1ERJA

Crystal structure of the c-terminal wd40 domain of tup1
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
388
structure length
350
Chain Sequence
HYLVPYNQRANHSKPIPPFLLDLDSQSVPDALKKQTNDYYILYNPALPREIDVELHKSLDHTSVVCCVKFSNDGEYLATGCNKTTQVYRVSDGSLVARLSDSSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNPLLMLQGHRNSVISVAVANGSSLGPEYNVFATGSGDCKARIWKYKKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRANSCRIPTIONAL REPRESSOR TUP1
publication title Structure of the C-terminal domain of Tup1, a corepressor of transcription in yeast.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription inhibitor
total genus 106
structure length 350
sequence length 388
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2000-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 1erjA00
2YMUA 4CC9A 2IURA 3JZHA 2H3XA 3F3FA 3VH0A 4A09B 3C9CA 4CY2A 4O3UB 4CI3A 2P9KC 4A0BA 3CFSB 3DSMA 2AGZA 4CI2A 4A2MA 4A08B 2G9AA 1VYHC 5EARA 4J8GA 3RSEC 5FKTA 3KRXB 1OLZA 2PM9B 4D0KA 4G56B 1SHYB 4A0AB 4FHLA 3EI2B 4BH6A 3B7FA 3RRMC 3OW8A 4U7AA 2H47A 3MKQA 4NSXA 3DXMC 3JROA 3ODTA 1JMZB 2H68A 3A0FA 5HYNB 3NVNA 3JPXA 5FKRA 5GXHA 2H6QA 3EI1A 2AGYA 5EM2A 4J82A 3SBRA 2IWFA 4CZYA 4O1QD 5FLXg 5HE3B 3MZKA 3N0DA 3OL2B 4GGDA 3C5MA 5EAPA 4ZOXA 4R7AB 2B5NA 1ERJA 2Z2PA 2PM6B 5EMLB 2Z2NA 4U1EI 4JXMA 3N0EA 3K26A 2OK6A 4L3HD 2GC4A 2Z2OA 5I5JA 5SXMA 3UVMA 4GMBA 2XU7A 4CI8A 3DM0A 4LG9A 1MDAH 3BWSA 2H13A 3IIYA 1TBGA 5IJ7E 1YFQA 2J55H 4D6VA 4FA4D 5THAA 2Q7QA 2YB8B 4J77A 4X63B 5TDHB 1PBYB 2HJ4A 3UVLA 3V9FA 4CY3A 4O9DA 2W18A 1A0RB 4E54B 2P9UC 3DXKC 2GC7A 3OKWA 2OVPB 3P4FA 4K3JB 3IJCA 4H5JA 3OKYA 5EAMA 2B5MA 4QT8A 5HE2B 5TEFA 3RMZD 1XIPA 2TRCB 3V5WB 2H6NA 5K19A 1QNIA 4GQ1A 4CZXA 3PXSD 5I5MA 3J80g 3IJ1A 4CZVA 5C9ZB 3I2NA 4XEIC 2B5LA 4IA9A 5IGOA 3BG0A 1XKSA 2UZXB 3CFVA 1L0QA 5H1MA 5GSAA 1NEXB 2H6KA 3I7KA 3NVQA 2GNQA 2PM7B 3RFGA 4FA9D 3PE7A 4A2LA 3EI3B 3PSCB 4A09A 4FA1D 4AEZA 5CXBB 3PVWB 3NVXA 4UI9R 5FKQA 4ERQA 5IT9g 3EI4B 1FWXA 2I3TA 2XL3A 3PSLA 4E5ZB 3AFCA 3FRXA 3J81g 2HKRA 5EMMB 4A08A 4A0BB 4PSWB 5FXYA 3FM0A 4FAVD 2YNNA 2IWKA 2H9NA 3V7DB 3BG1A 3I8CA 2I0TA 4KFMB 2CE8A 5FKSA 3GFCA 3UVNA 3CIKB 3EI2A 4A0AA 1GOTB 2J56H 3SFZA 5EMKB 3I7PA 4GM9A 5CXCA 3AL8A 2XYIA 3EU7A 1S4UX 2BCJB 3UR4A 4J84A 2OK4A 1RI6A 2HJBA 4GM3A 4OZUA 2HKMA 1XHMA 3IKOA 1GG2B 4CY1A 3RN0D 2H14A 3OL2A 1SQJA 4GM8A 5CYKA 2G99A 5KDOB 3I7HA 2QXVA 4A11B 1N6EA 4JSNC 3EMHA 2HYEA 1NR0A 3UKUC 1B9YA 5HQGA 2IAAA 3KRWB 4PXWA 3JAMg 4JT5C 2CO0C 2H9MA 1P22A 4ERZA 2AH1A 2H9PA 3RFHA 4TZ4A 1K32A 2P9SC 3OKTA 3K27A 3MXXA 4O3TB 3SBQA 4GQBB 5B4WA 4J0WA 3UVKA 1Q47A 1N6FA 5AFU3 5IGQA 2EBSA 2MTAH 1PEVA 4FWWA 4HDJA 4QRJA 2HESX 4BUJC 2AGWA 3VA6A 3UVOA 2J57G 5C2WB 5I5IA 2QC5A 1U2VC 2P9PC 4AOWA 3JRPA 4CI1A 2CO0A 2YNOA 3RLMD 3SHFA 5GXIA 4ZOZA 4J79A 4PBYA 4X3EA 3VGZA 1JOFA 1GXRA 3SVWD 2IUQA 4J87A 3EWEA 5EMJB 1N6DA 4H5IA 3L4OD 2I3SA 5K1CC 4IMMA 2O9KA 4JSVC 5FQDA 4X61B 3SWSD 3I89A 1JMXB 5TF2A 3JZNA 4PNKB 2AGLA 3FGBA 3I7NA 4ERYA 4N14A 1R5MA 1PI6A 4GZ8A 4BL0A 3ULEC 3EI3A 4ZOVA 3I7OA 4PC0A 5H17A 5CXBA 4O45A 5A2Qg 3EI4A 2HXCA 4E5ZA 2PM9A 2CN2A 2I0RA 3SXTD 3PXWD 3EG6A 1U4CA 4J78A 4J86A 4QQEA 4QL1A 3RN1D 4ESGA 4JT6C 2YNPA 2IUVA 4I79A 2XL2A 1PGUA 1K8KC 2P9LC 5C2VB 2CN3A 3EI1B 5FA5B 5CXCB 3AL8B 5EM2B 3U4YA 4FAND 3MKSB 4MK0B 4PBZA 3AL9A 2P9NC 4XYHA 5HE0B 3UKRC 4Y5RD 4L1QD 5GMKn 4L3GD 4L9OA 4A11A 5CYKB 1JJUB 4FB1D 3SN6B 4FA5D 3MMYA 3PXTD 