1S4UX

Crystal structure analysis of the beta-propeller protein ski8p
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
390
structure length
356
Chain Sequence
KVFIATANAGKAHDADIFSVSACNSFTVSCSGDGYLKVWDNKLLDNENPKDKSYSHFVHKSGLHHVDVLQAIERDAFELCLVATTSFSGDLLFYRITRKKVIFEKLDLLDSDMKKHSFWALKWGASLSHRLVATDVKGTTYIWKFHPFADESNSLTLNWSPTLELQGTVESPMTPSQFATSVDISERGLIATGFNNGTVQISELSTLRPLYNFENSIRSVKFSPQGSLLAIAHDSNSFGCITLYETEFGERIGSLSVFAHSSWVMSLSFNDSGETLCSAGWDGKLRFWDVKTKERITTLNMHCDDIEIEEDILAVDEHGDSLAEPGVFDVKFLKKGWRSNESLCCVCLDRSIRWFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antiviral protein SKI8
publication title Crystal structure of Ski8p, a WD-repeat protein with dual roles in mRNA metabolism and meiotic recombination
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Antiviral protein
total genus 85
structure length 356
sequence length 390
ec nomenclature
pdb deposition date 2004-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 1s4uX00
5GMKn 3IIYA 4PSXB 3ULEC 3PXTD 4BH6A 4A2MA 4ZOXA 5EM2A 5FLXg 1L0QA 3VH0A 3BG1A 2PBIB 3PXSD 5C9ZB 4J0XA 5FKTA 5THAA 4D0KA 4O3TB 3BG0A 3DWLC 5HE2B 4BUJC 1Q47A 2H9PA 3JZGA 3NVNA 5IT9g 3I7LA 3W15A 3K27A 2CE9A 3EG6A 5B4WA 3PSLA 4AOWA 2I0SA 1A0RB 5EMJB 3SCYA 3EMHA 4CZXA 4JSVC 3EI3B 1NR0A 3CFSB 1SQJA 1TBGA 4QRJA 4A09A 4GMBA 1ERJA 4ES0A 4PBZA 3UVMA 3L4OD 4OWRA 5I5JA 3RMZD 1NEXB 1S4UX 3DSMA 2P9KC 4FA4D 2AGZA 5K19A 2IWKA 2HKRA 1MDAH 4AEZA 2CO0A 4CY5A 2OK4A 3CIKB 2H6NA 3SBRA 2OIZA 5GXIA 5HQGA 4CZVA 3OKTA 3I89A 2H47A 2PM9B 2CN2A 1XIPA 2H13A 3UKUC 2XL3A 4PXWA 5CYKA 4JD2C 2I0RA 4J78A 3IJ0A 1FWXA 4Y7RA 4FA5D 4D6VA 4A0BB 3FM0A 4JT5C 3MZLA 4A7JA 1K8KC 2QXVA 4QL1A 5IGOA 1N6EA 2I3SA 3UVOA 3UVKA 4FB1D 4O1QD 3I7OA 3GFCA 4CZYA 5IGQA 3F3PA 2XYIA 2H6KA 2I3TA 4QT8A 4J8BA 5FKRA 3OL2A 4ERQA 3P4FA 3RN1D 2I0TA 3EI1B 4A11A 3SWSD 4FA9D 4IMMA 5CXCB 5AJAA 4KFMB 2QC5A 3EWEA 3OKYA 1PEVA 2Z2PA 4J84A 3J80g 3ODTA 4ZOYA 1SQ9A 3C99A 3UR4A 1PI6A 4ERYA 3L4MD 3JAMg 2IURA 2H9MA 3IIWA 4HDJA 4A0AA 3C5MA 5FKQA 4LG9A 2P9PC 4CI8A 2YBAA 2HESX 1B9XA 3SVWD 2OK6A 5TEFA 3VGZA 2G99A 4O9DA 4ZOZA 3HFQA 2H9NA 2GNQA 3SFZA 5EAMA 3NVQA 4ZOVA 3DM0A 4G56B 4K3ID 2AQ5A 3EI4A 3F3FA 4GQBB 3IJCA 4JSNC 2PM7B 4FA1D 5EALA 1RI6A 4NSXA 5TEEA 5FKSA 3I7KA 5IJ8E 5EAPA 2GC4A 4PNKB 3EI3A 2UZYB 3E0CA 5HE1B 3A0FA 3EI2B 2G9AA 4GM3A 2MTAH 4OZUA 2HKMA 3AH8B 1JJUB 2OVPB 3SN6B 4J82A 2J56H 5I5MA 3SBPA 2CNXA 1N6FA 2AH1A 4L9OA 1TYQC 2Z2NA 2GC7A 4JSPC 4XEIC 2CN3A 4E54B 5FXYA 1PBYB 5H17A 5IJ7E 2HYEA 1GOTB 1JMXB 3MXXA 4GGCA 2YMUA 2P9IC 2J57G 2BBKH 2AH0A 2IAAA 2PM9A 3C75H 4X3EA 4A08B 3BWSA 2IUPA 2OVRB 2TRCB 5K1CC 1MG3A 2YNNA 4H5IA 1QNIA 5EMMB 3MKQA 4TZ4A 4A0BA 4JSXC 5C2WB 3V9FA 1SHYB 5AMSA 4ERZA 2YB8B 3RN0D 2CE8A 4O45A 3SBQA 2B5NA 3RLMD 2B5MA 5C2VB 1OLZA 4R7AB 5IC7A 2P9LC 5CYKB 4GQ1A 4FAVD 4J8GA 2AGYA 3RSEC 4CY2A 5H1MA 5H14A 3JROA 3EI1A 1XKSA 3JZHA 2H14A 4Y5RD 5CXCA 4ZN4A 4X63B 4J86A 3DXMC 4L3GD 4J0WA 2P9UC 1XHMA 3GREA 3JB9L 1GP2B 2UZXB 3UVLA 4PBYA 4IA9A 3NVXA 3FRXA 4YVDA 5FA5B 3AFCA 2Q7QA 4E5ZB 5CXBB 4A11B 2B4EA 2AGLA 3MKSB 3MMYA 3KRWB 4JXMA 5EARA 1U2VC 1PGUA 3SMRA 2O9KA 4U7AA 3I8EA 3CFVA 4CY3A 3DXKC 4CI2A 4EWRA 4GGAA 5KDOB 2IWFA 1OMWB 5JWZA 3PE7A 4GZ8A 3N0DA 4GGDA 4O3UB 2H6QA 4H5JA 2Z2OA 4K3JB 3RFGA 3AL8B 4LG8A 3J81g 1GXRA 3JPXA 4L1QD 4A0AB 4FWWA 4XYIA 4XYHA 3OKWA 3RRMC 2HJ4A 4LGNA 5FQDA 5EM2B 3EI2A 5GSAA 2XU7A 2IUVA 2AGWA 4N14A 4J77A 3V5WB 3RFHA 3N0EA 3SXTD 4CI3A 3EI4B 4BL0A 