1ERJA

Crystal structure of the c-terminal wd40 domain of tup1
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
388
structure length
350
Chain Sequence
HYLVPYNQRANHSKPIPPFLLDLDSQSVPDALKKQTNDYYILYNPALPREIDVELHKSLDHTSVVCCVKFSNDGEYLATGCNKTTQVYRVSDGSLVARLSDSSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNPLLMLQGHRNSVISVAVANGSSLGPEYNVFATGSGDCKARIWKYKKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the C-terminal domain of Tup1, a corepressor of transcription in yeast.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription inhibitor
molecule keywords TRANSCRIPTIONAL REPRESSOR TUP1
total genus 106
structure length 350
sequence length 388
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2000-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 1erjA00
5FKQA 3I7HA 2HKMA 2CN2A 2EBSA 1XHMA 3FM0A 3I7OA 3DM0A 2UZYB 5A2Qg 2P9SC 2AGYA 2GC4A 4HDJA 3OL2B 4CI8A 2I3SA 5EAPA 4GM9A 4QQEA 3SN6B 2PM7B 4ZOXA 4PSWB 2UZXB 5AJAA 3PXWD 5GXHA 4X60B 3CFSB 4A0BB 3C5MA 4PXWA 4GMBA 3F3PA 3SBQA 3JB9L 3VH0A 2Q7QA 3DSMA 4Y7RA 4PBZA 3AL8A 3AL8B 2J55H 5CYKA 5TEEA 2GC7A 3RFHA 2P9IC 4A09A 4A09B 1N6EA 3SXTD 4CY5A 4X63B 3ULEC 2W18A 3ORVD 4JSPC 3DXMC 5H1MA 5SXMA 4ZOZA 2H6QA 4U7AA 2HXCA 4A11A 3KRXB 4L9OA 3SLED 2CN3A 3SHFA 5IT9g 5B4WA 3OL2A 2BCJB 4TZ4A 2YNPA 3MKSB 4A0AA 3E0CA 1PGUA 4CZVA 3N0EA 5K19A 3RN0D 3AFCA 1XKSA 4L3GD 3MMYA 3UVNA 3C9CA 1GG2B 4GGDA 2H6NA 2H9PA 1PI6A 2IURA 2TRCB 4CZXA 4FA1D 5CYKB 1ERJA 3EMHA 5HE0B 3MZKA 2HYEA 4H5JA 1SHYB 4ES0A 2I0RA 3BG0A 4D6VA 4A0BA 3F3GA 3JAMg 3RN1D 5THAA 5H17A 5HQGA 1B9XA 1A0RB 2OK6A 4ZOYA 1XIPA 3W15A 4GZ8A 4J78A 4A08A 4O45A 2YMUA 4KFMB 1JMZB 3SVWD 4I79A 4J73A 2QC5A 4XYIA 2HESX 3UVLA 3VGZA 2OVQB 5AFU3 5CXBA 1NEXB 3F3FA 4J8GA 5EM2A 4J87A 3A0FA 4JT6C 4ESGA 4FA4D 3EG6A 4K3ID 4E5ZB 4J82A 4LG8A 4X61B 5C2VB 4FAVD 2H6KA 3EI3A 3GFCA 3DXKC 2J57G 4JT5C 3HFQA 1Q47A 5IC7A 3RRMC 3UVMA 2H3XA 2PM9A 4A2MA 1K8KC 1GP2B 4FWWA 3UR4A 2CO0A 5I5JA 5EALA 2CE9A 5GXIA 3I8EA 2B5LA 3EI1A 2IAAA 3SFZA 4J0XA 2MTAH 4XEIC 4J86A 4AOWA 1S4UX 5JWZA 2H13A 4XYHA 3K26A 4LGNA 3K27A 3OKYA 2B4EA 4LG9A 2P9UC 3JRPA 4ZN4A 4JSVC 3NVQA 2IUPA 4J8BA 2YBAA 3I7LA 3PVWB 4Y5RD 1JOFA 3JPXA 5FLXg 5CXCA 3L4MD 3I7KA 2B5MA 4IA9A 2P9PC 2H9LA 3MZLA 2IWKA 4H5IA 2IWFA 4AEZA 4GGCA 3OKWA 3PXTD 1U4CA 4QL1A 3SMRA 3EI2B 3JROA 3BG1A 1P22A 2CNXA 4GQ1A 5IJ8E 4L3HD 3I8CA 2CE8A 3FRXA 4PBYA 1PEVA 4CI1A 3AH8B 2HJBA 3U4YA 3SBRA 2B5NA 3GREA 2H14A 5EMKB 4UI9R 4A2LA 2YB8B 4OZUA 1MG3A 5H14A 2OIZA 5IJ7E 2I0SA 4N14A 4MK0B 2H47A 4A08B 3RMZD 1SQ9A 1R5MA 5CXCB 3SWSD 1OLZA 4X3EA 1U2VC 4ERZA 3PVUB 3SJLD 4IMMA 4E54A 3V9FA 5K1CC 3IKOA 2YNOA 3RLMD 4BUJC 3P4FA 2H68A 1TYQC 2AGWA 4G56B 4FHLA 3EI3B 3UKRC 4R7AB 3PSLA 2IUVA 4BL0A 5FXYA 1N6DA 3JZHA 4J81A 4CI2A 2J56H 2G9AA 4O3TB 3NVNA 2HKRA 3SBPA 3IIWA 3OKYB 4BH6A 2Z2OA 3EI4B 1SQJA 2AH0A 4K3JB 3PE7A 3IJCA 1VYHC 4JSNC 3NVXA 3UVOA 5TEFA 5HE3B 4EWRA 2OK4A 3UKUC 5C9ZB 4ERYA 4QT8A 5FKTA 2XYIA 2G99A 3DWLC 1TBGA 3RFGA 4GGAA 2AQ5A 3IIYA 3FGBA 4CZYA 4JD2C 2XL3A 5C2WB 1L0QA 2AGXA 2H9MA 3I7PA 3ODTA 2YNNA 4YVDA 3B7FA 5EMLB 1MG2A 3EI4A 4JXMA 1YFQA 3OKTA 2HJ4A 1RI6A 3EU7A 3EWEA 4O1QD 3CFVA 5KDOB 5GSAA 2P9NC 4GM8A 3OW8A 2PM6B 4J77A 3EI2A 1QNIA 3EI1B 1PBYB 4E54B 3JZGA 3AL9A 3JZNA 1NR0A 4FB1D 4PSXB 3MKQA 3C75H 4PC0A 1B9YA 3PSCB 2O9KA 2PBIB 4D0KA 1JJUB 5TF2A 4CC9A 4NSXA 2OVPB 2XU7A 1JMXB 5FKRA 5I5MA 2Z2PA 5TDHB 3BWSA 5AMSA 3PXSD 5I5IA 4U1EI 