4GQ2P 2I0SA 2H9LA 4J8BA 3IJ0A 3F3PA 1TYQC 2BBKH 5HE1B 3AH8B 2AH0A 3W15A 2AGXA 3HFQA 5H14A 4GGCA 3ORVD 4ZN4A 3C99A 3JZGA 4ES0A 5EALA 4YVDA 2OJYA 4J73A 4OWRA 4PSXB 3L4MD 2OVQB 4XYIA 4JSXC 4LG8A 3SJLD 3GREA 3JB9L 2P9IC 1SQ9A 3I8EA 2OVRB 3OTTA 1MG3A 3SLED 4K3ID 4Y7RA 4E54A 4LGNA 4A7JA 3E0CA 4CY5A 5IC7A 1B9XA 2CE9A 4X60B 3SCYA 4ZOYA 3I7LA 2OIZA 1OMWB 5IJ8E 4JD2C 2B4EA 3OKYB 1MG2A 3SMRA 5AJAA 2UZYB 4EWRA 2CNXA 4GGAA 1GP2B 4J81A 3C75H 5TEEA 4Z8LA 3ZWLB 3IIWA 4JSPC 2IUPA 2YBAA 3PVUB 3F3GA 3MZLA 4J0XA 3SBPA 5JWZA 2AQ5A 5AMSA 2PBIB 3DWLC
chains in the Genus database with same CATH superfamily
2YMUA 3K6SA 4CC9A 2EICA 2IURA 4D9SA 3T3MA 2VDOA 3JZHA 2H3XA 3IUJA 3F3FA 3VH0A 4A09B 3C9CA 4CY2A 4O3UB 4MMZA 1M1XA 4CI3A 4BCDA 2P9KC 4A0BA 1UOPA 3CFSB 3DSMA 3NIGA 2AGZA 4CI2A 4A2MA 4A08B 2G9AA 1VYHC 3IVMA 5EARA 4J8GA 1E8NA 3RSEC 1O6GA 5FKTA 3KRXB 1OLZA 2PM9B 3ZDXA 4D0KA 4G56B 1SHYB 4G1EA 4AN1A 3ZE1A 4A0AB 4FHLA 3EI2B 4BH6A 3B7FA 3RRMC 3OW8A 4U7AA 2H47A 3MKQA 4NSXA 3DXMC 3JROA 3ODTA 1JMZB 2H68A 3A0FA 3OF7A 5HYNB 3NVNA 3JPXA 5FKRA 5GXHA 2H6QA 3EI1A 2AGYA 4JHNA 5EM2A 4J82A 3MVDK 3SBRA 2IWFA 4CZYA 4O1QD 5FLXg 5HE3B 3MZKA 3N0DA 3OL2B 4GGDA 1E8MA 3C5MA 5EAPA 4ZOXA 4R7AB 2B5NA 1ERJA 2HU5A 2Z2PA 1K3IA 2PM6B 3DDUA 5EMLB 2Z2NA 1UOOA 4U1EI 4JXMA 4WK0A 4AMYA 3N0EA 3K26A 2OK6A 4L3HD 2GC4A 4IRZA 3FCSA 2Z2OA 1GOFA 5I5JA 5SXMA 3UVMA 1T2XA 2XU7A 4GMBA 4CI8A 3DM0A 4LG9A 1MDAH 2EIDA 3BWSA 2H13A 3IIYA 1TBGA 5IJ7E 1YFQA 2J55H 4BP9A 4D6VA 4FA4D 5THAA 2Q7QA 2YB8B 2XDWA 1QFSA 4J77A 4X63B 5TDHB 4BP8A 1PBYB 1VZ2A 2HJ4A 3V4PA 3UVLA 3V9FA 4CY3A 1YR2A 4O9DA 2W18A 1A0RB 4E54B 2P9UC 1H2WA 3DXKC 2GC7A 3OKWA 4AX4A 2OVPB 3P4FA 4K3JB 3IJCA 4H5JA 3OKYA 5EAMA 2B5MA 4QT8A 5FFOA 5HE2B 5TEFA 3RMZD 1L5GA 1XIPA 2TRCB 3V5WB 3K71A 4O2WA 2H6NA 5K19A 1QNIA 4GQ1A 1UTCA 4CZXA 3PXSD 5E6RA 5I5MA 3J80g 3IJ1A 4CZVA 5C86A 5C9ZB 4O02A 5C92A 3I2NA 4XEIC 3O4JA 2B5LA 4IA9A 5IGOA 3BG0A 1XKSA 2UZXB 3CFVA 1L0QA 5H1MA 5GSAA 1NEXB 2H6KA 3I7KA 3NVQA 1I2MB 2GNQA 1C9LA 2PM7B 3RFGA 4FA9D 3PE7A 4A2LA 3EI3B 3PSCB 1QFMA 4A09A 3FCUA 4FA1D 4AEZA 4MMYA 5CXBB 3PVWB 3NVXA 4UI9R 4UM9A 5FKQA 4ERQA 5IT9g 3EI4B 1FWXA 2I3TA 2XL3A 3PSLA 4E5ZB 1H2XA 3AFCA 3FRXA 4RE5A 3J81g 2HKRA 5EMMB 4A08A 4A0BB 4PSWB 5FXYA 3FM0A 4FAVD 2YNNA 1JTDB 2IWKA 2H9NA 3V7DB 3BG1A 4DNUA 5M5TA 3I8CA 2BKLA 2WQ8A 2I0TA 4KFMB 3ZDZA 2CE8A 5FKSA 3GFCA 3UVNA 3CIKB 3EI2A 4A0AA 1GOTB 2J56H 3SFZA 5EMKB 3I7PA 4GM9A 1VE7A 3IUMA 2VC2A 5CXCA 2QZPA 3AL8A 2XYIA 3EU7A 2VZ3A 1S4UX 2BCJB 3UR4A 4J84A 4DNWA 1GOHA 2OK4A 1RI6A 2HJBA 4GM3A 4OZUA 2HKMA 1XHMA 3IKOA 1GG2B 4CY1A 3RN0D 2H14A 4BCCA 3ZE0A 3OL2A 1SQJA 4GM8A 5CYKA 2G99A 5KDOB 4AN0A 3I7HA 2QXVA 4A11B 1N6EA 4JSNC 3EMHA 2HYEA 1NR0A 3UKUC 1B9YA 2XZGA 5HQGA 2IAAA 3KRWB 4PXWA 3JAMg 2VDPA 4JT5C 4G55A 2CO0C 2H9MA 1P22A 4ERZA 1GOGA 2AH1A 2H9PA 5E6UA 4TZ4A 1K32A 2P9SC 3RFHA 3OKTA 3K27A 3MXXA 4O3TB 3SBQA 4GQBB 5B4WA 4J0WA 3UVKA 1Q47A 1N6FA 5AFU3 5IGQA 2EBSA 3IJEA 2MTAH 1PEVA 4FWWA 3NIFA 2VDQA 2XE4A 4G1MA 4HDJA 4QRJA 2HESX 4BUJC 1A12A 2EIBA 3QI0A 2AGWA 3VA6A 1O6FA 3UVOA 2VZ1A 2J57G 5C2WB 5I5IA 2QC5A 1U2VC 2P9PC 4AOWA 3JRPA 4RE6A 4L1MA 4CI1A 2CO0A 4NC4A 5M61A 2YNOA 3RLMD 3SHFA 5GXIA 5FFGA 3O4IA 4J79A 4PBYA 4X3EA 4ZOZA 1UOQA 3VGZA 1JOFA 2EIEA 1GXRA 3SVWD 2IUQA 4J87A 3EWEA 3KCIA 1N6DA 5EMJB 4H5IA 3L4OD 2I3SA 5K1CC 4IMMA 2O9KA 4JSVC 5FQDA 4X61B 3SWSD 3I89A 4DNVA 1JMXB 1H2YA 3JZNA 5TF2A 4NAAA 4PNKB 2AGLA 3FGBA 