5EMLB 4E54A 4CY1A 3I2NA 3SJLD 5EMKB 3SHFA 2W18A 2H9LA 3VA6A 4MK0B 4CI1A 4GQ2P 5HE3B 3I8CA 3UKRC 2H68A 2YNOA 4X61B 4U1EI 4A09B 1VYHC 4A08A 2YNPA 3PVWB 4A2LA 4I79A 2IUQA 5A2Qg 2P9SC 3AL9A 3V7DB 4Z8LA 1K32A 1JMZB 3ZWLB 5TF2A 3OW8A 2P9NC 1U4CA 2PM6B 3UVNA 3B7FA 3U4YA 2HXCA 2XL2A 4ESGA 5HYNB 2J55H 3PVUB 3PSCB 3JZNA 4J81A 4GM8A 1JOFA 3I7NA 3MZKA 2OJYA 2HJBA 3I7PA 3PXWD 4J87A 2OVQB 4GM9A 4J73A 5SXMA 3JRPA 1YFQA 1R5MA 3ORVD 5I5IA 1N6DA 5HE0B 3OL2B 4E5ZA 5CXBA 2B5LA 1P22A 3IJ1A 3I7HA 4PSWB 3SLED 3IKOA 4QQEA 3K26A 2AGXA 3FGBA 3KRXB 3OKYB 4J79A 4UI9R 3F3GA 1B9YA 5TDHB 3C9CA 4PC0A 2EBSA 3OTTA 3EU7A 2CO0C 4CC9A 2BCJB 4FHLA 4FAND 4X60B 4L3HD 1GG2B 1MG2A 2H3XA 5AFU3 5GXHA 4JT6C 3AL8A
chains in the Genus database with same CATH superfamily
2VDQA 1T2XA 5GMKn 3IIYA 3GD1I 4PSXB 3ULEC 3PXTD 4BH6A 5E6RA 4A2MA 4ZOXA 1QFSA 5EM2A 1L0QA 5FLXg 3VH0A 1VZ2A 4L1MA 3BG1A 2PBIB 3PXSD 5C9ZB 4J0XA 5FKTA 5THAA 3V4VA 4D0KA 4O3TB 3BG0A 2HU7A 2BKLA 3DWLC 5HE2B 4BUJC 1Q47A 2H9PA 3JZGA 3NVNA 5IT9g 3I7LA 3W15A 1GOGA 3K27A 2CE9A 3EG6A 3IURA 4BCDA 5B4WA 3PSLA 4AOWA 2I0SA 1A0RB 5EMJB 3SCYA 3EMHA 4CZXA 4JSVC 3EI3B 1NR0A 3CFSB 1SQJA 1TBGA 4QRJA 4A09A 5HDBA 4GMBA 1ERJA 4ES0A 4PBZA 3ZE0A 3UVMA 3L4OD 4OWRA 4WK0A 5I5JA 3RMZD 1UOQA 1NEXB 1TYEA 1S4UX 3DSMA 2P9KC 4FA4D 2AGZA 5K19A 2IWKA 2HKRA 4AMYA 2EICA 1MDAH 4AEZA 2VDKA 2CO0A 4CY5A 2OK4A 3O4HA 3CIKB 2H6NA 3SBRA 2OIZA 4NENA 5GXIA 5HQGA 4WK4A 4CZVA 3T3MA 3OKTA 3I89A 2H47A 3DDUA 2PM9B 2CN2A 1XIPA 2H13A 3IULA 4NC4A 3UKUC 2XL3A 4PXWA 5CYKA 3IUQA 4JD2C 3ZDYA 2I0RA 4J78A 3IJ0A 1FWXA 5FFOA 4Y7RA 4FA5D 1O6GA 4D6VA 4A0BB 4NBMA 3FM0A 4JT5C 3MZLA 4A7JA 1K8KC 2QXVA 1E8NA 4QL1A 5IGOA 1N6EA 2I3SA 3UVOA 3UVKA 4FB1D 4O1QD 3I7OA 3GFCA 4CZYA 5IGQA 3F3PA 2XYIA 2H6KA 2I3TA 4QT8A 4J8BA 5FKRA 3OL2A 4ERQA 3P4FA 4RE6A 3RN1D 4D9SA 2I0TA 2QR5A 3EI1B 4A11A 3SWSD 4FA9D 4BP8A 2HU8A 4IMMA 5C92A 5CXCB 5AJAA 4KFMB 2QC5A 3EWEA 3OKYA 1PEVA 2Z2PA 4AN1A 4J84A 4Z7QA 3T3PA 3J80g 3FCSA 3ODTA 4ZOYA 4NAAA 1SQ9A 3C99A 3UR4A 1PI6A 4ERYA 2VZ3A 3L4MD 3JAMg 2IURA 2H9MA 3IIWA 4HDJA 2XDWA 3ZDXA 4A0AA 3C5MA 5FKQA 1H2WA 4LG9A 2P9PC 2XZGA 4CI8A 2EIDA 2YBAA 2HESX 1B9XA 3SVWD 2OK6A 5TEFA 3VGZA 2G99A 4O9DA 4ZOZA 3HFQA 2H9NA 3KCIA 2GNQA 3SFZA 3K6SA 5EAMA 3NVQA 3FCUA 4ZOVA 3DM0A 4G56B 4K3ID 2AQ5A 3EI4A 4QAMA 3F3FA 4GQBB 3IJCA 3V4PA 4BP9A 1A12A 4JSNC 2PM7B 4FA1D 5EALA 1RI6A 4NSXA 5TEEA 5FKSA 3I7KA 5IJ8E 3O4IA 5EAPA 2GC4A 4PNKB 3EI3A 2UZYB 4AMZA 3E0CA 5HE1B 1VE6A 3A0FA 3EI2B 2G9AA 4GM3A 2MTAH 4OZUA 5FFGA 2HKMA 3AH8B 5M61A 1JJUB 2OVPB 4Z7OA 3SN6B 3ZE1A 2J56H 4J82A 5I5MA 3SBPA 1N6FA 2AH1A 2CNXA 4L9OA 4WJKA 1TYQC 2Z2NA 2GC7A 4JSPC 4XEIC 4DNWA 2VDLA 2CN3A 4E54B 5FXYA 1PBYB 5H17A 5IJ7E 2HYEA 1GOTB 4UM8A 1JMXB 3MXXA 4GGCA 2YMUA 2P9IC 2J57G 2BBKH 2AH0A 2IAAA 2PM9A 1YR2A 1UOPA 3C75H 4X3EA 4A08B 3BWSA 1UTCA 2IUPA 4Z7NA 2OVRB 2TRCB 5K1CC 1MG3A 2YNNA 4H5IA 1QNIA 5EMMB 3MKQA 4TZ4A 4A0BA 4JSXC 5C2WB 3V9FA 1SHYB 1QFMA 5AMSA 4ERZA 2YB8B 3RN0D 2CE8A 4O45A 3SBQA 3EQ9A 2B5NA 2EIEA 3RLMD 2B5MA 5C2VB 3VI4A 3O4GA 5E6SA 1OLZA 4R7AB 4BCBA 5IC7A 2P9LC 5CYKB 4GQ1A 1GOFA 4FAVD 4J8GA 2AGYA 2VDNA 3RSEC 4CY2A 5H1MA 3EQ7A 5H14A 3JROA 3EI1A 3EQ8A 1XKSA 3JZHA 1I2MB 2H14A 2WQ8A 4Y5RD 5CXCA 4ZN4A 2VZ1A 3IUMA 4X63B 4J86A 3DXMC 4L3GD 4J0WA 2P9UC 1VE7A 1H2YA 1XHMA 3GREA 4BCCA 3JB9L 1GP2B 2UZXB 3UVLA 3ZDZA 3IVMA 4PBYA 4IA9A 3NVXA 1BPOA 3FRXA 4YVDA 5FA5B 1JTDB 3AFCA 2Q7QA 4E5ZB 5CXBB 4A11B 4MMZA 4AX4A 2B4EA 2AGLA 3MKSB 