1S4UX

Crystal structure analysis of the beta-propeller protein ski8p
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
390
structure length
356
Chain Sequence
KVFIATANAGKAHDADIFSVSACNSFTVSCSGDGYLKVWDNKLLDNENPKDKSYSHFVHKSGLHHVDVLQAIERDAFELCLVATTSFSGDLLFYRITRKKVIFEKLDLLDSDMKKHSFWALKWGASLSHRLVATDVKGTTYIWKFHPFADESNSLTLNWSPTLELQGTVESPMTPSQFATSVDISERGLIATGFNNGTVQISELSTLRPLYNFENSIRSVKFSPQGSLLAIAHDSNSFGCITLYETEFGERIGSLSVFAHSSWVMSLSFNDSGETLCSAGWDGKLRFWDVKTKERITTLNMHCDDIEIEEDILAVDEHGDSLAEPGVFDVKFLKKGWRSNESLCCVCLDRSIRWFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Antiviral protein
molecule keywords Antiviral protein SKI8
publication title Crystal structure of Ski8p, a WD-repeat protein with dual roles in mRNA metabolism and meiotic recombination
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 85
structure length 356
sequence length 390
ec nomenclature
pdb deposition date 2004-01-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 1s4uX00
2CN3A 1FWXA 3SLED 3I7OA 1JOFA 4GQBB 4AEZA 3JZGA 4A09B 2CNXA 4LGNA 5FXYA 2MTAH 4A7JA 3U4YA 2IWKA 1PGUA 4PBYA 4FWWA 2HJBA 2YNOA 5HE0B 5EALA 3PXSD 2UZYB 2YBAA 2H9PA 5JWZA 4KFMB 3JAMg 3A0FA 4J8BA 5HE1B 3EI4A 3MKQA 3RFGA 3V7DB 2PM9B 4EWRA 3SBQA 4I79A 4X63B 3K27A 4FA5D 4J0XA 4D6VA 3L4MD 4X60B 4FHLA 5K19A 2IUQA 2P9SC 5CXCA 3AL9A 1PBYB 2I0RA 4J73A 3IKOA 3ORVD 5HQGA 3OKTA 2OIZA 2H9MA 5C9ZB 3I7LA 1MG3A 5H17A 2O9KA 4X3EA 4GMBA 2OVQB 4J77A 5TEFA 2PBIB 3F3GA 2UZXB 3J81g 4J86A 2J56H 5FQDA 3EI2A 2OJYA 2HJ4A 3IIYA 3JB9L 2PM6B 4ZOVA 5CXBB 3JZHA 3RLMD 4TZ4A 3OKYA 3I7PA 4CY2A 5FKQA 5I5MA 5FKTA 2QC5A 2H14A 4JXMA 5IJ8E 5EM2A 4J82A 3FM0A 4UI9R 3PVUB 1OMWB 1RI6A 5SXMA 3CIKB 3EG6A 2H68A 3RMZD 3W15A 4IMMA 3EI1A 3P4FA 4E54A 4X61B 3DXMC 3RN0D 2AGWA 3RFHA 4U7AA 3C75H 2P9IC 4CZXA 4GGCA 3BG0A 2XL3A 3SJLD 1JJUB 2YNPA 2HESX 2AGZA 4CZYA 2I3SA 3UVKA 2CE8A 2PM7B 3MKSB 3OW8A 4GZ8A 4QRJA 5TF2A 2B5LA 3C5MA 4CI2A 4A09A 3EMHA 3BG1A 3SHFA 4OWRA 2H9NA 3I2NA 3VA6A 3V5WB 5EMKB 4O3TB 4XEIC 4CI8A 5B4WA 4ES0A 3KRWB 4JSXC 1B9XA 4J84A 4AOWA 3FRXA 4FB1D 2EBSA 1R5MA 2CE9A 2H6QA 4A0AB 5GSAA 5TDHB 2H13A 1PI6A 3MZKA 4N14A 3JROA 2CN2A 5FLXg 4A08A 4GQ2P 3AL8A 3IJ1A 3C9CA 5H1MA 3UVLA 4GM8A 4PNKB 5KDOB 4PSWB 5FA5B 4A11B 5AFU3 4A0BB 1JMXB 3SFZA 2H6NA 5EMJB 1NR0A 3PSCB 2HKMA 5I5IA 2OK6A 3IJCA 3RRMC 3V9FA 2G9AA 5FKSA 1K8KC 3PSLA 4JSNC 4MK0B 4LG9A 5EMLB 5TEEA 2IWFA 2OVRB 3I89A 3SXTD 4GGAA 4D0KA 4BUJC 3MZLA 2HKRA 1GP2B 3SBPA 2XYIA 2YMUA 3EI3A 2J55H 4A2MA 3SVWD 1TYQC 3GFCA 4GM3A 5AMSA 2OVPB 5I5JA 4ESGA 3MMYA 2Q7QA 4BH6A 5HYNB 2HXCA 3DXKC 4FAVD 2QXVA 1S4UX 4LG8A 5THAA 5AJAA 2P9PC 3MXXA 5CXCB 3GREA 4ZOYA 2AQ5A 2TRCB 3B7FA 3NVNA 5EAMA 3IIWA 4O3UB 4XYIA 4IA9A 4O1QD 1SQ9A 4GM9A 5CYKA 3SMRA 3EU7A 4J8GA 3J80g 5HE2B 3NVXA 1N6FA 4JT5C 3EWEA 3I8CA 5H14A 2Z2NA 4J78A 4FA9D 4PBZA 4XYHA 3SBRA 3EI2B 4O45A 3SN6B 1GG2B 3UKUC 2I0SA 3E0CA 4A0AA 3OKYB 3BWSA 1TBGA 4GQ1A 3CFVA 1JMZB 5EM2B 4H5JA 4L3HD 2GNQA 4R7AB 5IGOA 5K1CC 3F3FA 4ZOXA 3N0DA 3OTTA 1YFQA 1B9YA 2GC7A 3DSMA 3I7NA 3EI1B 4NSXA 2PM9A 5GMKn 4E54B 1GXRA 5IC7A 3PXTD 4OZUA 1PEVA 4ERQA 3I7KA 4CZVA 4E5ZB 2AGXA 4CY5A 3SWSD 2AGLA 3VH0A 3JPXA 2P9NC 4O9DA 4A2LA 4QT8A 1K32A 3C99A 3L4OD 3OL2B 3K26A 5C2WB 1N6DA 2IUVA 1NEXB 4Y5RD 4CC9A 2HYEA 1QNIA 3PVWB 3PE7A 4CI1A 3JRPA 4ZOZA 2IAAA 4JD2C 4JT6C 4ERZA 2B5NA 4PXWA 4QL1A 5GXHA 3UVOA 5EAPA 1GOTB 1ERJA 5CXBA 1U2VC 4L3GD 1XKSA 4FA1D 3VGZA 4K3JB 2B4EA 4PSXB 2CO0A 4JSPC 5EARA 