4L1QD 4CY3A 3N0DA 1GOTB 2QXVA 4PNKB 4E5ZA 3MXXA 4JSXC 3UVKA 4CY2A 5FA5B 1K32A 4CI3A 1OMWB 1MDAH 3J80g 4ERQA 3L4OD 5EARA 4GM3A 3IJ1A 3CIKB 3C99A 2I0TA 5FQDA 3I89A 5IGOA 2PM9B 1FWXA 2I3TA 2AGLA 4GQ2P 4J84A 2BBKH 2AGZA 5EM2B 4Z8LA 4ZOVA 5EMMB 1GXRA 5FKSA 3RSEC 2XL2A 3KRWB 2IUQA 2OJYA 3J81g 4FA5D 1N6FA 4A11B 2Z2NA 3V7DB 2P9KC 2AH1A 3I7NA 4FAND 3V5WB 3ZWLB 4QRJA 5EMJB 4O9DA 4O3UB 5EAMA 2H9NA 4J79A 5CXBB 3VA6A 3OTTA 5HE2B 3I2NA 4OWRA 3SCYA 5HYNB 2OVRB 4CY1A 5HE1B 4A7JA 5GMKn 5IGQA 4J0WA 4GQBB 2P9LC 2CO0C 4FA9D 2GNQA 3IJ0A 4A0AB
chains in the Genus database with same CATH superfamily
5FKQA 3T3MA 4BCDA 3I7HA 2HKMA 2CN2A 2VDKA 3K6SA 2EBSA 1XHMA 2QZPA 3FM0A 3I7OA 3DM0A 1A12A 2UZYB 4AN0A 5A2Qg 2P9SC 3IURA 2AGYA 2GC4A 4HDJA 3OL2B 4CI8A 2I3SA 5EAPA 4GM9A 4QQEA 3SN6B 3V4PA 1GOHA 2PM7B 4ZOXA 5M61A 2VDMA 4PSWB 4BCCA 2UZXB 5AJAA 3PXWD 5GXHA 4X60B 4DNUA 3CFSB 4A0BB 3C5MA 4PXWA 4GMBA 1E5TA 3F3PA 3SBQA 4BP8A 3JB9L 3VH0A 3IULA 3IUMA 2Q7QA 3DSMA 4Y7RA 4L1MA 4PBZA 3AL8A 3AL8B 2J55H 5CYKA 5TEEA 3O4JA 2GC7A 3RFHA 1VE7A 2P9IC 4A09A 4A09B 1N6EA 2XE4A 3SXTD 4CY5A 4X63B 2VDQA 3ULEC 3MVDK 2W18A 1H2YA 3ORVD 4JSPC 3DXMC 5C86A 5H1MA 4DNVA 5SXMA 4ZOZA 1K3IA 2H6QA 4U7AA 3K71A 2JKXA 5C92A 2HXCA 4A11A 3KRXB 4L9OA 3SLED 2CN3A 3SHFA 5IT9g 5B4WA 3OL2A 4G1EA 2BCJB 3IUNA 4TZ4A 2YNPA 3MKSB 1UOOA 4A0AA 1GOFA 3E0CA 1PGUA 4RE6A 4CZVA 3N0EA 5K19A 3RN0D 3AFCA 1XKSA 4L3GD 4MMYA 3MMYA 3UVNA 3C9CA 1GG2B 1BPOA 4GGDA 2H6NA 2H9PA 1PI6A 3IVMA 2IURA 2TRCB 4CZXA 1I2MB 4FA1D 5CYKB 4WK2A 1ERJA 3EMHA 5HE0B 3MZKA 2HYEA 4H5JA 1SHYB 4ES0A 2I0RA 3BG0A 4D6VA 4A0BA 3F3GA 4AMZA 3JAMg 1T2XA 5THAA 5H17A 3RN1D 5HQGA 1B9XA 1A0RB 5E6RA 2OK6A 4ZOYA 1XIPA 2HU8A 3W15A 2VC2A 1M1XA 4GZ8A 4J78A 4A08A 4O45A 2YMUA 4KFMB 5FFOA 1JMZB 3O4GA 1C9IA 3SVWD 4I79A 4Z7QA 4Z7OA 4J73A 2QC5A 4XYIA 2HESX 3UVLA 3VGZA 2OVQB 3IUJA 5AFU3 1NEXB 3F3FA 4J8GA 5CXBA 1JV2A 4J87A 1H2WA 3A0FA 4JT6C 1UOQA 5EM2A 4ESGA 4FA4D 3EG6A 4K3ID 4BP9A 4J82A 4E5ZB 4LG8A 4X61B 3ZDXA 5C2VB 4NAAA 4FAVD 2H6KA 3EI3A 3GFCA 3DXKC 2J57G 4JT5C 3HFQA 1Q47A 5IC7A 3RRMC 3UVMA 2H3XA 2PM9A 4A2MA 1K8KC 1GP2B 4FWWA 3UR4A 2CO0A 5I5JA 5EALA 2CE9A 3QI0A 3MUNA 5GXIA 3I8EA 2B5LA 1UOPA 2IAAA 3EQ8A 4WJKA 3SFZA 1JTDB 2MTAH 4J0XA 4NENA 4UM8A 4XEIC 2WQ8A 4J86A 4AOWA 1S4UX 5JWZA 2H13A 4XYHA 4O2WA 3K26A 4LGNA 4Z7NA 3K27A 3OKYA 4AN1A 4D9SA 3NIDA 2VDLA 2B4EA 4LG9A 2P9UC 3JRPA 4ZN4A 4JSVC 1H2ZA 3NVQA 2IUPA 2VZ3A 4J8BA 2YBAA 3I7LA 2VDNA 3PVWB 4Y5RD 4DNWA 1JOFA 3JPXA 5FLXg 1U8CA 5CXCA 3L4MD 2HU7A 1VZ2A 3I7KA 2B5MA 3MUOA 4IA9A 2P9PC 2H9LA 3MZLA 4MMZA 2IWKA 4H5IA 2IWFA 4AEZA 4GGCA 3OKWA 3PXTD 1U4CA 4QL1A 1O6FA 3SMRA 1E8NA 3EI2B 3JROA 3BG1A 1E8MA 1P22A 2CNXA 4GQ1A 3FCUA 5IJ8E 4L3HD 3ZDZA 3I8CA 2CE8A 3FRXA 4PBYA 1PEVA 4AMYA 4CI1A 3AH8B 2HJBA 3U4YA 3SBRA 2B5NA 3GREA 2H14A 5EMKB 4UI9R 4A2LA 2YB8B 4OZUA 1MG3A 5H14A 2OIZA 5IJ7E 2I0SA 2VDPA 4N14A 4MK0B 2H47A 4A08B 3DDUA 3RMZD 4AX4A 1SQ9A 1R5MA 4RE5A 5CXCB 3V4VA 3SWSD 1OLZA 4X3EA 3ZE0A 2EIEA 3OF7A 1U2VC 4ERZA 3PVUB 3SJLD 5M5TA 4IMMA 4E54A 3V9FA 3O4IA 5K1CC 3IKOA 3ZE2A 2YNOA 3T3PA 1O6GA 3RLMD 4BUJC 3P4FA 2H68A 1TYQC 1QFMA 2AGWA 4G56B 4FHLA 3EI3B 2XDWA 3UKRC 4R7AB 3PSLA 2IUVA 4BL0A 5FXYA 1N6DA 3JZHA 4J81A 3KCIA 4CI2A 2J56H 2G9AA 4O3TB 3NVNA 2XZGA 2HKRA 3EI1A 1H2XA 3SBPA 3IIWA 3OKYB 3VI3A 4BH6A 2Z2OA 3EI4B 1SQJA 2AH0A 4K3JB 1VZ3A 3PE7A 3IJCA 3IUQA 1VYHC 4JSNC 4JHNA 3NVXA 3UVOA 5TEFA 5HE3B 2BKLA 4EWRA 2OK4A 3UKUC 1UTCA 