1ERJA

Crystal structure of the c-terminal wd40 domain of tup1
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
388
structure length
350
Chain Sequence
HYLVPYNQRANHSKPIPPFLLDLDSQSVPDALKKQTNDYYILYNPALPREIDVELHKSLDHTSVVCCVKFSNDGEYLATGCNKTTQVYRVSDGSLVARLSDSSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNPLLMLQGHRNSVISVAVANGSSLGPEYNVFATGSGDCKARIWKYKKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTIONAL REPRESSOR TUP1
publication title Structure of the C-terminal domain of Tup1, a corepressor of transcription in yeast.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription inhibitor
total genus 106
structure length 350
sequence length 388
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2000-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 1erjA00
5H14A 4FA5D 5FA5B 3C75H 2CO0C 4JSNC 5EAMA 2CN2A 2OVRB 1GOTB 5TDHB 4LGNA 2O9KA 5GSAA 3IIWA 4GM8A 3OTTA 3IJCA 4ZOZA 4JSPC 5HE1B 3RMZD 5K1CC 2YNOA 4PBYA 5FLXg 3VA6A 3RFHA 3W15A 3PVUB 4HDJA 3JZGA 2UZYB 4A0BB 4ES0A 3E0CA 4J81A 3KRWB 3EI3B 3UR4A 4H5JA 3JROA 1MG3A 2H47A 2I3TA 3RN1D 5IJ7E 3SN6B 5C2WB 3JB9L 1B9XA 1GXRA 3JPXA 3OKYB 3EI1B 3I2NA 3IJ0A 3V9FA 1XIPA 4X63B 1QNIA 2OK6A 4J8GA 4TZ4A 3I7NA 3NVXA 2AGXA 4J86A 1JJUB 2MTAH 4CY2A 3MZKA 1L0QA 4PXWA 2H9NA 5CYKB 3SJLD 4CI2A 2IAAA 5FKQA 3AL9A 4A08B 3MXXA 3FRXA 3F3FA 4FA9D 3SHFA 4XYIA 3AL8B 5SXMA 3C5MA 5A2Qg 3DM0A 2HESX 5CXBA 2CNXA 5EALA 3JZHA 3U4YA 3MMYA 4AOWA 1JMZB 4L1QD 4X3EA 3L4MD 5HE3B 3PXWD 3RFGA 2EBSA 4XYHA 3N0EA 2CE9A 3GFCA 4A09A 5AFU3 3PXTD 3N0DA 5IGOA 2H3XA 4ZN4A 3V7DB 4FAVD 2YNNA 2H9LA 4A0AB 4E5ZB 4GQBB 3JAMg 5EM2A 3JZNA 3EG6A 2AGYA 4AEZA 4CI1A 5GXHA 3SWSD 3SBRA 1P22A 2B5LA 4FA4D 3UKRC 2PBIB 1PI6A 2UZXB 4J87A 3CIKB 2OK4A 4NSXA 2CO0A 4PNKB 3AFCA 2J57G 5TEEA 5K19A 3OW8A 3CFVA 5H17A 2PM9A 4QL1A 3OKTA 3EWEA 3IIYA 4CZXA 3CFSB 5JWZA 3UVLA 5EARA 4A11A 4ERQA 2XL2A 2H9PA 4J82A 5THAA 4O3TB 4MK0B 3EI4A 1JMXB 1SHYB 1SQ9A 3NVQA 2BCJB 4CI3A 2OVQB 3SBPA 2Z2OA 3J81g 2PM6B 3K27A 4O9DA 3MKSB 3P4FA 4ZOYA 2OVPB 2P9NC 3SLED 5GMKn 1R5MA 1TBGA 4O1QD 4YVDA 4A2LA 2AQ5A 5AMSA 4GQ2P 5HE2B 3OL2A 3SXTD 3EI2A 4JSXC 4QT8A 5I5JA 4H5IA 2P9KC 4LG8A 2Z2NA 3L4OD 2HKMA 4PBZA 1U2VC 1XHMA 5IJ8E 4N14A 2HYEA 2AGWA 3UVMA 3I7KA 4ZOVA 3VGZA 4L9OA 2Z2PA 3VH0A 2IUPA 3BG0A 5TEFA 1S4UX 4CY5A 2GC7A 3I7LA 3JRPA 2QC5A 4J84A 4D0KA 5I5IA 1TYQC 4GM9A 4K3ID 3PE7A 4GMBA 2CN3A 2YB8B 4A0BA 5C9ZB 3EI3A 1PGUA 3J80g 3B7FA 3PXSD 4CI8A 3PSLA 2GC4A 4IMMA 4LG9A 3HFQA 1MDAH 5B4WA 3F3GA 3EI1A 3OKYA 2W18A 4CY3A 2H14A 1GG2B 3EU7A 4E54B 3I8EA 2H6QA 1OMWB 2H6KA 4U1EI 1Q47A 4GGCA 5CXCB 1JOFA 3C99A 3I7PA 4Y7RA 2I0RA 2HXCA 4PC0A 4IA9A 5CYKA 5FKSA 2TRCB 2AH0A 4UI9R 2B4EA 2H13A 1GP2B 2IUVA 4A08A 5EMLB 4R7AB 1A0RB 3A0FA 4L3HD 4A2MA 2I3SA 3AL8A 3RN0D 5EMJB 3SFZA 2XYIA 4PSWB 5I5MA 4Z8LA 2J55H 3DSMA 5IT9g 5EMKB 4GGDA 3GREA 5GXIA 3KRXB 4J79A 3UVKA 5C2VB 3IKOA 2B5MA 1K8KC 2I0SA 3BWSA 5HYNB 2PM7B 3SVWD 3EMHA 2GNQA 4JXMA 5FQDA 1N6EA 4X60B 1MG2A 4ZOXA 2H68A 3PSCB 4GM3A 1YFQA 2OJYA 4BH6A 4FWWA 1K32A 4A0AA 4E5ZA 3DXMC 4X61B 3NVNA 3ORVD 5HE0B 3OKWA 3IJ1A 1XKSA 3ODTA 2Q7QA 4FB1D 2I0TA 5EMMB 4J73A 1VYHC 4G56B 4I79A 5FKTA 4GQ1A 4QRJA 3I89A 5AJAA 1PEVA 2YMUA 3SBQA 4J0XA 3SCYA 4D6VA 4A7JA 1U4CA 3DWLC 4O45A 2B5NA 4CZYA 2HKRA 5FKRA 1N6DA 3ZWLB 2P9SC 3RRMC 4CC9A 2P9PC 5KDOB 3I7OA 2H9MA 3RLMD 3F3PA 4U7AA 4GGAA 1FWXA 4BL0A 1B9YA 2J56H 2XU7A 4CY1A 4GZ8A 5CXBB 3I8CA 4JD2C 4ESGA 3I7HA 