4BL0A 2BCJB 3UKRC 2GC4A 3N0EA 4J81A 4L1QD 1XHMA 4L9OA 2H3XA 2Z2OA 4Z8LA 4A08B 3NVQA 4K3ID 3SCYA 3AL8B 1A0RB 4CY1A 3RN1D 3HFQA 1P22A 2AH1A 3EI4B 3IJ0A 3FGBA 4H5IA 4JSVC 4Y7RA 4HDJA 2IURA 2AH0A 2H47A 2J57G 2P9LC 4CY3A 3AFCA 2YNNA 2OK4A 2Z2PA 4YVDA 2P9KC 3AH8B 3ULEC 1L0QA 4J0WA 5IGQA 2AGYA 2YB8B 4U1EI 1MDAH 4ERYA 1XIPA 2H9LA 1VYHC 2CO0C 3UR4A 4CI3A 1MG2A 1N6EA 3DM0A 3EI3B 4J79A 2H6KA 3PXWD 3ODTA 4J87A 5IJ7E 2XU7A 2B5MA 2G99A 3RSEC 3UVMA 2P9UC 4E5ZA 2IUPA 2XL2A 2BBKH 2I3TA 5EMMB 3F3PA 4FAND 3OKWA 5FKRA 3UVNA 3JZNA 3OL2A 1SHYB 5A2Qg 1Q47A 3ZWLB 1U4CA 5IT9g 4FA4D 2W18A 4A11A 4A0BA 3I8EA 1SQJA 5GXIA 2I0TA 5CYKB 5HE3B 4GGDA 3DWLC 3CFSB 4G56B 5C2VB 3KRXB 3I7HA 4QQEA 1OLZA 4ZN4A 4PC0A
chains in the Genus database with same CATH superfamily
2CN3A 1U8CA 2BKLA 2XDWA 1FWXA 3ZDZA 3SLED 3I7OA 1JOFA 4GQBB 4AEZA 4L1MA 3EQ9A 3JZGA 4A09B 2CNXA 4LGNA 5FXYA 4G55A 1UOQA 4MMZA 2MTAH 4A7JA 3U4YA 2IWKA 1PGUA 2QR5A 1K3IA 4FWWA 2VDMA 4PBYA 4Z7QA 2HJBA 2YNOA 5HE0B 5EALA 3MUNA 3PXSD 2UZYB 2YBAA 2H9PA 5JWZA 4KFMB 3JAMg 3A0FA 4J8BA 5HE1B 1QFMA 3EI4A 3MKQA 3RFGA 3V7DB 2PM9B 4EWRA 3SBQA 4I79A 4X63B 3K27A 4FA5D 1JV2A 1VZ3A 4J0XA 5M5TA 4D6VA 3L4MD 4X60B 4FHLA 5K19A 1GOFA 3GD1I 2IUQA 2P9SC 5CXCA 3AL9A 1PBYB 2I0RA 4J73A 3IKOA 3ORVD 5HQGA 4BP9A 3OKTA 2OIZA 2H9MA 5C9ZB 3I7LA 1MG3A 5H17A 3KCIA 3O4IA 2O9KA 4X3EA 4GMBA 2OVQB 4J77A 5TEFA 2PBIB 3F3GA 2UZXB 3J81g 4J86A 2J56H 3MVDK 5FQDA 3EI2A 2OJYA 2VDQA 4MMXA 2HJ4A 3IIYA 3JB9L 2PM6B 4ZOVA 4DNVA 5CXBB 3JZHA 3RLMD 4TZ4A 2HU5A 3OKYA 3I7PA 4CY2A 5FKQA 5I5MA 5FKTA 1I2MB 4RE5A 2QC5A 2H14A 4JXMA 5IJ8E 2VDLA 5EM2A 5M5VA 4J82A 3FM0A 3FCUA 1C9IA 4UI9R 3PVUB 1OMWB 1O6FA 1RI6A 4JHNA 2EIEA 5SXMA 3CIKB 3EG6A 3K6SA 2H68A 5C92A 3RMZD 3W15A 4IMMA 3EI1A 3P4FA 4O02A 4E54A 4X61B 3V4PA 3DXMC 3RN0D 1UTCA 2WQ8A 2AGWA 5E6SA 3RFHA 4U7AA 3C75H 2P9IC 4CZXA 4GGCA 1L5GA 3BG0A 2XL3A 3SJLD 1JJUB 2YNPA 2HESX 2AGZA 4CZYA 2I3SA 3UVKA 2CE8A 2PM7B 3MKSB 3OW8A 1GOHA 4GZ8A 4QRJA 5TF2A 2B5LA 3C5MA 4CI2A 4A09A 3EMHA 3IULA 3BG1A 3SHFA 4OWRA 2H9NA 3I2NA 3VA6A 3V5WB 5EMKB 4O3TB 4XEIC 4CI8A 5B4WA 4ES0A 3KRWB 3IVMA 4JSXC 4IRZA 1B9XA 4J84A 4AOWA 3FRXA 4FB1D 3OF7A 2EBSA 1T2XA 1R5MA 2CE9A 2H6QA 3IJEA 4A0AB 5GSAA 2QZPA 5TDHB 2H13A 1PI6A 3MZKA 4N14A 3JROA 2CN2A 5FLXg 4A08A 4RE6A 4GQ2P 3AL8A 3IJ1A 3C9CA 5H1MA 3ZDXA 3UVLA 4GM8A 3IURA 4PNKB 5KDOB 4PSWB 5FA5B 1H2WA 4A11B 5AFU3 4A0BB 1O6GA 1JMXB 4DNUA 3SFZA 1E8NA 2H6NA 1NR0A 4WK0A 5EMJB 4DNWA 3PSCB 5M5UA 2HKMA 5C86A 5I5IA 2OK6A 3IJCA 3RRMC 3V9FA 2G9AA 5FKSA 1K8KC 3PSLA 4JSNC 4MK0B 4LG9A 5EMLB 5TEEA 2IWFA 2OVRB 3I89A 3SXTD 4AN1A 3NIGA 2VDKA 4GGAA 4D0KA 4BUJC 3MZLA 4NC4A 2HKRA 1GP2B 2VDPA 2VDOA 3SBPA 2XYIA 3EQ8A 3K71A 2YMUA 3EI3A 2J55H 5M61A 3ZE0A 4A2MA 3SVWD 1TYQC 3GFCA 4BCDA 4GM3A 5AMSA 2OVPB 2HU8A 5I5JA 3NIFA 4WK2A 5FFGA 3MMYA 4ESGA 1E8MA 2Q7QA 4BH6A 5HYNB 4QAMA 2HXCA 3DXKC 4FAVD 2QXVA 4AMYA 1S4UX 4LG8A 1E5TA 4NENA 1JTDB 5THAA 5AJAA 2EICA 2P9PC 3MXXA 5CXCB 3GREA 4ZOYA 1TYEA 2AQ5A 2TRCB 3B7FA 3NVNA 5EAMA 1GOGA 3ZE1A 1YR2A 3IIWA 2HU7A 4O3UB 4XYIA 4IA9A 4O1QD 1SQ9A 2VDRA 4GM9A 5CYKA 3SMRA 3EU7A 4J8GA 3J80g 4AN0A 5HE2B 5FFOA 2VC2A 1N6FA 3NVXA 3MUOA 3EWEA 3I8CA 4JT5C 2XE4A 5H14A 4G1MA 2Z2NA 1UOOA 4J78A 3EQ7A 5E6RA 1A12A 4FA9D 4PBZA 4XYHA 3SBRA 3EI2B 4O45A 3SN6B 1H2XA 1GG2B 4JHPC 3UKUC 2I0SA 3IUNA 3QHYB 4WK4A 3E0CA 4A0AA 3OKYB 5M5SA 3BWSA 3T3MA 1TBGA 4GQ1A 3CFVA 1JMZB 5EM2B 4H5JA 4L3HD 2GNQA 4R7AB 5IGOA 5K1CC 3F3FA 4ZOXA 3N0DA 