5C9ZB 5HDBA 4ERYA 4QT8A 5FKTA 4MMXA 2XYIA 2G99A 3DWLC 4A0AB 1TBGA 3RFGA 4GGAA 2AQ5A 3IIYA 3FGBA 4CZYA 3EQ7A 2XL3A 4JD2C 4O02A 1L0QA 2AGXA 2H9MA 3I7PA 3ODTA 5C2WB 2YNNA 4YVDA 3ZDYA 3B7FA 5EMLB 1MG2A 3EI4A 4JXMA 4UM9A 1YFQA 3OKTA 2HJ4A 4WK4A 1RI6A 3EU7A 3EWEA 4O1QD 3CFVA 3ZE1A 5KDOB 5GSAA 2P9NC 4GM8A 1VE6A 3OW8A 2PM6B 4J77A 3EI2A 1QNIA 3EI1B 1PBYB 4E54B 3JZGA 4NC4A 3AL9A 3JZNA 4G55A 1NR0A 4FB1D 4PSXB 3NIGA 3EQ9A 3MKQA 3C75H 2EIBA 4PC0A 1B9YA 3PSCB 2O9KA 4BCBA 2PBIB 4D0KA 1JJUB 5TF2A 4CC9A 4NSXA 4WK0A 2OVPB 2XU7A 1JMXB 3VI4A 1QFSA 5FKRA 5I5MA 2VDRA 5M5SA 2Z2PA 5TDHB 3BWSA 5AMSA 1YR2A 2EICA 3PXSD 5I5IA 4U1EI 4L1QD 4CY3A 3N0DA 1GOTB 2QXVA 4PNKB 4E5ZA 3MXXA 4JSXC 3UVKA 4CY2A 5FA5B 1K32A 4CI3A 1OMWB 3IJEA 1MDAH 3J80g 4ERQA 3L4OD 5EARA 4GM3A 5FFGA 3IJ1A 5M5UA 3CIKB 3C99A 2I0TA 5FQDA 3I89A 5IGOA 2PM9B 5E6UA 1FWXA 2I3TA 1TYEA 2AGLA 5M5VA 3QHYB 1C9LA 5E6SA 4GQ2P 4J84A 3NIFA 3K72A 2BBKH 2AGZA 2VDOA 4Z8LA 5EM2B 4ZOVA 5EMMB 1GXRA 5FKSA 3RSEC 2XL2A 3KRWB 4IRZA 2IUQA 2OJYA 3J81g 4FA5D 1N6FA 4NBMA 4A11B 4G1MA 2Z2NA 3V7DB 3O4HA 1L5GA 2P9KC 4JHPC 2AH1A 3I7NA 4FAND 2VZ1A 3V5WB 3ZWLB 4QRJA 5EMJB 4O9DA 4O3UB 5EAMA 2H9NA 4J79A 5CXBB 3VA6A 3OTTA 3FCSA 5HE2B 2QR5A 3I2NA 4OWRA 2EIDA 3SCYA 5HYNB 2OVRB 4CY1A 5M5RA 5HE1B 4A7JA 5GMKn 5IGQA 1GOGA 4J0WA 3GD1I 3GC3B 4QAMA 4GQBB 2P9LC 2CO0C 4FA9D 2GNQA 3IJ0A 2HU5A
chains in the Genus database with same CATH topology
5FKQA 3I7HA 2HKMA 2CN2A 2EBSA 1XHMA 3FM0A 3I7OA 3DM0A 2UZYB 5A2Qg 2P9SC 2AGYA 2GC4A 4HDJA 3OL2B 4CI8A 2I3SA 5EAPA 4GM9A 4QQEA 3SN6B 2PM7B 4ZOXA 4PSWB 2UZXB 5AJAA 3PXWD 5GXHA 4X60B 3CFSB 4A0BB 3C5MA 4PXWA 4GMBA 3F3PA 3SBQA 3JB9L 3VH0A 2Q7QA 3DSMA 4Y7RA 4PBZA 3AL8A 3AL8B 2J55H 5CYKA 5TEEA 2GC7A 3RFHA 2P9IC 4A09A 4A09B 1N6EA 3SXTD 4CY5A 4X63B 3ULEC 2W18A 3ORVD 4JSPC 3DXMC 5H1MA 5SXMA 4ZOZA 2H6QA 4U7AA 2HXCA 4A11A 3KRXB 4L9OA 3SLED 2CN3A 3SHFA 5IT9g 5B4WA 3OL2A 2BCJB 4TZ4A 2YNPA 3MKSB 4A0AA 3E0CA 1PGUA 4CZVA 3N0EA 5K19A 3RN0D 3AFCA 1XKSA 4L3GD 3MMYA 3UVNA 3C9CA 1GG2B 4GGDA 2H6NA 2H9PA 1PI6A 2IURA 2TRCB 4CZXA 4FA1D 5CYKB 1ERJA 3EMHA 5HE0B 3MZKA 2HYEA 4H5JA 1SHYB 4ES0A 2I0RA 3BG0A 4D6VA 4A0BA 3F3GA 3JAMg 3RN1D 5THAA 5H17A 5HQGA 1B9XA 1A0RB 2OK6A 4ZOYA 1XIPA 3W15A 4GZ8A 4J78A 4A08A 4O45A 2YMUA 4KFMB 1JMZB 3SVWD 4I79A 4J73A 2QC5A 4XYIA 2HESX 3UVLA 3VGZA 2OVQB 5AFU3 5CXBA 1NEXB 3F3FA 4J8GA 5EM2A 4J87A 3A0FA 4JT6C 4ESGA 4FA4D 3EG6A 4K3ID 4E5ZB 4J82A 4LG8A 4X61B 5C2VB 4FAVD 2H6KA 3EI3A 3GFCA 3DXKC 2J57G 4JT5C 3HFQA 1Q47A 5IC7A 3RRMC 3UVMA 2H3XA 2PM9A 4A2MA 1K8KC 1GP2B 4FWWA 3UR4A 2CO0A 5I5JA 5EALA 2CE9A 5GXIA 3I8EA 2B5LA 3EI1A 2IAAA 3SFZA 4J0XA 2MTAH 4XEIC 4J86A 4AOWA 1S4UX 5JWZA 2H13A 4XYHA 3K26A 4LGNA 3K27A 3OKYA 2B4EA 4LG9A 2P9UC 3JRPA 4ZN4A 4JSVC 3NVQA 2IUPA 4J8BA 2YBAA 3I7LA 3PVWB 4Y5RD 1JOFA 3JPXA 5FLXg 5CXCA 3L4MD 3I7KA 2B5MA 4IA9A 2P9PC 2H9LA 3MZLA 2IWKA 4H5IA 2IWFA 4AEZA 4GGCA 3OKWA 3PXTD 1U4CA 4QL1A 3SMRA 3EI2B 3JROA 3BG1A 1P22A 2CNXA 4GQ1A 5IJ8E 4L3HD 3I8CA 2CE8A 3FRXA 4PBYA 1PEVA 4CI1A 3AH8B 2HJBA 3U4YA 3SBRA 2B5NA 3GREA 2H14A 5EMKB 4UI9R 4A2LA 2YB8B 4OZUA 1MG3A 5H14A 2OIZA 5IJ7E 2I0SA 4N14A 4MK0B 2H47A 4A08B 3RMZD 1SQ9A 1R5MA 5CXCB 3SWSD 1OLZA 4X3EA 1U2VC 4ERZA 3PVUB 3SJLD 4IMMA 4E54A 3V9FA 5K1CC 3IKOA 2YNOA 3RLMD 4BUJC 3P4FA 2H68A 1TYQC 2AGWA 4G56B 4FHLA 3EI3B 3UKRC 4R7AB 3PSLA 2IUVA 4BL0A 5FXYA 1N6DA 3JZHA 4J81A 4CI2A 2J56H 2G9AA 4O3TB 3NVNA 2HKRA 3SBPA 3IIWA 3OKYB 4BH6A 