3MMYA 3KRWB 4JXMA 5EARA 1U2VC 1PGUA 3SMRA 4AN0A 2O9KA 5M5RA 4U7AA 3I8EA 3CFVA 3ZE2A 1L5GA 5M5UA 4CY3A 4MMYA 1C9LA 3DXKC 4CI2A 4EWRA 3MVDK 4GGAA 5KDOB 2IWFA 1OMWB 3NIGA 5JWZA 1JV2A 3NIFA 4IRZA 1U8CA 4UM9A 3PE7A 4GZ8A 3N0DA 4GGDA 1M1XA 4G1EA 2H6QA 4H5JA 4O3UB 2Z2OA 4K3JB 3RFGA 3AL8B 4LG8A 3J81g 1GXRA 4WK2A 3JPXA 4L1QD 4A0AB 4FWWA 4XYIA 4XYHA 4JHNA 2VC2A 3OKWA 3RRMC 2HJ4A 4LGNA 5FQDA 3MUOA 1O6FA 5EM2B 3EI2A 5GSAA 2XU7A 2IUVA 3IUJA 1C9IA 2AGWA 4N14A 4J77A 3V5WB 2JKXA 3RFHA 3N0EA 5E6UA 3SXTD 4CI3A 3EI4B 4BL0A 5EMLB 4E54A 4DNUA 4CY1A 3I2NA 3SJLD 2XE4A 5EMKB 3SHFA 5M5SA 2W18A 2H9LA 3VA6A 4MK0B 4CI1A 4GQ2P 5HE3B 3I8CA 3UKRC 2H68A 2YNOA 4X61B 5M5TA 4U1EI 2VDPA 4A09B 1VYHC 4A08A 2YNPA 3PVWB 4A2LA 4I79A 2IUQA 5A2Qg 2P9SC 3IJEA 3AL9A 3V7DB 4Z8LA 1K32A 1JMZB 3ZWLB 1UOOA 4JHPC 5TF2A 3OW8A 2P9NC 1U4CA 1E8MA 2PM6B 3UVNA 3B7FA 3U4YA 2HXCA 2XL2A 4ESGA 5HYNB 4RE5A 2J55H 3PVUB 3PSCB 4G1MA 3JZNA 4J81A 4GM8A 1JOFA 3I7NA 3QI0A 3MZKA 1GOHA 3OF7A 2VDMA 2OJYA 2QZPA 2HJBA 3I7PA 4O2WA 3MUNA 3PXWD 4J87A 3IUNA 2OVQB 4GM9A 4J73A 5SXMA 3JRPA 1YFQA 4MMXA 3VI3A 5C86A 1R5MA 3ORVD 1H2ZA 2HU5A 4O02A 5I5IA 1E5TA 1N6DA 5HE0B 3OL2B 4E5ZA 5CXBA 3K71A 2B5LA 1P22A 3IJ1A 3I7HA 4PSWB 3SLED 3IKOA 2VDOA 2EIBA 4QQEA 3K26A 2AGXA 3NIDA 1H2XA 1VZ3A 3FGBA 3KRXB 3O4JA 3OKYB 4J79A 4UI9R 3F3GA 1B9YA 2VDRA 5TDHB 3C9CA 4PC0A 2EBSA 3OTTA 3EU7A 2CO0C 4CC9A 2BCJB 3QHYB 4FHLA 4FAND 4X60B 5M5VA 4L3HD 1GG2B 1K3IA 1MG2A 4DNVA 2H3XA 5AFU3 4G55A 5GXHA 4JT6C 3GC3B 3K72A 3AL8A
chains in the Genus database with same CATH topology
5GMKn 3IIYA 4PSXB 3ULEC 3PXTD 4BH6A 4A2MA 4ZOXA 5EM2A 5FLXg 1L0QA 3VH0A 3BG1A 2PBIB 3PXSD 5C9ZB 4J0XA 5FKTA 5THAA 4D0KA 4O3TB 3BG0A 3DWLC 5HE2B 4BUJC 1Q47A 2H9PA 3JZGA 3NVNA 5IT9g 3I7LA 3W15A 3K27A 2CE9A 3EG6A 5B4WA 3PSLA 4AOWA 2I0SA 1A0RB 5EMJB 3SCYA 3EMHA 4CZXA 4JSVC 3EI3B 1NR0A 3CFSB 1SQJA 1TBGA 4QRJA 4A09A 4GMBA 1ERJA 4ES0A 4PBZA 3UVMA 3L4OD 4OWRA 5I5JA 3RMZD 1NEXB 1S4UX 3DSMA 2P9KC 4FA4D 2AGZA 5K19A 2IWKA 2HKRA 1MDAH 4AEZA 2CO0A 4CY5A 2OK4A 3CIKB 2H6NA 3SBRA 2OIZA 5GXIA 5HQGA 4CZVA 3OKTA 3I89A 2H47A 2PM9B 2CN2A 1XIPA 2H13A 3UKUC 2XL3A 4PXWA 5CYKA 4JD2C 2I0RA 4J78A 3IJ0A 1FWXA 4Y7RA 4FA5D 4D6VA 4A0BB 3FM0A 4JT5C 3MZLA 4A7JA 1K8KC 2QXVA 4QL1A 5IGOA 1N6EA 2I3SA 3UVOA 3UVKA 4FB1D 4O1QD 3I7OA 3GFCA 4CZYA 5IGQA 3F3PA 2XYIA 2H6KA 2I3TA 4QT8A 4J8BA 5FKRA 3OL2A 4ERQA 3P4FA 3RN1D 2I0TA 3EI1B 4A11A 3SWSD 4FA9D 4IMMA 5CXCB 5AJAA 4KFMB 2QC5A 3EWEA 3OKYA 1PEVA 2Z2PA 4J84A 3J80g 3ODTA 4ZOYA 1SQ9A 3C99A 3UR4A 1PI6A 4ERYA 3L4MD 3JAMg 2IURA 2H9MA 3IIWA 4HDJA 4A0AA 3C5MA 5FKQA 4LG9A 2P9PC 4CI8A 2YBAA 2HESX 1B9XA 3SVWD 2OK6A 5TEFA 3VGZA 2G99A 4O9DA 4ZOZA 3HFQA 2H9NA 2GNQA 3SFZA 5EAMA 3NVQA 4ZOVA 3DM0A 4G56B 4K3ID 2AQ5A 3EI4A 3F3FA 4GQBB 3IJCA 4JSNC 2PM7B 4FA1D 5EALA 1RI6A 4NSXA 5TEEA 5FKSA 3I7KA 5IJ8E 5EAPA 2GC4A 4PNKB 3EI3A 2UZYB 3E0CA 5HE1B 3A0FA 3EI2B 2G9AA 4GM3A 2MTAH 4OZUA 2HKMA 3AH8B 1JJUB 2OVPB 3SN6B 4J82A 2J56H 5I5MA 3SBPA 2CNXA 1N6FA 2AH1A 4L9OA 1TYQC 2Z2NA 2GC7A 4JSPC 4XEIC 2CN3A 4E54B 5FXYA 1PBYB 5H17A 5IJ7E 2HYEA 1GOTB 1JMXB 3MXXA 4GGCA 2YMUA 2P9IC 2J57G 2BBKH 2AH0A 2IAAA 2PM9A 3C75H 4X3EA 4A08B 3BWSA 2IUPA 2OVRB 2TRCB 5K1CC 1MG3A 2YNNA 4H5IA 1QNIA 5EMMB 3MKQA 4TZ4A 4A0BA 4JSXC 5C2WB 3V9FA 1SHYB 5AMSA 4ERZA 2YB8B 3RN0D 2CE8A 4O45A 3SBQA 2B5NA 3RLMD 2B5MA 5C2VB 1OLZA 4R7AB 5IC7A 2P9LC 5CYKB 4GQ1A 4FAVD 4J8GA 2AGYA 3RSEC 4CY2A 5H1MA 5H14A 3JROA 3EI1A 1XKSA 3JZHA 2H14A 4Y5RD 