3OTTA 1YFQA 1B9YA 2GC7A 2XZGA 3FCSA 3DSMA 3I7NA 3EI1B 2VDNA 3IUQA 2JKXA 4NSXA 2PM9A 5GMKn 4E54B 1GXRA 4NAAA 4O2WA 5IC7A 3PXTD 4OZUA 1M1XA 1PEVA 4BCCA 3I7KA 4CZVA 4ERQA 4E5ZB 2AGXA 4CY5A 3ZE2A 4BCBA 3SWSD 2AGLA 3VH0A 3JPXA 2P9NC 4O9DA 4A2LA 4QT8A 1K32A 3C99A 3L4OD 3OL2B 3K26A 5C2WB 1N6DA 2IUVA 1NEXB 4Y5RD 4CC9A 2HYEA 1QNIA 3PVWB 3PE7A 4CI1A 4UM9A 3JRPA 4ZOZA 2IAAA 4JD2C 4JT6C 3DDUA 4ERZA 2B5NA 4PXWA 4QL1A 3IUJA 2VZ1A 5GXHA 3QI0A 1C9LA 3UVOA 1H2YA 5EAPA 1GOTB 1ERJA 3NIDA 5CXBA 1U2VC 4L3GD 5HDBA 1XKSA 4FA1D 3VGZA 2B4EA 4K3JB 4PSXB 3K72A 2CO0A 4JSPC 5EARA 4BL0A 2BCJB 3UKRC 1BPOA 2GC4A 3N0EA 4J81A 4D9SA 4L1QD 1XHMA 4L9OA 2H3XA 3T3PA 2Z2OA 4Z8LA 4A08B 3NVQA 4AMZA 3O4HA 4K3ID 4BP8A 3SCYA 3AL8B 1A0RB 4CY1A 1QFSA 4Z7NA 3RN1D 3HFQA 1P22A 2AH1A 3VI4A 3EI4B 3IJ0A 3FGBA 4H5IA 4JSVC 5M5RA 4Y7RA 4HDJA 2IURA 2AH0A 2H47A 2J57G 2P9LC 4CY3A 2EIBA 3AFCA 4AX4A 2YNNA 4MMYA 3ZDYA 1UOPA 2OK4A 2Z2PA 4YVDA 2P9KC 4UM8A 3O4GA 3AH8B 3ULEC 1L0QA 4J0WA 5IGQA 2AGYA 2YB8B 4U1EI 1MDAH 4G1EA 3VI3A 4ERYA 1XIPA 2H9LA 1VYHC 2CO0C 3UR4A 4CI3A 1MG2A 1N6EA 3DM0A 1VE6A 3EI3B 4J79A 2H6KA 3PXWD 4Z7OA 3ODTA 4J87A 4NBMA 5IJ7E 2XU7A 2B5MA 4WJKA 2G99A 3RSEC 3O4JA 3UVMA 2P9UC 4E5ZA 2IUPA 2XL2A 2BBKH 2I3TA 5EMMB 3F3PA 4FAND 3OKWA 5FKRA 3UVNA 3JZNA 3OL2A 1SHYB 5A2Qg 1Q47A 3GC3B 3ZWLB 1U4CA 5IT9g 4FA4D 2W18A 4A11A 1VE7A 4A0BA 3I8EA 1SQJA 3V4VA 5GXIA 2VZ3A 2I0TA 5CYKB 5HE3B 4GGDA 3DWLC 3IUMA 3CFSB 4G56B 5C2VB 3KRXB 3I7HA 4QQEA 5E6UA 1VZ2A 1OLZA 4ZN4A 2EIDA 1H2ZA 4PC0A
chains in the Genus database with same CATH topology
2CN3A 1FWXA 3SLED 3I7OA 1JOFA 4GQBB 4AEZA 3JZGA 4A09B 2CNXA 4LGNA 5FXYA 2MTAH 4A7JA 3U4YA 2IWKA 1PGUA 4PBYA 4FWWA 2HJBA 2YNOA 5HE0B 5EALA 3PXSD 2UZYB 2YBAA 2H9PA 5JWZA 4KFMB 3JAMg 3A0FA 4J8BA 5HE1B 3EI4A 3MKQA 3RFGA 3V7DB 2PM9B 4EWRA 3SBQA 4I79A 4X63B 3K27A 4FA5D 4J0XA 4D6VA 3L4MD 4X60B 4FHLA 5K19A 2IUQA 2P9SC 5CXCA 3AL9A 1PBYB 2I0RA 4J73A 3IKOA 3ORVD 5HQGA 3OKTA 2OIZA 2H9MA 5C9ZB 3I7LA 1MG3A 5H17A 2O9KA 4X3EA 4GMBA 2OVQB 4J77A 5TEFA 2PBIB 3F3GA 2UZXB 3J81g 4J86A 2J56H 5FQDA 3EI2A 2OJYA 2HJ4A 3IIYA 3JB9L 2PM6B 4ZOVA 5CXBB 3JZHA 3RLMD 4TZ4A 3OKYA 3I7PA 4CY2A 5FKQA 5I5MA 5FKTA 2QC5A 2H14A 4JXMA 5IJ8E 5EM2A 4J82A 3FM0A 4UI9R 3PVUB 1OMWB 1RI6A 5SXMA 3CIKB 3EG6A 2H68A 3RMZD 3W15A 4IMMA 3EI1A 3P4FA 4E54A 4X61B 3DXMC 3RN0D 2AGWA 3RFHA 4U7AA 3C75H 2P9IC 4CZXA 4GGCA 3BG0A 2XL3A 3SJLD 1JJUB 2YNPA 2HESX 2AGZA 4CZYA 2I3SA 3UVKA 2CE8A 2PM7B 3MKSB 3OW8A 4GZ8A 4QRJA 5TF2A 2B5LA 3C5MA 4CI2A 4A09A 3EMHA 3BG1A 3SHFA 4OWRA 2H9NA 3I2NA 3VA6A 3V5WB 5EMKB 4O3TB 4XEIC 4CI8A 5B4WA 4ES0A 3KRWB 4JSXC 1B9XA 4J84A 4AOWA 3FRXA 4FB1D 2EBSA 1R5MA 2CE9A 2H6QA 4A0AB 5GSAA 5TDHB 2H13A 1PI6A 3MZKA 4N14A 3JROA 2CN2A 5FLXg 4A08A 4GQ2P 3AL8A 3IJ1A 3C9CA 5H1MA 3UVLA 4GM8A 4PNKB 5KDOB 4PSWB 5FA5B 4A11B 5AFU3 4A0BB 1JMXB 3SFZA 2H6NA 5EMJB 1NR0A 3PSCB 2HKMA 5I5IA 2OK6A 3IJCA 3RRMC 3V9FA 2G9AA 5FKSA 1K8KC 3PSLA 4JSNC 4MK0B 4LG9A 5EMLB 5TEEA 2IWFA 2OVRB 3I89A 3SXTD 4GGAA 4D0KA 4BUJC 3MZLA 2HKRA 1GP2B 3SBPA 2XYIA 2YMUA 3EI3A 2J55H 4A2MA 3SVWD 1TYQC 3GFCA 4GM3A 5AMSA 2OVPB 5I5JA 4ESGA 3MMYA 2Q7QA 4BH6A 5HYNB 2HXCA 3DXKC 4FAVD 2QXVA 1S4UX 4LG8A 5THAA 5AJAA 2P9PC 3MXXA 5CXCB 3GREA 4ZOYA 2AQ5A 2TRCB 3B7FA 3NVNA 5EAMA 3IIWA 4O3UB 4XYIA 4IA9A 4O1QD 1SQ9A 4GM9A 5CYKA 3SMRA 3EU7A 4J8GA 3J80g 5HE2B 3NVXA 1N6FA 4JT5C 3EWEA 3I8CA 5H14A 2Z2NA 4J78A 4FA9D 4PBZA 4XYHA 3SBRA 3EI2B 4O45A 3SN6B 1GG2B 3UKUC 2I0SA 3E0CA 