2Z2OA 3EI4B 1SQJA 2AH0A 4K3JB 3PE7A 3IJCA 1VYHC 4JSNC 3NVXA 3UVOA 5TEFA 5HE3B 4EWRA 2OK4A 3UKUC 5C9ZB 4ERYA 4QT8A 5FKTA 2XYIA 2G99A 3DWLC 1TBGA 3RFGA 4GGAA 2AQ5A 3IIYA 3FGBA 4CZYA 4JD2C 2XL3A 5C2WB 1L0QA 2AGXA 2H9MA 3I7PA 3ODTA 2YNNA 4YVDA 3B7FA 5EMLB 1MG2A 3EI4A 4JXMA 1YFQA 3OKTA 2HJ4A 1RI6A 3EU7A 3EWEA 4O1QD 3CFVA 5KDOB 5GSAA 2P9NC 4GM8A 3OW8A 2PM6B 4J77A 3EI2A 1QNIA 3EI1B 1PBYB 4E54B 3JZGA 3AL9A 3JZNA 1NR0A 4FB1D 4PSXB 3MKQA 3C75H 4PC0A 1B9YA 3PSCB 2O9KA 2PBIB 4D0KA 1JJUB 5TF2A 4CC9A 4NSXA 2OVPB 2XU7A 1JMXB 5FKRA 5I5MA 2Z2PA 5TDHB 3BWSA 5AMSA 3PXSD 5I5IA 4U1EI 4L1QD 4CY3A 3N0DA 1GOTB 2QXVA 4PNKB 4E5ZA 3MXXA 4JSXC 3UVKA 4CY2A 5FA5B 1K32A 4CI3A 1OMWB 1MDAH 3J80g 4ERQA 3L4OD 5EARA 4GM3A 3IJ1A 3CIKB 3C99A 2I0TA 5FQDA 3I89A 5IGOA 2PM9B 1FWXA 2I3TA 2AGLA 4GQ2P 4J84A 2BBKH 2AGZA 5EM2B 4Z8LA 4ZOVA 5EMMB 1GXRA 5FKSA 3RSEC 2XL2A 3KRWB 2IUQA 2OJYA 3J81g 4FA5D 1N6FA 4A11B 2Z2NA 3V7DB 2P9KC 2AH1A 3I7NA 4FAND 3V5WB 3ZWLB 4QRJA 5EMJB 4O9DA 4O3UB 5EAMA 2H9NA 4J79A 5CXBB 3VA6A 3OTTA 5HE2B 3I2NA 4OWRA 3SCYA 5HYNB 2OVRB 4CY1A 5HE1B 4A7JA 5GMKn 5IGQA 4J0WA 4GQBB 2P9LC 2CO0C 4FA9D 2GNQA 3IJ0A 4A0AB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FKQ A;  3I7H A;  2HKM A;  2CN2 A;  2EBS A;  1XHM A;  3FM0 A;  3I7O A;  3DM0 A;  2UZY B;  5A2Q g;  2P9S C;  2AGY A;  2GC4 A;  4HDJ A;  3OL2 B;  4CI8 A;  2I3S A;  5EAP A;  4GM9 A;  4QQE A;  3SN6 B;  2PM7 B;  4ZOX A;  4PSW B;  2UZX B;  5AJA A;  3PXW D;  5GXH A;  4X60 B;  3CFS B;  4A0B B;  3C5M A;  4PXW A;  4GMB A;  3F3P A;  3SBQ A;  3JB9 L;  3VH0 A;  2Q7Q A;  3DSM A;  4Y7R A;  4PBZ A;  3AL8 A;  3AL8 B;  2J55 H;  5CYK A;  5TEE A;  2GC7 A;  3RFH A;  2P9I C;  4A09 A;  4A09 B;  1N6E A;  3SXT D;  4CY5 A;  4X63 B;  3ULE C;  2W18 A;  3ORV D;  4JSP C;  3DXM C;  5H1M A;  5SXM A;  4ZOZ A;  2H6Q A;  4U7A A;  2HXC A;  4A11 A;  3KRX B;  4L9O A;  3SLE D;  2CN3 A;  3SHF A;  5IT9 g;  5B4W A;  3OL2 A;  2BCJ B;  4TZ4 A;  2YNP A;  3MKS B;  4A0A A;  3E0C A;  1PGU A;  4CZV A;  3N0E A;  5K19 A;  3RN0 D;  3AFC A;  1XKS A;  4L3G D;  3MMY A;  3UVN A;  3C9C A;  1GG2 B;  4GGD A;  2H6N A;  2H9P A;  1PI6 A;  2IUR A;  2TRC B;  4CZX A;  4FA1 D;  5CYK B;  1ERJ A;  3EMH A;  5HE0 B;  3MZK A;  2HYE A;  4H5J A;  1SHY B;  4ES0 A;  2I0R A;  3BG0 A;  4D6V A;  4A0B A;  3F3G A;  3JAM g;  3RN1 D;  5THA A;  5H17 A;  5HQG A;  1B9X A;  1A0R B;  2OK6 A;  4ZOY A;  1XIP A;  3W15 A;  4GZ8 A;  4J78 A;  4A08 A;  4O45 A;  2YMU A;  4KFM B;  1JMZ B;  3SVW D;  4I79 A;  4J73 A;  2QC5 A;  4XYI A;  2HES X;  3UVL A;  3VGZ A;  2OVQ B;  5AFU 3;  5CXB A;  1NEX B;  3F3F A;  4J8G A;  5EM2 A;  4J87 A;  3A0F A;  4JT6 C;  4ESG A;  4FA4 D;  3EG6 A;  4K3I D;  4E5Z B;  4J82 A;  4LG8 A;  4X61 B;  5C2V B;  4FAV D;  2H6K A;  3EI3 A;  3GFC A;  3DXK C;  2J57 G;  4JT5 C;  3HFQ A;  1Q47 A;  5IC7 A;  3RRM C;  3UVM A;  2H3X A;  2PM9 A;  4A2M A;  1K8K C;  1GP2 B;  4FWW A;  3UR4 A;  2CO0 A;  5I5J A;  5EAL A;  2CE9 A;  5GXI A;  3I8E A;  2B5L A;  3EI1 A;  2IAA A;  3SFZ A;  4J0X A;  2MTA H;  4XEI C;  4J86 A;  4AOW A;  1S4U X;  5JWZ A;  2H13 A;  4XYH A;  3K26 A;  4LGN A;  3K27 A;  3OKY A;  2B4E A;  4LG9 A;  2P9U C;  3JRP A;  4ZN4 A;  4JSV C;  3NVQ A;  2IUP A;  4J8B A;  2YBA A;  3I7L A;  3PVW B;  4Y5R D;  1JOF A;  3JPX A;  5FLX g;  5CXC A;  3L4M D;  3I7K A;  2B5M A;  4IA9 A;  2P9P C;  2H9L A;  3MZL A;  2IWK A;  4H5I A;  2IWF A;  4AEZ A;  4GGC A;  3OKW A;  3PXT