A;  5FFO A;  4XYI A;  4K3I D;  1VZ2 A;  3C9C A;  3SXT D;  1ERJ A;  4ZOX A;  4A0A B;  1GXR A;  3EI3 A;  4DNV A;  3OKY B;  4BCD A;  2UZX B;  3UVM A;  4ESG A;  4GQ2 P;  3CFV A;  5A2Q g;  2GNQ A;  2BKL A;  5EMK B;  3SBP A;  3AL9 A;  2B5L A;  3P4F A;  3DXK C;  3VI4 A;  2HKR A;  2EIB A;  3V9F A;  1JMX B;  4FA4 D;  2AGZ A;  3OW8 A;  3ZDZ A;  3V4P A;  1XIP A;  3QI0 A;  4FAN D;  4J78 A;  5E6R A;  4AOW A;  4J87 A;  5EMM B;  3MMY A;  3RLM D;  4E54 B;  3RFG A;  4A2M A;  4J79 A;  3I7O A;  4U1E I;  2P9K C;  3T3M A;  1UOP A;  1JJU B;  3SMR A;  3MZK A;  4JXM A;  4ZOY A;  4BUJ C;  2HJ4 A;  3I89 A;  5M61 A;  2B5N A;  3OKT A;  2I0R A;  4A0B B;  1B9X A;  2HXC A;  4PXW A;  2HJB A;  3JPX A;  2OVR B;  4AN1 A;  1PBY B;  1UOQ A;  2YB8 B;  4GM9 A;  3EU7 A;  5GXH A;  5FKS A;  5HDB A;  3EI1 A;  1L5G A;  4IRZ A;  5HYN B;  2H14 A;  3DXM C;  3I8E A;  1N6F A;  3IJC A;  4BP8 A;  1R5M A;  4I79 A;  1YR2 A;  2PM6 B;  4QRJ A;  2W18 A;  4A0B A;  1BPO A;  2CE8 A;  3AL8 B;  2XU7 A;  5SXM A;  5I5J A;  2VDM A;  3IUL A;  3IKO A;  3EI4 A;  3BG1 A;  5HE3 B;  3U4Y A;  4AEZ A;  4A08 B;  1GOT B;  3NVX A;  3SLE D;  5FA5 B;  4GM3 A;  3L4O D;  5GXI A;  4D0K A;  5K1C C;  4D6V A;  4CY3 A;  4L3G D;  1GP2 B;  5HE0 B;  2CE9 A;  3RRM C;  3UVO A;  1O6F A;  3IUM A;  4JHN A;  3GD1 I;  3NVQ A;  2YNO A;  4JD2 C;  4CY2 A;  3AL8 A;  4GGC A;  5M5T A;  4OZU A;  4G1E A;  4BCB A;  2EIC A;  4NSX A;  3V5W B;  2VZ1 A;  4Y7R A;  3MXX A;  5GSA A;  4X61 B;  4Z8L A;  3EQ9 A;  3BG0 A;  4H5I A;  1SHY B;  3HFQ A;  3UR4 A;  5AJA A;  3JB9 L;  5THA A;  3EI3 B;  2VC2 A;  3MUN A;  4JHP C;  3RFH A;  3SBQ A;  3E0C A;  3JRP A;  2XYI A;  4MMY A;  4PNK B;  4FAV D;  4Z7Q A;  4J0W A;  4Z7O A;  3B7F A;  4L3H D;  3F3G A;  4FWW A;  1PI6 A;  5H17 A;  4CZY A;  3ZDX A;  3EI2 B;  3ZE2 A;  2EBS A;  3IIW A;  1YFQ A;  2H47 A;  5IGQ A;  3BWS A;  2P9N C;  3O4J A;  3I7N A;  2HU7 A;  3NVN A;  2H9M A;  5HQG A;  3UVK A;  5EM2 B;  5H14 A;  4PBZ A;  1VE6 A;  2YNP A;  5FKQ A;  4ERY A;  4H5J A;  3RSE C;  1TYQ C;  5AMS A;  3ZE1 A;  2H9N A;  1JTD B;  1JOF A;  1UOO A;  3SWS D;  5IJ7 E;  4CY1 A;  1B9Y A;  5C86 