2G99A 4JT5C 2HJ4A 3C9CA 5TF2A 4L3GD 3SMRA 5FXYA 4A09B 4QQEA 4JSVC 4OZUA 2YBAA 3BG1A 2YNPA 4BUJC 2IURA 3UVOA 3DXKC 4K3JB 1N6FA 2HJBA 2IUQA 5EM2B 2P9LC 3UKUC 1NEXB 4O3UB 5IGQA 2AGZA 3K26A 3FGBA 4FHLA 2AGLA 2IWKA 3MZLA 1ERJA 5HQGA 1NR0A 4KFMB 4XEIC 3UVNA 5IC7A 1PBYB 3FM0A 4OWRA 2PM9B 4EWRA 3V5WB 4J77A 1RI6A 4ERYA 2P9IC 4ERZA 1SQJA 2QXVA 4A11B 4J78A 4E54A 4FA1D 3EI4B 4JT6C 2BBKH 1OLZA 4FAND 2XL3A 5CXCA 4J0WA 2CE8A 2G9AA 4Y5RD 5EAPA 3MKQA 2IWFA 2P9UC 3AH8B 4J8BA 4CZVA 5H1MA 2AH1A 3ULEC 3OL2B 3EI2B 2H6NA 3PVWB 4PSXB 3RSEC 2OIZA
chains in the Genus database with same CATH superfamily
5H14A 4FA5D 5FA5B 3C75H 2CO0C 4JSNC 3MUNA 2EIBA 5EAMA 1UOPA 2CN2A 2OVRB 1GOTB 5TDHB 4LGNA 3KCIA 4RE6A 2O9KA 5GSAA 3IIWA 4GM8A 3OTTA 3ZDXA 3IJCA 4ZOZA 4JSPC 3FCSA 5HE1B 3RMZD 5K1CC 2YNOA 4PBYA 2XDWA 4L1MA 5FLXg 3VA6A 3RFHA 4BCBA 1C9LA 3W15A 1L5GA 3PVUB 4HDJA 1E8NA 4BCDA 3JZGA 2UZYB 4A0BB 4ES0A 3E0CA 4J81A 3KRWB 3EI3B 3UR4A 4IRZA 4H5JA 3JROA 2QR5A 4MMYA 1MG3A 3O4GA 2H47A 2I3TA 3RN1D 5IJ7E 3SN6B 5C2WB 3JB9L 1B9XA 1GXRA 3JPXA 3OKYB 3EI1B 3I2NA 3IJ0A 3V9FA 1XIPA 4X63B 1QNIA 2OK6A 4J8GA 4TZ4A 3I7NA 3NVXA 2AGXA 4J86A 2EICA 3IUQA 4MMZA 1JJUB 2MTAH 4CY2A 3MZKA 1L0QA 4PXWA 2H9NA 4RE5A 5CYKB 1QFMA 3SJLD 4CI2A 2IAAA 5FKQA 3AL9A 4A08B 3MXXA 3FRXA 3F3FA 4FA9D 3SHFA 4BCCA 4XYIA 3AL8B 5SXMA 3C5MA 5A2Qg 3DM0A 2HESX 5CXBA 2CNXA 2EIEA 5EALA 3JZHA 3U4YA 3MMYA 4AOWA 3MUOA 1U8CA 3K6SA 1JMZB 4L1QD 4X3EA 3L4MD 5HE3B 3PXWD 3RFGA 5M5VA 2EBSA 3IVMA 1C9IA 4XYHA 3N0EA 2CE9A 3GFCA 4A09A 5AFU3 3PXTD 3IUJA 3N0DA 3GC3B 5IGOA 2H3XA 4ZN4A 3V4PA 3V7DB 4FAVD 3K71A 2YNNA 2H9LA 1T2XA 4A0AB 2EIDA 3IUNA 4E5ZB 4GQBB 2WQ8A 3JAMg 5EM2A 3ZE0A 4Z7OA 3JZNA 3EG6A 2AGYA 3EQ7A 4AEZA 2VDRA 4CI1A 5GXHA 3SWSD 3SBRA 4WK4A 1P22A 3MVDK 4NENA 3ZDYA 2B5LA 4FA4D 3UKRC 3O4HA 2PBIB 1PI6A 2UZXB 4J87A 3CIKB 2OK4A 4NSXA 2CO0A 4PNKB 3AFCA 3ZE1A 2J57G 5TEEA 5K19A 3OW8A 3CFVA 1E8MA 5H17A 2PM9A 2VDKA 3V4VA 4QL1A 3T3MA 3OKTA 1UOOA 3EWEA 3IIYA 1H2YA 4CZXA 3CFSB 5JWZA 3UVLA 5EARA 4A11A 4ERQA 2XL2A 2H9PA 4J82A 5THAA 4O3TB 1UOQA 4MK0B 3EI4A 1JMXB 1SHYB 1SQ9A 3NVQA 2BCJB 4CI3A 2OVQB 3SBPA 2VDNA 2Z2OA 3GD1I 4AN1A 3J81g 2PM6B 3K27A 4O9DA 3MKSB 1O6GA 3P4FA 4JHPC 2OVPB 2P9NC 3SLED 3ZE2A 4ZOYA 1R5MA 5GMKn 1TBGA 4O1QD 4YVDA 3VI3A 4A2LA 2AQ5A 1UTCA 5AMSA 4AX4A 4GQ2P 5HE2B 3OL2A 5C92A 4NBMA 3SXTD 3EI2A 4JSXC 4QT8A 5I5JA 4H5IA 2BKLA 2P9KC 4LG8A 2Z2NA 3L4OD 1H2XA 2VDOA 1YR2A 2HKMA 4PBZA 1U2VC 1XHMA 5E6SA 5IJ8E 4N14A 2HYEA 2AGWA 4NAAA 3I7KA 4ZOVA 3UVMA 3NIDA 3VGZA 4L9OA 2Z2PA 3VH0A 2IUPA 3BG0A 5TEFA 1S4UX 4CY5A 2GC7A 3I7LA 3NIFA 3JRPA 4DNWA 2QC5A 4J84A 4D0KA 5I5IA 1GOGA 1TYQC 4GM9A 3PE7A 4GMBA 4K3ID 2CN3A 2VDMA 2YB8B 4A0BA 5C9ZB 3EI3A 4AN0A 1PGUA 3J80g 3B7FA 3PXSD 4CI8A 3PSLA 2GC4A 4IMMA 4LG9A 3HFQA 1MDAH 5B4WA 4O2WA 3F3GA 2HU8A 4WK0A 2JKXA 3EI1A 3OKYA 3QI0A 2W18A 4CY3A 2H14A 1GG2B 1H2WA 3EU7A 4E54B 3I8EA 2H6QA 5FFOA 1OMWB 2VZ1A 2H6KA 4U1EI 1Q47A 4GGCA 5CXCB 1JOFA 3C99A 3I7PA 3O4IA 4Y7RA 2XE4A 2HU5A 2I0RA 2HXCA 4PC0A 4IA9A 5CYKA 5FKSA 2TRCB 2AH0A 4UI9R 2B4EA 1GP2B 2H13A 2IUVA 4A08A 5EMLB 4BP8A 4R7AB 1A0RB 5M5RA 3A0FA 4L3HD 4A2MA 2I3SA 3AL8A 3RN0D 5EMJB 3SFZA 2XYIA 4PSWB 5I5MA 4Z8LA 2J55H 3DSMA 5IT9g 5EMKB 2XZGA 3IJEA 4GGDA 4DNUA 3GREA 2VDLA 5GXIA 3KRXB 4J79A 3UVKA 5C2VB 3IKOA 4G1MA 2B5MA 1K8KC 2I0SA 3BWSA 5HYNB 2PM7B 3SVWD 3EMHA 1M1XA 2GNQA 4JXMA 5FQDA 1N6EA 4X60B 1MG2A 4ZOXA 2H68A 3PSCB 1VE7A 4GM3A 4JHNA 1E5TA 