D;  1U4C A;  4QL1 A;  3SMR A;  3EI2 B;  3JRO A;  3BG1 A;  1P22 A;  2CNX A;  4GQ1 A;  5IJ8 E;  4L3H D;  3I8C A;  2CE8 A;  3FRX A;  4PBY A;  1PEV A;  4CI1 A;  3AH8 B;  2HJB A;  3U4Y A;  3SBR A;  2B5N A;  3GRE A;  2H14 A;  5EMK B;  4UI9 R;  4A2L A;  2YB8 B;  4OZU A;  1MG3 A;  5H14 A;  2OIZ A;  5IJ7 E;  2I0S A;  4N14 A;  4MK0 B;  2H47 A;  4A08 B;  3RMZ D;  1SQ9 A;  1R5M A;  5CXC B;  3SWS D;  1OLZ A;  4X3E A;  1U2V C;  4ERZ A;  3PVU B;  3SJL D;  4IMM A;  4E54 A;  3V9F A;  5K1C C;  3IKO A;  2YNO A;  3RLM D;  4BUJ C;  3P4F A;  2H68 A;  1TYQ C;  2AGW A;  4G56 B;  4FHL A;  3EI3 B;  3UKR C;  4R7A B;  3PSL A;  2IUV A;  4BL0 A;  5FXY A;  1N6D A;  3JZH A;  4J81 A;  4CI2 A;  2J56 H;  2G9A A;  4O3T B;  3NVN A;  2HKR A;  3SBP A;  3IIW A;  3OKY B;  4BH6 A;  2Z2O A;  3EI4 B;  1SQJ A;  2AH0 A;  4K3J B;  3PE7 A;  3IJC A;  1VYH C;  4JSN C;  3NVX A;  3UVO A;  5TEF A;  5HE3 B;  4EWR A;  2OK4 A;  3UKU C;  5C9Z B;  4ERY A;  4QT8 A;  5FKT A;  2XYI A;  2G99 A;  3DWL C;  1TBG A;  3RFG A;  4GGA A;  2AQ5 A;  3IIY A;  3FGB A;  4CZY A;  4JD2 C;  2XL3 A;  5C2W B;  1L0Q A;  2AGX A;  2H9M A;  3I7P A;  3ODT A;  2YNN A;  4YVD A;  3B7F A;  5EML B;  1MG2 A;  3EI4 A;  4JXM A;  1YFQ A;  3OKT A;  2HJ4 A;  1RI6 A;  3EU7 A;  3EWE A;  4O1Q D;  3CFV A;  5KDO B;  5GSA A;  2P9N C;  4GM8 A;  3OW8 A;  2PM6 B;  4J77 A;  3EI2 A;  1QNI A;  3EI1 B;  1PBY B;  4E54 B;  3JZG A;  3AL9 A;  3JZN A;  1NR0 A;  4FB1 D;  4PSX B;  3MKQ A;  3C75 H;  4PC0 A;  1B9Y A;  3PSC B;  2O9K A;  2PBI B;  4D0K A;  1JJU B;  5TF2 A;  4CC9 A;  4NSX A;  2OVP B;  2XU7 A;  1JMX B;  5FKR A;  5I5M A;  2Z2P A;  5TDH B;  3BWS A;  5AMS A;  3PXS D;  5I5I A;  4U1E I;  4L1Q D;  4CY3 A;  3N0D A;  1GOT B;  2QXV A;  4PNK B;  4E5Z A;  3MXX A;  4JSX C;  3UVK A;  4CY2 A;  5FA5 B;  1K32 A;  4CI3 A;  1OMW B;  1MDA H;  3J80 g;  4ERQ A;  3L4O D;  5EAR A;  4GM3 A;  3IJ1 A;  3CIK B;  3C99 A;  2I0T A;  5FQD A;  3I89 A;  5IGO A;  2PM9 B;  1FWX A;  2I3T A;  2AGL A;  4GQ2 P;  4J84 A;  2BBK H;  2AGZ A;  5EM2 B;  4Z8L A;  4ZOV A;  5EMM B;  1GXR A;  5FKS A;  3RSE C;  2XL2 A;  3KRW B;  2IUQ A;  2OJY A;  3J81 g;  4FA5 D;  1N6F A;  4A11 B;  2Z2N A;  3V7D B;  2P9K C;  2AH1 A;  3I7N A;  4FAN D;  3V5W B;  3ZWL B;  4QRJ A;  5EMJ B;  4O9D A;  4O3U B;  5EAM A;  2H9N A;  4J79 A;  5CXB B;  3VA6 A;  3OTT A;  5HE2 B;  3I2N A;  4OWR A;  3SCY A;  5HYN B;  2OVR B;  4CY1 A;  5HE1 B;  4A7J A;  5GMK n;  5IGQ A;  4J0W A;  4GQB B;  2P9L C;  2CO0 C;  4FA9 D;  2GNQ A;  3IJ0 A;  4A0A B; 
#chains in the Genus database with same CATH topology
 5FKQ A;  3T3M A;  4BCD A;  3I7H A;  2HKM A;  2CN2 A;  2VDK A;  3K6S A;  2EBS A;  1XHM A;  2QZP A;  3FM0 A;  3I7O A;  3DM0 A;  1A12 A;  2UZY B;  4AN0 A;  5A2Q g;  2P9S C;  3IUR A;  2AGY A;  2GC4 A;  4HDJ A;  3OL2 B;  4CI8 A;  2I3S A;  5EAP A;  4GM9 A;  4QQE A;  3SN6 B;  3V4P A;  1GOH A;  2PM7 B;  4ZOX A;  5M61 A;  2VDM A;  4PSW B;  4BCC A;  2UZX B;  5AJA A;  3PXW D;  5GXH A;  4X60 B;  4DNU A;  3CFS B;  4A0B B;  3C5M A;  4PXW A;  4GMB A;  1E5T A;  3F3P A;  3SBQ A;  4BP8 A;  3JB9 L;  3VH0 A;  3IUL A;  3IUM A;  2Q7Q A;  3DSM A;  4Y7R A;  4L1M A;  4PBZ A;  3AL8 A;  3AL8 B;  2J55 H;  5CYK A;  5TEE A;  3O4J A;  2GC7 A;  3RFH A;  1VE7 A;  2P9I C;  4A09 A;  4A09 B;  1N6E A;  2XE4 A;  3SXT D;  4CY5 A;  4X63 B;  2VDQ A;  3ULE C;  3MVD K;  2W18 A;  1H2Y A;  3ORV D;  4JSP C;  3DXM C;  5C86 A;  5H1M A;  4DNV