4A0AA 3OKYB 3BWSA 1TBGA 4GQ1A 3CFVA 1JMZB 5EM2B 4H5JA 4L3HD 2GNQA 4R7AB 5IGOA 5K1CC 3F3FA 4ZOXA 3N0DA 3OTTA 1YFQA 1B9YA 2GC7A 3DSMA 3I7NA 3EI1B 4NSXA 2PM9A 5GMKn 4E54B 1GXRA 5IC7A 3PXTD 4OZUA 1PEVA 4ERQA 3I7KA 4CZVA 4E5ZB 2AGXA 4CY5A 3SWSD 2AGLA 3VH0A 3JPXA 2P9NC 4O9DA 4A2LA 4QT8A 1K32A 3C99A 3L4OD 3OL2B 3K26A 5C2WB 1N6DA 2IUVA 1NEXB 4Y5RD 4CC9A 2HYEA 1QNIA 3PVWB 3PE7A 4CI1A 3JRPA 4ZOZA 2IAAA 4JD2C 4JT6C 4ERZA 2B5NA 4PXWA 4QL1A 5GXHA 3UVOA 5EAPA 1GOTB 1ERJA 5CXBA 1U2VC 4L3GD 1XKSA 4FA1D 3VGZA 4K3JB 2B4EA 4PSXB 2CO0A 4JSPC 5EARA 4BL0A 2BCJB 3UKRC 2GC4A 3N0EA 4J81A 4L1QD 1XHMA 4L9OA 2H3XA 2Z2OA 4Z8LA 4A08B 3NVQA 4K3ID 3SCYA 3AL8B 1A0RB 4CY1A 3RN1D 3HFQA 1P22A 2AH1A 3EI4B 3IJ0A 3FGBA 4H5IA 4JSVC 4Y7RA 4HDJA 2IURA 2AH0A 2H47A 2J57G 2P9LC 4CY3A 3AFCA 2YNNA 2OK4A 2Z2PA 4YVDA 2P9KC 3AH8B 3ULEC 1L0QA 4J0WA 5IGQA 2AGYA 2YB8B 4U1EI 1MDAH 4ERYA 1XIPA 2H9LA 1VYHC 2CO0C 3UR4A 4CI3A 1MG2A 1N6EA 3DM0A 3EI3B 4J79A 2H6KA 3PXWD 3ODTA 4J87A 5IJ7E 2XU7A 2B5MA 2G99A 3RSEC 3UVMA 2P9UC 4E5ZA 2IUPA 2XL2A 2BBKH 2I3TA 5EMMB 3F3PA 4FAND 3OKWA 5FKRA 3UVNA 3JZNA 3OL2A 1SHYB 5A2Qg 1Q47A 3ZWLB 1U4CA 5IT9g 4FA4D 2W18A 4A11A 4A0BA 3I8EA 1SQJA 5GXIA 2I0TA 5CYKB 5HE3B 4GGDA 3DWLC 3CFSB 4G56B 5C2VB 3KRXB 3I7HA 4QQEA 1OLZA 4ZN4A 4PC0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CN3 A;  1FWX A;  3SLE D;  3I7O A;  1JOF A;  4GQB B;  4AEZ A;  3JZG A;  4A09 B;  2CNX A;  4LGN A;  5FXY A;  2MTA H;  4A7J A;  3U4Y A;  2IWK A;  1PGU A;  4PBY A;  4FWW A;  2HJB A;  2YNO A;  5HE0 B;  5EAL A;  3PXS D;  2UZY B;  2YBA A;  2H9P A;  5JWZ A;  4KFM B;  3JAM g;  3A0F A;  4J8B A;  5HE1 B;  3EI4 A;  3MKQ A;  3RFG A;  3V7D B;  2PM9 B;  4EWR A;  3SBQ A;  4I79 A;  4X63 B;  3K27 A;  4FA5 D;  4J0X A;  4D6V A;  3L4M D;  4X60 B;  4FHL A;  5K19 A;  2IUQ A;  2P9S C;  5CXC A;  3AL9 A;  1PBY B;  2I0R A;  4J73 A;  3IKO A;  3ORV D;  5HQG A;  3OKT A;  2OIZ A;  2H9M A;  5C9Z B;  3I7L A;  1MG3 A;  5H17 A;  2O9K A;  4X3E A;  4GMB A;  2OVQ B;  4J77 A;  5TEF A;  2PBI B;  3F3G A;  2UZX B;  3J81 g;  4J86 A;  2J56 H;  5FQD A;  3EI2 A;  2OJY A;  2HJ4 A;  3IIY A;  3JB9 L;  2PM6 B;  4ZOV A;  5CXB B;  3JZH A;  3RLM D;  4TZ4 A;  3OKY A;  3I7P A;  4CY2 A;  5FKQ A;  5I5M A;  5FKT A;  2QC5 A;  2H14 A;  4JXM A;  5IJ8 E;  5EM2 A;  4J82 A;  3FM0 A;  4UI9 R;  3PVU B;  1OMW B;  1RI6 A;  5SXM A;  3CIK B;  3EG6 A;  2H68 A;  3RMZ D;  3W15 A;  4IMM A;  3EI1 A;  3P4F A;  4E54 A;  4X61 B;  3DXM C;  3RN0 D;  2AGW A;  3RFH A;  4U7A A;  3C75 H;  2P9I C;  4CZX A;  4GGC A;  3BG0 A;  2XL3 A;  3SJL D;  1JJU B;  2YNP A;  2HES X;  2AGZ A;  4CZY A;  2I3S A;  3UVK A;  2CE8 A;  2PM7 B;  3MKS B;  3OW8 A;  4GZ8 A;  4QRJ A;  5TF2 A;  2B5L A;  3C5M A;  4CI2 A;  4A09 A;  3EMH A;  3BG1 A;  3SHF A;  4OWR A;  2H9N A;  3I2N A;  3VA6 A;  3V5W B;  5EMK B;  4O3T B;  4XEI C;  4CI8 A;  5B4W A;  4ES0 A;  3KRW B;  4JSX C;  1B9X A;  4J84 A;  4AOW A;  3FRX A;  4FB1 D;  2EBS A;  1R5M A;  2CE9 A;  2H6Q A;  4A0A B;  5GSA A;  5TDH B;  2H13 A;  1PI6 A;  3MZK A;  4N14 A;  3JRO A;  2CN2 A;  5FLX g;  4A08 A;  4GQ2 P;  3AL8 A;  3IJ1 A;  3C9C A;  5H1M A;  3UVL A;  4GM8 A;  4PNK B;  5KDO B;  4PSW B;  5FA5 B;  4A11 B;  5AFU 3;  4A0B B;  1JMX B;  3SFZ A;  2H6N A;  5EMJ B;  1NR0 A;  3PSC B;  2HKM A;  5I5I A;  2OK6 A;  3IJC A;  3RRM C;  3V9F A;  2G9A A;  5FKS A;  1K8K C;  3PSL A;  4JSN C;  4MK0 B;  4LG9 A;  5EML B;  5TEE A;  2IWF A;  2OVR B;  3I89 A;  3SXT D;  4GGA