3I7NA 4ERYA 4N14A 5M5VA 4NENA 1R5MA 1PI6A 5M5UA 4GZ8A 4BL0A 3ULEC 3EI3A 4ZOVA 3I7OA 4PC0A 5H17A 5CXBA 4O45A 4WK4A 5A2Qg 3EI4A 2HXCA 4E5ZA 3V4VA 2PM9A 3K72A 2CN2A 2I0RA 3SXTD 4Z7QA 3PXWD 3EG6A 3MUOA 4QAMA 1U4CA 4J78A 3IURA 1TYEA 4J86A 5M5SA 4QQEA 1C9IA 2JKXA 4QL1A 2VDNA 3RN1D 3T3PA 4UM8A 4ESGA 4JT6C 2YNPA 2IUVA 2QR5A 4I79A 2XL2A 1PGUA 2HU8A 1K8KC 3O4HA 4Z7NA 2P9LC 4Z7OA 5C2VB 2HU7A 2CN3A 3EI1B 5FA5B 5CXCB 3GD1I 3ZDYA 3QHYB 4NBMA 3AL8B 5EM2B 3U4YA 4FAND 3MKSB 4MK0B 4PBZA 3AL9A 2VDLA 2P9NC 4XYHA 4AMZA 4WJKA 4JHPC 2VDMA 3IUQA 5HE0B 3UKRC 4Y5RD 4L1QD 5GMKn 4L3GD 4L9OA 4A11A 5CYKB 1H2ZA 1JJUB 4FB1D 3SN6B 4FA5D 3MMYA 3NIDA 3PXTD 4GQ2P 2I0SA 2H9LA 5HDBA 4J8BA 3O4GA 3IJ0A 1BPOA 3F3PA 1TYQC 2BBKH 5HE1B 3AH8B 2AH0A 3W15A 2AGXA 3HFQA 3EQ9A 5H14A 4GGCA 3ORVD 4ZN4A 4BCBA 3C99A 3JZGA 4ES0A 5EALA 4YVDA 2OJYA 1U8CA 2VDRA 4J73A 4OWRA 4MMXA 4PSXB 3L4MD 2OVQB 4XYIA 4WK2A 4JSXC 4LG8A 3SJLD 3GREA 3JB9L 3GC3B 2P9IC 1SQ9A 3VI3A 3I8EA 2OVRB 3IULA 3OTTA 1MG3A 3SLED 4K3ID 4Y7RA 4E54A 4LGNA 4A7JA 3E0CA 4CY5A 2VDKA 3EQ8A 1VZ3A 5IC7A 1B9XA 1E5TA 2CE9A 3EQ7A 4X60B 3SCYA 4ZOYA 3I7LA 2OIZA 1OMWB 5IJ8E 4JD2C 2B4EA 3OKYB 1MG2A 1JV2A 3SMRA 5AJAA 2UZYB 4EWRA 1VE6A 3IUNA 3VI4A 5M5RA 2CNXA 5E6SA 4GGAA 1GP2B 4J81A 3C75H 5TEEA 4Z8LA 3ZWLB 3IIWA 4JSPC 2IUPA 2YBAA 3PVUB 3F3GA 3MZLA 3ZE2A 4J0XA 3SBPA 5JWZA 2AQ5A 3MUNA 5AMSA 2PBIB 3DWLC
chains in the Genus database with same CATH topology
2YMUA 4CC9A 2IURA 3JZHA 2H3XA 3F3FA 3VH0A 4A09B 3C9CA 4CY2A 4O3UB 4CI3A 2P9KC 4A0BA 3CFSB 3DSMA 2AGZA 4CI2A 4A2MA 4A08B 2G9AA 1VYHC 5EARA 4J8GA 3RSEC 5FKTA 3KRXB 1OLZA 2PM9B 4D0KA 4G56B 1SHYB 4A0AB 4FHLA 3EI2B 4BH6A 3B7FA 3RRMC 3OW8A 4U7AA 2H47A 3MKQA 4NSXA 3DXMC 3JROA 3ODTA 1JMZB 2H68A 3A0FA 5HYNB 3NVNA 3JPXA 5FKRA 5GXHA 2H6QA 3EI1A 2AGYA 5EM2A 4J82A 3SBRA 2IWFA 4CZYA 4O1QD 5FLXg 5HE3B 3MZKA 3N0DA 3OL2B 4GGDA 3C5MA 5EAPA 4ZOXA 4R7AB 2B5NA 1ERJA 2Z2PA 2PM6B 5EMLB 2Z2NA 4U1EI 4JXMA 3N0EA 3K26A 2OK6A 4L3HD 2GC4A 2Z2OA 5I5JA 5SXMA 3UVMA 4GMBA 2XU7A 4CI8A 3DM0A 4LG9A 1MDAH 3BWSA 2H13A 3IIYA 1TBGA 5IJ7E 1YFQA 2J55H 4D6VA 4FA4D 5THAA 2Q7QA 2YB8B 4J77A 4X63B 5TDHB 1PBYB 2HJ4A 3UVLA 3V9FA 4CY3A 4O9DA 2W18A 1A0RB 4E54B 2P9UC 3DXKC 2GC7A 3OKWA 2OVPB 3P4FA 4K3JB 3IJCA 4H5JA 3OKYA 5EAMA 2B5MA 4QT8A 5HE2B 5TEFA 3RMZD 1XIPA 2TRCB 3V5WB 2H6NA 5K19A 1QNIA 4GQ1A 4CZXA 3PXSD 5I5MA 3J80g 3IJ1A 4CZVA 5C9ZB 3I2NA 4XEIC 2B5LA 4IA9A 5IGOA 3BG0A 1XKSA 2UZXB 3CFVA 1L0QA 5H1MA 5GSAA 1NEXB 2H6KA 3I7KA 3NVQA 2GNQA 2PM7B 3RFGA 4FA9D 3PE7A 4A2LA 3EI3B 3PSCB 4A09A 4FA1D 4AEZA 5CXBB 3PVWB 3NVXA 4UI9R 5FKQA 4ERQA 5IT9g 3EI4B 1FWXA 2I3TA 2XL3A 3PSLA 4E5ZB 3AFCA 3FRXA 3J81g 2HKRA 5EMMB 4A08A 4A0BB 4PSWB 5FXYA 3FM0A 4FAVD 2YNNA 2IWKA 2H9NA 3V7DB 3BG1A 3I8CA 2I0TA 4KFMB 2CE8A 5FKSA 3GFCA 3UVNA 3CIKB 3EI2A 4A0AA 1GOTB 2J56H 3SFZA 5EMKB 3I7PA 4GM9A 5CXCA 3AL8A 2XYIA 3EU7A 1S4UX 2BCJB 3UR4A 4J84A 2OK4A 1RI6A 2HJBA 4GM3A 4OZUA 2HKMA 1XHMA 3IKOA 1GG2B 4CY1A 3RN0D 2H14A 3OL2A 1SQJA 4GM8A 5CYKA 2G99A 5KDOB 3I7HA 2QXVA 4A11B 1N6EA 4JSNC 3EMHA 2HYEA 1NR0A 3UKUC 1B9YA 5HQGA 2IAAA 3KRWB 4PXWA 3JAMg 4JT5C 2CO0C 2H9MA 1P22A 4ERZA 2AH1A 2H9PA 3RFHA 4TZ4A 1K32A 2P9SC 3OKTA 3K27A 3MXXA 4O3TB 3SBQA 4GQBB 5B4WA 4J0WA 3UVKA 1Q47A 1N6FA 5AFU3 5IGQA 2EBSA 2MTAH 1PEVA 4FWWA 4HDJA 4QRJA 2HESX 4BUJC 2AGWA 3VA6A 3UVOA 2J57G 5C2WB 5I5IA 2QC5A 1U2VC 2P9PC 4AOWA 3JRPA 4CI1A 2CO0A 2YNOA 3RLMD 3SHFA 5GXIA 4ZOZA 4J79A 4PBYA 4X3EA 