1YFQA 2OJYA 4BH6A 2VDQA 4FWWA 3IULA 4MMXA 1K32A 4A0AA 5E6RA 4E5ZA 3DXMC 5C86A 4X61B 3NVNA 3ORVD 5HE0B 3ZDZA 3OKWA 3IJ1A 1XKSA 3ODTA 2Q7QA 4FB1D 1O6FA 2I0TA 4QAMA 5EMMB 4J73A 1VYHC 4G56B 4I79A 5FKTA 4GQ1A 4QRJA 5M5UA 3EQ8A 3I89A 3FCUA 1GOHA 5AJAA 1PEVA 2YMUA 5M5TA 3IURA 3SBQA 4J0XA 3SCYA 4Z7QA 4WK2A 4D6VA 4A7JA 1U4CA 3DWLC 4O45A 2B5NA 4CZYA 2HKRA 5FKRA 1N6DA 3ZWLB 2P9SC 3RRMC 4AMYA 4DNVA 5M5SA 4CC9A 2P9PC 4BP9A 5KDOB 3I7OA 2H9MA 3RLMD 3F3PA 4U7AA 4GGAA 1FWXA 2HU7A 4WJKA 4BL0A 3O4JA 1B9YA 2J56H 2XU7A 4G1EA 4CY1A 4GZ8A 5CXBB 3I8CA 4JD2C 1K3IA 4ESGA 3I7HA 2G99A 4JT5C 5HDBA 2HJ4A 3C9CA 4UM9A 4AMZA 1H2ZA 4D9SA 5TF2A 4L3GD 3SMRA 5FXYA 4A09B 4QQEA 4JSVC 4OZUA 2YBAA 3BG1A 2YNPA 4BUJC 1BPOA 2IURA 3UVOA 3DXKC 4K3JB 1N6FA 2HJBA 2IUQA 3QHYB 5EM2B 5M61A 2P9LC 3UKUC 3T3PA 3DDUA 1NEXB 3IUMA 4O3UB 4O02A 5IGQA 2AGZA 3K26A 3FGBA 4FHLA 2AGLA 4Z7NA 2IWKA 3MZLA 1ERJA 5HQGA 4UM8A 1NR0A 2QZPA 4KFMB 4XEIC 3UVNA 5FFGA 5IC7A 1PBYB 4G55A 3FM0A 1VZ3A 4OWRA 2PM9B 3NIGA 4EWRA 3V5WB 1A12A 4J77A 1RI6A 4ERYA 1JTDB 2P9IC 4ERZA 4NC4A 1SQJA 2QXVA 3EQ9A 4A11B 4J78A 1I2MB 4E54A 4FA1D 2VZ3A 3EI4B 4JT6C 2VDPA 2BBKH 1OLZA 4FAND 1VE6A 2XL3A 5CXCA 4J0WA 2CE8A 2VC2A 1VZ2A 3VI4A 2G9AA 5E6UA 4Y5RD 1QFSA 5EAPA 3OF7A 3MKQA 2IWFA 3K72A 2P9UC 3AH8B 4J8BA 4CZVA 1JV2A 5H1MA 2AH1A 3ULEC 3OL2B 1TYEA 1GOFA 3EI2B 2H6NA 3PVWB 4PSXB 3RSEC 2OIZA
chains in the Genus database with same CATH topology
5H14A 4FA5D 5FA5B 3C75H 2CO0C 4JSNC 5EAMA 2CN2A 2OVRB 1GOTB 5TDHB 4LGNA 2O9KA 5GSAA 3IIWA 4GM8A 3OTTA 3IJCA 4ZOZA 4JSPC 5HE1B 3RMZD 5K1CC 2YNOA 4PBYA 5FLXg 3VA6A 3RFHA 3W15A 3PVUB 4HDJA 3JZGA 2UZYB 4A0BB 4ES0A 3E0CA 4J81A 3KRWB 3EI3B 3UR4A 4H5JA 3JROA 1MG3A 2H47A 2I3TA 3RN1D 5IJ7E 3SN6B 5C2WB 3JB9L 1B9XA 1GXRA 3JPXA 3OKYB 3EI1B 3I2NA 3IJ0A 3V9FA 1XIPA 4X63B 1QNIA 2OK6A 4J8GA 4TZ4A 3I7NA 3NVXA 2AGXA 4J86A 1JJUB 2MTAH 4CY2A 3MZKA 1L0QA 4PXWA 2H9NA 5CYKB 3SJLD 4CI2A 2IAAA 5FKQA 3AL9A 4A08B 3MXXA 3FRXA 3F3FA 4FA9D 3SHFA 4XYIA 3AL8B 5SXMA 3C5MA 5A2Qg 3DM0A 2HESX 5CXBA 2CNXA 5EALA 3JZHA 3U4YA 3MMYA 4AOWA 1JMZB 4L1QD 4X3EA 3L4MD 5HE3B 3PXWD 3RFGA 2EBSA 4XYHA 3N0EA 2CE9A 3GFCA 4A09A 5AFU3 3PXTD 3N0DA 5IGOA 2H3XA 4ZN4A 3V7DB 4FAVD 2YNNA 2H9LA 4A0AB 4E5ZB 4GQBB 3JAMg 5EM2A 3JZNA 3EG6A 2AGYA 4AEZA 4CI1A 5GXHA 3SWSD 3SBRA 1P22A 2B5LA 4FA4D 3UKRC 2PBIB 1PI6A 2UZXB 4J87A 3CIKB 2OK4A 4NSXA 2CO0A 4PNKB 3AFCA 2J57G 5TEEA 5K19A 3OW8A 3CFVA 5H17A 2PM9A 4QL1A 3OKTA 3EWEA 3IIYA 4CZXA 3CFSB 5JWZA 3UVLA 5EARA 4A11A 4ERQA 2XL2A 2H9PA 4J82A 5THAA 4O3TB 4MK0B 3EI4A 1JMXB 1SHYB 1SQ9A 3NVQA 2BCJB 4CI3A 2OVQB 3SBPA 2Z2OA 3J81g 2PM6B 3K27A 4O9DA 3MKSB 3P4FA 4ZOYA 2OVPB 2P9NC 3SLED 5GMKn 1R5MA 1TBGA 4O1QD 4YVDA 4A2LA 2AQ5A 5AMSA 4GQ2P 5HE2B 3OL2A 3SXTD 3EI2A 4JSXC 4QT8A 5I5JA 4H5IA 2P9KC 4LG8A 2Z2NA 3L4OD 2HKMA 4PBZA 1U2VC 1XHMA 5IJ8E 4N14A 2HYEA 2AGWA 3UVMA 3I7KA 4ZOVA 3VGZA 4L9OA 2Z2PA 3VH0A 2IUPA 3BG0A 5TEFA 1S4UX 4CY5A 2GC7A 3I7LA 3JRPA 2QC5A 4J84A 4D0KA 5I5IA 1TYQC 4GM9A 4K3ID 3PE7A 4GMBA 2CN3A 2YB8B 4A0BA 5C9ZB 3EI3A 1PGUA 3J80g 3B7FA 3PXSD 4CI8A 3PSLA 2GC4A 4IMMA 4LG9A 3HFQA 1MDAH 5B4WA 3F3GA 3EI1A 3OKYA 2W18A 4CY3A 2H14A 1GG2B 3EU7A 4E54B 3I8EA 2H6QA 1OMWB 2H6KA 4U1EI 1Q47A 4GGCA 5CXCB 1JOFA 3C99A 3I7PA 4Y7RA 2I0RA 2HXCA 4PC0A 4IA9A 5CYKA 5FKSA 2TRCB 2AH0A 4UI9R 2B4EA 2H13A 1GP2B 2IUVA 4A08A 5EMLB 4R7AB 1A0RB 3A0FA 4L3HD 4A2MA 2I3SA 3AL8A 3RN0D 5EMJB 3SFZA 2XYIA 4PSWB 5I5MA 4Z8LA 2J55H 3DSMA 