5CXCA 4ZN4A 4X63B 4J86A 3DXMC 4L3GD 4J0WA 2P9UC 1XHMA 3GREA 3JB9L 1GP2B 2UZXB 3UVLA 4PBYA 4IA9A 3NVXA 3FRXA 4YVDA 5FA5B 3AFCA 2Q7QA 4E5ZB 5CXBB 4A11B 2B4EA 2AGLA 3MKSB 3MMYA 3KRWB 4JXMA 5EARA 1U2VC 1PGUA 3SMRA 2O9KA 4U7AA 3I8EA 3CFVA 4CY3A 3DXKC 4CI2A 4EWRA 4GGAA 5KDOB 2IWFA 1OMWB 5JWZA 3PE7A 4GZ8A 3N0DA 4GGDA 4O3UB 2H6QA 4H5JA 2Z2OA 4K3JB 3RFGA 3AL8B 4LG8A 3J81g 1GXRA 3JPXA 4L1QD 4A0AB 4FWWA 4XYIA 4XYHA 3OKWA 3RRMC 2HJ4A 4LGNA 5FQDA 5EM2B 3EI2A 5GSAA 2XU7A 2IUVA 2AGWA 4N14A 4J77A 3V5WB 3RFHA 3N0EA 3SXTD 4CI3A 3EI4B 4BL0A 5EMLB 4E54A 4CY1A 3I2NA 3SJLD 5EMKB 3SHFA 2W18A 2H9LA 3VA6A 4MK0B 4CI1A 4GQ2P 5HE3B 3I8CA 3UKRC 2H68A 2YNOA 4X61B 4U1EI 4A09B 1VYHC 4A08A 2YNPA 3PVWB 4A2LA 4I79A 2IUQA 5A2Qg 2P9SC 3AL9A 3V7DB 4Z8LA 1K32A 1JMZB 3ZWLB 5TF2A 3OW8A 2P9NC 1U4CA 2PM6B 3UVNA 3B7FA 3U4YA 2HXCA 2XL2A 4ESGA 5HYNB 2J55H 3PVUB 3PSCB 3JZNA 4J81A 4GM8A 1JOFA 3I7NA 3MZKA 2OJYA 2HJBA 3I7PA 3PXWD 4J87A 2OVQB 4GM9A 4J73A 5SXMA 3JRPA 1YFQA 1R5MA 3ORVD 5I5IA 1N6DA 5HE0B 3OL2B 4E5ZA 5CXBA 2B5LA 1P22A 3IJ1A 3I7HA 4PSWB 3SLED 3IKOA 4QQEA 3K26A 2AGXA 3FGBA 3KRXB 3OKYB 4J79A 4UI9R 3F3GA 1B9YA 5TDHB 3C9CA 4PC0A 2EBSA 3OTTA 3EU7A 2CO0C 4CC9A 2BCJB 4FHLA 4FAND 4X60B 4L3HD 1GG2B 1MG2A 2H3XA 5AFU3 5GXHA 4JT6C 3AL8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GMK n;  3IIY A;  4PSX B;  3ULE C;  3PXT D;  4BH6 A;  4A2M A;  4ZOX A;  5EM2 A;  5FLX g;  1L0Q A;  3VH0 A;  3BG1 A;  2PBI B;  3PXS D;  5C9Z B;  4J0X A;  5FKT A;  5THA A;  4D0K A;  4O3T B;  3BG0 A;  3DWL C;  5HE2 B;  4BUJ C;  1Q47 A;  2H9P A;  3JZG A;  3NVN A;  5IT9 g;  3I7L A;  3W15 A;  3K27 A;  2CE9 A;  3EG6 A;  5B4W A;  3PSL A;  4AOW A;  2I0S A;  1A0R B;  5EMJ B;  3SCY A;  3EMH A;  4CZX A;  4JSV C;  3EI3 B;  1NR0 A;  3CFS B;  1SQJ A;  1TBG A;  4QRJ A;  4A09 A;  4GMB A;  1ERJ A;  4ES0 A;  4PBZ A;  3UVM A;  3L4O D;  4OWR A;  5I5J A;  3RMZ D;  1NEX B;  1S4U X;  3DSM A;  2P9K C;  4FA4 D;  2AGZ A;  5K19 A;  2IWK A;  2HKR A;  1MDA H;  4AEZ A;  2CO0 A;  4CY5 A;  2OK4 A;  3CIK B;  2H6N A;  3SBR A;  2OIZ A;  5GXI A;  5HQG A;  4CZV A;  3OKT A;  3I89 A;  2H47 A;  2PM9 B;  2CN2 A;  1XIP A;  2H13 A;  3UKU C;  2XL3 A;  4PXW A;  5CYK A;  4JD2 C;  2I0R A;  4J78 A;  3IJ0 A;  1FWX A;  4Y7R A;  4FA5 D;  4D6V A;  4A0B B;  3FM0 A;  4JT5 C;  3MZL A;  4A7J A;  1K8K C;  2QXV A;  4QL1 A;  5IGO A;  1N6E A;  2I3S A;  3UVO A;  3UVK A;  4FB1 D;  4O1Q D;  3I7O A;  3GFC A;  4CZY A;  5IGQ A;  3F3P A;  2XYI A;  2H6K A;  2I3T A;  4QT8 A;  4J8B A;  5FKR A;  3OL2 A;  4ERQ A;  3P4F A;  3RN1 D;  2I0T A;  3EI1 B;  4A11 A;  3SWS D;  4FA9 D;  4IMM A;  5CXC B;  5AJA A;  4KFM B;  2QC5 A;  3EWE A;  3OKY A;  1PEV A;  2Z2P A;  4J84 A;  3J80 g;  3ODT A;  4ZOY A;  1SQ9 A;  3C99 A;  3UR4 A;  1PI6 A;  4ERY A;  3L4M D;  3JAM g;  2IUR A;  2H9M A;  3IIW A;  4HDJ A;  4A0A A;  3C5M A;  5FKQ A;  4LG9 A;  2P9P C;  4CI8 A;  2YBA A;  2HES X;  1B9X A;  3SVW D;  2OK6 A;  5TEF A;  3VGZ A;  2G99 A;  4O9D A;  4ZOZ A;  3HFQ A;  2H9N A;  2GNQ A;  3SFZ A;  5EAM A;  3NVQ A;  4ZOV A;  3DM0 A;  4G56 B;  4K3I D;  2AQ5 A;  3EI4 A;  3F3F A;  4GQB B;  3IJC A;  4JSN C;  2PM7 B;  4FA1 D;  5EAL A;  1RI6 A;  4NSX A;  5TEE A;  5FKS A;  3I7K A;  5IJ8 E;  5EAP A;  2GC4 A;  4PNK B;  3EI3 A;  2UZY B;  3E0C A;  5HE1 B;  3A0F A;  3EI2 B;  2G9A A;  4GM3 A;  2MTA H;  4OZU A;  2HKM A;  3AH8 B;  1JJU B;  2OVP B;  3SN6 B;  4J82 A;  2J56 H;  5I5M A;  3SBP A;  2CNX A;  1N6F A;  