A;  5FXY A;  2TRC B;  3A0F A;  1H2Y A;  2I3S A;  4QT8 A;  3CFS B;  2I3T A;  5M5R A;  1VZ3 A;  2VDR A;  3EI2 A;  4GGD A;  1H2X A;  1QFS A;  4L9O A;  1GOH A;  1S4U X;  3JZG A;  1E8N A;  4AMZ A;  2Z2N A;  5I5M A;  3F3P A;  4JSV C;  4NEN A;  1L0Q A;  5EM2 A;  2H6N A;  3PE7 A;  3EI1 B;  3K27 A;  3IVM A;  1C9I A;  3DDU A;  1NR0 A;  2AGY A;  3PVW B;  2AGL A;  2IUP A;  3SN6 B;  3GC3 B;  3KCI A;  4A11 B;  3T3P A;  3KRW B;  4GQ1 A;  2HES X;  3DSM A;  2AGW A;  4XYH A;  3MUO A;  4D9S A;  2EID A;  2PM7 B;  2AGX A;  5K19 A;  2H9L A;  2IUQ A;  4X63 B;  3FM0 A;  1P22 A;  1NEX B;  5TDH B;  2B4E A;  4G1M A;  3EI4 B;  4PBY A;  2XL2 A;  4J86 A;  3VI3 A;  4L1M A;  3I7H A;  4QL1 A;  2CO0 A;  4J0X A;  1MG2 A;  3ULE C;  2AH1 A;  3I2N A;  5C92 A;  4CY5 A;  2UZY B;  2BBK H;  2O9K A;  3ORV D;  1GG2 B;  4A11 A;  4ES0 A;  1GOF A;  3SVW D;  4WK2 A;  5M5V A;  4N14 A;  5FKR A;  2YBA A;  4O9D A;  4WK0 A;  1H2W A;  4BL0 A;  5CXB A;  3CIK B;  3UKR C;  3J80 g;  3C99 A;  3VGZ A;  2H13 A;  5HE2 B;  2PBI B;  1U4C A;  4GMB A;  2XE4 A;  4X3E A;  4A09 A;  2VDP A;  2QC5 A;  3EMH A;  3V7D B;  3AFC A;  3MZL A;  5FLX g;  2YNN A;  4J8B A;  1I2M B;  2J56 H;  3UVN A;  2IUV A;  2H6Q A;  3JZH A;  4ZOZ A;  4JSP C;  2IUR A;  4KFM B;  1E8M A;  4DNW A;  1XHM A;  4A7J A;  2OIZ A;  4FA5 D;  1K8K C;  1XKS A;  1VE7 A;  3PSC B;  2CN3 A;  3I7K A;  1GOG A;  1K32 A;  4CI3 A;  2VDO A;  4MK0 B;  3IUQ A;  5EAP A;  3PSL A;  4JT5 C;  3EWE A;  3DM0 A;  1E5T A;  1U2V C;  2Z2P A;  4GZ8 A;  1O6G A;  4AX4 A;  2XL3 A;  3OKW A;  4BH6 A;  3C75 H;  3K72 A;  3ODT A;  3IUR A;  2WQ8 A;  4J77 A;  4E5Z A;  4UM8 A;  2OJY A;  2VDK A;  2PM9 A;  1PEV A;  1UTC A;  2OK4 A;  4EWR A;  2JKX A;  5H1M A;  3MKQ A;  5M5U A;  3JAM g;  4LG9 A;  2VDL A;  5HE1 B;  2I0T A;  3OL2 A;  3K71 A;  5EML B;  2AQ5 A;  1SQ9 A;  3SHF A;  3C5M A;  4J84 A;  3N0E A;  2QXV A;  2Q7Q A;  5C2V B;  1C9L A;  4MMZ A;  1RI6 A;  3IUN A;  3W15 A;  2IWF A;  4QQE A;  3SJL D;  4TZ4 A;  4LGN A;  2CN2 A;  3F3F A;  2P9I C;  3V4V A;  4JSX C;  4Z7N A;  2BCJ B;  4JT6 C;  1TBG A;  1VYH C;  4RE6 A;  4QAM A;  5AFU 3;  3EQ7 A;  2QZP A;  