A;  4D0K A;  4BUJ C;  3MZL A;  2HKR A;  1GP2 B;  3SBP A;  2XYI A;  2YMU A;  3EI3 A;  2J55 H;  4A2M A;  3SVW D;  1TYQ C;  3GFC A;  4GM3 A;  5AMS A;  2OVP B;  5I5J A;  4ESG A;  3MMY A;  2Q7Q A;  4BH6 A;  5HYN B;  2HXC A;  3DXK C;  4FAV D;  2QXV A;  1S4U X;  4LG8 A;  5THA A;  5AJA A;  2P9P C;  3MXX A;  5CXC B;  3GRE A;  4ZOY A;  2AQ5 A;  2TRC B;  3B7F A;  3NVN A;  5EAM A;  3IIW A;  4O3U B;  4XYI A;  4IA9 A;  4O1Q D;  1SQ9 A;  4GM9 A;  5CYK A;  3SMR A;  3EU7 A;  4J8G A;  3J80 g;  5HE2 B;  3NVX A;  1N6F A;  4JT5 C;  3EWE A;  3I8C A;  5H14 A;  2Z2N A;  4J78 A;  4FA9 D;  4PBZ A;  4XYH A;  3SBR A;  3EI2 B;  4O45 A;  3SN6 B;  1GG2 B;  3UKU C;  2I0S A;  3E0C A;  4A0A A;  3OKY B;  3BWS A;  1TBG A;  4GQ1 A;  3CFV A;  1JMZ B;  5EM2 B;  4H5J A;  4L3H D;  2GNQ A;  4R7A B;  5IGO A;  5K1C C;  3F3F A;  4ZOX A;  3N0D A;  3OTT A;  1YFQ A;  1B9Y A;  2GC7 A;  3DSM A;  3I7N A;  3EI1 B;  4NSX A;  2PM9 A;  5GMK n;  4E54 B;  1GXR A;  5IC7 A;  3PXT D;  4OZU A;  1PEV A;  4ERQ A;  3I7K A;  4CZV A;  4E5Z B;  2AGX A;  4CY5 A;  3SWS D;  2AGL A;  3VH0 A;  3JPX A;  2P9N C;  4O9D A;  4A2L A;  4QT8 A;  1K32 A;  3C99 A;  3L4O D;  3OL2 B;  3K26 A;  5C2W B;  1N6D A;  2IUV A;  1NEX B;  4Y5R D;  4CC9 A;  2HYE A;  1QNI A;  3PVW B;  3PE7 A;  4CI1 A;  3JRP A;  4ZOZ A;  2IAA A;  4JD2 C;  4JT6 C;  4ERZ A;  2B5N A;  4PXW A;  4QL1 A;  5GXH A;  3UVO A;  5EAP A;  1GOT B;  1ERJ A;  5CXB A;  1U2V C;  4L3G D;  1XKS A;  4FA1 D;  3VGZ A;  4K3J B;  2B4E A;  4PSX B;  2CO0 A;  4JSP C;  5EAR A;  4BL0 A;  2BCJ B;  3UKR C;  2GC4 A;  3N0E A;  4J81 A;  4L1Q D;  1XHM A;  4L9O A;  2H3X A;  2Z2O A;  4Z8L A;  4A08 B;  3NVQ A;  4K3I D;  3SCY A;  3AL8 B;  1A0R B;  4CY1 A;  3RN1 D;  3HFQ A;  1P22 A;  2AH1 A;  3EI4 B;  3IJ0 A;  3FGB A;  4H5I A;  4JSV C;  4Y7R A;  4HDJ A;  2IUR A;  2AH0 A;  2H47 A;  2J57 G;  2P9L C;  4CY3 A;  3AFC A;  2YNN A;  2OK4 A;  2Z2P A;  4YVD A;  2P9K C;  3AH8 B;  3ULE C;  1L0Q A;  4J0W A;  5IGQ A;  2AGY A;  2YB8 B;  4U1E I;  1MDA H;  4ERY A;  1XIP A;  2H9L A;  1VYH C;  2CO0 C;  3UR4 A;  4CI3 A;  1MG2 A;  1N6E A;  3DM0 A;  3EI3 B;  4J79 A;  2H6K A;  3PXW D;  3ODT A;  4J87 A;  5IJ7 E;  2XU7 A;  2B5M A;  2G99 A;  3RSE C;  3UVM A;  2P9U C;  4E5Z A;  2IUP A;  2XL2 A;  2BBK H;  2I3T A;  5EMM B;  3F3P A;  4FAN D;  3OKW A;  5FKR A;  3UVN A;  3JZN A;  3OL2 A;  1SHY B;  5A2Q g;  1Q47 A;  3ZWL B;  1U4C A;  5IT9 g;  4FA4 D;  2W18 A;  4A11 A;  4A0B A;  3I8E A;  1SQJ A;  5GXI A;  2I0T A;  5CYK B;  5HE3 B;  4GGD A;  3DWL C;  3CFS B;  4G56 B;  5C2V B;  3KRX B;  3I7H A;  4QQE A;  1OLZ A;  4ZN4 A;  4PC0 A; 
#chains in the Genus database with same CATH topology
 2CN3 A;  1U8C A;  2BKL A;  2XDW A;  1FWX A;  3ZDZ A;  3SLE D;  3I7O A;  1JOF A;  4GQB B;  4AEZ A;  4L1M A;  3EQ9 A;  3JZG A;  4A09 B;  2CNX A;  4LGN A;  5FXY A;  4G55 A;  1UOQ A;  4MMZ A;  2MTA H;  4A7J A;  3U4Y A;  2IWK A;  1PGU A;  2QR5 A;  1K3I A;  4FWW A;  2VDM A;  4PBY A;  4Z7Q A;  2HJB A;  2YNO A;  5HE0 B;  5EAL A;  3MUN A;  3PXS D;  2UZY B;  2YBA A;  2H9P A;  5JWZ A;  4KFM B;  3JAM g;  3A0F A;  4J8B A;  5HE1 B;  1QFM A;  3EI4 A;  3MKQ A;  3RFG A;  3V7D B;  2PM9 B;  4EWR A;  3SBQ A;  4I79 A;  4X63 B;  3K27 A;  4FA5 D;  1JV2 A;  1VZ3 A;  4J0X A;  5M5T A;  4D6V A;  3L4M D;  4X60 B;  4FHL A;  5K19 A;  1GOF A;  3GD1 I;  2IUQ A;  2P9S C;  5CXC A;  3AL9 A;  1PBY B;  2I0R A;  4J73 A;  3IKO A;  3ORV D;  5HQG A;  4BP9 A;  3OKT A;  