2AH1 A;  4L9O A;  1TYQ C;  2Z2N A;  2GC7 A;  4JSP C;  4XEI C;  2CN3 A;  4E54 B;  5FXY A;  1PBY B;  5H17 A;  5IJ7 E;  2HYE A;  1GOT B;  1JMX B;  3MXX A;  4GGC A;  2YMU A;  2P9I C;  2J57 G;  2BBK H;  2AH0 A;  2IAA A;  2PM9 A;  3C75 H;  4X3E A;  4A08 B;  3BWS A;  2IUP A;  2OVR B;  2TRC B;  5K1C C;  1MG3 A;  2YNN A;  4H5I A;  1QNI A;  5EMM B;  3MKQ A;  4TZ4 A;  4A0B A;  4JSX C;  5C2W B;  3V9F A;  1SHY B;  5AMS A;  4ERZ A;  2YB8 B;  3RN0 D;  2CE8 A;  4O45 A;  3SBQ A;  2B5N A;  3RLM D;  2B5M A;  5C2V B;  1OLZ A;  4R7A B;  5IC7 A;  2P9L C;  5CYK B;  4GQ1 A;  4FAV D;  4J8G A;  2AGY A;  3RSE C;  4CY2 A;  5H1M A;  5H14 A;  3JRO A;  3EI1 A;  1XKS A;  3JZH A;  2H14 A;  4Y5R D;  5CXC A;  4ZN4 A;  4X63 B;  4J86 A;  3DXM C;  4L3G D;  4J0W A;  2P9U C;  1XHM A;  3GRE A;  3JB9 L;  1GP2 B;  2UZX B;  3UVL A;  4PBY A;  4IA9 A;  3NVX A;  3FRX A;  4YVD A;  5FA5 B;  3AFC A;  2Q7Q A;  4E5Z B;  5CXB B;  4A11 B;  2B4E A;  2AGL A;  3MKS B;  3MMY A;  3KRW B;  4JXM A;  5EAR A;  1U2V C;  1PGU A;  3SMR A;  2O9K A;  4U7A A;  3I8E A;  3CFV A;  4CY3 A;  3DXK C;  4CI2 A;  4EWR A;  4GGA A;  5KDO B;  2IWF A;  1OMW B;  5JWZ A;  3PE7 A;  4GZ8 A;  3N0D A;  4GGD A;  4O3U B;  2H6Q A;  4H5J A;  2Z2O A;  4K3J B;  3RFG A;  3AL8 B;  4LG8 A;  3J81 g;  1GXR A;  3JPX A;  4L1Q D;  4A0A B;  4FWW A;  4XYI A;  4XYH A;  3OKW A;  3RRM C;  2HJ4 A;  4LGN A;  5FQD A;  5EM2 B;  3EI2 A;  5GSA A;  2XU7 A;  2IUV A;  2AGW A;  4N14 A;  4J77 A;  3V5W B;  3RFH A;  3N0E A;  3SXT D;  4CI3 A;  3EI4 B;  4BL0 A;  5EML B;  4E54 A;  4CY1 A;  3I2N A;  3SJL D;  5EMK B;  3SHF A;  2W18 A;  2H9L A;  3VA6 A;  4MK0 B;  4CI1 A;  4GQ2 P;  5HE3 B;  3I8C A;  3UKR C;  2H68 A;  2YNO A;  4X61 B;  4U1E I;  4A09 B;  1VYH C;  4A08 A;  2YNP A;  3PVW B;  4A2L A;  4I79 A;  2IUQ A;  5A2Q g;  2P9S C;  3AL9 A;  3V7D B;  4Z8L A;  1K32 A;  1JMZ B;  3ZWL B;  5TF2 A;  3OW8 A;  2P9N C;  1U4C A;  2PM6 B;  3UVN A;  3B7F A;  3U4Y A;  2HXC A;  2XL2 A;  4ESG A;  5HYN B;  2J55 H;  3PVU B;  3PSC B;  3JZN A;  4J81 A;  4GM8 A;  1JOF A;  3I7N A;  3MZK A;  2OJY A;  2HJB A;  3I7P A;  3PXW D;  4J87 A;  2OVQ B;  4GM9 A;  4J73 A;  5SXM A;  3JRP A;  1YFQ A;  1R5M A;  3ORV D;  5I5I A;  1N6D A;  5HE0 B;  3OL2 B;  4E5Z A;  5CXB A;  2B5L A;  1P22 A;  3IJ1 A;  3I7H A;  4PSW B;  3SLE D;  3IKO A;  4QQE A;  3K26 A;  2AGX A;  3FGB A;  3KRX B;  3OKY B;  4J79 A;  4UI9 R;  3F3G A;  1B9Y A;  5TDH B;  3C9C A;  4PC0 A;  2EBS A;  3OTT A;  3EU7 A;  2CO0 C;  4CC9 A;  2BCJ B;  4FHL A;  4FAN D;  4X60 B;  4L3H D;  1GG2 B;  1MG2 A;  2H3X A;  5AFU 3;  5GXH A;  4JT6 C;  3AL8 A; 
#chains in the Genus database with same CATH topology
 2VDQ A;  1T2X A;  5GMK n;  3IIY A;  3GD1 I;  4PSX B;  3ULE C;  3PXT D;  4BH6 A;  5E6R A;  4A2M A;  4ZOX A;  1QFS A;  5EM2 A;  1L0Q A;  5FLX g;  3VH0 A;  1VZ2 A;  4L1M A;  3BG1 A;  2PBI B;  3PXS D;  5C9Z B;  4J0X A;  5FKT A;  5THA A;  3V4V A;  4D0K A;  4O3T B;  3BG0 A;  2HU7 A;  2BKL A;  3DWL C;  5HE2 B;  4BUJ C;  1Q47 A;  2H9P A;  3JZG A;  3NVN A;  5IT9 g;  3I7L A;  3W15 A;  1GOG A;  3K27 A;  2CE9 A;  3EG6 A;  3IUR A;  4BCD A;  5B4W A;  3PSL A;  4AOW A;  2I0S A;  1A0R B;  5EMJ B;  3SCY A;  3EMH A;  4CZX A;  4JSV C;  3EI3 B;  1NR0 A;  3CFS B;  1SQJ A;  1TBG A;  4QRJ A;  4A09 A;  5HDB A;  4GMB A;  1ERJ A;  4ES0 A;  4PBZ A;  3ZE0 A;  3UVM A;  3L4O D;  4OWR A;  4WK0 A;  5I5J A;  3RMZ D;  1UOQ A;  1NEX B;  1TYE A;  1S4U X;  3DSM A;  2P9K