A;  5SXM A;  4ZOZ A;  1K3I A;  2H6Q A;  4U7A A;  3K71 A;  2JKX A;  5C92 A;  2HXC A;  4A11 A;  3KRX B;  4L9O A;  3SLE D;  2CN3 A;  3SHF A;  5IT9 g;  5B4W A;  3OL2 A;  4G1E A;  2BCJ B;  3IUN A;  4TZ4 A;  2YNP A;  3MKS B;  1UOO A;  4A0A A;  1GOF A;  3E0C A;  1PGU A;  4RE6 A;  4CZV A;  3N0E A;  5K19 A;  3RN0 D;  3AFC A;  1XKS A;  4L3G D;  4MMY A;  3MMY A;  3UVN A;  3C9C A;  1GG2 B;  1BPO A;  4GGD A;  2H6N A;  2H9P A;  1PI6 A;  3IVM A;  2IUR A;  2TRC B;  4CZX A;  1I2M B;  4FA1 D;  5CYK B;  4WK2 A;  1ERJ A;  3EMH A;  5HE0 B;  3MZK A;  2HYE A;  4H5J A;  1SHY B;  4ES0 A;  2I0R A;  3BG0 A;  4D6V A;  4A0B A;  3F3G A;  4AMZ A;  3JAM g;  1T2X A;  5THA A;  5H17 A;  3RN1 D;  5HQG A;  1B9X A;  1A0R B;  5E6R A;  2OK6 A;  4ZOY A;  1XIP A;  2HU8 A;  3W15 A;  2VC2 A;  1M1X A;  4GZ8 A;  4J78 A;  4A08 A;  4O45 A;  2YMU A;  4KFM B;  5FFO A;  1JMZ B;  3O4G A;  1C9I A;  3SVW D;  4I79 A;  4Z7Q A;  4Z7O A;  4J73 A;  2QC5 A;  4XYI A;  2HES X;  3UVL A;  3VGZ A;  2OVQ B;  3IUJ A;  5AFU 3;  1NEX B;  3F3F A;  4J8G A;  5CXB A;  1JV2 A;  4J87 A;  1H2W A;  3A0F A;  4JT6 C;  1UOQ A;  5EM2 A;  4ESG A;  4FA4 D;  3EG6 A;  4K3I D;  4BP9 A;  4J82 A;  4E5Z B;  4LG8 A;  4X61 B;  3ZDX A;  5C2V B;  4NAA A;  4FAV D;  2H6K A;  3EI3 A;  3GFC A;  3DXK C;  2J57 G;  4JT5 C;  3HFQ A;  1Q47 A;  5IC7 A;  3RRM C;  3UVM A;  2H3X A;  2PM9 A;  4A2M A;  1K8K C;  1GP2 B;  4FWW A;  3UR4 A;  2CO0 A;  5I5J A;  5EAL A;  2CE9 A;  3QI0 A;  3MUN A;  5GXI A;  3I8E A;  2B5L A;  1UOP A;  2IAA A;  3EQ8 A;  4WJK A;  3SFZ A;  1JTD B;  2MTA H;  4J0X A;  4NEN A;  4UM8 A;  4XEI C;  2WQ8 A;  4J86 A;  4AOW A;  1S4U X;  5JWZ A;  2H13 A;  4XYH A;  4O2W A;  3K26 A;  4LGN A;  4Z7N A;  3K27 A;  3OKY A;  4AN1 A;  4D9S A;  3NID A;  2VDL A;  2B4E A;  4LG9 A;  2P9U C;  3JRP A;  4ZN4 A;  4JSV C;  1H2Z A;  3NVQ A;  2IUP A;  2VZ3 A;  4J8B A;  2YBA A;  3I7L A;  2VDN A;  3PVW B;  4Y5R D;  4DNW A;  1JOF A;  3JPX A;  5FLX g;  1U8C A;  5CXC A;  3L4M D;  2HU7 A;  1VZ2 A;  3I7K A;  2B5M A;  3MUO A;  4IA9 A;  2P9P C;  2H9L A;  3MZL A;  4MMZ A;  2IWK A;  4H5I A;  2IWF A;  4AEZ A;  4GGC A;  3OKW A;  3PXT D;  1U4C A;  4QL1 A;  1O6F A;  3SMR A;  1E8N A;  3EI2 B;  3JRO A;  3BG1 A;  1E8M A;  1P22 A;  2CNX A;  4GQ1 A;  3FCU A;  5IJ8 E;  4L3H D;  3ZDZ A;  3I8C A;  2CE8 A;  3FRX A;  4PBY A;  1PEV A;  4AMY A;  4CI1 A;  3AH8 B;  2HJB A;  3U4Y A;  3SBR A;  2B5N A;  3GRE A;  2H14 A;  5EMK B;  4UI9 R;  4A2L A;  2YB8 B;  4OZU A;  1MG3 A;  5H14 A;  2OIZ A;  5IJ7 E;  2I0S A;  2VDP A;  4N14 A;  4MK0 B;  2H47 A;  4A08 B;  3DDU A;  3RMZ D;  4AX4 A;  1SQ9 A;  1R5M A;  4RE5 A;  5CXC B;  3V4V A;  3SWS D;  1OLZ A;  4X3E A;  3ZE0 A;  2EIE A;  3OF7 A;  1U2V C;  4ERZ A;  3PVU B;  3SJL D;  5M5T A;  4IMM A;  4E54 A;  3V9F A;  3O4I A;  5K1C C;  3IKO A;  3ZE2 A;  2YNO A;  3T3P A;  1O6G A;  3RLM D;  4BUJ C;  3P4F A;  2H68 A;  1TYQ C;  1QFM A;  2AGW A;  4G56 B;  4FHL A;  3EI3 B;  2XDW A;  3UKR C;  4R7A B;  3PSL A;  2IUV A;  4BL0 A;  5FXY A;  1N6D A;  3JZH A;  4J81 A;  3KCI A;  4CI2 A;  2J56 H;  2G9A A;  4O3T B;  3NVN A;  2XZG A;  2HKR A;  3EI1 A;  1H2X A;  3SBP A;  3IIW A;  3OKY B;  3VI3 A;  4BH6 A;  2Z2O A;  3EI4 B;  1SQJ A;  2AH0 A;  4K3J B;  1VZ3 A;  3PE7 A;  3IJC A;  3IUQ A;  1VYH C;  4JSN C;  4JHN A;  3NVX A;  3UVO A;  5TEF A;  5HE3 B;  2BKL A;  4EWR A;  2OK4 A;  3UKU C;  1UTC A;  5C9Z B;  5HDB A;  4ERY A;  4QT8 A;  5FKT A;  