5IT9g 5EMKB 4GGDA 3GREA 5GXIA 3KRXB 4J79A 3UVKA 5C2VB 3IKOA 2B5MA 1K8KC 2I0SA 3BWSA 5HYNB 2PM7B 3SVWD 3EMHA 2GNQA 4JXMA 5FQDA 1N6EA 4X60B 1MG2A 4ZOXA 2H68A 3PSCB 4GM3A 1YFQA 2OJYA 4BH6A 4FWWA 1K32A 4A0AA 4E5ZA 3DXMC 4X61B 3NVNA 3ORVD 5HE0B 3OKWA 3IJ1A 1XKSA 3ODTA 2Q7QA 4FB1D 2I0TA 5EMMB 4J73A 1VYHC 4G56B 4I79A 5FKTA 4GQ1A 4QRJA 3I89A 5AJAA 1PEVA 2YMUA 3SBQA 4J0XA 3SCYA 4D6VA 4A7JA 1U4CA 3DWLC 4O45A 2B5NA 4CZYA 2HKRA 5FKRA 1N6DA 3ZWLB 2P9SC 3RRMC 4CC9A 2P9PC 5KDOB 3I7OA 2H9MA 3RLMD 3F3PA 4U7AA 4GGAA 1FWXA 4BL0A 1B9YA 2J56H 2XU7A 4CY1A 4GZ8A 5CXBB 3I8CA 4JD2C 4ESGA 3I7HA 2G99A 4JT5C 2HJ4A 3C9CA 5TF2A 4L3GD 3SMRA 5FXYA 4A09B 4QQEA 4JSVC 4OZUA 2YBAA 3BG1A 2YNPA 4BUJC 2IURA 3UVOA 3DXKC 4K3JB 1N6FA 2HJBA 2IUQA 5EM2B 2P9LC 3UKUC 1NEXB 4O3UB 5IGQA 2AGZA 3K26A 3FGBA 4FHLA 2AGLA 2IWKA 3MZLA 1ERJA 5HQGA 1NR0A 4KFMB 4XEIC 3UVNA 5IC7A 1PBYB 3FM0A 4OWRA 2PM9B 4EWRA 3V5WB 4J77A 1RI6A 4ERYA 2P9IC 4ERZA 1SQJA 2QXVA 4A11B 4J78A 4E54A 4FA1D 3EI4B 4JT6C 2BBKH 1OLZA 4FAND 2XL3A 5CXCA 4J0WA 2CE8A 2G9AA 4Y5RD 5EAPA 3MKQA 2IWFA 2P9UC 3AH8B 4J8BA 4CZVA 5H1MA 2AH1A 3ULEC 3OL2B 3EI2B 2H6NA 3PVWB 4PSXB 3RSEC 2OIZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5H14 A;  4FA5 D;  5FA5 B;  3C75 H;  2CO0 C;  4JSN C;  5EAM A;  2CN2 A;  2OVR B;  1GOT B;  5TDH B;  4LGN A;  2O9K A;  5GSA A;  3IIW A;  4GM8 A;  3OTT A;  3IJC A;  4ZOZ A;  4JSP C;  5HE1 B;  3RMZ D;  5K1C C;  2YNO A;  4PBY A;  5FLX g;  3VA6 A;  3RFH A;  3W15 A;  3PVU B;  4HDJ A;  3JZG A;  2UZY B;  4A0B B;  4ES0 A;  3E0C A;  4J81 A;  3KRW B;  3EI3 B;  3UR4 A;  4H5J A;  3JRO A;  1MG3 A;  2H47 A;  2I3T A;  3RN1 D;  5IJ7 E;  3SN6 B;  5C2W B;  3JB9 L;  1B9X A;  1GXR A;  3JPX A;  3OKY B;  3EI1 B;  3I2N A;  3IJ0 A;  3V9F A;  1XIP A;  4X63 B;  1QNI A;  2OK6 A;  4J8G A;  4TZ4 A;  3I7N A;  3NVX A;  2AGX A;  4J86 A;  1JJU B;  2MTA H;  4CY2 A;  3MZK A;  1L0Q A;  4PXW A;  2H9N A;  5CYK B;  3SJL D;  4CI2 A;  2IAA A;  5FKQ A;  3AL9 A;  4A08 B;  3MXX A;  3FRX A;  3F3F A;  4FA9 D;  3SHF A;  4XYI A;  3AL8 B;  5SXM A;  3C5M A;  5A2Q g;  3DM0 A;  2HES X;  5CXB A;  2CNX A;  5EAL A;  3JZH A;  3U4Y A;  3MMY A;  4AOW A;  1JMZ B;  4L1Q D;  4X3E A;  3L4M D;  5HE3 B;  3PXW D;  3RFG A;  2EBS A;  4XYH A;  3N0E A;  2CE9 A;  3GFC A;  4A09 A;  5AFU 3;  3PXT D;  3N0D A;  5IGO A;  2H3X A;  4ZN4 A;  3V7D B;  4FAV D;  2YNN A;  2H9L A;  4A0A B;  4E5Z B;  4GQB B;  3JAM g;  5EM2 A;  3JZN A;  3EG6 A;  2AGY A;  4AEZ A;  4CI1 A;  5GXH A;  3SWS D;  3SBR A;  1P22 A;  2B5L A;  4FA4 D;  3UKR C;  2PBI B;  1PI6 A;  2UZX B;  4J87 A;  3CIK B;  2OK4 A;  4NSX A;  2CO0 A;  4PNK B;  3AFC A;  2J57 G;  5TEE A;  5K19 A;  3OW8 A;  3CFV A;  5H17 A;  2PM9 A;  4QL1 A;  3OKT A;  3EWE A;  3IIY A;  4CZX A;  3CFS B;  5JWZ A;  3UVL A;  5EAR A;  4A11 A;  4ERQ A;  2XL2 A;  2H9P A;  4J82 A;  5THA A;  4O3T B;  4MK0 B;  3EI4 A;  1JMX B;  1SHY B;  1SQ9 A;  3NVQ A;  2BCJ B;  4CI3 A;  2OVQ B;  3SBP A;  2Z2O A;  3J81 g;  2PM6 B;  3K27 A;  4O9D A;  3MKS B;  3P4F A;  4ZOY A;  2OVP B;  2P9N C;  3SLE D;  5GMK n;  1R5M A;  1TBG A;  4O1Q D;  4YVD A;  4A2L A;  2AQ5 A;  5AMS A;  4GQ2 P;  5HE2 B;  3OL2 A;  3SXT D;  3EI2 A;  4JSX C;  4QT8 A;  5I5J A;  4H5I A;  2P9K C;  4LG8 A;  2Z2N A;  3L4O D;  2HKM A;  4PBZ A;  1U2V C;  1XHM A;  5IJ8 E;  4N14 A;  2HYE A;  2AGW A;  3UVM A;  3I7K A;  4ZOV A;  3VGZ A;  4L9O A;  2Z2P A;  3VH0 A;  2IUP A;  3BG0 A;  5TEF A;  