C;  4FA4 D;  2AGZ A;  5K19 A;  2IWK A;  2HKR A;  4AMY A;  2EIC A;  1MDA H;  4AEZ A;  2VDK A;  2CO0 A;  4CY5 A;  2OK4 A;  3O4H A;  3CIK B;  2H6N A;  3SBR A;  2OIZ A;  4NEN A;  5GXI A;  5HQG A;  4WK4 A;  4CZV A;  3T3M A;  3OKT A;  3I89 A;  2H47 A;  3DDU A;  2PM9 B;  2CN2 A;  1XIP A;  2H13 A;  3IUL A;  4NC4 A;  3UKU C;  2XL3 A;  4PXW A;  5CYK A;  3IUQ A;  4JD2 C;  3ZDY A;  2I0R A;  4J78 A;  3IJ0 A;  1FWX A;  5FFO A;  4Y7R A;  4FA5 D;  1O6G A;  4D6V A;  4A0B B;  4NBM A;  3FM0 A;  4JT5 C;  3MZL A;  4A7J A;  1K8K C;  2QXV A;  1E8N A;  4QL1 A;  5IGO A;  1N6E A;  2I3S A;  3UVO A;  3UVK A;  4FB1 D;  4O1Q D;  3I7O A;  3GFC A;  4CZY A;  5IGQ A;  3F3P A;  2XYI A;  2H6K A;  2I3T A;  4QT8 A;  4J8B A;  5FKR A;  3OL2 A;  4ERQ A;  3P4F A;  4RE6 A;  3RN1 D;  4D9S A;  2I0T A;  2QR5 A;  3EI1 B;  4A11 A;  3SWS D;  4FA9 D;  4BP8 A;  2HU8 A;  4IMM A;  5C92 A;  5CXC B;  5AJA A;  4KFM B;  2QC5 A;  3EWE A;  3OKY A;  1PEV A;  2Z2P A;  4AN1 A;  4J84 A;  4Z7Q A;  3T3P A;  3J80 g;  3FCS A;  3ODT A;  4ZOY A;  4NAA A;  1SQ9 A;  3C99 A;  3UR4 A;  1PI6 A;  4ERY A;  2VZ3 A;  3L4M D;  3JAM g;  2IUR A;  2H9M A;  3IIW A;  4HDJ A;  2XDW A;  3ZDX A;  4A0A A;  3C5M A;  5FKQ A;  1H2W A;  4LG9 A;  2P9P C;  2XZG A;  4CI8 A;  2EID A;  2YBA A;  2HES X;  1B9X A;  3SVW D;  2OK6 A;  5TEF A;  3VGZ A;  2G99 A;  4O9D A;  4ZOZ A;  3HFQ A;  2H9N A;  3KCI A;  2GNQ A;  3SFZ A;  3K6S A;  5EAM A;  3NVQ A;  3FCU A;  4ZOV A;  3DM0 A;  4G56 B;  4K3I D;  2AQ5 A;  3EI4 A;  4QAM A;  3F3F A;  4GQB B;  3IJC A;  3V4P A;  4BP9 A;  1A12 A;  4JSN C;  2PM7 B;  4FA1 D;  5EAL A;  1RI6 A;  4NSX A;  5TEE A;  5FKS A;  3I7K A;  5IJ8 E;  3O4I A;  5EAP A;  2GC4 A;  4PNK B;  3EI3 A;  2UZY B;  4AMZ A;  3E0C A;  5HE1 B;  1VE6 A;  3A0F A;  3EI2 B;  2G9A A;  4GM3 A;  2MTA H;  4OZU A;  5FFG A;  2HKM A;  3AH8 B;  5M61 A;  1JJU B;  2OVP B;  4Z7O A;  3SN6 B;  3ZE1 A;  2J56 H;  4J82 A;  5I5M A;  3SBP A;  1N6F A;  2AH1 A;  2CNX A;  4L9O A;  4WJK A;  1TYQ C;  2Z2N A;  2GC7 A;  4JSP C;  4XEI C;  4DNW A;  2VDL A;  2CN3 A;  4E54 B;  5FXY A;  1PBY B;  5H17 A;  5IJ7 E;  2HYE A;  1GOT B;  4UM8 A;  1JMX B;  3MXX A;  4GGC A;  2YMU A;  2P9I C;  2J57 G;  2BBK H;  2AH0 A;  2IAA A;  2PM9 A;  1YR2 A;  1UOP A;  3C75 H;  4X3E A;  4A08 B;  3BWS A;  1UTC A;  2IUP A;  4Z7N A;  2OVR B;  2TRC B;  5K1C C;  1MG3 A;  2YNN A;  4H5I A;  1QNI A;  5EMM B;  3MKQ A;  4TZ4 A;  4A0B A;  4JSX C;  5C2W B;  3V9F A;  1SHY B;  1QFM A;  5AMS A;  4ERZ A;  2YB8 B;  3RN0 D;  2CE8 A;  4O45 A;  3SBQ A;  3EQ9 A;  2B5N A;  2EIE A;  3RLM D;  2B5M A;  5C2V B;  3VI4 A;  3O4G A;  5E6S A;  1OLZ A;  4R7A B;  4BCB A;  5IC7 A;  2P9L C;  5CYK B;  4GQ1 A;  1GOF A;  4FAV D;  4J8G A;  2AGY A;  2VDN A;  3RSE C;  4CY2 A;  5H1M A;  3EQ7 A;  5H14 A;  3JRO A;  3EI1 A;  3EQ8 A;  1XKS A;  3JZH A;  1I2M B;  2H14 A;  2WQ8 A;  4Y5R D;  5CXC A;  4ZN4 A;  2VZ1 A;  3IUM A;  4X63 B;  4J86 A;  3DXM C;  4L3G D;  4J0W A;  2P9U C;  1VE7 A;  1H2Y A;  1XHM A;  3GRE A;  4BCC A;  3JB9 L;  1GP2 B;  2UZX B;  3UVL A;  3ZDZ A;  3IVM A;  4PBY A;  4IA9 A;  3NVX A;  1BPO A;  3FRX A;  4YVD A;  5FA5 B;  1JTD B;  3AFC A;  2Q7Q A;  4E5Z B;  5CXB B;  4A11 B;  4MMZ A;  4AX4 A;  2B4E A;  2AGL A;  3MKS B;  3MMY A;  3KRW B;  4JXM A;  5EAR A;  1U2V C;  1PGU A;  3SMR A;  4AN0 A;  2O9K A;  5M5R A;  4U7A A;  3I8E A;  3CFV A;  3ZE2 A;  1L5G A;  5M5U A;  4CY3 A;  4MMY A;  1C9L A;  3DXK C;  4CI2 A;  4EWR A;  