2OIZ A;  2H9M A;  5C9Z B;  3I7L A;  1MG3 A;  5H17 A;  3KCI A;  3O4I A;  2O9K A;  4X3E A;  4GMB A;  2OVQ B;  4J77 A;  5TEF A;  2PBI B;  3F3G A;  2UZX B;  3J81 g;  4J86 A;  2J56 H;  3MVD K;  5FQD A;  3EI2 A;  2OJY A;  2VDQ A;  4MMX A;  2HJ4 A;  3IIY A;  3JB9 L;  2PM6 B;  4ZOV A;  4DNV A;  5CXB B;  3JZH A;  3RLM D;  4TZ4 A;  2HU5 A;  3OKY A;  3I7P A;  4CY2 A;  5FKQ A;  5I5M A;  5FKT A;  1I2M B;  4RE5 A;  2QC5 A;  2H14 A;  4JXM A;  5IJ8 E;  2VDL A;  5EM2 A;  5M5V A;  4J82 A;  3FM0 A;  3FCU A;  1C9I A;  4UI9 R;  3PVU B;  1OMW B;  1O6F A;  1RI6 A;  4JHN A;  2EIE A;  5SXM A;  3CIK B;  3EG6 A;  3K6S A;  2H68 A;  5C92 A;  3RMZ D;  3W15 A;  4IMM A;  3EI1 A;  3P4F A;  4O02 A;  4E54 A;  4X61 B;  3V4P A;  3DXM C;  3RN0 D;  1UTC A;  2WQ8 A;  2AGW A;  5E6S A;  3RFH A;  4U7A A;  3C75 H;  2P9I C;  4CZX A;  4GGC A;  1L5G A;  3BG0 A;  2XL3 A;  3SJL D;  1JJU B;  2YNP A;  2HES X;  2AGZ A;  4CZY A;  2I3S A;  3UVK A;  2CE8 A;  2PM7 B;  3MKS B;  3OW8 A;  1GOH A;  4GZ8 A;  4QRJ A;  5TF2 A;  2B5L A;  3C5M A;  4CI2 A;  4A09 A;  3EMH A;  3IUL A;  3BG1 A;  3SHF A;  4OWR A;  2H9N A;  3I2N A;  3VA6 A;  3V5W B;  5EMK B;  4O3T B;  4XEI C;  4CI8 A;  5B4W A;  4ES0 A;  3KRW B;  3IVM A;  4JSX C;  4IRZ A;  1B9X A;  4J84 A;  4AOW A;  3FRX A;  4FB1 D;  3OF7 A;  2EBS A;  1T2X A;  1R5M A;  2CE9 A;  2H6Q A;  3IJE A;  4A0A B;  5GSA A;  2QZP A;  5TDH B;  2H13 A;  1PI6 A;  3MZK A;  4N14 A;  3JRO A;  2CN2 A;  5FLX g;  4A08 A;  4RE6 A;  4GQ2 P;  3AL8 A;  3IJ1 A;  3C9C A;  5H1M A;  3ZDX A;  3UVL A;  4GM8 A;  3IUR A;  4PNK B;  5KDO B;  4PSW B;  5FA5 B;  1H2W A;  4A11 B;  5AFU 3;  4A0B B;  1O6G A;  1JMX B;  4DNU A;  3SFZ A;  1E8N A;  2H6N A;  1NR0 A;  4WK0 A;  5EMJ B;  4DNW A;  3PSC B;  5M5U A;  2HKM A;  5C86 A;  5I5I A;  2OK6 A;  3IJC A;  3RRM C;  3V9F A;  2G9A A;  5FKS A;  1K8K C;  3PSL A;  4JSN C;  4MK0 B;  4LG9 A;  5EML B;  5TEE A;  2IWF A;  2OVR B;  3I89 A;  3SXT D;  4AN1 A;  3NIG A;  2VDK A;  4GGA A;  4D0K A;  4BUJ C;  3MZL A;  4NC4 A;  2HKR A;  1GP2 B;  2VDP A;  2VDO A;  3SBP A;  2XYI A;  3EQ8 A;  3K71 A;  2YMU A;  3EI3 A;  2J55 H;  5M61 A;  3ZE0 A;  4A2M A;  3SVW D;  1TYQ C;  3GFC A;  4BCD A;  4GM3 A;  5AMS A;  2OVP B;  2HU8 A;  5I5J A;  3NIF A;  4WK2 A;  5FFG A;  3MMY A;  4ESG A;  1E8M A;  2Q7Q A;  4BH6 A;  5HYN B;  4QAM A;  2HXC A;  3DXK C;  4FAV D;  2QXV A;  4AMY A;  1S4U X;  4LG8 A;  1E5T A;  4NEN A;  1JTD B;  5THA A;  5AJA A;  2EIC A;  2P9P C;  3MXX A;  5CXC B;  3GRE A;  4ZOY A;  1TYE A;  2AQ5 A;  2TRC B;  3B7F A;  3NVN A;  5EAM A;  1GOG A;  3ZE1 A;  1YR2 A;  3IIW A;  2HU7 A;  4O3U B;  4XYI A;  4IA9 A;  4O1Q D;  1SQ9 A;  2VDR A;  4GM9 A;  5CYK A;  3SMR A;  3EU7 A;  4J8G A;  3J80 g;  4AN0 A;  5HE2 B;  5FFO A;  2VC2 A;  1N6F A;  3NVX A;  3MUO A;  3EWE A;  3I8C A;  4JT5 C;  2XE4 A;  5H14 A;  4G1M A;  2Z2N A;  1UOO A;  4J78 A;  3EQ7 A;  5E6R A;  1A12 A;  4FA9 D;  4PBZ A;  4XYH A;  3SBR A;  3EI2 B;  4O45 A;  3SN6 B;  1H2X A;  1GG2 B;  4JHP C;  3UKU C;  2I0S A;  3IUN A;  3QHY B;  4WK4 A;  3E0C A;  4A0A A;  3OKY B;  5M5S A;  3BWS A;  3T3M A;  1TBG A;  4GQ1 A;  3CFV A;  1JMZ B;  5EM2 B;  4H5J A;  4L3H D;  2GNQ A;  4R7A B;  5IGO A;  5K1C C;  3F3F A;  4ZOX A;  3N0D A;  3OTT A;  1YFQ A;  1B9Y A;  2GC7 A;  2XZG A;  3FCS A;  3DSM A;  3I7N A;  3EI1 B;  2VDN A;  3IUQ A;  2JKX A;  4NSX A;  2PM9 A;  5GMK n;  4E54 B;  1GXR A;  4NAA A;  4O2W A;  5IC7 A;  3PXT D;  4OZU A;  1M1X A;  