3VGZA 1JOFA 1GXRA 3SVWD 2IUQA 4J87A 3EWEA 5EMJB 1N6DA 4H5IA 3L4OD 2I3SA 5K1CC 4IMMA 2O9KA 4JSVC 5FQDA 4X61B 3SWSD 3I89A 1JMXB 5TF2A 3JZNA 4PNKB 2AGLA 3FGBA 3I7NA 4ERYA 4N14A 1R5MA 1PI6A 4GZ8A 4BL0A 3ULEC 3EI3A 4ZOVA 3I7OA 4PC0A 5H17A 5CXBA 4O45A 5A2Qg 3EI4A 2HXCA 4E5ZA 2PM9A 2CN2A 2I0RA 3SXTD 3PXWD 3EG6A 1U4CA 4J78A 4J86A 4QQEA 4QL1A 3RN1D 4ESGA 4JT6C 2YNPA 2IUVA 4I79A 2XL2A 1PGUA 1K8KC 2P9LC 5C2VB 2CN3A 3EI1B 5FA5B 5CXCB 3AL8B 5EM2B 3U4YA 4FAND 3MKSB 4MK0B 4PBZA 3AL9A 2P9NC 4XYHA 5HE0B 3UKRC 4Y5RD 4L1QD 5GMKn 4L3GD 4L9OA 4A11A 5CYKB 1JJUB 4FB1D 3SN6B 4FA5D 3MMYA 3PXTD 4GQ2P 2I0SA 2H9LA 4J8BA 3IJ0A 3F3PA 1TYQC 2BBKH 5HE1B 3AH8B 2AH0A 3W15A 2AGXA 3HFQA 5H14A 4GGCA 3ORVD 4ZN4A 3C99A 3JZGA 4ES0A 5EALA 4YVDA 2OJYA 4J73A 4OWRA 4PSXB 3L4MD 2OVQB 4XYIA 4JSXC 4LG8A 3SJLD 3GREA 3JB9L 2P9IC 1SQ9A 3I8EA 2OVRB 3OTTA 1MG3A 3SLED 4K3ID 4Y7RA 4E54A 4LGNA 4A7JA 3E0CA 4CY5A 5IC7A 1B9XA 2CE9A 4X60B 3SCYA 4ZOYA 3I7LA 2OIZA 1OMWB 5IJ8E 4JD2C 2B4EA 3OKYB 1MG2A 3SMRA 5AJAA 2UZYB 4EWRA 2CNXA 4GGAA 1GP2B 4J81A 3C75H 5TEEA 4Z8LA 3ZWLB 3IIWA 4JSPC 2IUPA 2YBAA 3PVUB 3F3GA 3MZLA 4J0XA 3SBPA 5JWZA 2AQ5A 5AMSA 2PBIB 3DWLC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YMU A;  4CC9 A;  2IUR A;  3JZH A;  2H3X A;  3F3F A;  3VH0 A;  4A09 B;  3C9C A;  4CY2 A;  4O3U B;  4CI3 A;  2P9K C;  4A0B A;  3CFS B;  3DSM A;  2AGZ A;  4CI2 A;  4A2M A;  4A08 B;  2G9A A;  1VYH C;  5EAR A;  4J8G A;  3RSE C;  5FKT A;  3KRX B;  1OLZ A;  2PM9 B;  4D0K A;  4G56 B;  1SHY B;  4A0A B;  4FHL A;  3EI2 B;  4BH6 A;  3B7F A;  3RRM C;  3OW8 A;  4U7A A;  2H47 A;  3MKQ A;  4NSX A;  3DXM C;  3JRO A;  3ODT A;  1JMZ B;  2H68 A;  3A0F A;  5HYN B;  3NVN A;  3JPX A;  5FKR A;  5GXH A;  2H6Q A;  3EI1 A;  2AGY A;  5EM2 A;  4J82 A;  3SBR A;  2IWF A;  4CZY A;  4O1Q D;  5FLX g;  5HE3 B;  3MZK A;  3N0D A;  3OL2 B;  4GGD A;  3C5M A;  5EAP A;  4ZOX A;  4R7A B;  2B5N A;  1ERJ A;  2Z2P A;  2PM6 B;  5EML B;  2Z2N A;  4U1E I;  4JXM A;  3N0E A;  3K26 A;  2OK6 A;  4L3H D;  2GC4 A;  2Z2O A;  5I5J A;  5SXM A;  3UVM A;  4GMB A;  2XU7 A;  4CI8 A;  3DM0 A;  4LG9 A;  1MDA H;  3BWS A;  2H13 A;  3IIY A;  1TBG A;  5IJ7 E;  1YFQ A;  2J55 H;  4D6V A;  4FA4 D;  5THA A;  2Q7Q A;  2YB8 B;  4J77 A;  4X63 B;  5TDH B;  1PBY B;  2HJ4 A;  3UVL A;  3V9F A;  4CY3 A;  4O9D A;  2W18 A;  1A0R B;  4E54 B;  2P9U C;  3DXK C;  2GC7 A;  3OKW A;  2OVP B;  3P4F A;  4K3J B;  3IJC A;  4H5J A;  3OKY A;  5EAM A;  2B5M A;  4QT8 A;  5HE2 B;  5TEF A;  3RMZ D;  1XIP A;  2TRC B;  3V5W B;  2H6N A;  5K19 A;  1QNI A;  4GQ1 A;  4CZX A;  3PXS D;  5I5M A;  3J80 g;  3IJ1 A;  4CZV A;  5C9Z B;  3I2N A;  4XEI C;  2B5L A;  4IA9 A;  5IGO A;  3BG0 A;  1XKS A;  2UZX B;  3CFV A;  1L0Q A;  5H1M A;  5GSA A;  1NEX B;  2H6K A;  3I7K A;  3NVQ A;  2GNQ A;  2PM7 B;  3RFG A;  4FA9 D;  3PE7 A;  4A2L A;  3EI3 B;  3PSC B;  4A09 A;  4FA1 D;  4AEZ A;  5CXB B;  3PVW B;  3NVX A;  4UI9 R;  5FKQ A;  4ERQ A;  5IT9 g;  3EI4 B;  1FWX A;  2I3T A;  2XL3 A;  3PSL A;  4E5Z B;  3AFC A;  3FRX A;  3J81 g;  2HKR A;  5EMM B;  4A08 A;  4A0B B;  4PSW B;  5FXY A;  3FM0 A;  4FAV D;  2YNN A;  2IWK A;  2H9N A;  3V7D B;  3BG1 A;  3I8C A;  2I0T A;  4KFM B;  2CE8 A;  5FKS A;  3GFC A;  3UVN A;  3CIK B;  3EI2 A;  4A0A A;  1GOT B;  2J56 H;  3SFZ A;  5EMK B;  3I7P A;  4GM9 A;  5CXC A;  3AL8 A;  2XYI A;  3EU7 A;  1S4U X;  2BCJ B;  3UR4 A;  4J84 A;  2OK4 A;  1RI6 A;  2HJB A;  4GM3 