1S4U X;  4CY5 A;  2GC7 A;  3I7L A;  3JRP A;  2QC5 A;  4J84 A;  4D0K A;  5I5I A;  1TYQ C;  4GM9 A;  4K3I D;  3PE7 A;  4GMB A;  2CN3 A;  2YB8 B;  4A0B A;  5C9Z B;  3EI3 A;  1PGU A;  3J80 g;  3B7F A;  3PXS D;  4CI8 A;  3PSL A;  2GC4 A;  4IMM A;  4LG9 A;  3HFQ A;  1MDA H;  5B4W A;  3F3G A;  3EI1 A;  3OKY A;  2W18 A;  4CY3 A;  2H14 A;  1GG2 B;  3EU7 A;  4E54 B;  3I8E A;  2H6Q A;  1OMW B;  2H6K A;  4U1E I;  1Q47 A;  4GGC A;  5CXC B;  1JOF A;  3C99 A;  3I7P A;  4Y7R A;  2I0R A;  2HXC A;  4PC0 A;  4IA9 A;  5CYK A;  5FKS A;  2TRC B;  2AH0 A;  4UI9 R;  2B4E A;  2H13 A;  1GP2 B;  2IUV A;  4A08 A;  5EML B;  4R7A B;  1A0R B;  3A0F A;  4L3H D;  4A2M A;  2I3S A;  3AL8 A;  3RN0 D;  5EMJ B;  3SFZ A;  2XYI A;  4PSW B;  5I5M A;  4Z8L A;  2J55 H;  3DSM A;  5IT9 g;  5EMK B;  4GGD A;  3GRE A;  5GXI A;  3KRX B;  4J79 A;  3UVK A;  5C2V B;  3IKO A;  2B5M A;  1K8K C;  2I0S A;  3BWS A;  5HYN B;  2PM7 B;  3SVW D;  3EMH A;  2GNQ A;  4JXM A;  5FQD A;  1N6E A;  4X60 B;  1MG2 A;  4ZOX A;  2H68 A;  3PSC B;  4GM3 A;  1YFQ A;  2OJY A;  4BH6 A;  4FWW A;  1K32 A;  4A0A A;  4E5Z A;  3DXM C;  4X61 B;  3NVN A;  3ORV D;  5HE0 B;  3OKW A;  3IJ1 A;  1XKS A;  3ODT A;  2Q7Q A;  4FB1 D;  2I0T A;  5EMM B;  4J73 A;  1VYH C;  4G56 B;  4I79 A;  5FKT A;  4GQ1 A;  4QRJ A;  3I89 A;  5AJA A;  1PEV A;  2YMU A;  3SBQ A;  4J0X A;  3SCY A;  4D6V A;  4A7J A;  1U4C A;  3DWL C;  4O45 A;  2B5N A;  4CZY A;  2HKR A;  5FKR A;  1N6D A;  3ZWL B;  2P9S C;  3RRM C;  4CC9 A;  2P9P C;  5KDO B;  3I7O A;  2H9M A;  3RLM D;  3F3P A;  4U7A A;  4GGA A;  1FWX A;  4BL0 A;  1B9Y A;  2J56 H;  2XU7 A;  4CY1 A;  4GZ8 A;  5CXB B;  3I8C A;  4JD2 C;  4ESG A;  3I7H A;  2G99 A;  4JT5 C;  2HJ4 A;  3C9C A;  5TF2 A;  4L3G D;  3SMR A;  5FXY A;  4A09 B;  4QQE A;  4JSV C;  4OZU A;  2YBA A;  3BG1 A;  2YNP A;  4BUJ C;  2IUR A;  3UVO A;  3DXK C;  4K3J B;  1N6F A;  2HJB A;  2IUQ A;  5EM2 B;  2P9L C;  3UKU C;  1NEX B;  4O3U B;  5IGQ A;  2AGZ A;  3K26 A;  3FGB A;  4FHL A;  2AGL A;  2IWK A;  3MZL A;  1ERJ A;  5HQG A;  1NR0 A;  4KFM B;  4XEI C;  3UVN A;  5IC7 A;  1PBY B;  3FM0 A;  4OWR A;  2PM9 B;  4EWR A;  3V5W B;  4J77 A;  1RI6 A;  4ERY A;  2P9I C;  4ERZ A;  1SQJ A;  2QXV A;  4A11 B;  4J78 A;  4E54 A;  4FA1 D;  3EI4 B;  4JT6 C;  2BBK H;  1OLZ A;  4FAN D;  2XL3 A;  5CXC A;  4J0W A;  2CE8 A;  2G9A A;  4Y5R D;  5EAP A;  3MKQ A;  2IWF A;  2P9U C;  3AH8 B;  4J8B A;  4CZV A;  5H1M A;  2AH1 A;  3ULE C;  3OL2 B;  3EI2 B;  2H6N A;  3PVW B;  4PSX B;  3RSE C;  2OIZ A; 
#chains in the Genus database with same CATH topology
 5H14 A;  4FA5 D;  5FA5 B;  3C75 H;  2CO0 C;  4JSN C;  3MUN A;  2EIB A;  5EAM A;  1UOP A;  2CN2 A;  2OVR B;  1GOT B;  5TDH B;  4LGN A;  3KCI A;  4RE6 A;  2O9K A;  5GSA A;  3IIW A;  4GM8 A;  3OTT A;  3ZDX A;  3IJC A;  4ZOZ A;  4JSP C;  3FCS A;  5HE1 B;  3RMZ D;  5K1C C;  2YNO A;  4PBY A;  2XDW A;  4L1M A;  5FLX g;  3VA6 A;  3RFH A;  4BCB A;  1C9L A;  3W15 A;  1L5G A;  3PVU B;  4HDJ A;  1E8N A;  4BCD A;  3JZG A;  2UZY B;  4A0B B;  4ES0 A;  3E0C A;  4J81 A;  3KRW B;  3EI3 B;  3UR4 A;  4IRZ A;  4H5J A;  3JRO A;  2QR5 A;  4MMY A;  1MG3 A;  3O4G A;  2H47 A;  2I3T A;  3RN1 D;  5IJ7 E;  3SN6 B;  5C2W B;  3JB9 L;  1B9X A;  1GXR A;  3JPX A;  3OKY B;  3EI1 B;  3I2N A;  3IJ0 A;  3V9F A;  1XIP A;  4X63 B;  1QNI A;  2OK6 A;  4J8G A;  4TZ4 A;  3I7N A;  3NVX A;  2AGX A;  4J86 A;  2EIC A;  3IUQ A;  4MMZ A;  1JJU