3MVD K;  4GGA A;  5KDO B;  2IWF A;  1OMW B;  3NIG A;  5JWZ A;  1JV2 A;  3NIF A;  4IRZ A;  1U8C A;  4UM9 A;  3PE7 A;  4GZ8 A;  3N0D A;  4GGD A;  1M1X A;  4G1E A;  2H6Q A;  4H5J A;  4O3U B;  2Z2O A;  4K3J B;  3RFG A;  3AL8 B;  4LG8 A;  3J81 g;  1GXR A;  4WK2 A;  3JPX A;  4L1Q D;  4A0A B;  4FWW A;  4XYI A;  4XYH A;  4JHN A;  2VC2 A;  3OKW A;  3RRM C;  2HJ4 A;  4LGN A;  5FQD A;  3MUO A;  1O6F A;  5EM2 B;  3EI2 A;  5GSA A;  2XU7 A;  2IUV A;  3IUJ A;  1C9I A;  2AGW A;  4N14 A;  4J77 A;  3V5W B;  2JKX A;  3RFH A;  3N0E A;  5E6U A;  3SXT D;  4CI3 A;  3EI4 B;  4BL0 A;  5EML B;  4E54 A;  4DNU A;  4CY1 A;  3I2N A;  3SJL D;  2XE4 A;  5EMK B;  3SHF A;  5M5S A;  2W18 A;  2H9L A;  3VA6 A;  4MK0 B;  4CI1 A;  4GQ2 P;  5HE3 B;  3I8C A;  3UKR C;  2H68 A;  2YNO A;  4X61 B;  5M5T A;  4U1E I;  2VDP A;  4A09 B;  1VYH C;  4A08 A;  2YNP A;  3PVW B;  4A2L A;  4I79 A;  2IUQ A;  5A2Q g;  2P9S C;  3IJE A;  3AL9 A;  3V7D B;  4Z8L A;  1K32 A;  1JMZ B;  3ZWL B;  1UOO A;  4JHP C;  5TF2 A;  3OW8 A;  2P9N C;  1U4C A;  1E8M A;  2PM6 B;  3UVN A;  3B7F A;  3U4Y A;  2HXC A;  2XL2 A;  4ESG A;  5HYN B;  4RE5 A;  2J55 H;  3PVU B;  3PSC B;  4G1M A;  3JZN A;  4J81 A;  4GM8 A;  1JOF A;  3I7N A;  3QI0 A;  3MZK A;  1GOH A;  3OF7 A;  2VDM A;  2OJY A;  2QZP A;  2HJB A;  3I7P A;  4O2W A;  3MUN A;  3PXW D;  4J87 A;  3IUN A;  2OVQ B;  4GM9 A;  4J73 A;  5SXM A;  3JRP A;  1YFQ A;  4MMX A;  3VI3 A;  5C86 A;  1R5M A;  3ORV D;  1H2Z A;  2HU5 A;  4O02 A;  5I5I A;  1E5T A;  1N6D A;  5HE0 B;  3OL2 B;  4E5Z A;  5CXB A;  3K71 A;  2B5L A;  1P22 A;  3IJ1 A;  3I7H A;  4PSW B;  3SLE D;  3IKO A;  2VDO A;  2EIB A;  4QQE A;  3K26 A;  2AGX A;  3NID A;  1H2X A;  1VZ3 A;  3FGB A;  3KRX B;  3O4J A;  3OKY B;  4J79 A;  4UI9 R;  3F3G A;  1B9Y A;  2VDR A;  5TDH B;  3C9C A;  4PC0 A;  2EBS A;  3OTT A;  3EU7 A;  2CO0 C;  4CC9 A;  2BCJ B;  3QHY B;  4FHL A;  4FAN D;  4X60 B;  5M5V A;  4L3H D;  1GG2 B;  1K3I A;  1MG2 A;  4DNV A;  2H3X A;  5AFU 3;  4G55 A;  5GXH A;  4JT6 C;  3GC3 B;  3K72 A;  3AL8 A; 
#chains in the Genus database with same CATH homology
 5GMK n;  3IIY A;  4PSX B;  3ULE C;  3PXT D;  4BH6 A;  4A2M A;  4ZOX A;  5EM2 A;  5FLX g;  1L0Q A;  3VH0 A;  3BG1 A;  2PBI B;  3PXS D;  5C9Z B;  4J0X A;  5FKT A;  5THA A;  4D0K A;  4O3T B;  3BG0 A;  3DWL C;  5HE2 B;  4BUJ C;  1Q47 A;  2H9P A;  3JZG A;  3NVN A;  5IT9 g;  3I7L A;  3W15 A;  3K27 A;  2CE9 A;  3EG6 A;  5B4W A;  3PSL A;  4AOW A;  2I0S A;  1A0R B;  5EMJ B;  3SCY A;  3EMH A;  4CZX A;  4JSV C;  3EI3 B;  1NR0 A;  3CFS B;  1SQJ A;  1TBG A;  4QRJ A;  4A09 A;  4GMB A;  1ERJ A;  4ES0 A;  4PBZ A;  3UVM A;  3L4O D;  4OWR A;  5I5J A;  3RMZ D;  1NEX B;  1S4U X;  3DSM A;  2P9K C;  4FA4 D;  2AGZ A;  5K19 A;  2IWK A;  2HKR A;  1MDA H;  4AEZ A;  2CO0 A;  4CY5 A;  2OK4 A;  3CIK B;  2H6N A;  3SBR A;  2OIZ A;  5GXI A;  5HQG A;  4CZV A;  3OKT A;  3I89 A;  2H47 A;  2PM9 B;  2CN2 A;  1XIP A;  2H13 A;  3UKU C;  2XL3 A;  4PXW A;  5CYK A;  4JD2 C;  2I0R A;  4J78 A;  3IJ0 A;  1FWX A;  4Y7R A;  4FA5 D;  4D6V A;  4A0B B;  3FM0 A;  4JT5 C;  3MZL A;  4A7J A;  1K8K C;  2QXV A;  4QL1 A;  5IGO A;  1N6E A;  2I3S A;  3UVO A;  3UVK A;  4FB1 D;  4O1Q D;  3I7O A;  3GFC A;  4CZY A;  5IGQ A;  3F3P A;  2XYI A;  2H6K A;  2I3T A;  4QT8 A;  4J8B A;  5FKR A;  3OL2 A;  4ERQ A;  3P4F A;  3RN1 D;  2I0T A;  3EI1 B;  4A11 A;  3SWS D;  4FA9 D;  4IMM A;  5CXC B;  5AJA A;  4KFM B;  2QC5 A;  3EWE A;  