1S4UX

Crystal structure analysis of the beta-propeller protein ski8p
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
390
structure length
356
Chain Sequence
KVFIATANAGKAHDADIFSVSACNSFTVSCSGDGYLKVWDNKLLDNENPKDKSYSHFVHKSGLHHVDVLQAIERDAFELCLVATTSFSGDLLFYRITRKKVIFEKLDLLDSDMKKHSFWALKWGASLSHRLVATDVKGTTYIWKFHPFADESNSLTLNWSPTLELQGTVESPMTPSQFATSVDISERGLIATGFNNGTVQISELSTLRPLYNFENSIRSVKFSPQGSLLAIAHDSNSFGCITLYETEFGERIGSLSVFAHSSWVMSLSFNDSGETLCSAGWDGKLRFWDVKTKERITTLNMHCDDIEIEEDILAVDEHGDSLAEPGVFDVKFLKKGWRSNESLCCVCLDRSIRWFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antiviral protein SKI8
publication title Crystal structure of Ski8p, a WD-repeat protein with dual roles in mRNA metabolism and meiotic recombination
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Antiviral protein
total genus 85
structure length 356
sequence length 390
ec nomenclature
pdb deposition date 2004-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 1s4uX00
3SWSD 4GMBA 4PC0A 5GXIA 1B9XA 5IJ7E 2I0RA 4PSXB 4ZOYA 3EI2B 3C5MA 3OKYA 3RLMD 3UVMA 3J81g 4J0WA 3GFCA 2Q7QA 3RMZD 1QNIA 4UI9R 1GG2B 4XYHA 3AL8B 3OKTA 1N6DA 3MKSB 2P9LC 1S4UX 3SXTD 3FRXA 3SHFA 3UVNA 2PM9B 5TEFA 4PXWA 5IGOA 1JMXB 2J56H 3MZLA 2HXCA 2CNXA 4J86A 4X60B 4ZOXA 5C9ZB 3JZNA 3MZKA 3E0CA 5IJ8E 4OZUA 4J8GA 2AGLA 5HE1B 2W18A 5I5IA 1U2VC 5EMMB 4XEIC 3GREA 2HESX 3DXMC 3HFQA 3VGZA 4GQBB 5AMSA 3W15A 3IIWA 3FGBA 4A08A 1MDAH 3NVQA 2AH0A 4ZN4A 2H47A 2UZYB 2XU7A 3OTTA 4MK0B 5C2WB 2H68A 1NR0A 4ES0A 2HYEA 2B5MA 3UR4A 4N14A 5JWZA 3SBRA 3PE7A 4OWRA 3AL9A 3UVOA 3V9FA 4CI2A 5EM2B 3AFCA 5B4WA 3ORVD 2H6KA 4CZYA 3J80g 2OK4A 3VH0A 3F3GA 3EI3A 3N0DA 1XKSA 5EARA 4IA9A 4BH6A 2GC7A 3C9CA 2YBAA 3OL2B 3FM0A 3I8EA 3OKWA 2BCJB 4J78A 4PNKB 5C2VB 3NVXA 3CIKB 4A0AA 4GGDA 5FQDA 3SN6B 1B9YA 4U1EI 2PBIB 4X63B 5CYKB 3EI1B 2XL2A 3PSLA 4IMMA 2YMUA 1SQ9A 5CXBB 3SBPA 4Z8LA 5I5MA 4K3JB 4L1QD 3UKUC 4NSXA 3I2NA 2P9NC 5K19A 3IJCA 2G9AA 3EI4A 3C99A 4JXMA 3PVUB 4GM3A 2CN3A 4Y7RA 3BG0A 2H9LA 2H14A 3I7KA 3V5WB 1ERJA 4A09B 5EALA 3RFGA 5HE3B 2G99A 1K32A 4PBZA 3EI2A 4E54B 4FWWA 5GSAA 3MMYA 3IIYA 3PSCB 4ERYA 3MXXA 5SXMA 4E5ZB 4J81A 4FAVD 2P9UC 4A11B 3AL8A 5FKSA 4GM8A 3CFSB 2MTAH 5AFU3 2CN2A 2IUVA 4J8BA 5IGQA 2OVPB 2PM9A 5HE0B 2AGWA 4JD2C 5I5JA 4GQ2P 3RN1D 3DXKC 4BUJC 4R7AB 3DWLC 1PEVA 4X61B 2YNNA 5FA5B 4X3EA 4PBYA 2AQ5A 2Z2NA 4ZOZA 4JT5C 4O3TB 4J84A 1MG3A 1N6FA 4GGAA 4QL1A 2HJ4A 4D6VA 5EAMA 5FKRA 2AGZA 2OJYA 2QC5A 4JSXC 4J0XA 4EWRA 4O3UB 3I8CA 2H6QA 4L3HD 4LGNA 5HQGA 1SQJA 1GXRA 4L9OA 1RI6A 4I79A 4J82A 3PXWD 4ERZA 5KDOB 1P22A 3I7OA 4GQ1A 2H9MA 4H5JA 4CY3A 3SCYA 2H3XA 2PM7B 2UZXB 1OLZA 3I7PA 2I3TA 2J55H 5CXCB 4GZ8A 3OW8A 3ZWLB 2H6NA 1PI6A 5GMKn 3JB9L 3PXTD 4J87A 3CFVA 5FXYA 3SJLD 4TZ4A 4FA9D 5EM2A 4ZOVA 4D0KA 4JSNC 2CE9A 3PXSD 5THAA 1PGUA 2J57G 4GM9A 1XHMA 1YFQA 3EMHA 3AH8B 4JSVC 5AJAA 3JROA 3A0FA 2P9KC 5FKQA 4H5IA 3OL2A 1OMWB 2IURA 1NEXB 2XYIA 4KFMB 2IUPA 3L4MD 5TDHB 3EI1A 4G56B 4LG8A 2Z2OA 5CYKA 5HE2B 4QRJA 3KRWB 3N0EA 2HKRA 3K26A 5H17A 5CXBA 3DSMA 2GC4A 4Y5RD 2OK6A 4A0BB 4J73A 3PVWB 2PM6B 3BG1A 3EG6A 2QXVA 5TF2A 4A09A 4J79A 3IJ0A 2TRCB 5FLXg 2CO0C 4AEZA 1U4CA 4CI1A 5A2Qg 4QT8A 4JT6C 2Z2PA 4O45A 4E54A 3K27A 2P9PC 2AGYA 2B5LA 2IUQA 2P9SC 3OKYB 2H9NA 4BL0A 2I0TA 1JMZB 1Q47A 3UVKA 4U7AA 3EWEA 4E5ZA 4CZXA 4CZVA 3F3PA 1JOFA 2P9IC 4A11A 3SLED 3RFHA 3JRPA 3IJ1A 2H9PA 5IT9g 2CO0A 3JPXA 1FWXA 1K8KC 4CY5A 3SMRA 5FKTA 3ODTA 4FHLA 3JZHA 1PBYB 