1H2Z A;  2HU8 A;  4JSN C;  5CYK B;  4J81 A;  2VZ3 A;  5E6U A;  2GC7 A;  4DNU A;  1A0R B;  2VDQ A;  4RE5 A;  4NC4 A;  3PXW D;  3PXS D;  3KRX B;  4ERQ A;  3VA6 A;  4CI8 A;  3O4I A;  4O2W A;  3JZN A;  3IIY A;  1T2X A;  3PVU B;  4O3T B;  2P9U C;  3RMZ D;  2AH0 A;  3EG6 A;  4L1Q D;  5CXB B;  4AMY A;  3MVD K;  2J57 G;  4U7A A;  4G56 B;  4GGA A;  4A0A A;  3GRE A;  4CZV A;  3NID A;  5KDO B;  4PC0 A;  5GMK n;  3OKY A;  4G55 A;  2HYE A;  1QNI A;  4XEI C;  5CYK A;  3SCY A;  1SQJ A;  4LG8 A;  5EMJ B;  5FFG A;  4FA9 D;  4A09 B;  2I0S A;  1Q47 A;  2H3X A;  3NIG A;  3ZE0 A;  4FHL A;  2QR5 A;  2OVQ B;  4NAA A;  3FCU A;  2G99 A;  2OVP B;  3I7P A;  3O4H A;  1MDA H;  4BP9 A;  3OTT A;  5EAM A;  4K3J B;  1U8C A;  4Y5R D;  5IT9 g;  3IUJ A;  4R7A B;  4E54 A;  5IGO A;  3L4M D;  3QHY B;  5B4W A;  3VH0 A;  2H6K A;  2Z2O A;  3IJE A;  1N6E A;  4O3U B;  4GQB B;  3ZDY A;  4ZN4 A;  5IJ8 E;  4CI1 A;  2XZG A;  1PGU A;  4NBM A;  3NIF A;  3OF7 A;  4WK4 A;  4ERZ A;  3IJ1 A;  1OMW B;  2VDN A;  4UI9 R;  5CXC B;  5EAL A;  3MKS B;  4CZX A;  3JRO A;  3IJ0 A;  2OK6 A;  1TYE A;  2P9S C;  3FGB A;  4O1Q D;  4E5Z B;  4YVD A;  1JMZ B;  3EQ8 A;  2PM9 B;  1A12 A;  3J81 g;  2H68 A;  1MG3 A;  4UM9 A;  4BCC A;  3GFC A;  3AH8 B;  4FB1 D;  2EIE A;  2XDW A;  3I8C A;  4O02 A;  4WJK A;  5EAR A;  4CC9 A;  2H9P A;  2P9P C;  2YMU A;  3K26 A;  3OL2 B;  4X60 B;  3UKU C;  5FQD A;  5IC7 A;  1JV2 A;  3FRX A;  4AN0 A;  2P9L C;  4CI2 A;  2HU5 A;  3K6S A;  1OLZ A;  4A2L A;  5M5S A;  1QFM A;  4J73 A;  5CXC A;  1FWX A;  5E6S A;  2G9A A;  2B5M A;  1M1X A;  5FKT A;  3UVL A;  5C2W B;  4FA1 D;  3PXT D;  1K3I A;  2MTA H;  4HDJ A;  3I7L A;  4MMX A;  3RN1 D;  4A08 A;  4J8G A;  4GM8 A;  3N0D A;  5TEF A;  2GC4 A;  1N6D A;  3SBR A;  2CNX A;  3DWL C;  5I5I A;  3SFZ A;  2CO0 C;  4ZOV A;  2J55 H; 
#chains in the Genus database with same CATH homology
 3KCI A;  4NBM A;  1I2M B;  3OF7 A;  4JHN A;  1JTD B;  4NAA A;  4O2W A;  4D9S A;  4DNW A;  3MVD K;  1A12 A;  3QI0 A;  4L1M A;  4QAM A;  3QHY B;  4DNV A;  4DNU A;  4NC4 A;  4JHP C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...