4MMX A;  2XYI A;  2G99 A;  3DWL C;  4A0A B;  1TBG A;  3RFG A;  4GGA A;  2AQ5 A;  3IIY A;  3FGB A;  4CZY A;  3EQ7 A;  2XL3 A;  4JD2 C;  4O02 A;  1L0Q A;  2AGX A;  2H9M A;  3I7P A;  3ODT A;  5C2W B;  2YNN A;  4YVD A;  3ZDY A;  3B7F A;  5EML B;  1MG2 A;  3EI4 A;  4JXM A;  4UM9 A;  1YFQ A;  3OKT A;  2HJ4 A;  4WK4 A;  1RI6 A;  3EU7 A;  3EWE A;  4O1Q D;  3CFV A;  3ZE1 A;  5KDO B;  5GSA A;  2P9N C;  4GM8 A;  1VE6 A;  3OW8 A;  2PM6 B;  4J77 A;  3EI2 A;  1QNI A;  3EI1 B;  1PBY B;  4E54 B;  3JZG A;  4NC4 A;  3AL9 A;  3JZN A;  4G55 A;  1NR0 A;  4FB1 D;  4PSX B;  3NIG A;  3EQ9 A;  3MKQ A;  3C75 H;  2EIB A;  4PC0 A;  1B9Y A;  3PSC B;  2O9K A;  4BCB A;  2PBI B;  4D0K A;  1JJU B;  5TF2 A;  4CC9 A;  4NSX A;  4WK0 A;  2OVP B;  2XU7 A;  1JMX B;  3VI4 A;  1QFS A;  5FKR A;  5I5M A;  2VDR A;  5M5S A;  2Z2P A;  5TDH B;  3BWS A;  5AMS A;  1YR2 A;  2EIC A;  3PXS D;  5I5I A;  4U1E I;  4L1Q D;  4CY3 A;  3N0D A;  1GOT B;  2QXV A;  4PNK B;  4E5Z A;  3MXX A;  4JSX C;  3UVK A;  4CY2 A;  5FA5 B;  1K32 A;  4CI3 A;  1OMW B;  3IJE A;  1MDA H;  3J80 g;  4ERQ A;  3L4O D;  5EAR A;  4GM3 A;  5FFG A;  3IJ1 A;  5M5U A;  3CIK B;  3C99 A;  2I0T A;  5FQD A;  3I89 A;  5IGO A;  2PM9 B;  5E6U A;  1FWX A;  2I3T A;  1TYE A;  2AGL A;  5M5V A;  3QHY B;  1C9L A;  5E6S A;  4GQ2 P;  4J84 A;  3NIF A;  3K72 A;  2BBK H;  2AGZ A;  2VDO A;  4Z8L A;  5EM2 B;  4ZOV A;  5EMM B;  1GXR A;  5FKS A;  3RSE C;  2XL2 A;  3KRW B;  4IRZ A;  2IUQ A;  2OJY A;  3J81 g;  4FA5 D;  1N6F A;  4NBM A;  4A11 B;  4G1M A;  2Z2N A;  3V7D B;  3O4H A;  1L5G A;  2P9K C;  4JHP C;  2AH1 A;  3I7N A;  4FAN D;  2VZ1 A;  3V5W B;  3ZWL B;  4QRJ A;  5EMJ B;  4O9D A;  4O3U B;  5EAM A;  2H9N A;  4J79 A;  5CXB B;  3VA6 A;  3OTT A;  3FCS A;  5HE2 B;  2QR5 A;  3I2N A;  4OWR A;  2EID A;  3SCY A;  5HYN B;  2OVR B;  4CY1 A;  5M5R A;  5HE1 B;  4A7J A;  5GMK n;  5IGQ A;  1GOG A;  4J0W A;  3GD1 I;  3GC3 B;  4QAM A;  4GQB B;  2P9L C;  2CO0 C;  4FA9 D;  2GNQ A;  3IJ0 A;  2HU5 A; 
#chains in the Genus database with same CATH homology
 5FKQ A;  3I7H A;  2HKM A;  2CN2 A;  2EBS A;  1XHM A;  3FM0 A;  3I7O A;  3DM0 A;  2UZY B;  5A2Q g;  2P9S C;  2AGY A;  2GC4 A;  4HDJ A;  3OL2 B;  4CI8 A;  2I3S A;  5EAP A;  4GM9 A;  4QQE A;  3SN6 B;  2PM7 B;  4ZOX A;  4PSW B;  2UZX B;  5AJA A;  3PXW D;  5GXH A;  4X60 B;  3CFS B;  4A0B B;  3C5M A;  4PXW A;  4GMB A;  3F3P A;  3SBQ A;  3JB9 L;  3VH0 A;  2Q7Q A;  3DSM A;  4Y7R A;  4PBZ A;  3AL8 A;  3AL8 B;  2J55 H;  5CYK A;  5TEE A;  2GC7 A;  3RFH A;  2P9I C;  4A09 A;  4A09 B;  1N6E A;  3SXT D;  4CY5 A;  4X63 B;  3ULE C;  2W18 A;  3ORV D;  4JSP C;  3DXM C;  5H1M A;  5SXM A;  4ZOZ A;  2H6Q A;  4U7A A;  2HXC A;  4A11 A;  3KRX B;  4L9O A;  3SLE D;  2CN3 A;  3SHF A;  5IT9 g;  5B4W A;  3OL2 A;  2BCJ B;  4TZ4 A;  2YNP A;  3MKS B;  4A0A A;  3E0C A;  1PGU A;  4CZV A;  3N0E A;  5K19 A;  3RN0 D;  3AFC A;  1XKS A;  4L3G D;  3MMY A;  3UVN A;  3C9C A;  1GG2 B;  4GGD A;  2H6N A;  2H9P A;  1PI6 A;  2IUR A;  2TRC B;  4CZX A;  4FA1 D;  5CYK B;  1ERJ A;  3EMH A;  5HE0 B;  3MZK A;  2HYE A;  4H5J A;  1SHY B;  4ES0 A;  2I0R A;  3BG0 A;  4D6V A;  4A0B A;  3F3G A;  3JAM g;  3RN1 D;  5THA A;  5H17 A;  5HQG A;  1B9X A;  1A0R B;  2OK6 A;  4ZOY A;  1XIP A;  3W15 A;  4GZ8 A;  4J78 A;  4A08 A;  4O45 A;  2YMU A;  4KFM B;  1JMZ B;  3SVW D;  4I79 A;  4J73 A;  2QC5 A;  4XYI A;  2HES X;  3UVL A;  3VGZ A;  2OVQ B;  5AFU 