B;  2MTA H;  4CY2 A;  3MZK A;  1L0Q A;  4PXW A;  2H9N A;  4RE5 A;  5CYK B;  1QFM A;  3SJL D;  4CI2 A;  2IAA A;  5FKQ A;  3AL9 A;  4A08 B;  3MXX A;  3FRX A;  3F3F A;  4FA9 D;  3SHF A;  4BCC A;  4XYI A;  3AL8 B;  5SXM A;  3C5M A;  5A2Q g;  3DM0 A;  2HES X;  5CXB A;  2CNX A;  2EIE A;  5EAL A;  3JZH A;  3U4Y A;  3MMY A;  4AOW A;  3MUO A;  1U8C A;  3K6S A;  1JMZ B;  4L1Q D;  4X3E A;  3L4M D;  5HE3 B;  3PXW D;  3RFG A;  5M5V A;  2EBS A;  3IVM A;  1C9I A;  4XYH A;  3N0E A;  2CE9 A;  3GFC A;  4A09 A;  5AFU 3;  3PXT D;  3IUJ A;  3N0D A;  3GC3 B;  5IGO A;  2H3X A;  4ZN4 A;  3V4P A;  3V7D B;  4FAV D;  3K71 A;  2YNN A;  2H9L A;  1T2X A;  4A0A B;  2EID A;  3IUN A;  4E5Z B;  4GQB B;  2WQ8 A;  3JAM g;  5EM2 A;  3ZE0 A;  4Z7O A;  3JZN A;  3EG6 A;  2AGY A;  3EQ7 A;  4AEZ A;  2VDR A;  4CI1 A;  5GXH A;  3SWS D;  3SBR A;  4WK4 A;  1P22 A;  3MVD K;  4NEN A;  3ZDY A;  2B5L A;  4FA4 D;  3UKR C;  3O4H A;  2PBI B;  1PI6 A;  2UZX B;  4J87 A;  3CIK B;  2OK4 A;  4NSX A;  2CO0 A;  4PNK B;  3AFC A;  3ZE1 A;  2J57 G;  5TEE A;  5K19 A;  3OW8 A;  3CFV A;  1E8M A;  5H17 A;  2PM9 A;  2VDK A;  3V4V A;  4QL1 A;  3T3M A;  3OKT A;  1UOO A;  3EWE A;  3IIY A;  1H2Y A;  4CZX A;  3CFS B;  5JWZ A;  3UVL A;  5EAR A;  4A11 A;  4ERQ A;  2XL2 A;  2H9P A;  4J82 A;  5THA A;  4O3T B;  1UOQ A;  4MK0 B;  3EI4 A;  1JMX B;  1SHY B;  1SQ9 A;  3NVQ A;  2BCJ B;  4CI3 A;  2OVQ B;  3SBP A;  2VDN A;  2Z2O A;  3GD1 I;  4AN1 A;  3J81 g;  2PM6 B;  3K27 A;  4O9D A;  3MKS B;  1O6G A;  3P4F A;  4JHP C;  2OVP B;  2P9N C;  3SLE D;  3ZE2 A;  4ZOY A;  1R5M A;  5GMK n;  1TBG A;  4O1Q D;  4YVD A;  3VI3 A;  4A2L A;  2AQ5 A;  1UTC A;  5AMS A;  4AX4 A;  4GQ2 P;  5HE2 B;  3OL2 A;  5C92 A;  4NBM A;  3SXT D;  3EI2 A;  4JSX C;  4QT8 A;  5I5J A;  4H5I A;  2BKL A;  2P9K C;  4LG8 A;  2Z2N A;  3L4O D;  1H2X A;  2VDO A;  1YR2 A;  2HKM A;  4PBZ A;  1U2V C;  1XHM A;  5E6S A;  5IJ8 E;  4N14 A;  2HYE A;  2AGW A;  4NAA A;  3I7K A;  4ZOV A;  3UVM A;  3NID A;  3VGZ A;  4L9O A;  2Z2P A;  3VH0 A;  2IUP A;  3BG0 A;  5TEF A;  1S4U X;  4CY5 A;  2GC7 A;  3I7L A;  3NIF A;  3JRP A;  4DNW A;  2QC5 A;  4J84 A;  4D0K A;  5I5I A;  1GOG A;  1TYQ C;  4GM9 A;  3PE7 A;  4GMB A;  4K3I D;  2CN3 A;  2VDM A;  2YB8 B;  4A0B A;  5C9Z B;  3EI3 A;  4AN0 A;  1PGU A;  3J80 g;  3B7F A;  3PXS D;  4CI8 A;  3PSL A;  2GC4 A;  4IMM A;  4LG9 A;  3HFQ A;  1MDA H;  5B4W A;  4O2W A;  3F3G A;  2HU8 A;  4WK0 A;  2JKX A;  3EI1 A;  3OKY A;  3QI0 A;  2W18 A;  4CY3 A;  2H14 A;  1GG2 B;  1H2W A;  3EU7 A;  4E54 B;  3I8E A;  2H6Q A;  5FFO A;  1OMW B;  2VZ1 A;  2H6K A;  4U1E I;  1Q47 A;  4GGC A;  5CXC B;  1JOF A;  3C99 A;  3I7P A;  3O4I A;  4Y7R A;  2XE4 A;  2HU5 A;  2I0R A;  2HXC A;  4PC0 A;  4IA9 A;  5CYK A;  5FKS A;  2TRC B;  2AH0 A;  4UI9 R;  2B4E A;  1GP2 B;  2H13 A;  2IUV A;  4A08 A;  5EML B;  4BP8 A;  4R7A B;  1A0R B;  5M5R A;  3A0F A;  4L3H D;  4A2M A;  2I3S A;  3AL8 A;  3RN0 D;  5EMJ B;  3SFZ A;  2XYI A;  4PSW B;  5I5M A;  4Z8L A;  2J55 H;  3DSM A;  5IT9 g;  5EMK B;  2XZG A;  3IJE A;  4GGD A;  4DNU A;  3GRE A;  2VDL A;  5GXI A;  3KRX B;  4J79 A;  3UVK A;  5C2V B;  3IKO A;  4G1M A;  2B5M A;  1K8K C;  2I0S A;  3BWS A;  5HYN B;  2PM7 B;  3SVW D;  3EMH A;  1M1X A;  2GNQ A;  4JXM A;  5FQD A;  1N6E A;  4X60 B;  1MG2 A;  4ZOX A;  2H68 A;  3PSC B;  1VE7 A;  4GM3 A;  4JHN A;  1E5T A;  1YFQ A;  2OJY A;  4BH6 A;  2VDQ A;  4FWW A;  3IUL A;  