4QQEA 2B4EA 4FA4D 3V7DB 3IKOA 2OVQB 2IWFA 1GP2B 1VYHC 3U4YA 5H1MA 4A2MA 4O9DA 3JAMg 3C75H 2HKMA 1MG2A 1TYQC 3EU7A 4A7JA 1A0RB 2HJBA 1L0QA 2YNPA 5H14A 3RN0D 1R5MA 2OIZA 3NVNA 3DM0A 4A08B 3L4OD 1N6EA 3RRMC 1GOTB 2I3SA 2YB8B 3I7LA 4CC9A 4GGCA 3SVWD 4CY2A 5EMKB 1SHYB 3B7FA 3BWSA 3UVLA 3SBQA 3RSEC 3P4FA 5CXCA 3I7HA 3JZGA 4HDJA 4FA5D 2GNQA 2YNOA 4AOWA 4FAND 3I89A 3VA6A 5HYNB 5EMLB 2AH1A 4A2LA 1XIPA 3UKRC 4JSPC 2AGXA 3EI3B 1TBGA 3ULEC 4LG9A 3SFZA 4ESGA 2B5NA 5GXHA 5IC7A 5K1CC 2OVRB 2O9KA 2EBSA 2IWKA 5EAPA 2XL3A 4A0AB 4FB1D 1JJUB 5TEEA 4K3ID 4J77A 2BBKH 3F3FA 2H13A 3MKQA 4YVDA 3KRXB 4CY1A 3I7NA 2CE8A 4A0BA 4L3GD 2I0SA 3EI4B 4FA1D 5EMJB 4PSWB 4ERQA 4CI8A 4CI3A 4O1QD 4XYIA 2IAAA
chains in the Genus database with same CATH superfamily
3SWSD 4GMBA 3VI4A 4PC0A 5GXIA 1B9XA 5IJ7E 1VE7A 2I0RA 4PSXB 4ZOYA 3EI2B 2XDWA 3C5MA 3DDUA 3OKYA 5M5SA 3RLMD 3UVMA 3J81g 2VDKA 2VZ3A 4J0WA 3GFCA 2QR5A 2Q7QA 3RMZD 1QNIA 4UI9R 4DNWA 1GG2B 4XYHA 3AL8B 5E6SA 3OKTA 1N6DA 3MKSB 1H2ZA 2P9LC 1S4UX 3SXTD 3FRXA 3SHFA 1YR2A 3UVNA 1VZ3A 2PM9B 4AX4A 5TEFA 4PXWA 5IGOA 1JMXB 2J56H 3MZLA 2HXCA 1L5GA 2CNXA 2QZPA 4J86A 4X60B 4ZOXA 5C9ZB 3JZNA 3MZKA 4JHPC 3E0CA 5IJ8E 4UM9A 4OZUA 4J8GA 2AGLA 5HE1B 2W18A 5I5IA 1U2VC 1M1XA 5EMMB 4XEIC 3GREA 2HESX 4BCBA 3DXMC 3HFQA 3VGZA 1UTCA 4GQBB 5AMSA 3W15A 3IIWA 2BKLA 3FGBA 4BCCA 4A08A 1MDAH 3NVQA 2AH0A 4ZN4A 2H47A 2UZYB 2XU7A 3OTTA 4MK0B 5C2WB 2H68A 4MMZA 1NR0A 4ES0A 2HYEA 2B5MA 3UR4A 4N14A 5JWZA 3SBRA 4DNVA 3PE7A 4OWRA 1O6GA 3AL9A 3UVOA 3IJEA 3V9FA 2XE4A 2XZGA 4CI2A 5EM2B 3AFCA 5B4WA 3MVDK 3ORVD 2H6KA 4CZYA 2VC2A 3J80g 2OK4A 3VH0A 3F3GA 3EI3A 2HU5A 3NIGA 3N0DA 1XKSA 5E6RA 5EARA 5C86A 2VDLA 4IA9A 3O4IA 4BH6A 1C9LA 3ZDZA 2GC7A 3NIFA 1T2XA 3C9CA 2YBAA 3OL2B 3FM0A 3I8EA 3OKWA 2BCJB 4J78A 4PNKB 5C2VB 3EQ9A 3NVXA 3CIKB 4A0AA 5M61A 4GGDA 5FQDA 3SN6B 1B9YA 4U1EI 2PBIB 4X63B 5CYKB 3EI1B 2XL2A 3PSLA 4IMMA 2YMUA 1SQ9A 5CXBB 3SBPA 4Z8LA 5I5MA 4Z7NA 4K3JB 4L1QD 3UKUC 4O02A 5M5VA 4NSXA 3I2NA 2P9NC 3GD1I 5K19A 3IJCA 1I2MB 2G9AA 3FCSA 3EI4A 5FFOA 1C9IA 3C99A 4JXMA 3PVUB 4GM3A 2CN3A 4Y7RA 3BG0A 2EIDA 3I7KA 2H9LA 2H14A 3V5WB 1ERJA 4A09B 5EALA 3RFGA 5HE3B 2G99A 3ZDYA 4NBMA 1QFSA 4DNUA 1K32A 4PBZA 3EI2A 4E54B 4NAAA 4FWWA 5GSAA 3FCUA 3MMYA 3ZE0A 2HU8A 3IIYA 3PSCB 1UOPA 4ERYA 3EQ8A 3MXXA 5SXMA 4E5ZB 4J81A 4FAVD 2P9UC 4A11B 3AL8A 5FKSA 4GM8A 3CFSB 2MTAH 3IUJA 5AFU3 2CN2A 2IUVA 4J8BA 5IGQA 2OVPB 2PM9A 5HE0B 2AGWA 4JD2C 5I5JA 4GQ2P 3RN1D 3DXKC 4BUJC 4R7AB 3DWLC 3EQ7A 1JTDB 5M5UA 2VDRA 4BP9A 1PEVA 4X61B 2HU7A 3O4JA 2YNNA 1U8CA 5FA5B 4X3EA 4PBYA 2AQ5A 2Z2NA 4BCDA 4ZOZA 4JT5C 4O3TB 3ZDXA 4J84A 1MG3A 1N6FA 4GGAA 4QL1A 1TYEA 2HJ4A 4D6VA 5EAMA 5FKRA 3VI3A 2AGZA 2OJYA 2QC5A 4JSXC 4J0XA 4EWRA 4O3UB 3I8CA 2H6QA 4L3HD 4LGNA 5HQGA 1SQJA 1H2XA 1GXRA 4L9OA 1RI6A 4I79A 4J82A 4RE6A 3PXWD 4ERZA 5KDOB 3KCIA 1P22A 3I7OA 3IVMA 1E5TA 1O6FA 4GQ1A 2H9MA 1GOHA 4H5JA 4CY3A 3SCYA 2H3XA 2PM7B 4MMYA 4WK4A 2UZXB 1OLZA 3I7PA 2I3TA 4G55A 2J55H 5CXCB 4GZ8A 3OW8A 3ZWLB 2H6NA 1PI6A 5GMKn 3JB9L 2VDMA 3PXTD 3IUQA 4J87A 5E6UA 3CFVA 5FXYA 3SJLD 4TZ4A 5FFGA 5EM2A 4FA9D 4ZOVA 4UM8A 4D0KA 4BP8A 2VZ1A 4JSNC 2CE9A 3PXSD 5THAA 1PGUA 3IUMA 2J57G 4GM9A 1XHMA 1YFQA 3EMHA 2VDNA 3AH8B 3MUNA 4JSVC 5AJAA 2WQ8A 3JROA 3A0FA 3OF7A 1QFMA 2P9KC 4H5IA 5FKQA 3OL2A 1OMWB 2IURA 1NEXB 3O4HA 2XYIA 4KFMB 2IUPA 3L4MD 1GOGA 5TDHB 3EI1A 4G56B 4LG8A 2Z2OA 5CYKA 5HE2B 4QRJA 3KRWB 3N0EA 2HKRA 3K26A 5H17A 5CXBA 1JV2A 3DSMA 2EICA 