1PEV A;  4BCC A;  3I7K A;  4CZV A;  4ERQ A;  4E5Z B;  2AGX A;  4CY5 A;  3ZE2 A;  4BCB A;  3SWS D;  2AGL A;  3VH0 A;  3JPX A;  2P9N C;  4O9D A;  4A2L A;  4QT8 A;  1K32 A;  3C99 A;  3L4O D;  3OL2 B;  3K26 A;  5C2W B;  1N6D A;  2IUV A;  1NEX B;  4Y5R D;  4CC9 A;  2HYE A;  1QNI A;  3PVW B;  3PE7 A;  4CI1 A;  4UM9 A;  3JRP A;  4ZOZ A;  2IAA A;  4JD2 C;  4JT6 C;  3DDU A;  4ERZ A;  2B5N A;  4PXW A;  4QL1 A;  3IUJ A;  2VZ1 A;  5GXH A;  3QI0 A;  1C9L A;  3UVO A;  1H2Y A;  5EAP A;  1GOT B;  1ERJ A;  3NID A;  5CXB A;  1U2V C;  4L3G D;  5HDB A;  1XKS A;  4FA1 D;  3VGZ A;  2B4E A;  4K3J B;  4PSX B;  3K72 A;  2CO0 A;  4JSP C;  5EAR A;  4BL0 A;  2BCJ B;  3UKR C;  1BPO A;  2GC4 A;  3N0E A;  4J81 A;  4D9S A;  4L1Q D;  1XHM A;  4L9O A;  2H3X A;  3T3P A;  2Z2O A;  4Z8L A;  4A08 B;  3NVQ A;  4AMZ A;  3O4H A;  4K3I D;  4BP8 A;  3SCY A;  3AL8 B;  1A0R B;  4CY1 A;  1QFS A;  4Z7N A;  3RN1 D;  3HFQ A;  1P22 A;  2AH1 A;  3VI4 A;  3EI4 B;  3IJ0 A;  3FGB A;  4H5I A;  4JSV C;  5M5R A;  4Y7R A;  4HDJ A;  2IUR A;  2AH0 A;  2H47 A;  2J57 G;  2P9L C;  4CY3 A;  2EIB A;  3AFC A;  4AX4 A;  2YNN A;  4MMY A;  3ZDY A;  1UOP A;  2OK4 A;  2Z2P A;  4YVD A;  2P9K C;  4UM8 A;  3O4G A;  3AH8 B;  3ULE C;  1L0Q A;  4J0W A;  5IGQ A;  2AGY A;  2YB8 B;  4U1E I;  1MDA H;  4G1E A;  3VI3 A;  4ERY A;  1XIP A;  2H9L A;  1VYH C;  2CO0 C;  3UR4 A;  4CI3 A;  1MG2 A;  1N6E A;  3DM0 A;  1VE6 A;  3EI3 B;  4J79 A;  2H6K A;  3PXW D;  4Z7O A;  3ODT A;  4J87 A;  4NBM A;  5IJ7 E;  2XU7 A;  2B5M A;  4WJK A;  2G99 A;  3RSE C;  3O4J A;  3UVM A;  2P9U C;  4E5Z A;  2IUP A;  2XL2 A;  2BBK H;  2I3T A;  5EMM B;  3F3P A;  4FAN D;  3OKW A;  5FKR A;  3UVN A;  3JZN A;  3OL2 A;  1SHY B;  5A2Q g;  1Q47 A;  3GC3 B;  3ZWL B;  1U4C A;  5IT9 g;  4FA4 D;  2W18 A;  4A11 A;  1VE7 A;  4A0B A;  3I8E A;  1SQJ A;  3V4V A;  5GXI A;  2VZ3 A;  2I0T A;  5CYK B;  5HE3 B;  4GGD A;  3DWL C;  3IUM A;  3CFS B;  4G56 B;  5C2V B;  3KRX B;  3I7H A;  4QQE A;  5E6U A;  1VZ2 A;  1OLZ A;  4ZN4 A;  2EID A;  1H2Z A;  4PC0 A; 
#chains in the Genus database with same CATH homology
 2CN3 A;  1FWX A;  3SLE D;  3I7O A;  1JOF A;  4GQB B;  4AEZ A;  3JZG A;  4A09 B;  2CNX A;  4LGN A;  5FXY A;  2MTA H;  4A7J A;  3U4Y A;  2IWK A;  1PGU A;  4PBY A;  4FWW A;  2HJB A;  2YNO A;  5HE0 B;  5EAL A;  3PXS D;  2UZY B;  2YBA A;  2H9P A;  5JWZ A;  4KFM B;  3JAM g;  3A0F A;  4J8B A;  5HE1 B;  3EI4 A;  3MKQ A;  3RFG A;  3V7D B;  2PM9 B;  4EWR A;  3SBQ A;  4I79 A;  4X63 B;  3K27 A;  4FA5 D;  4J0X A;  4D6V A;  3L4M D;  4X60 B;  4FHL A;  5K19 A;  2IUQ A;  2P9S C;  5CXC A;  3AL9 A;  1PBY B;  2I0R A;  4J73 A;  3IKO A;  3ORV D;  5HQG A;  3OKT A;  2OIZ A;  2H9M A;  5C9Z B;  3I7L A;  1MG3 A;  5H17 A;  2O9K A;  4X3E A;  4GMB A;  2OVQ B;  4J77 A;  5TEF A;  2PBI B;  3F3G A;  2UZX B;  3J81 g;  4J86 A;  2J56 H;  5FQD A;  3EI2 A;  2OJY A;  2HJ4 A;  3IIY A;  3JB9 L;  2PM6 B;  4ZOV A;  5CXB B;  3JZH A;  3RLM D;  4TZ4 A;  3OKY A;  3I7P A;  4CY2 A;  5FKQ A;  5I5M A;  5FKT A;  2QC5 A;  2H14 A;  4JXM A;  5IJ8 E;  5EM2 A;  4J82 A;  3FM0 A;  4UI9 R;  3PVU B;  1OMW B;  1RI6 A;  5SXM A;  3CIK B;  3EG6 A;  2H68 A;  3RMZ D;  3W15 A;  4IMM A;  3EI1 A;  3P4F A;  4E54 A;  4X61 B;  3DXM C;  3RN0 D;  2AGW A;  3RFH A;  4U7A A;  3C75 H;  2P9I C;  4CZX A;  4GGC A;  3BG0 A;  2XL3 A;  3SJL D;  1JJU B;  2YNP A;  2HES X;  2AGZ A;  4CZY A;  2I3S A;  3UVK A;  2CE8 A;  2PM7 B;  3MKS B;  3OW8 