A;  4OZU A;  2HKM A;  1XHM A;  3IKO A;  1GG2 B;  4CY1 A;  3RN0 D;  2H14 A;  3OL2 A;  1SQJ A;  4GM8 A;  5CYK A;  2G99 A;  5KDO B;  3I7H A;  2QXV A;  4A11 B;  1N6E A;  4JSN C;  3EMH A;  2HYE A;  1NR0 A;  3UKU C;  1B9Y A;  5HQG A;  2IAA A;  3KRW B;  4PXW A;  3JAM g;  4JT5 C;  2CO0 C;  2H9M A;  1P22 A;  4ERZ A;  2AH1 A;  2H9P A;  3RFH A;  4TZ4 A;  1K32 A;  2P9S C;  3OKT A;  3K27 A;  3MXX A;  4O3T B;  3SBQ A;  4GQB B;  5B4W A;  4J0W A;  3UVK A;  1Q47 A;  1N6F A;  5AFU 3;  5IGQ A;  2EBS A;  2MTA H;  1PEV A;  4FWW A;  4HDJ A;  4QRJ A;  2HES X;  4BUJ C;  2AGW A;  3VA6 A;  3UVO A;  2J57 G;  5C2W B;  5I5I A;  2QC5 A;  1U2V C;  2P9P C;  4AOW A;  3JRP A;  4CI1 A;  2CO0 A;  2YNO A;  3RLM D;  3SHF A;  5GXI A;  4ZOZ A;  4J79 A;  4PBY A;  4X3E A;  3VGZ A;  1JOF A;  1GXR A;  3SVW D;  2IUQ A;  4J87 A;  3EWE A;  5EMJ B;  1N6D A;  4H5I A;  3L4O D;  2I3S A;  5K1C C;  4IMM A;  2O9K A;  4JSV C;  5FQD A;  4X61 B;  3SWS D;  3I89 A;  1JMX B;  5TF2 A;  3JZN A;  4PNK B;  2AGL A;  3FGB A;  3I7N A;  4ERY A;  4N14 A;  1R5M A;  1PI6 A;  4GZ8 A;  4BL0 A;  3ULE C;  3EI3 A;  4ZOV A;  3I7O A;  4PC0 A;  5H17 A;  5CXB A;  4O45 A;  5A2Q g;  3EI4 A;  2HXC A;  4E5Z A;  2PM9 A;  2CN2 A;  2I0R A;  3SXT D;  3PXW D;  3EG6 A;  1U4C A;  4J78 A;  4J86 A;  4QQE A;  4QL1 A;  3RN1 D;  4ESG A;  4JT6 C;  2YNP A;  2IUV A;  4I79 A;  2XL2 A;  1PGU A;  1K8K C;  2P9L C;  5C2V B;  2CN3 A;  3EI1 B;  5FA5 B;  5CXC B;  3AL8 B;  5EM2 B;  3U4Y A;  4FAN D;  3MKS B;  4MK0 B;  4PBZ A;  3AL9 A;  2P9N C;  4XYH A;  5HE0 B;  3UKR C;  4Y5R D;  4L1Q D;  5GMK n;  4L3G D;  4L9O A;  4A11 A;  5CYK B;  1JJU B;  4FB1 D;  3SN6 B;  4FA5 D;  3MMY A;  3PXT D;  4GQ2 P;  2I0S A;  2H9L A;  4J8B A;  3IJ0 A;  3F3P A;  1TYQ C;  2BBK H;  5HE1 B;  3AH8 B;  2AH0 A;  3W15 A;  2AGX A;  3HFQ A;  5H14 A;  4GGC A;  3ORV D;  4ZN4 A;  3C99 A;  3JZG A;  4ES0 A;  5EAL A;  4YVD A;  2OJY A;  4J73 A;  4OWR A;  4PSX B;  3L4M D;  2OVQ B;  4XYI A;  4JSX C;  4LG8 A;  3SJL D;  3GRE A;  3JB9 L;  2P9I C;  1SQ9 A;  3I8E A;  2OVR B;  3OTT A;  1MG3 A;  3SLE D;  4K3I D;  4Y7R A;  4E54 A;  4LGN A;  4A7J A;  3E0C A;  4CY5 A;  5IC7 A;  1B9X A;  2CE9 A;  4X60 B;  3SCY A;  4ZOY A;  3I7L A;  2OIZ A;  1OMW B;  5IJ8 E;  4JD2 C;  2B4E A;  3OKY B;  1MG2 A;  3SMR A;  5AJA A;  2UZY B;  4EWR A;  2CNX A;  4GGA A;  1GP2 B;  4J81 A;  3C75 H;  5TEE A;  4Z8L A;  3ZWL B;  3IIW A;  4JSP C;  2IUP A;  2YBA A;  3PVU B;  3F3G A;  3MZL A;  4J0X A;  3SBP A;  5JWZ A;  2AQ5 A;  5AMS A;  2PBI B;  3DWL C; 
#chains in the Genus database with same CATH topology
 2YMU A;  3K6S A;  4CC9 A;  2EIC A;  2IUR A;  4D9S A;  3T3M A;  2VDO A;  3JZH A;  2H3X A;  3IUJ A;  3F3F A;  3VH0 A;  4A09 B;  3C9C A;  4CY2 A;  4O3U B;  4MMZ A;  1M1X A;  4CI3 A;  4BCD A;  2P9K C;  4A0B A;  1UOP A;  3CFS B;  3DSM A;  3NIG A;  2AGZ A;  4CI2 A;  4A2M A;  4A08 B;  2G9A A;  1VYH C;  3IVM A;  5EAR A;  4J8G A;  1E8N A;  3RSE C;  1O6G A;  5FKT A;  3KRX B;  1OLZ A;  2PM9 B;  3ZDX A;  4D0K A;  4G56 B;  1SHY B;  4G1E A;  4AN1 A;  3ZE1 A;  4A0A B;  4FHL A;  3EI2 B;  4BH6 A;  3B7F A;  3RRM C;  3OW8 A;  4U7A A;  2H47 A;  3MKQ A;  4NSX A;  3DXM C;  3JRO A;  3ODT A;  1JMZ B;  2H68 A;  3A0F A;  3OF7 A;  5HYN B;  3NVN A;  3JPX A;  5FKR A;  5GXH A;  2H6Q A;  3EI1 A;  2AGY A;  4JHN A;  5EM2 A;  4J82 A;  3MVD K;  3SBR A;  2IWF A;  4CZY A;  4O1Q D;  5FLX g;  5HE3 B;  3MZK A;  3N0D A;  3OL2 B;  