2GC4A 1UOOA 4Y5RD 2OK6A 4A0BB 4J73A 3K71A 2EIBA 3PVWB 3ZE2A 3K72A 2PM6B 3BG1A 3EG6A 2QXVA 4Z7QA 5TF2A 4A09A 4J79A 3IJ0A 2TRCB 5FLXg 2CO0C 4AEZA 1U4CA 4CI1A 5A2Qg 4QT8A 4JT6C 1H2YA 2Z2PA 1H2WA 4O45A 3V4VA 4QAMA 4E54A 3K27A 2P9PC 2AGYA 2B5LA 3QI0A 2IUQA 2P9SC 3OKYB 2H9NA 4BL0A 2I0TA 1JMZB 1Q47A 3UVKA 4U7AA 3EWEA 4E5ZA 4CZXA 4CZVA 4AMYA 3F3PA 1JOFA 2P9IC 3IUNA 4A11A 3SLED 3RFHA 1E8MA 3JRPA 4O2WA 3IJ1A 2H9PA 5IT9g 2CO0A 3JPXA 1FWXA 1VZ2A 4NENA 1K8KC 4CY5A 3SMRA 5FKTA 3ODTA 3V4PA 4FHLA 3JZHA 1PBYB 4QQEA 4D9SA 2B4EA 4FA4D 3V7DB 3IKOA 2OVQB 2IWFA 1GP2B 1VYHC 3MUOA 3U4YA 3NIDA 5H1MA 4NC4A 4A2MA 4O9DA 3IURA 3JAMg 4Z7OA 3C75H 3T3MA 2HKMA 1MG2A 1TYQC 3EU7A 4A7JA 1A0RB 2HJBA 1L0QA 2YNPA 5H14A 3RN0D 1R5MA 2OIZA 3NVNA 3DM0A 4A08B 3L4OD 1N6EA 4WK0A 3RRMC 1GOTB 2I3SA 2YB8B 2JKXA 3I7LA 4CC9A 4GGCA 3SVWD 4CY2A 5EMKB 3T3PA 1SHYB 3B7FA 2VDQA 1GOFA 3BWSA 3UVLA 3SBQA 3RSEC 4G1EA 3P4FA 5CXCA 3I7HA 3JZGA 4G1MA 1UOQA 2VDPA 4HDJA 4FA5D 2GNQA 2YNOA 4L1MA 4AOWA 4FAND 3I89A 5M5RA 5M5TA 3VA6A 4AN1A 5HYNB 2VDOA 1K3IA 5EMLB 2AH1A 4A2LA 3QHYB 5C92A 1XIPA 3UKRC 4JSPC 2AGXA 3EI3B 1TBGA 3ULEC 4LG9A 4WK2A 3SFZA 1A12A 4ESGA 2B5NA 5GXHA 1VE6A 5IC7A 5K1CC 2OVRB 4RE5A 2O9KA 2EBSA 2IWKA 4AN0A 5EAPA 2XL3A 4MMXA 4FB1D 1JJUB 4A0AB 4IRZA 5TEEA 4K3ID 4J77A 2BBKH 3F3FA 2H13A 4AMZA 3MKQA 4YVDA 3KRXB 4CY1A 1E8NA 3I7NA 2CE8A 1BPOA 3K6SA 4A0BA 4L3GD 3IULA 3ZE1A 4JHNA 2I0SA 3EI4B 4FA1D 5EMJB 4PSWB 3GC3B 4ERQA 4CI8A 5HDBA 4CI3A 4O1QD 4XYIA 4WJKA 2IAAA 2EIEA 3O4GA
chains in the Genus database with same CATH topology
3SWSD 4GMBA 4PC0A 5GXIA 1B9XA 5IJ7E 2I0RA 4PSXB 4ZOYA 3EI2B 3C5MA 3OKYA 3RLMD 3UVMA 3J81g 4J0WA 3GFCA 2Q7QA 3RMZD 1QNIA 4UI9R 1GG2B 4XYHA 3AL8B 3OKTA 1N6DA 3MKSB 2P9LC 1S4UX 3SXTD 3FRXA 3SHFA 3UVNA 2PM9B 5TEFA 4PXWA 5IGOA 1JMXB 2J56H 3MZLA 2HXCA 2CNXA 4J86A 4X60B 4ZOXA 5C9ZB 3JZNA 3MZKA 3E0CA 5IJ8E 4OZUA 4J8GA 2AGLA 5HE1B 2W18A 5I5IA 1U2VC 5EMMB 4XEIC 3GREA 2HESX 3DXMC 3HFQA 3VGZA 4GQBB 5AMSA 3W15A 3IIWA 3FGBA 4A08A 1MDAH 3NVQA 2AH0A 4ZN4A 2H47A 2UZYB 2XU7A 3OTTA 4MK0B 5C2WB 2H68A 1NR0A 4ES0A 2HYEA 2B5MA 3UR4A 4N14A 5JWZA 3SBRA 3PE7A 4OWRA 3AL9A 3UVOA 3V9FA 4CI2A 5EM2B 3AFCA 5B4WA 3ORVD 2H6KA 4CZYA 3J80g 2OK4A 3VH0A 3F3GA 3EI3A 3N0DA 1XKSA 5EARA 4IA9A 4BH6A 2GC7A 3C9CA 2YBAA 3OL2B 3FM0A 3I8EA 3OKWA 2BCJB 4J78A 4PNKB 5C2VB 3NVXA 3CIKB 4A0AA 4GGDA 5FQDA 3SN6B 1B9YA 4U1EI 2PBIB 4X63B 5CYKB 3EI1B 2XL2A 3PSLA 4IMMA 2YMUA 1SQ9A 5CXBB 3SBPA 4Z8LA 5I5MA 4K3JB 4L1QD 3UKUC 4NSXA 3I2NA 2P9NC 5K19A 3IJCA 2G9AA 3EI4A 3C99A 4JXMA 3PVUB 4GM3A 2CN3A 4Y7RA 3BG0A 2H9LA 2H14A 3I7KA 3V5WB 1ERJA 4A09B 5EALA 3RFGA 5HE3B 2G99A 1K32A 4PBZA 3EI2A 4E54B 4FWWA 5GSAA 3MMYA 3IIYA 3PSCB 4ERYA 3MXXA 5SXMA 4E5ZB 4J81A 4FAVD 2P9UC 4A11B 3AL8A 5FKSA 4GM8A 3CFSB 2MTAH 5AFU3 2CN2A 2IUVA 4J8BA 5IGQA 2OVPB 2PM9A 5HE0B 2AGWA 4JD2C 5I5JA 4GQ2P 3RN1D 3DXKC 4BUJC 4R7AB 3DWLC 1PEVA 4X61B 2YNNA 5FA5B 4X3EA 4PBYA 2AQ5A 2Z2NA 4ZOZA 4JT5C 4O3TB 4J84A 1MG3A 1N6FA 4GGAA 4QL1A 2HJ4A 4D6VA 5EAMA 5FKRA 2AGZA 2OJYA 2QC5A 4JSXC 4J0XA 4EWRA 4O3UB 3I8CA 2H6QA 4L3HD 4LGNA 5HQGA 1SQJA 1GXRA 4L9OA 1RI6A 4I79A 4J82A 3PXWD 4ERZA 5KDOB 1P22A 3I7OA 4GQ1A 2H9MA 4H5JA 4CY3A 3SCYA 2H3XA 2PM7B 2UZXB 1OLZA 3I7PA 2I3TA 2J55H 5CXCB 4GZ8A 3OW8A 3ZWLB 2H6NA 1PI6A 5GMKn 3JB9L 3PXTD 4J87A 3CFVA 5FXYA 3SJLD 4TZ4A 4FA9D 5EM2A 4ZOVA 4D0KA 4JSNC 2CE9A 3PXSD 5THAA 1PGUA 2J57G 4GM9A 1XHMA 1YFQA 3EMHA 3AH8B 4JSVC 5AJAA 3JROA 3A0FA 2P9KC 5FKQA 4H5IA 