A;  4GZ8 A;  4QRJ A;  5TF2 A;  2B5L A;  3C5M A;  4CI2 A;  4A09 A;  3EMH A;  3BG1 A;  3SHF A;  4OWR A;  2H9N A;  3I2N A;  3VA6 A;  3V5W B;  5EMK B;  4O3T B;  4XEI C;  4CI8 A;  5B4W A;  4ES0 A;  3KRW B;  4JSX C;  1B9X A;  4J84 A;  4AOW A;  3FRX A;  4FB1 D;  2EBS A;  1R5M A;  2CE9 A;  2H6Q A;  4A0A B;  5GSA A;  5TDH B;  2H13 A;  1PI6 A;  3MZK A;  4N14 A;  3JRO A;  2CN2 A;  5FLX g;  4A08 A;  4GQ2 P;  3AL8 A;  3IJ1 A;  3C9C A;  5H1M A;  3UVL A;  4GM8 A;  4PNK B;  5KDO B;  4PSW B;  5FA5 B;  4A11 B;  5AFU 3;  4A0B B;  1JMX B;  3SFZ A;  2H6N A;  5EMJ B;  1NR0 A;  3PSC B;  2HKM A;  5I5I A;  2OK6 A;  3IJC A;  3RRM C;  3V9F A;  2G9A A;  5FKS A;  1K8K C;  3PSL A;  4JSN C;  4MK0 B;  4LG9 A;  5EML B;  5TEE A;  2IWF A;  2OVR B;  3I89 A;  3SXT D;  4GGA A;  4D0K A;  4BUJ C;  3MZL A;  2HKR A;  1GP2 B;  3SBP A;  2XYI A;  2YMU A;  3EI3 A;  2J55 H;  4A2M A;  3SVW D;  1TYQ C;  3GFC A;  4GM3 A;  5AMS A;  2OVP B;  5I5J A;  4ESG A;  3MMY A;  2Q7Q A;  4BH6 A;  5HYN B;  2HXC A;  3DXK C;  4FAV D;  2QXV A;  1S4U X;  4LG8 A;  5THA A;  5AJA A;  2P9P C;  3MXX A;  5CXC B;  3GRE A;  4ZOY A;  2AQ5 A;  2TRC B;  3B7F A;  3NVN A;  5EAM A;  3IIW A;  4O3U B;  4XYI A;  4IA9 A;  4O1Q D;  1SQ9 A;  4GM9 A;  5CYK A;  3SMR A;  3EU7 A;  4J8G A;  3J80 g;  5HE2 B;  3NVX A;  1N6F A;  4JT5 C;  3EWE A;  3I8C A;  5H14 A;  2Z2N A;  4J78 A;  4FA9 D;  4PBZ A;  4XYH A;  3SBR A;  3EI2 B;  4O45 A;  3SN6 B;  1GG2 B;  3UKU C;  2I0S A;  3E0C A;  4A0A A;  3OKY B;  3BWS A;  1TBG A;  4GQ1 A;  3CFV A;  1JMZ B;  5EM2 B;  4H5J A;  4L3H D;  2GNQ A;  4R7A B;  5IGO A;  5K1C C;  3F3F A;  4ZOX A;  3N0D A;  3OTT A;  1YFQ A;  1B9Y A;  2GC7 A;  3DSM A;  3I7N A;  3EI1 B;  4NSX A;  2PM9 A;  5GMK n;  4E54 B;  1GXR A;  5IC7 A;  3PXT D;  4OZU A;  1PEV A;  4ERQ A;  3I7K A;  4CZV A;  4E5Z B;  2AGX A;  4CY5 A;  3SWS D;  2AGL A;  3VH0 A;  3JPX A;  2P9N C;  4O9D A;  4A2L A;  4QT8 A;  1K32 A;  3C99 A;  3L4O D;  3OL2 B;  3K26 A;  5C2W B;  1N6D A;  2IUV A;  1NEX B;  4Y5R D;  4CC9 A;  2HYE A;  1QNI A;  3PVW B;  3PE7 A;  4CI1 A;  3JRP A;  4ZOZ A;  2IAA A;  4JD2 C;  4JT6 C;  4ERZ A;  2B5N A;  4PXW A;  4QL1 A;  5GXH A;  3UVO A;  5EAP A;  1GOT B;  1ERJ A;  5CXB A;  1U2V C;  4L3G D;  1XKS A;  4FA1 D;  3VGZ A;  4K3J B;  2B4E A;  4PSX B;  2CO0 A;  4JSP C;  5EAR A;  4BL0 A;  2BCJ B;  3UKR C;  2GC4 A;  3N0E A;  4J81 A;  4L1Q D;  1XHM A;  4L9O A;  2H3X A;  2Z2O A;  4Z8L A;  4A08 B;  3NVQ A;  4K3I D;  3SCY A;  3AL8 B;  1A0R B;  4CY1 A;  3RN1 D;  3HFQ A;  1P22 A;  2AH1 A;  3EI4 B;  3IJ0 A;  3FGB A;  4H5I A;  4JSV C;  4Y7R A;  4HDJ A;  2IUR A;  2AH0 A;  2H47 A;  2J57 G;  2P9L C;  4CY3 A;  3AFC A;  2YNN A;  2OK4 A;  2Z2P A;  4YVD A;  2P9K C;  3AH8 B;  3ULE C;  1L0Q A;  4J0W A;  5IGQ A;  2AGY A;  2YB8 B;  4U1E I;  1MDA H;  4ERY A;  1XIP A;  2H9L A;  1VYH C;  2CO0 C;  3UR4 A;  4CI3 A;  1MG2 A;  1N6E A;  3DM0 A;  3EI3 B;  4J79 A;  2H6K A;  3PXW D;  3ODT A;  4J87 A;  5IJ7 E;  2XU7 A;  2B5M A;  2G99 A;  3RSE C;  3UVM A;  2P9U C;  4E5Z A;  2IUP A;  2XL2 A;  2BBK H;  2I3T A;  5EMM B;  3F3P A;  4FAN D;  3OKW A;  5FKR A;  3UVN A;  3JZN A;  3OL2 A;  1SHY B;  5A2Q g;  1Q47 A;  3ZWL B;  1U4C A;  5IT9 g;  4FA4 D;  2W18 A;  4A11 A;  4A0B A;  3I8E A;  1SQJ A;  5GXI A;  2I0T A;  5CYK B;  5HE3 B;  4GGD A;  3DWL C;  3CFS B;  4G56 B;  5C2V B;  3KRX B;  3I7H A;  4QQE A;  1OLZ A;  4ZN4 A;  4PC0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...