4GGD A;  1E8M A;  3C5M A;  5EAP A;  4ZOX A;  4R7A B;  2B5N A;  1ERJ A;  2HU5 A;  2Z2P A;  1K3I A;  2PM6 B;  3DDU A;  5EML B;  2Z2N A;  1UOO A;  4U1E I;  4JXM A;  4WK0 A;  4AMY A;  3N0E A;  3K26 A;  2OK6 A;  4L3H D;  2GC4 A;  4IRZ A;  3FCS A;  2Z2O A;  1GOF A;  5I5J A;  5SXM A;  3UVM A;  1T2X A;  2XU7 A;  4GMB A;  4CI8 A;  3DM0 A;  4LG9 A;  1MDA H;  2EID A;  3BWS A;  2H13 A;  3IIY A;  1TBG A;  5IJ7 E;  1YFQ A;  2J55 H;  4BP9 A;  4D6V A;  4FA4 D;  5THA A;  2Q7Q A;  2YB8 B;  2XDW A;  1QFS A;  4J77 A;  4X63 B;  5TDH B;  4BP8 A;  1PBY B;  1VZ2 A;  2HJ4 A;  3V4P A;  3UVL A;  3V9F A;  4CY3 A;  1YR2 A;  4O9D A;  2W18 A;  1A0R B;  4E54 B;  2P9U C;  1H2W A;  3DXK C;  2GC7 A;  3OKW A;  4AX4 A;  2OVP B;  3P4F A;  4K3J B;  3IJC A;  4H5J A;  3OKY A;  5EAM A;  2B5M A;  4QT8 A;  5FFO A;  5HE2 B;  5TEF A;  3RMZ D;  1L5G A;  1XIP A;  2TRC B;  3V5W B;  3K71 A;  4O2W A;  2H6N A;  5K19 A;  1QNI A;  4GQ1 A;  1UTC A;  4CZX A;  3PXS D;  5E6R A;  5I5M A;  3J80 g;  3IJ1 A;  4CZV A;  5C86 A;  5C9Z B;  4O02 A;  5C92 A;  3I2N A;  4XEI C;  3O4J A;  2B5L A;  4IA9 A;  5IGO A;  3BG0 A;  1XKS A;  2UZX B;  3CFV A;  1L0Q A;  5H1M A;  5GSA A;  1NEX B;  2H6K A;  3I7K A;  3NVQ A;  1I2M B;  2GNQ A;  1C9L A;  2PM7 B;  3RFG A;  4FA9 D;  3PE7 A;  4A2L A;  3EI3 B;  3PSC B;  1QFM A;  4A09 A;  3FCU A;  4FA1 D;  4AEZ A;  4MMY A;  5CXB B;  3PVW B;  3NVX A;  4UI9 R;  4UM9 A;  5FKQ A;  4ERQ A;  5IT9 g;  3EI4 B;  1FWX A;  2I3T A;  2XL3 A;  3PSL A;  4E5Z B;  1H2X A;  3AFC A;  3FRX A;  4RE5 A;  3J81 g;  2HKR A;  5EMM B;  4A08 A;  4A0B B;  4PSW B;  5FXY A;  3FM0 A;  4FAV D;  2YNN A;  1JTD B;  2IWK A;  2H9N A;  3V7D B;  3BG1 A;  4DNU A;  5M5T A;  3I8C A;  2BKL A;  2WQ8 A;  2I0T A;  4KFM B;  3ZDZ A;  2CE8 A;  5FKS A;  3GFC A;  3UVN A;  3CIK B;  3EI2 A;  4A0A A;  1GOT B;  2J56 H;  3SFZ A;  5EMK B;  3I7P A;  4GM9 A;  1VE7 A;  3IUM A;  2VC2 A;  5CXC A;  2QZP A;  3AL8 A;  2XYI A;  3EU7 A;  2VZ3 A;  1S4U X;  2BCJ B;  3UR4 A;  4J84 A;  4DNW A;  1GOH A;  2OK4 A;  1RI6 A;  2HJB A;  4GM3 A;  4OZU A;  2HKM A;  1XHM A;  3IKO A;  1GG2 B;  4CY1 A;  3RN0 D;  2H14 A;  4BCC A;  3ZE0 A;  3OL2 A;  1SQJ A;  4GM8 A;  5CYK A;  2G99 A;  5KDO B;  4AN0 A;  3I7H A;  2QXV A;  4A11 B;  1N6E A;  4JSN C;  3EMH A;  2HYE A;  1NR0 A;  3UKU C;  1B9Y A;  2XZG A;  5HQG A;  2IAA A;  3KRW B;  4PXW A;  3JAM g;  2VDP A;  4JT5 C;  4G55 A;  2CO0 C;  2H9M A;  1P22 A;  4ERZ A;  1GOG A;  2AH1 A;  2H9P A;  5E6U A;  4TZ4 A;  1K32 A;  2P9S C;  3RFH A;  3OKT A;  3K27 A;  3MXX A;  4O3T B;  3SBQ A;  4GQB B;  5B4W A;  4J0W A;  3UVK A;  1Q47 A;  1N6F A;  5AFU 3;  5IGQ A;  2EBS A;  3IJE A;  2MTA H;  1PEV A;  4FWW A;  3NIF A;  2VDQ A;  2XE4 A;  4G1M A;  4HDJ A;  4QRJ A;  2HES X;  4BUJ C;  1A12 A;  2EIB A;  3QI0 A;  2AGW A;  3VA6 A;  1O6F A;  3UVO A;  2VZ1 A;  2J57 G;  5C2W B;  5I5I A;  2QC5 A;  1U2V C;  2P9P C;  4AOW A;  3JRP A;  4RE6 A;  4L1M A;  4CI1 A;  2CO0 A;  4NC4 A;  5M61 A;  2YNO A;  3RLM D;  3SHF A;  5GXI A;  5FFG A;  3O4I A;  4J79 A;  4PBY A;  4X3E A;  4ZOZ A;  1UOQ A;  3VGZ A;  1JOF A;  2EIE A;  1GXR A;  3SVW D;  2IUQ A;  4J87 A;  3EWE A;  3KCI A;  1N6D A;  5EMJ B;  4H5I A;  3L4O D;  2I3S A;  5K1C C;  4IMM A;  2O9K A;  4JSV C;  5FQD A;  4X61 B;  3SWS D;  3I89 A;  4DNV A;  1JMX B;  1H2Y A;  3JZN A;  5TF2 A;  4NAA A;  4PNK B;  2AGL A;  3FGB A;  3I7N A;  4ERY A;  4N14 A;  5M5V A;  4NEN A;  1R5M A;  1PI6 A;  