4MMX A;  1K32 A;  4A0A A;  5E6R A;  4E5Z A;  3DXM C;  5C86 A;  4X61 B;  3NVN A;  3ORV D;  5HE0 B;  3ZDZ A;  3OKW A;  3IJ1 A;  1XKS A;  3ODT A;  2Q7Q A;  4FB1 D;  1O6F A;  2I0T A;  4QAM A;  5EMM B;  4J73 A;  1VYH C;  4G56 B;  4I79 A;  5FKT A;  4GQ1 A;  4QRJ A;  5M5U A;  3EQ8 A;  3I89 A;  3FCU A;  1GOH A;  5AJA A;  1PEV A;  2YMU A;  5M5T A;  3IUR A;  3SBQ A;  4J0X A;  3SCY A;  4Z7Q A;  4WK2 A;  4D6V A;  4A7J A;  1U4C A;  3DWL C;  4O45 A;  2B5N A;  4CZY A;  2HKR A;  5FKR A;  1N6D A;  3ZWL B;  2P9S C;  3RRM C;  4AMY A;  4DNV A;  5M5S A;  4CC9 A;  2P9P C;  4BP9 A;  5KDO B;  3I7O A;  2H9M A;  3RLM D;  3F3P A;  4U7A A;  4GGA A;  1FWX A;  2HU7 A;  4WJK A;  4BL0 A;  3O4J A;  1B9Y A;  2J56 H;  2XU7 A;  4G1E A;  4CY1 A;  4GZ8 A;  5CXB B;  3I8C A;  4JD2 C;  1K3I A;  4ESG A;  3I7H A;  2G99 A;  4JT5 C;  5HDB A;  2HJ4 A;  3C9C A;  4UM9 A;  4AMZ A;  1H2Z A;  4D9S A;  5TF2 A;  4L3G D;  3SMR A;  5FXY A;  4A09 B;  4QQE A;  4JSV C;  4OZU A;  2YBA A;  3BG1 A;  2YNP A;  4BUJ C;  1BPO A;  2IUR A;  3UVO A;  3DXK C;  4K3J B;  1N6F A;  2HJB A;  2IUQ A;  3QHY B;  5EM2 B;  5M61 A;  2P9L C;  3UKU C;  3T3P A;  3DDU A;  1NEX B;  3IUM A;  4O3U B;  4O02 A;  5IGQ A;  2AGZ A;  3K26 A;  3FGB A;  4FHL A;  2AGL A;  4Z7N A;  2IWK A;  3MZL A;  1ERJ A;  5HQG A;  4UM8 A;  1NR0 A;  2QZP A;  4KFM B;  4XEI C;  3UVN A;  5FFG A;  5IC7 A;  1PBY B;  4G55 A;  3FM0 A;  1VZ3 A;  4OWR A;  2PM9 B;  3NIG A;  4EWR A;  3V5W B;  1A12 A;  4J77 A;  1RI6 A;  4ERY A;  1JTD B;  2P9I C;  4ERZ A;  4NC4 A;  1SQJ A;  2QXV A;  3EQ9 A;  4A11 B;  4J78 A;  1I2M B;  4E54 A;  4FA1 D;  2VZ3 A;  3EI4 B;  4JT6 C;  2VDP A;  2BBK H;  1OLZ A;  4FAN D;  1VE6 A;  2XL3 A;  5CXC A;  4J0W A;  2CE8 A;  2VC2 A;  1VZ2 A;  3VI4 A;  2G9A A;  5E6U A;  4Y5R D;  1QFS A;  5EAP A;  3OF7 A;  3MKQ A;  2IWF A;  3K72 A;  2P9U C;  3AH8 B;  4J8B A;  4CZV A;  1JV2 A;  5H1M A;  2AH1 A;  3ULE C;  3OL2 B;  1TYE A;  1GOF A;  3EI2 B;  2H6N A;  3PVW B;  4PSX B;  3RSE C;  2OIZ A; 
#chains in the Genus database with same CATH homology
 5H14 A;  4FA5 D;  5FA5 B;  3C75 H;  2CO0 C;  4JSN C;  5EAM A;  2CN2 A;  2OVR B;  1GOT B;  5TDH B;  4LGN A;  2O9K A;  5GSA A;  3IIW A;  4GM8 A;  3OTT A;  3IJC A;  4ZOZ A;  4JSP C;  5HE1 B;  3RMZ D;  5K1C C;  2YNO A;  4PBY A;  5FLX g;  3VA6 A;  3RFH A;  3W15 A;  3PVU B;  4HDJ A;  3JZG A;  2UZY B;  4A0B B;  4ES0 A;  3E0C A;  4J81 A;  3KRW B;  3EI3 B;  3UR4 A;  4H5J A;  3JRO A;  1MG3 A;  2H47 A;  2I3T A;  3RN1 D;  5IJ7 E;  3SN6 B;  5C2W B;  3JB9 L;  1B9X A;  1GXR A;  3JPX A;  3OKY B;  3EI1 B;  3I2N A;  3IJ0 A;  3V9F A;  1XIP A;  4X63 B;  1QNI A;  2OK6 A;  4J8G A;  4TZ4 A;  3I7N A;  3NVX A;  2AGX A;  4J86 A;  1JJU B;  2MTA H;  4CY2 A;  3MZK A;  1L0Q A;  4PXW A;  2H9N A;  5CYK B;  3SJL D;  4CI2 A;  2IAA A;  5FKQ A;  3AL9 A;  4A08 B;  3MXX A;  3FRX A;  3F3F A;  4FA9 D;  3SHF A;  4XYI A;  3AL8 B;  5SXM A;  3C5M A;  5A2Q g;  3DM0 A;  2HES X;  5CXB A;  2CNX A;  5EAL A;  3JZH A;  3U4Y A;  3MMY A;  4AOW A;  1JMZ B;  4L1Q D;  4X3E A;  3L4M D;  5HE3 B;  3PXW D;  3RFG A;  2EBS A;  4XYH A;  3N0E A;  2CE9 A;  3GFC A;  4A09 A;  5AFU 3;  3PXT D;  3N0D A;  5IGO A;  2H3X A;  4ZN4 A;  3V7D B;  4FAV D;  2YNN A;  2H9L A;  4A0A B;  4E5Z B;  4GQB B;  3JAM g;  5EM2 A;  3JZN A;  3EG6 A;  2AGY A;  4AEZ A;  4CI1 A;  5GXH A;  3SWS D;  3SBR A;  1P22 A;  2B5L A;  4FA4 D;  3UKR C;  2PBI B;  1PI6 A;  2UZX B;  