3OL2A 1OMWB 2IURA 1NEXB 2XYIA 4KFMB 2IUPA 3L4MD 5TDHB 3EI1A 4G56B 4LG8A 2Z2OA 5CYKA 5HE2B 4QRJA 3KRWB 3N0EA 2HKRA 3K26A 5H17A 5CXBA 3DSMA 2GC4A 4Y5RD 2OK6A 4A0BB 4J73A 3PVWB 2PM6B 3BG1A 3EG6A 2QXVA 5TF2A 4A09A 4J79A 3IJ0A 2TRCB 5FLXg 2CO0C 4AEZA 1U4CA 4CI1A 5A2Qg 4QT8A 4JT6C 2Z2PA 4O45A 4E54A 3K27A 2P9PC 2AGYA 2B5LA 2IUQA 2P9SC 3OKYB 2H9NA 4BL0A 2I0TA 1JMZB 1Q47A 3UVKA 4U7AA 3EWEA 4E5ZA 4CZXA 4CZVA 3F3PA 1JOFA 2P9IC 4A11A 3SLED 3RFHA 3JRPA 3IJ1A 2H9PA 5IT9g 2CO0A 3JPXA 1FWXA 1K8KC 4CY5A 3SMRA 5FKTA 3ODTA 4FHLA 3JZHA 1PBYB 4QQEA 2B4EA 4FA4D 3V7DB 3IKOA 2OVQB 2IWFA 1GP2B 1VYHC 3U4YA 5H1MA 4A2MA 4O9DA 3JAMg 3C75H 2HKMA 1MG2A 1TYQC 3EU7A 4A7JA 1A0RB 2HJBA 1L0QA 2YNPA 5H14A 3RN0D 1R5MA 2OIZA 3NVNA 3DM0A 4A08B 3L4OD 1N6EA 3RRMC 1GOTB 2I3SA 2YB8B 3I7LA 4CC9A 4GGCA 3SVWD 4CY2A 5EMKB 1SHYB 3B7FA 3BWSA 3UVLA 3SBQA 3RSEC 3P4FA 5CXCA 3I7HA 3JZGA 4HDJA 4FA5D 2GNQA 2YNOA 4AOWA 4FAND 3I89A 3VA6A 5HYNB 5EMLB 2AH1A 4A2LA 1XIPA 3UKRC 4JSPC 2AGXA 3EI3B 1TBGA 3ULEC 4LG9A 3SFZA 4ESGA 2B5NA 5GXHA 5IC7A 5K1CC 2OVRB 2O9KA 2EBSA 2IWKA 5EAPA 2XL3A 4A0AB 4FB1D 1JJUB 5TEEA 4K3ID 4J77A 2BBKH 3F3FA 2H13A 3MKQA 4YVDA 3KRXB 4CY1A 3I7NA 2CE8A 4A0BA 4L3GD 2I0SA 3EI4B 4FA1D 5EMJB 4PSWB 4ERQA 4CI8A 4CI3A 4O1QD 4XYIA 2IAAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SWS D;  4GMB A;  4PC0 A;  5GXI A;  1B9X A;  5IJ7 E;  2I0R A;  4PSX B;  4ZOY A;  3EI2 B;  3C5M A;  3OKY A;  3RLM D;  3UVM A;  3J81 g;  4J0W A;  3GFC A;  2Q7Q A;  3RMZ D;  1QNI A;  4UI9 R;  1GG2 B;  4XYH A;  3AL8 B;  3OKT A;  1N6D A;  3MKS B;  2P9L C;  1S4U X;  3SXT D;  3FRX A;  3SHF A;  3UVN A;  2PM9 B;  5TEF A;  4PXW A;  5IGO A;  1JMX B;  2J56 H;  3MZL A;  2HXC A;  2CNX A;  4J86 A;  4X60 B;  4ZOX A;  5C9Z B;  3JZN A;  3MZK A;  3E0C A;  5IJ8 E;  4OZU A;  4J8G A;  2AGL A;  5HE1 B;  2W18 A;  5I5I A;  1U2V C;  5EMM B;  4XEI C;  3GRE A;  2HES X;  3DXM C;  3HFQ A;  3VGZ A;  4GQB B;  5AMS A;  3W15 A;  3IIW A;  3FGB A;  4A08 A;  1MDA H;  3NVQ A;  2AH0 A;  4ZN4 A;  2H47 A;  2UZY B;  2XU7 A;  3OTT A;  4MK0 B;  5C2W B;  2H68 A;  1NR0 A;  4ES0 A;  2HYE A;  2B5M A;  3UR4 A;  4N14 A;  5JWZ A;  3SBR A;  3PE7 A;  4OWR A;  3AL9 A;  3UVO A;  3V9F A;  4CI2 A;  5EM2 B;  3AFC A;  5B4W A;  3ORV D;  2H6K A;  4CZY A;  3J80 g;  2OK4 A;  3VH0 A;  3F3G A;  3EI3 A;  3N0D A;  1XKS A;  5EAR A;  4IA9 A;  4BH6 A;  2GC7 A;  3C9C A;  2YBA A;  3OL2 B;  3FM0 A;  3I8E A;  3OKW A;  2BCJ B;  4J78 A;  4PNK B;  5C2V B;  3NVX A;  3CIK B;  4A0A A;  4GGD A;  5FQD A;  3SN6 B;  1B9Y A;  4U1E I;  2PBI B;  4X63 B;  5CYK B;  3EI1 B;  2XL2 A;  3PSL A;  4IMM A;  2YMU A;  1SQ9 A;  5CXB B;  3SBP A;  4Z8L A;  5I5M A;  4K3J B;  4L1Q D;  3UKU C;  4NSX A;  3I2N A;  2P9N C;  5K19 A;  3IJC A;  2G9A A;  3EI4 A;  3C99 A;  4JXM A;  3PVU B;  4GM3 A;  2CN3 A;  4Y7R A;  3BG0 A;  2H9L A;  2H14 A;  3I7K A;  3V5W B;  1ERJ A;  4A09 B;  5EAL A;  3RFG A;  5HE3 B;  2G99 A;  1K32 A;  4PBZ A;  3EI2 A;  4E54 B;  4FWW A;  5GSA A;  3MMY A;  3IIY A;  3PSC B;  4ERY A;  3MXX A;  5SXM A;  4E5Z B;  4J81 A;  4FAV D;  2P9U C;  4A11 B;  3AL8 A;  5FKS A;  4GM8 A;  3CFS B;  2MTA H;  5AFU 3;  2CN2 A;  2IUV A;  4J8B A;  5IGQ A;  2OVP B;  2PM9 A;  5HE0 B;  2AGW A;  4JD2 C;  5I5J A;  4GQ2 P;  3RN1 D;  3DXK C;  4BUJ C;  4R7A B;  3DWL C;  1PEV A;  4X61 B;  2YNN A;  5FA5 B;  4X3E A;  4PBY A;  2AQ5 A;  2Z2N A;  4ZOZ A;  4JT5 C;  4O3T B;  4J84 A;  1MG3 A;  1N6F A;  4GGA A;  4QL1 A;  