3OKY A;  1PEV A;  2Z2P A;  4J84 A;  3J80 g;  3ODT A;  4ZOY A;  1SQ9 A;  3C99 A;  3UR4 A;  1PI6 A;  4ERY A;  3L4M D;  3JAM g;  2IUR A;  2H9M A;  3IIW A;  4HDJ A;  4A0A A;  3C5M A;  5FKQ A;  4LG9 A;  2P9P C;  4CI8 A;  2YBA A;  2HES X;  1B9X A;  3SVW D;  2OK6 A;  5TEF A;  3VGZ A;  2G99 A;  4O9D A;  4ZOZ A;  3HFQ A;  2H9N A;  2GNQ A;  3SFZ A;  5EAM A;  3NVQ A;  4ZOV A;  3DM0 A;  4G56 B;  4K3I D;  2AQ5 A;  3EI4 A;  3F3F A;  4GQB B;  3IJC A;  4JSN C;  2PM7 B;  4FA1 D;  5EAL A;  1RI6 A;  4NSX A;  5TEE A;  5FKS A;  3I7K A;  5IJ8 E;  5EAP A;  2GC4 A;  4PNK B;  3EI3 A;  2UZY B;  3E0C A;  5HE1 B;  3A0F A;  3EI2 B;  2G9A A;  4GM3 A;  2MTA H;  4OZU A;  2HKM A;  3AH8 B;  1JJU B;  2OVP B;  3SN6 B;  4J82 A;  2J56 H;  5I5M A;  3SBP A;  2CNX A;  1N6F A;  2AH1 A;  4L9O A;  1TYQ C;  2Z2N A;  2GC7 A;  4JSP C;  4XEI C;  2CN3 A;  4E54 B;  5FXY A;  1PBY B;  5H17 A;  5IJ7 E;  2HYE A;  1GOT B;  1JMX B;  3MXX A;  4GGC A;  2YMU A;  2P9I C;  2J57 G;  2BBK H;  2AH0 A;  2IAA A;  2PM9 A;  3C75 H;  4X3E A;  4A08 B;  3BWS A;  2IUP A;  2OVR B;  2TRC B;  5K1C C;  1MG3 A;  2YNN A;  4H5I A;  1QNI A;  5EMM B;  3MKQ A;  4TZ4 A;  4A0B A;  4JSX C;  5C2W B;  3V9F A;  1SHY B;  5AMS A;  4ERZ A;  2YB8 B;  3RN0 D;  2CE8 A;  4O45 A;  3SBQ A;  2B5N A;  3RLM D;  2B5M A;  5C2V B;  1OLZ A;  4R7A B;  5IC7 A;  2P9L C;  5CYK B;  4GQ1 A;  4FAV D;  4J8G A;  2AGY A;  3RSE C;  4CY2 A;  5H1M A;  5H14 A;  3JRO A;  3EI1 A;  1XKS A;  3JZH A;  2H14 A;  4Y5R D;  5CXC A;  4ZN4 A;  4X63 B;  4J86 A;  3DXM C;  4L3G D;  4J0W A;  2P9U C;  1XHM A;  3GRE A;  3JB9 L;  1GP2 B;  2UZX B;  3UVL A;  4PBY A;  4IA9 A;  3NVX A;  3FRX A;  4YVD A;  5FA5 B;  3AFC A;  2Q7Q A;  4E5Z B;  5CXB B;  4A11 B;  2B4E A;  2AGL A;  3MKS B;  3MMY A;  3KRW B;  4JXM A;  5EAR A;  1U2V C;  1PGU A;  3SMR A;  2O9K A;  4U7A A;  3I8E A;  3CFV A;  4CY3 A;  3DXK C;  4CI2 A;  4EWR A;  4GGA A;  5KDO B;  2IWF A;  1OMW B;  5JWZ A;  3PE7 A;  4GZ8 A;  3N0D A;  4GGD A;  4O3U B;  2H6Q A;  4H5J A;  2Z2O A;  4K3J B;  3RFG A;  3AL8 B;  4LG8 A;  3J81 g;  1GXR A;  3JPX A;  4L1Q D;  4A0A B;  4FWW A;  4XYI A;  4XYH A;  3OKW A;  3RRM C;  2HJ4 A;  4LGN A;  5FQD A;  5EM2 B;  3EI2 A;  5GSA A;  2XU7 A;  2IUV A;  2AGW A;  4N14 A;  4J77 A;  3V5W B;  3RFH A;  3N0E A;  3SXT D;  4CI3 A;  3EI4 B;  4BL0 A;  5EML B;  4E54 A;  4CY1 A;  3I2N A;  3SJL D;  5EMK B;  3SHF A;  2W18 A;  2H9L A;  3VA6 A;  4MK0 B;  4CI1 A;  4GQ2 P;  5HE3 B;  3I8C A;  3UKR C;  2H68 A;  2YNO A;  4X61 B;  4U1E I;  4A09 B;  1VYH C;  4A08 A;  2YNP A;  3PVW B;  4A2L A;  4I79 A;  2IUQ A;  5A2Q g;  2P9S C;  3AL9 A;  3V7D B;  4Z8L A;  1K32 A;  1JMZ B;  3ZWL B;  5TF2 A;  3OW8 A;  2P9N C;  1U4C A;  2PM6 B;  3UVN A;  3B7F A;  3U4Y A;  2HXC A;  2XL2 A;  4ESG A;  5HYN B;  2J55 H;  3PVU B;  3PSC B;  3JZN A;  4J81 A;  4GM8 A;  1JOF A;  3I7N A;  3MZK A;  2OJY A;  2HJB A;  3I7P A;  3PXW D;  4J87 A;  2OVQ B;  4GM9 A;  4J73 A;  5SXM A;  3JRP A;  1YFQ A;  1R5M A;  3ORV D;  5I5I A;  1N6D A;  5HE0 B;  3OL2 B;  4E5Z A;  5CXB A;  2B5L A;  1P22 A;  3IJ1 A;  3I7H A;  4PSW B;  3SLE D;  3IKO A;  4QQE A;  3K26 A;  2AGX A;  3FGB A;  3KRX B;  3OKY B;  4J79 A;  4UI9 R;  3F3G A;  1B9Y A;  5TDH B;  3C9C A;  4PC0 A;  2EBS A;  3OTT A;  3EU7 A;  2CO0 C;  4CC9 A;  2BCJ B;  4FHL A;  4FAN D;  4X60 B;  4L3H D;  1GG2 B;  1MG2 A;  2H3X A;  5AFU 3;  5GXH A;  4JT6 C;  3AL8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...