5M5U A;  4GZ8 A;  4BL0 A;  3ULE C;  3EI3 A;  4ZOV A;  3I7O A;  4PC0 A;  5H17 A;  5CXB A;  4O45 A;  4WK4 A;  5A2Q g;  3EI4 A;  2HXC A;  4E5Z A;  3V4V A;  2PM9 A;  3K72 A;  2CN2 A;  2I0R A;  3SXT D;  4Z7Q A;  3PXW D;  3EG6 A;  3MUO A;  4QAM A;  1U4C A;  4J78 A;  3IUR A;  1TYE A;  4J86 A;  5M5S A;  4QQE A;  1C9I A;  2JKX A;  4QL1 A;  2VDN A;  3RN1 D;  3T3P A;  4UM8 A;  4ESG A;  4JT6 C;  2YNP A;  2IUV A;  2QR5 A;  4I79 A;  2XL2 A;  1PGU A;  2HU8 A;  1K8K C;  3O4H A;  4Z7N A;  2P9L C;  4Z7O A;  5C2V B;  2HU7 A;  2CN3 A;  3EI1 B;  5FA5 B;  5CXC B;  3GD1 I;  3ZDY A;  3QHY B;  4NBM A;  3AL8 B;  5EM2 B;  3U4Y A;  4FAN D;  3MKS B;  4MK0 B;  4PBZ A;  3AL9 A;  2VDL A;  2P9N C;  4XYH A;  4AMZ A;  4WJK A;  4JHP C;  2VDM A;  3IUQ A;  5HE0 B;  3UKR C;  4Y5R D;  4L1Q D;  5GMK n;  4L3G D;  4L9O A;  4A11 A;  5CYK B;  1H2Z A;  1JJU B;  4FB1 D;  3SN6 B;  4FA5 D;  3MMY A;  3NID A;  3PXT D;  4GQ2 P;  2I0S A;  2H9L A;  5HDB A;  4J8B A;  3O4G A;  3IJ0 A;  1BPO A;  3F3P A;  1TYQ C;  2BBK H;  5HE1 B;  3AH8 B;  2AH0 A;  3W15 A;  2AGX A;  3HFQ A;  3EQ9 A;  5H14 A;  4GGC A;  3ORV D;  4ZN4 A;  4BCB A;  3C99 A;  3JZG A;  4ES0 A;  5EAL A;  4YVD A;  2OJY A;  1U8C A;  2VDR A;  4J73 A;  4OWR A;  4MMX A;  4PSX B;  3L4M D;  2OVQ B;  4XYI A;  4WK2 A;  4JSX C;  4LG8 A;  3SJL D;  3GRE A;  3JB9 L;  3GC3 B;  2P9I C;  1SQ9 A;  3VI3 A;  3I8E A;  2OVR B;  3IUL A;  3OTT A;  1MG3 A;  3SLE D;  4K3I D;  4Y7R A;  4E54 A;  4LGN A;  4A7J A;  3E0C A;  4CY5 A;  2VDK A;  3EQ8 A;  1VZ3 A;  5IC7 A;  1B9X A;  1E5T A;  2CE9 A;  3EQ7 A;  4X60 B;  3SCY A;  4ZOY A;  3I7L A;  2OIZ A;  1OMW B;  5IJ8 E;  4JD2 C;  2B4E A;  3OKY B;  1MG2 A;  1JV2 A;  3SMR A;  5AJA A;  2UZY B;  4EWR A;  1VE6 A;  3IUN A;  3VI4 A;  5M5R A;  2CNX A;  5E6S A;  4GGA A;  1GP2 B;  4J81 A;  3C75 H;  5TEE A;  4Z8L A;  3ZWL B;  3IIW A;  4JSP C;  2IUP A;  2YBA A;  3PVU B;  3F3G A;  3MZL A;  3ZE2 A;  4J0X A;  3SBP A;  5JWZ A;  2AQ5 A;  3MUN A;  5AMS A;  2PBI B;  3DWL C; 
#chains in the Genus database with same CATH homology
 2YMU A;  4CC9 A;  2IUR A;  3JZH A;  2H3X A;  3F3F A;  3VH0 A;  4A09 B;  3C9C A;  4CY2 A;  4O3U B;  4CI3 A;  2P9K C;  4A0B A;  3CFS B;  3DSM A;  2AGZ A;  4CI2 A;  4A2M A;  4A08 B;  2G9A A;  1VYH C;  5EAR A;  4J8G A;  3RSE C;  5FKT A;  3KRX B;  1OLZ A;  2PM9 B;  4D0K A;  4G56 B;  1SHY B;  4A0A B;  4FHL A;  3EI2 B;  4BH6 A;  3B7F A;  3RRM C;  3OW8 A;  4U7A A;  2H47 A;  3MKQ A;  4NSX A;  3DXM C;  3JRO A;  3ODT A;  1JMZ B;  2H68 A;  3A0F A;  5HYN B;  3NVN A;  3JPX A;  5FKR A;  5GXH A;  2H6Q A;  3EI1 A;  2AGY A;  5EM2 A;  4J82 A;  3SBR A;  2IWF A;  4CZY A;  4O1Q D;  5FLX g;  5HE3 B;  3MZK A;  3N0D A;  3OL2 B;  4GGD A;  3C5M A;  5EAP A;  4ZOX A;  4R7A B;  2B5N A;  1ERJ A;  2Z2P A;  2PM6 B;  5EML B;  2Z2N A;  4U1E I;  4JXM A;  3N0E A;  3K26 A;  2OK6 A;  4L3H D;  2GC4 A;  2Z2O A;  5I5J A;  5SXM A;  3UVM A;  4GMB A;  2XU7 A;  4CI8 A;  3DM0 A;  4LG9 A;  1MDA H;  3BWS A;  2H13 A;  3IIY A;  1TBG A;  5IJ7 E;  1YFQ A;  2J55 H;  4D6V A;  4FA4 D;  5THA A;  2Q7Q A;  2YB8 B;  4J77 A;  4X63 B;  5TDH B;  1PBY B;  2HJ4 A;  3UVL A;  3V9F A;  4CY3 A;  4O9D A;  2W18 A;  1A0R B;  4E54 B;  2P9U C;  3DXK C;  2GC7 A;  3OKW A;  2OVP B;  3P4F A;  4K3J B;  3IJC A;  4H5J A;  3OKY A;  5EAM A;  2B5M A;  4QT8 A;  5HE2 B;  5TEF A;  3RMZ D;  1XIP A;  2TRC B;  3V5W B;  2H6N A;  5K19 A;  1QNI A;  4GQ1 A;  4CZX A;  3PXS D;  5I5M A;  3J80 g;  3IJ1 A;  4CZV A;  5C9Z B;  3I2N A;  4XEI C;  2B5L A;  4IA9 A;  5IGO A;  3BG0 A;  1XKS A;  2UZX B;  3CFV A;  1L0Q A;  5H1M A;  5GSA A;  1NEX B;  2H6K A;  3I7K A;  3NVQ A;  2GNQ A;  2PM7 B;  3RFG A;  4FA9 D;  3PE7 A;  4A2L A;  3EI3 B;  3PSC B;  4A09 A;  4FA1 D;  4AEZ A;  5CXB B;  3PVW B;  3NVX A;  4UI9 R;  5FKQ A;  4ERQ A;  5IT9 g;  3EI4 B;  1FWX A;  2I3T A;  2XL3 A;  3PSL A;  4E5Z B;  3AFC A;  3FRX A;  3J81 g;  2HKR A;  5EMM B;  4A08 A;  4A0B B;  4PSW B;  5FXY A;  3FM0 A;  4FAV D;  2YNN A;  2IWK A;  2H9N A;  3V7D B;  3BG1 A;  3I8C A;  2I0T A;  4KFM B;  2CE8 A;  5FKS A;  3GFC A;  3UVN A;  3CIK B;  3EI2 A;  4A0A A;  1GOT B;  2J56 H;  3SFZ A;  5EMK B;  3I7P A;  4GM9 A;  5CXC A;  3AL8 A;  2XYI A;  3EU7 A;  1S4U X;  2BCJ B;  3UR4 A;  4J84 A;  2OK4 A;  1RI6 A;  2HJB A;  4GM3 A;  4OZU A;  2HKM A;  1XHM A;  3IKO A;  1GG2 B;  4CY1 A;  3RN0 D;  2H14 A;  3OL2 A;  1SQJ A;  4GM8 A;  5CYK A;  2G99 A;  5KDO B;  3I7H A;  2QXV A;  4A11 B;  1N6E A;  4JSN C;  3EMH A;  2HYE A;  1NR0 A;  3UKU C;  1B9Y A;  5HQG A;  2IAA A;  3KRW B;  4PXW A;  3JAM g;  4JT5 C;  2CO0 C;  2H9M A;  1P22 A;  4ERZ A;  2AH1 A;  2H9P A;  3RFH A;  4TZ4 A;  1K32 A;  2P9S C;  3OKT A;  3K27 A;  3MXX A;  4O3T B;  3SBQ A;  4GQB B;  5B4W A;  4J0W A;  3UVK A;  1Q47 A;  1N6F A;  5AFU 3;  5IGQ A;  2EBS A;  2MTA H;  1PEV A;  4FWW A;  4HDJ A;  4QRJ A;  2HES X;  4BUJ C;  2AGW A;  3VA6 A;  3UVO A;  2J57 G;  5C2W B;  5I5I A;  2QC5 A;  1U2V C;  2P9P C;  4AOW A;  3JRP A;  4CI1 A;  2CO0 A;  2YNO A;  3RLM D;  3SHF A;  5GXI A;  4ZOZ A;  4J79 A;  4PBY A;  4X3E A;  3VGZ A;  1JOF A;  1GXR A;  3SVW D;  2IUQ A;  4J87 A;  3EWE A;  5EMJ B;  1N6D A;  4H5I A;  3L4O D;  2I3S A;  5K1C C;  4IMM A;  2O9K A;  4JSV C;  5FQD A;  4X61 B;  3SWS D;  3I89 A;  1JMX B;  5TF2 A;  3JZN A;  4PNK B;  2AGL A;  3FGB A;  3I7N A;  4ERY A;  4N14 A;  1R5M A;  1PI6 A;  4GZ8 A;  4BL0 A;  3ULE C;  3EI3 A;  4ZOV A;  3I7O A;  4PC0 A;  5H17 A;  5CXB A;  4O45 A;  5A2Q g;  3EI4 A;  2HXC A;  4E5Z A;  2PM9 A;  2CN2 A;  2I0R A;  3SXT D;  3PXW D;  3EG6 A;  1U4C A;  4J78 A;  4J86 A;  4QQE A;  4QL1 A;  3RN1 D;  4ESG A;  4JT6 C;  2YNP A;  2IUV A;  4I79 A;  2XL2 A;  1PGU A;  1K8K C;  2P9L C;  5C2V B;  2CN3 A;  3EI1 B;  5FA5 B;  5CXC B;  3AL8 B;  5EM2 B;  3U4Y A;  4FAN D;  3MKS B;  4MK0 B;  4PBZ A;  3AL9 A;  2P9N C;  4XYH A;  5HE0 B;  3UKR C;  4Y5R D;  4L1Q D;  5GMK n;  4L3G D;  4L9O A;  4A11 A;  5CYK B;  1JJU B;  4FB1 D;  3SN6 B;  4FA5 D;  3MMY A;  3PXT D;  4GQ2 P;  2I0S A;  2H9L A;  4J8B A;  3IJ0 A;  3F3P A;  1TYQ C;  2BBK H;  5HE1 B;  3AH8 B;  2AH0 A;  3W15 A;  2AGX A;  3HFQ A;  5H14 A;  4GGC A;  3ORV D;  4ZN4 A;  3C99 A;  3JZG A;  4ES0 A;  5EAL A;  4YVD A;  2OJY A;  4J73 A;  4OWR A;  4PSX B;  3L4M D;  2OVQ B;  4XYI A;  4JSX C;  4LG8 A;  3SJL D;  3GRE A;  3JB9 L;  2P9I C;  1SQ9 A;  3I8E A;  2OVR B;  3OTT A;  1MG3 A;  3SLE D;  4K3I D;  4Y7R A;  4E54 A;  4LGN A;  4A7J A;  3E0C A;  4CY5 A;  5IC7 A;  1B9X A;  2CE9 A;  4X60 B;  3SCY A;  4ZOY A;  3I7L A;  2OIZ A;  1OMW B;  5IJ8 E;  4JD2 C;  2B4E A;  3OKY B;  1MG2 A;  3SMR A;  5AJA A;  2UZY B;  4EWR A;  2CNX A;  4GGA A;  1GP2 B;  4J81 A;  3C75 H;  5TEE A;  4Z8L A;  3ZWL B;  3IIW A;  4JSP C;  2IUP A;  2YBA A;  3PVU B;  3F3G A;  3MZL A;  4J0X A;  3SBP A;  5JWZ A;  2AQ5 A;  5AMS A;  2PBI B;  3DWL C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...