3;  5CXB A;  1NEX B;  3F3F A;  4J8G A;  5EM2 A;  4J87 A;  3A0F A;  4JT6 C;  4ESG A;  4FA4 D;  3EG6 A;  4K3I D;  4E5Z B;  4J82 A;  4LG8 A;  4X61 B;  5C2V B;  4FAV D;  2H6K A;  3EI3 A;  3GFC A;  3DXK C;  2J57 G;  4JT5 C;  3HFQ A;  1Q47 A;  5IC7 A;  3RRM C;  3UVM A;  2H3X A;  2PM9 A;  4A2M A;  1K8K C;  1GP2 B;  4FWW A;  3UR4 A;  2CO0 A;  5I5J A;  5EAL A;  2CE9 A;  5GXI A;  3I8E A;  2B5L A;  3EI1 A;  2IAA A;  3SFZ A;  4J0X A;  2MTA H;  4XEI C;  4J86 A;  4AOW A;  1S4U X;  5JWZ A;  2H13 A;  4XYH A;  3K26 A;  4LGN A;  3K27 A;  3OKY A;  2B4E A;  4LG9 A;  2P9U C;  3JRP A;  4ZN4 A;  4JSV C;  3NVQ A;  2IUP A;  4J8B A;  2YBA A;  3I7L A;  3PVW B;  4Y5R D;  1JOF A;  3JPX A;  5FLX g;  5CXC A;  3L4M D;  3I7K A;  2B5M A;  4IA9 A;  2P9P C;  2H9L A;  3MZL A;  2IWK A;  4H5I A;  2IWF A;  4AEZ A;  4GGC A;  3OKW A;  3PXT D;  1U4C A;  4QL1 A;  3SMR A;  3EI2 B;  3JRO A;  3BG1 A;  1P22 A;  2CNX A;  4GQ1 A;  5IJ8 E;  4L3H D;  3I8C A;  2CE8 A;  3FRX A;  4PBY A;  1PEV A;  4CI1 A;  3AH8 B;  2HJB A;  3U4Y A;  3SBR A;  2B5N A;  3GRE A;  2H14 A;  5EMK B;  4UI9 R;  4A2L A;  2YB8 B;  4OZU A;  1MG3 A;  5H14 A;  2OIZ A;  5IJ7 E;  2I0S A;  4N14 A;  4MK0 B;  2H47 A;  4A08 B;  3RMZ D;  1SQ9 A;  1R5M A;  5CXC B;  3SWS D;  1OLZ A;  4X3E A;  1U2V C;  4ERZ A;  3PVU B;  3SJL D;  4IMM A;  4E54 A;  3V9F A;  5K1C C;  3IKO A;  2YNO A;  3RLM D;  4BUJ C;  3P4F A;  2H68 A;  1TYQ C;  2AGW A;  4G56 B;  4FHL A;  3EI3 B;  3UKR C;  4R7A B;  3PSL A;  2IUV A;  4BL0 A;  5FXY A;  1N6D A;  3JZH A;  4J81 A;  4CI2 A;  2J56 H;  2G9A A;  4O3T B;  3NVN A;  2HKR A;  3SBP A;  3IIW A;  3OKY B;  4BH6 A;  2Z2O A;  3EI4 B;  1SQJ A;  2AH0 A;  4K3J B;  3PE7 A;  3IJC A;  1VYH C;  4JSN C;  3NVX A;  3UVO A;  5TEF A;  5HE3 B;  4EWR A;  2OK4 A;  3UKU C;  5C9Z B;  4ERY A;  4QT8 A;  5FKT A;  2XYI A;  2G99 A;  3DWL C;  1TBG A;  3RFG A;  4GGA A;  2AQ5 A;  3IIY A;  3FGB A;  4CZY A;  4JD2 C;  2XL3 A;  5C2W B;  1L0Q A;  2AGX A;  2H9M A;  3I7P A;  3ODT A;  2YNN A;  4YVD A;  3B7F A;  5EML B;  1MG2 A;  3EI4 A;  4JXM A;  1YFQ A;  3OKT A;  2HJ4 A;  1RI6 A;  3EU7 A;  3EWE A;  4O1Q D;  3CFV A;  5KDO B;  5GSA A;  2P9N C;  4GM8 A;  3OW8 A;  2PM6 B;  4J77 A;  3EI2 A;  1QNI A;  3EI1 B;  1PBY B;  4E54 B;  3JZG A;  3AL9 A;  3JZN A;  1NR0 A;  4FB1 D;  4PSX B;  3MKQ A;  3C75 H;  4PC0 A;  1B9Y A;  3PSC B;  2O9K A;  2PBI B;  4D0K A;  1JJU B;  5TF2 A;  4CC9 A;  4NSX A;  2OVP B;  2XU7 A;  1JMX B;  5FKR A;  5I5M A;  2Z2P A;  5TDH B;  3BWS A;  5AMS A;  3PXS D;  5I5I A;  4U1E I;  4L1Q D;  4CY3 A;  3N0D A;  1GOT B;  2QXV A;  4PNK B;  4E5Z A;  3MXX A;  4JSX C;  3UVK A;  4CY2 A;  5FA5 B;  1K32 A;  4CI3 A;  1OMW B;  1MDA H;  3J80 g;  4ERQ A;  3L4O D;  5EAR A;  4GM3 A;  3IJ1 A;  3CIK B;  3C99 A;  2I0T A;  5FQD A;  3I89 A;  5IGO A;  2PM9 B;  1FWX A;  2I3T A;  2AGL A;  4GQ2 P;  4J84 A;  2BBK H;  2AGZ A;  5EM2 B;  4Z8L A;  4ZOV A;  5EMM B;  1GXR A;  5FKS A;  3RSE C;  2XL2 A;  3KRW B;  2IUQ A;  2OJY A;  3J81 g;  4FA5 D;  1N6F A;  4A11 B;  2Z2N A;  3V7D B;  2P9K C;  2AH1 A;  3I7N A;  4FAN D;  3V5W B;  3ZWL B;  4QRJ A;  5EMJ B;  4O9D A;  4O3U B;  5EAM A;  2H9N A;  4J79 A;  5CXB B;  3VA6 A;  3OTT A;  5HE2 B;  3I2N A;  4OWR A;  3SCY A;  5HYN B;  2OVR B;  4CY1 A;  5HE1 B;  4A7J A;  5GMK n;  5IGQ A;  4J0W A;  4GQB B;  2P9L C;  2CO0 C;  4FA9 D;  2GNQ A;  3IJ0 A;  4A0A B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...