2HJ4 A;  4D6V A;  5EAM A;  5FKR A;  2AGZ A;  2OJY A;  2QC5 A;  4JSX C;  4J0X A;  4EWR A;  4O3U B;  3I8C A;  2H6Q A;  4L3H D;  4LGN A;  5HQG A;  1SQJ A;  1GXR A;  4L9O A;  1RI6 A;  4I79 A;  4J82 A;  3PXW D;  4ERZ A;  5KDO B;  1P22 A;  3I7O A;  4GQ1 A;  2H9M A;  4H5J A;  4CY3 A;  3SCY A;  2H3X A;  2PM7 B;  2UZX B;  1OLZ A;  3I7P A;  2I3T A;  2J55 H;  5CXC B;  4GZ8 A;  3OW8 A;  3ZWL B;  2H6N A;  1PI6 A;  5GMK n;  3JB9 L;  3PXT D;  4J87 A;  3CFV A;  5FXY A;  3SJL D;  4TZ4 A;  4FA9 D;  5EM2 A;  4ZOV A;  4D0K A;  4JSN C;  2CE9 A;  3PXS D;  5THA A;  1PGU A;  2J57 G;  4GM9 A;  1XHM A;  1YFQ A;  3EMH A;  3AH8 B;  4JSV C;  5AJA A;  3JRO A;  3A0F A;  2P9K C;  5FKQ A;  4H5I A;  3OL2 A;  1OMW B;  2IUR A;  1NEX B;  2XYI A;  4KFM B;  2IUP A;  3L4M D;  5TDH B;  3EI1 A;  4G56 B;  4LG8 A;  2Z2O A;  5CYK A;  5HE2 B;  4QRJ A;  3KRW B;  3N0E A;  2HKR A;  3K26 A;  5H17 A;  5CXB A;  3DSM A;  2GC4 A;  4Y5R D;  2OK6 A;  4A0B B;  4J73 A;  3PVW B;  2PM6 B;  3BG1 A;  3EG6 A;  2QXV A;  5TF2 A;  4A09 A;  4J79 A;  3IJ0 A;  2TRC B;  5FLX g;  2CO0 C;  4AEZ A;  1U4C A;  4CI1 A;  5A2Q g;  4QT8 A;  4JT6 C;  2Z2P A;  4O45 A;  4E54 A;  3K27 A;  2P9P C;  2AGY A;  2B5L A;  2IUQ A;  2P9S C;  3OKY B;  2H9N A;  4BL0 A;  2I0T A;  1JMZ B;  1Q47 A;  3UVK A;  4U7A A;  3EWE A;  4E5Z A;  4CZX A;  4CZV A;  3F3P A;  1JOF A;  2P9I C;  4A11 A;  3SLE D;  3RFH A;  3JRP A;  3IJ1 A;  2H9P A;  5IT9 g;  2CO0 A;  3JPX A;  1FWX A;  1K8K C;  4CY5 A;  3SMR A;  5FKT A;  3ODT A;  4FHL A;  3JZH A;  1PBY B;  4QQE A;  2B4E A;  4FA4 D;  3V7D B;  3IKO A;  2OVQ B;  2IWF A;  1GP2 B;  1VYH C;  3U4Y A;  5H1M A;  4A2M A;  4O9D A;  3JAM g;  3C75 H;  2HKM A;  1MG2 A;  1TYQ C;  3EU7 A;  4A7J A;  1A0R B;  2HJB A;  1L0Q A;  2YNP A;  5H14 A;  3RN0 D;  1R5M A;  2OIZ A;  3NVN A;  3DM0 A;  4A08 B;  3L4O D;  1N6E A;  3RRM C;  1GOT B;  2I3S A;  2YB8 B;  3I7L A;  4CC9 A;  4GGC A;  3SVW D;  4CY2 A;  5EMK B;  1SHY B;  3B7F A;  3BWS A;  3UVL A;  3SBQ A;  3RSE C;  3P4F A;  5CXC A;  3I7H A;  3JZG A;  4HDJ A;  4FA5 D;  2GNQ A;  2YNO A;  4AOW A;  4FAN D;  3I89 A;  3VA6 A;  5HYN B;  5EML B;  2AH1 A;  4A2L A;  1XIP A;  3UKR C;  4JSP C;  2AGX A;  3EI3 B;  1TBG A;  3ULE C;  4LG9 A;  3SFZ A;  4ESG A;  2B5N A;  5GXH A;  5IC7 A;  5K1C C;  2OVR B;  2O9K A;  2EBS A;  2IWK A;  5EAP A;  2XL3 A;  4A0A B;  4FB1 D;  1JJU B;  5TEE A;  4K3I D;  4J77 A;  2BBK H;  3F3F A;  2H13 A;  3MKQ A;  4YVD A;  3KRX B;  4CY1 A;  3I7N A;  2CE8 A;  4A0B A;  4L3G D;  2I0S A;  3EI4 B;  4FA1 D;  5EMJ B;  4PSW B;  4ERQ A;  4CI8 A;  4CI3 A;  4O1Q D;  4XYI A;  2IAA A; 
#chains in the Genus database with same CATH topology
 3SWS D;  4GMB A;  3VI4 A;  4PC0 A;  5GXI A;  1B9X A;  5IJ7 E;  1VE7 A;  2I0R A;  4PSX B;  4ZOY A;  3EI2 B;  2XDW A;  3C5M A;  3DDU A;  3OKY A;  5M5S A;  3RLM D;  3UVM A;  3J81 g;  2VDK A;  2VZ3 A;  4J0W A;  3GFC A;  2QR5 A;  2Q7Q A;  3RMZ D;  1QNI A;  4UI9 R;  4DNW A;  1GG2 B;  4XYH A;  3AL8 B;  5E6S A;  3OKT A;  1N6D A;  3MKS B;  1H2Z A;  2P9L C;  1S4U X;  3SXT D;  3FRX A;  3SHF A;  1YR2 A;  3UVN A;  1VZ3 A;  2PM9 B;  4AX4 A;  5TEF A;  4PXW A;  5IGO A;  1JMX B;  2J56 H;  3MZL A;  2HXC A;  1L5G A;  2CNX A;  2QZP A;  4J86 A;  4X60 B;  4ZOX A;  5C9Z B;  3JZN A;  3MZK A;  4JHP C;  3E0C A;  5IJ8 E;  4UM9 A;  4OZU A;  4J8G A;  2AGL A;  5HE1 B;  2W18 A;  5I5I A;  1U2V C;  1M1X A;  5EMM B;  4XEI C;  3GRE A;  2HES X;  4BCB A;  3DXM C;  3HFQ A;  3VGZ A;  1UTC A;  4GQB B;  5AMS A;  3W15 A;  3IIW A;  2BKL A;  3FGB A;  4BCC A;  4A08 A;  1MDA H;  3NVQ A;  2AH0 A;  4ZN4 A;  2H47 A;  2UZY B;  2XU7 A;  3OTT A;  4MK0 B;  5C2W B;  2H68 A;  4MMZ A;  1NR0 A;  4ES0 A;  2HYE A;  2B5M A;  3UR4 A;  4N14 A;  5JWZ A;  3SBR A;  4DNV A;  3PE7 A;  4OWR A;  1O6G A;  3AL9 A;  3UVO A;  3IJE A;  3V9F A;  2XE4 A;  2XZG A;  4CI2 A;  5EM2 B;  3AFC A;  5B4W A;  3MVD K;  3ORV D;  2H6K A;  4CZY A;  2VC2 A;  3J80 g;  2OK4 A;  3VH0 A;  3F3G A;  3EI3 A;  2HU5 A;  3NIG A;  3N0D A;  1XKS A;  5E6R A;  5EAR A;  5C86 A;  2VDL A;  4IA9 A;  3O4I A;  4BH6 A;  1C9L A;  3ZDZ A;  2GC7 A;  3NIF A;  1T2X A;  3C9C A;  2YBA A;  3OL2 B;  3FM0 A;  3I8E A;  3OKW A;  2BCJ B;  4J78 A;  4PNK B;  5C2V B;  3EQ9 A;  3NVX A;  3CIK B;  4A0A A;  5M61 A;  4GGD A;  5FQD A;  3SN6 B;  1B9Y A;  4U1E I;  2PBI B;  4X63 B;  5CYK B;  3EI1 B;  2XL2 A;  3PSL A;  4IMM A;  2YMU A;  1SQ9 A;  5CXB B;  3SBP A;  4Z8L A;  5I5M A;  4Z7N A;  4K3J B;  4L1Q D;  3UKU C;  4O02 A;  5M5V A;  4NSX A;  3I2N A;  2P9N C;  3GD1 I;  5K19 A;  3IJC A;  1I2M B;  2G9A A;  3FCS A;  3EI4 A;  5FFO A;  1C9I A;  3C99 A;  4JXM A;  3PVU B;  4GM3 A;  2CN3 A;  4Y7R A;  3BG0 A;  2EID A;  3I7K A;  2H9L A;  2H14 A;  3V5W B;  1ERJ A;  4A09 B;  5EAL A;  3RFG A;  5HE3 B;  2G99 A;  3ZDY A;  4NBM A;  1QFS A;  4DNU A;  1K32 A;  4PBZ A;  3EI2 A;  4E54 B;  4NAA A;  4FWW A;  5GSA A;  3FCU A;  3MMY A;  3ZE0 A;  2HU8 A;  3IIY A;  3PSC B;  1UOP A;  4ERY A;  3EQ8 A;  3MXX A;  5SXM A;  4E5Z B;  4J81 A;  4FAV D;  2P9U C;  4A11 B;  3AL8 A;  5FKS A;  4GM8 A;  3CFS B;  2MTA H;  3IUJ A;  5AFU 3;  2CN2 A;  2IUV A;  4J8B A;  5IGQ A;  2OVP B;  2PM9 A;  5HE0 B;  2AGW A;  4JD2 C;  5I5J A;  4GQ2 P;  3RN1 D;  3DXK C;  4BUJ C;  4R7A B;  3DWL C;  3EQ7 A;  1JTD B;  5M5U A;  2VDR A;  4BP9 A;  1PEV A;  4X61 B;  2HU7 A;  3O4J A;  2YNN A;  1U8C A;  5FA5 B;  4X3E A;  4PBY A;  2AQ5 A;  2Z2N A;  4BCD A;  4ZOZ A;  4JT5 C;  4O3T B;  3ZDX A;  4J84 A;  1MG3 A;  1N6F A;  4GGA A;  4QL1 A;  1TYE A;  2HJ4 A;  4D6V A;  5EAM A;  5FKR A;  3VI3 A;  2AGZ A;  2OJY A;  2QC5 A;  4JSX C;  4J0X A;  4EWR A;  4O3U B;  3I8C A;  2H6Q A;  4L3H D;  4LGN A;  5HQG A;  1SQJ A;  1H2X A;  1GXR A;  4L9O A;  1RI6 A;  4I79 A;  4J82 A;  4RE6 A;  3PXW D;  4ERZ A;  5KDO B;  3KCI A;  1P22 A;  3I7O A;  3IVM A;  1E5T A;  1O6F A;  4GQ1 A;  2H9M A;  1GOH A;  4H5J A;  4CY3 A;  3SCY A;  2H3X A;  2PM7 B;  4MMY A;  4WK4 A;  2UZX B;  1OLZ A;  3I7P A;  2I3T A;  4G55 A;  2J55 H;  5CXC B;  4GZ8 A;  3OW8 A;  3ZWL B;  2H6N A;  1PI6 A;  5GMK n;  3JB9 L;  2VDM A;  3PXT D;  3IUQ A;  4J87 A;  5E6U A;  3CFV A;  5FXY A;  3SJL D;  4TZ4 A;  5FFG A;  5EM2 A;  4FA9 D;  4ZOV A;  4UM8 A;  4D0K A;  4BP8 A;  2VZ1 A;  4JSN C;  2CE9 A;  3PXS D;  5THA A;  1PGU A;  3IUM A;  2J57 G;  4GM9 A;  1XHM A;  1YFQ A;  3EMH A;  2VDN A;  3AH8 B;  3MUN A;  4JSV C;  5AJA A;  2WQ8 A;  3JRO A;  3A0F A;  3OF7 A;  1QFM A;  2P9K C;  4H5I A;  5FKQ A;  3OL2 A;  1OMW B;  2IUR A;  1NEX B;  3O4H A;  2XYI A;  4KFM B;  2IUP A;  3L4M D;  1GOG A;  5TDH B;  3EI1 A;  4G56 B;  4LG8 A;  2Z2O A;  5CYK A;  5HE2 B;  4QRJ A;  3KRW B;  3N0E A;  2HKR A;  3K26 A;  5H17 A;  5CXB A;  1JV2 A;  3DSM A;  2EIC A;  2GC4 A;  1UOO A;  4Y5R D;  2OK6 A;  4A0B B;  4J73 A;  3K71 A;  2EIB A;  3PVW B;  3ZE2 A;  3K72 A;  2PM6 B;  3BG1 A;  3EG6 A;  2QXV A;  4Z7Q A;  5TF2 A;  4A09 A;  4J79 A;  3IJ0 A;  2TRC B;  5FLX g;  