4J87 A;  3CIK B;  2OK4 A;  4NSX A;  2CO0 A;  4PNK B;  3AFC A;  2J57 G;  5TEE A;  5K19 A;  3OW8 A;  3CFV A;  5H17 A;  2PM9 A;  4QL1 A;  3OKT A;  3EWE A;  3IIY A;  4CZX A;  3CFS B;  5JWZ A;  3UVL A;  5EAR A;  4A11 A;  4ERQ A;  2XL2 A;  2H9P A;  4J82 A;  5THA A;  4O3T B;  4MK0 B;  3EI4 A;  1JMX B;  1SHY B;  1SQ9 A;  3NVQ A;  2BCJ B;  4CI3 A;  2OVQ B;  3SBP A;  2Z2O A;  3J81 g;  2PM6 B;  3K27 A;  4O9D A;  3MKS B;  3P4F A;  4ZOY A;  2OVP B;  2P9N C;  3SLE D;  5GMK n;  1R5M A;  1TBG A;  4O1Q D;  4YVD A;  4A2L A;  2AQ5 A;  5AMS A;  4GQ2 P;  5HE2 B;  3OL2 A;  3SXT D;  3EI2 A;  4JSX C;  4QT8 A;  5I5J A;  4H5I A;  2P9K C;  4LG8 A;  2Z2N A;  3L4O D;  2HKM A;  4PBZ A;  1U2V C;  1XHM A;  5IJ8 E;  4N14 A;  2HYE A;  2AGW A;  3UVM A;  3I7K A;  4ZOV A;  3VGZ A;  4L9O A;  2Z2P A;  3VH0 A;  2IUP A;  3BG0 A;  5TEF A;  1S4U X;  4CY5 A;  2GC7 A;  3I7L A;  3JRP A;  2QC5 A;  4J84 A;  4D0K A;  5I5I A;  1TYQ C;  4GM9 A;  4K3I D;  3PE7 A;  4GMB A;  2CN3 A;  2YB8 B;  4A0B A;  5C9Z B;  3EI3 A;  1PGU A;  3J80 g;  3B7F A;  3PXS D;  4CI8 A;  3PSL A;  2GC4 A;  4IMM A;  4LG9 A;  3HFQ A;  1MDA H;  5B4W A;  3F3G A;  3EI1 A;  3OKY A;  2W18 A;  4CY3 A;  2H14 A;  1GG2 B;  3EU7 A;  4E54 B;  3I8E A;  2H6Q A;  1OMW B;  2H6K A;  4U1E I;  1Q47 A;  4GGC A;  5CXC B;  1JOF A;  3C99 A;  3I7P A;  4Y7R A;  2I0R A;  2HXC A;  4PC0 A;  4IA9 A;  5CYK A;  5FKS A;  2TRC B;  2AH0 A;  4UI9 R;  2B4E A;  2H13 A;  1GP2 B;  2IUV A;  4A08 A;  5EML B;  4R7A B;  1A0R B;  3A0F A;  4L3H D;  4A2M A;  2I3S A;  3AL8 A;  3RN0 D;  5EMJ B;  3SFZ A;  2XYI A;  4PSW B;  5I5M A;  4Z8L A;  2J55 H;  3DSM A;  5IT9 g;  5EMK B;  4GGD A;  3GRE A;  5GXI A;  3KRX B;  4J79 A;  3UVK A;  5C2V B;  3IKO A;  2B5M A;  1K8K C;  2I0S A;  3BWS A;  5HYN B;  2PM7 B;  3SVW D;  3EMH A;  2GNQ A;  4JXM A;  5FQD A;  1N6E A;  4X60 B;  1MG2 A;  4ZOX A;  2H68 A;  3PSC B;  4GM3 A;  1YFQ A;  2OJY A;  4BH6 A;  4FWW A;  1K32 A;  4A0A A;  4E5Z A;  3DXM C;  4X61 B;  3NVN A;  3ORV D;  5HE0 B;  3OKW A;  3IJ1 A;  1XKS A;  3ODT A;  2Q7Q A;  4FB1 D;  2I0T A;  5EMM B;  4J73 A;  1VYH C;  4G56 B;  4I79 A;  5FKT A;  4GQ1 A;  4QRJ A;  3I89 A;  5AJA A;  1PEV A;  2YMU A;  3SBQ A;  4J0X A;  3SCY A;  4D6V A;  4A7J A;  1U4C A;  3DWL C;  4O45 A;  2B5N A;  4CZY A;  2HKR A;  5FKR A;  1N6D A;  3ZWL B;  2P9S C;  3RRM C;  4CC9 A;  2P9P C;  5KDO B;  3I7O A;  2H9M A;  3RLM D;  3F3P A;  4U7A A;  4GGA A;  1FWX A;  4BL0 A;  1B9Y A;  2J56 H;  2XU7 A;  4CY1 A;  4GZ8 A;  5CXB B;  3I8C A;  4JD2 C;  4ESG A;  3I7H A;  2G99 A;  4JT5 C;  2HJ4 A;  3C9C A;  5TF2 A;  4L3G D;  3SMR A;  5FXY A;  4A09 B;  4QQE A;  4JSV C;  4OZU A;  2YBA A;  3BG1 A;  2YNP A;  4BUJ C;  2IUR A;  3UVO A;  3DXK C;  4K3J B;  1N6F A;  2HJB A;  2IUQ A;  5EM2 B;  2P9L C;  3UKU C;  1NEX B;  4O3U B;  5IGQ A;  2AGZ A;  3K26 A;  3FGB A;  4FHL A;  2AGL A;  2IWK A;  3MZL A;  1ERJ A;  5HQG A;  1NR0 A;  4KFM B;  4XEI C;  3UVN A;  5IC7 A;  1PBY B;  3FM0 A;  4OWR A;  2PM9 B;  4EWR A;  3V5W B;  4J77 A;  1RI6 A;  4ERY A;  2P9I C;  4ERZ A;  1SQJ A;  2QXV A;  4A11 B;  4J78 A;  4E54 A;  4FA1 D;  3EI4 B;  4JT6 C;  2BBK H;  1OLZ A;  4FAN D;  2XL3 A;  5CXC A;  4J0W A;  2CE8 A;  2G9A A;  4Y5R D;  5EAP A;  3MKQ A;  2IWF A;  2P9U C;  3AH8 B;  4J8B A;  4CZV A;  5H1M A;  2AH1 A;  3ULE C;  3OL2 B;  3EI2 B;  2H6N A;  3PVW B;  4PSX B;  3RSE C;  2OIZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...