2CO0 C;  4AEZ A;  1U4C A;  4CI1 A;  5A2Q g;  4QT8 A;  4JT6 C;  1H2Y A;  2Z2P A;  1H2W A;  4O45 A;  3V4V A;  4QAM A;  4E54 A;  3K27 A;  2P9P C;  2AGY A;  2B5L A;  3QI0 A;  2IUQ A;  2P9S C;  3OKY B;  2H9N A;  4BL0 A;  2I0T A;  1JMZ B;  1Q47 A;  3UVK A;  4U7A A;  3EWE A;  4E5Z A;  4CZX A;  4CZV A;  4AMY A;  3F3P A;  1JOF A;  2P9I C;  3IUN A;  4A11 A;  3SLE D;  3RFH A;  1E8M A;  3JRP A;  4O2W A;  3IJ1 A;  2H9P A;  5IT9 g;  2CO0 A;  3JPX A;  1FWX A;  1VZ2 A;  4NEN A;  1K8K C;  4CY5 A;  3SMR A;  5FKT A;  3ODT A;  3V4P A;  4FHL A;  3JZH A;  1PBY B;  4QQE A;  4D9S A;  2B4E A;  4FA4 D;  3V7D B;  3IKO A;  2OVQ B;  2IWF A;  1GP2 B;  1VYH C;  3MUO A;  3U4Y A;  3NID A;  5H1M A;  4NC4 A;  4A2M A;  4O9D A;  3IUR A;  3JAM g;  4Z7O A;  3C75 H;  3T3M A;  2HKM A;  1MG2 A;  1TYQ C;  3EU7 A;  4A7J A;  1A0R B;  2HJB A;  1L0Q A;  2YNP A;  5H14 A;  3RN0 D;  1R5M A;  2OIZ A;  3NVN A;  3DM0 A;  4A08 B;  3L4O D;  1N6E A;  4WK0 A;  3RRM C;  1GOT B;  2I3S A;  2YB8 B;  2JKX A;  3I7L A;  4CC9 A;  4GGC A;  3SVW D;  4CY2 A;  5EMK B;  3T3P A;  1SHY B;  3B7F A;  2VDQ A;  1GOF A;  3BWS A;  3UVL A;  3SBQ A;  3RSE C;  4G1E A;  3P4F A;  5CXC A;  3I7H A;  3JZG A;  4G1M A;  1UOQ A;  2VDP A;  4HDJ A;  4FA5 D;  2GNQ A;  2YNO A;  4L1M A;  4AOW A;  4FAN D;  3I89 A;  5M5R A;  5M5T A;  3VA6 A;  4AN1 A;  5HYN B;  2VDO A;  1K3I A;  5EML B;  2AH1 A;  4A2L A;  3QHY B;  5C92 A;  1XIP A;  3UKR C;  4JSP C;  2AGX A;  3EI3 B;  1TBG A;  3ULE C;  4LG9 A;  4WK2 A;  3SFZ A;  1A12 A;  4ESG A;  2B5N A;  5GXH A;  1VE6 A;  5IC7 A;  5K1C C;  2OVR B;  4RE5 A;  2O9K A;  2EBS A;  2IWK A;  4AN0 A;  5EAP A;  2XL3 A;  4MMX A;  4FB1 D;  1JJU B;  4A0A B;  4IRZ A;  5TEE A;  4K3I D;  4J77 A;  2BBK H;  3F3F A;  2H13 A;  4AMZ A;  3MKQ A;  4YVD A;  3KRX B;  4CY1 A;  1E8N A;  3I7N A;  2CE8 A;  1BPO A;  3K6S A;  4A0B A;  4L3G D;  3IUL A;  3ZE1 A;  4JHN A;  2I0S A;  3EI4 B;  4FA1 D;  5EMJ B;  4PSW B;  3GC3 B;  4ERQ A;  4CI8 A;  5HDB A;  4CI3 A;  4O1Q D;  4XYI A;  4WJK A;  2IAA A;  2EIE A;  3O4G A; 
#chains in the Genus database with same CATH homology
 3SWS D;  4GMB A;  4PC0 A;  5GXI A;  1B9X A;  5IJ7 E;  2I0R A;  4PSX B;  4ZOY A;  3EI2 B;  3C5M A;  3OKY A;  3RLM D;  3UVM A;  3J81 g;  4J0W A;  3GFC A;  2Q7Q A;  3RMZ D;  1QNI A;  4UI9 R;  1GG2 B;  4XYH A;  3AL8 B;  3OKT A;  1N6D A;  3MKS B;  2P9L C;  1S4U X;  3SXT D;  3FRX A;  3SHF A;  3UVN A;  2PM9 B;  5TEF A;  4PXW A;  5IGO A;  1JMX B;  2J56 H;  3MZL A;  2HXC A;  2CNX A;  4J86 A;  4X60 B;  4ZOX A;  5C9Z B;  3JZN A;  3MZK A;  3E0C A;  5IJ8 E;  4OZU A;  4J8G A;  2AGL A;  5HE1 B;  2W18 A;  5I5I A;  1U2V C;  5EMM B;  4XEI C;  3GRE A;  2HES X;  3DXM C;  3HFQ A;  3VGZ A;  4GQB B;  5AMS A;  3W15 A;  3IIW A;  3FGB A;  4A08 A;  1MDA H;  3NVQ A;  2AH0 A;  4ZN4 A;  2H47 A;  2UZY B;  2XU7 A;  3OTT A;  4MK0 B;  5C2W B;  2H68 A;  1NR0 A;  4ES0 A;  2HYE A;  2B5M A;  3UR4 A;  4N14 A;  5JWZ A;  3SBR A;  3PE7 A;  4OWR A;  3AL9 A;  3UVO A;  3V9F A;  4CI2 A;  5EM2 B;  3AFC A;  5B4W A;  3ORV D;  2H6K A;  4CZY A;  3J80 g;  2OK4 A;  3VH0 A;  3F3G A;  3EI3 A;  3N0D A;  1XKS A;  5EAR A;  4IA9 A;  4BH6 A;  2GC7 A;  3C9C A;  2YBA A;  3OL2 B;  3FM0 A;  3I8E A;  3OKW A;  2BCJ B;  4J78 A;  4PNK B;  5C2V B;  3NVX A;  3CIK B;  4A0A A;  4GGD A;  5FQD A;  3SN6 B;  1B9Y A;  4U1E I;  2PBI B;  4X63 B;  5CYK B;  3EI1 B;  2XL2 A;  3PSL A;  4IMM A;  2YMU A;  1SQ9 A;  5CXB B;  3SBP A;  4Z8L A;  5I5M A;  4K3J B;  4L1Q D;  3UKU C;  4NSX A;  3I2N A;  2P9N C;  5K19 A;  3IJC A;  2G9A A;  3EI4 A;  3C99 A;  4JXM A;  3PVU B;  4GM3 A;  2CN3 A;  4Y7R A;  3BG0 A;  2H9L A;  2H14 A;  3I7K A;  3V5W B;  1ERJ A;  4A09 B;  5EAL A;  3RFG A;  5HE3 B;  2G99 A;  1K32 A;  4PBZ A;  3EI2 A;  4E54 B;  4FWW A;  5GSA A;  3MMY A;  3IIY A;  3PSC B;  4ERY A;  3MXX A;  5SXM A;  4E5Z B;  4J81 A;  4FAV D;  2P9U C;  4A11 B;  3AL8 A;  5FKS A;  4GM8 A;  3CFS B;  2MTA H;  5AFU 3;  2CN2 A;  2IUV A;  4J8B A;  5IGQ A;  2OVP B;  2PM9 A;  5HE0 B;  2AGW A;  4JD2 C;  5I5J A;  4GQ2 P;  3RN1 D;  3DXK C;  4BUJ C;  4R7A B;  3DWL C;  1PEV A;  4X61 B;  2YNN A;  5FA5 B;  4X3E A;  4PBY A;  2AQ5 A;  2Z2N A;  4ZOZ A;  4JT5 C;  4O3T B;  4J84 A;  1MG3 A;  1N6F A;  4GGA A;  4QL1 A;  2HJ4 A;  4D6V A;  5EAM A;  5FKR A;  2AGZ A;  2OJY A;  2QC5 A;  4JSX C;  4J0X A;  4EWR A;  4O3U B;  3I8C A;  2H6Q A;  4L3H D;  4LGN A;  5HQG A;  1SQJ A;  1GXR A;  4L9O A;  1RI6 A;  4I79 A;  4J82 A;  3PXW D;  4ERZ A;  5KDO B;  1P22 A;  3I7O A;  4GQ1 A;  2H9M A;  4H5J A;  4CY3 A;  3SCY A;  2H3X A;  2PM7 B;  2UZX B;  1OLZ A;  3I7P A;  2I3T A;  2J55 H;  5CXC B;  4GZ8 A;  3OW8 A;  3ZWL B;  2H6N A;  1PI6 A;  5GMK n;  3JB9 L;  3PXT D;  4J87 A;  3CFV A;  5FXY A;  3SJL D;  4TZ4 A;  4FA9 D;  5EM2 A;  4ZOV A;  4D0K A;  4JSN C;  2CE9 A;  3PXS D;  5THA A;  1PGU A;  2J57 G;  4GM9 A;  1XHM A;  1YFQ A;  3EMH A;  3AH8 B;  4JSV C;  5AJA A;  3JRO A;  3A0F A;  2P9K C;  5FKQ A;  4H5I A;  3OL2 A;  1OMW B;  2IUR A;  1NEX B;  2XYI A;  4KFM B;  2IUP A;  3L4M D;  5TDH B;  3EI1 A;  4G56 B;  4LG8 A;  2Z2O A;  5CYK A;  5HE2 B;  4QRJ A;  3KRW B;  3N0E A;  2HKR A;  3K26 A;  5H17 A;  5CXB A;  3DSM A;  2GC4 A;  4Y5R D;  2OK6 A;  4A0B B;  4J73 A;  3PVW B;  2PM6 B;  3BG1 A;  3EG6 A;  2QXV A;  5TF2 A;  4A09 A;  4J79 A;  3IJ0 A;  2TRC B;  5FLX g;  2CO0 C;  4AEZ A;  1U4C A;  4CI1 A;  5A2Q g;  4QT8 A;  4JT6 C;  2Z2P A;  4O45 A;  4E54 A;  3K27 A;  2P9P C;  2AGY A;  2B5L A;  2IUQ A;  2P9S C;  3OKY B;  2H9N A;  4BL0 A;  2I0T A;  1JMZ B;  1Q47 A;  3UVK A;  4U7A A;  3EWE A;  4E5Z A;  4CZX A;  4CZV A;  3F3P A;  1JOF A;  2P9I C;  4A11 A;  3SLE D;  3RFH A;  3JRP A;  3IJ1 A;  2H9P A;  5IT9 g;  2CO0 A;  3JPX A;  1FWX A;  1K8K C;  4CY5 A;  3SMR A;  5FKT A;  3ODT A;  4FHL A;  3JZH A;  1PBY B;  4QQE A;  2B4E A;  4FA4 D;  3V7D B;  3IKO A;  2OVQ B;  2IWF A;  1GP2 B;  1VYH C;  3U4Y A;  5H1M A;  4A2M A;  4O9D A;  3JAM g;  3C75 H;  2HKM A;  1MG2 A;  1TYQ C;  3EU7 A;  4A7J A;  1A0R B;  2HJB A;  1L0Q A;  2YNP A;  5H14 A;  3RN0 D;  1R5M A;  2OIZ A;  3NVN A;  3DM0 A;  4A08 B;  3L4O D;  1N6E A;  3RRM C;  1GOT B;  2I3S A;  2YB8 B;  3I7L A;  4CC9 A;  4GGC A;  3SVW D;  4CY2 A;  5EMK B;  1SHY B;  3B7F A;  3BWS A;  3UVL A;  3SBQ A;  3RSE C;  3P4F A;  5CXC A;  3I7H A;  3JZG A;  4HDJ A;  4FA5 D;  2GNQ A;  2YNO A;  4AOW A;  4FAN D;  3I89 A;  3VA6 A;  5HYN B;  5EML B;  2AH1 A;  4A2L A;  1XIP A;  3UKR C;  4JSP C;  2AGX A;  3EI3 B;  1TBG A;  3ULE C;  4LG9 A;  3SFZ A;  4ESG A;  2B5N A;  5GXH A;  5IC7 A;  5K1C C;  2OVR B;  2O9K A;  2EBS A;  2IWK A;  5EAP A;  2XL3 A;  4A0A B;  4FB1 D;  1JJU B;  5TEE A;  4K3I D;  4J77 A;  2BBK H;  3F3F A;  2H13 A;  3MKQ A;  4YVD A;  3KRX B;  4CY1 A;  3I7N A;  2CE8 A;  4A0B A;  4L3G D;  2I0S A;  3EI4 B;  4FA1 D;  5EMJ B;  4PSW B;  4ERQ A;  4CI8 A;  4CI3 A;  4O1Q D;  4XYI A;  2IAA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...