1ERJA

Crystal structure of the c-terminal wd40 domain of tup1
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
388
structure length
350
Chain Sequence
HYLVPYNQRANHSKPIPPFLLDLDSQSVPDALKKQTNDYYILYNPALPREIDVELHKSLDHTSVVCCVKFSNDGEYLATGCNKTTQVYRVSDGSLVARLSDSSDLYIRSVCFSPDGKFLATGAEDRLIRIWDIENRKIVMILQGHEQDIYSLDYFPSGDKLVSGSGDRTVRIWDLRTGQCSLTLSIEDGVTTVAVSPGDGKYIAAGSLDRAVRVWDSETGFLVERLDTGHKDSVYSVVFTRDGQSVVSGSLDRSVKLWNLTCEVTYIGHKDFVLSVATTQNDEYILSGSKDRGVLFWDKKSGNPLLMLQGHRNSVISVAVANGSSLGPEYNVFATGSGDCKARIWKYKKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription inhibitor
molecule keywords TRANSCRIPTIONAL REPRESSOR TUP1
publication title Structure of the C-terminal domain of Tup1, a corepressor of transcription in yeast.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 106
structure length 350
sequence length 388
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2000-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 1erjA00
2B4EA 3SJLD 3I8CA 5TEEA 3PSLA 3CFSB 4CI3A 1JJUB 5HE2B 4H5IA 2P9SC 3PXTD 3ZWLB 5B4WA 4J86A 4A09B 2J55H 2P9UC 4FHLA 3UVLA 5FKTA 3KRXB 5EMJB 2AQ5A 3IKOA 4JSPC 3SN6B 4GM8A 5EMMB 1N6EA 4A2LA 3VGZA 2QC5A 3DM0A 4K3JB 3L4OD 4J79A 2AH0A 2IURA 2YNPA 3EI3B 2CE9A 5IC7A 1MDAH 3RN1D 3GREA 2YMUA 4O3UB 5HE0B 5CXBB 4A08B 4YVDA 3SBRA 4E54A 3SLED 3SVWD 4A0AA 5HYNB 2OIZA 1PGUA 5HE1B 2QXVA 3F3GA 1OMWB 4LG8A 4UI9R 3F3FA 2AGZA 3AL8B 2P9NC 3CIKB 3I7LA 4JSVC 3K27A 5IGOA 1PBYB 5A2Qg 2OK6A 1RI6A 4L1QD 3OKWA 2CNXA 5GMKn 1N6DA 2IUQA 5EM2B 4H5JA 4I79A 4J82A 2CO0A 2I0SA 3PXWD 3V9FA 5K19A 2GC7A 4GGDA 2OVRB 5EAMA 3EI4B 1GOTB 5HQGA 3V7DB 1K32A 2EBSA 3ULEC 1S4UX 2G9AA 3EI3A 2PM7B 5IT9g 4J8GA 2P9LC 5HE3B 4CZXA 2H6KA 4J87A 3C75H 3EI2B 2HESX 4MK0B 2H9LA 2I0RA 5CXBA 4A08A 3OL2A 1Q47A 5FQDA 4E5ZB 3JZHA 3C9CA 5TDHB 4PSWB 2AGXA 4D6VA 1K8KC 1TBGA 2UZYB 3VA6A 3RRMC 4CZVA 2AGWA 3RFGA 3KRWB 3JPXA 3OKTA 2GC4A 3I7HA 1GXRA 4CY5A 4XEIC 1U2VC 5FKRA 4OWRA 1VYHC 1PEVA 5IJ7E 4A0BA 2YBAA 3PVUB 5FKSA 3J80g 3IJ0A 5I5MA 3UVMA 5AJAA 3DXKC 3I7OA 4FA5D 4FA4D 4G56B 3MKQA 5EM2A 3UKRC 3SXTD 4ZOYA 2P9PC 3DSMA 5K1CC 4ZOXA 2H9PA 1NR0A 4FA9D 2H13A 3EI4A 2W18A 4O1QD 3SFZA 2IWFA 4O9DA 3PXSD 3AFCA 4Y7RA 5FXYA 4TZ4A 3I8EA 4N14A 2HXCA 2AGLA 3MZKA 4X61B 3EWEA 3RLMD 3MKSB 4O45A 3EI2A 3PVWB 3BG0A 2CN3A 1SQJA 3BG1A 4E5ZA 5CYKB 5FLXg 4KFMB 2CO0C 3SBPA 2OVPB 4CI1A 4JSNC 3OKYA 2I0TA 4PXWA 2Z2NA 4FAVD 5EALA 5I5IA 2H6QA 4J77A 5C2VB 1TYQC 3CFVA 4J84A 3J81g 3I2NA 4J8BA 4NSXA 4A11B 3UKUC 4JXMA 2IAAA 4BUJC 4GQBB 2AH1A 4A09A 4BH6A 2IUVA 2XU7A 4ERQA 5GSAA 2PM9B 3C99A 3EI1B 4U7AA 5H17A 1MG3A 4BL0A 2B5MA 1JMXB 3FRXA 4OZUA 4PBYA 1XIPA 3SCYA 3UR4A 4GQ1A 3VH0A 2P9KC 2HYEA 2P9IC 4EWRA 3FGBA 3AH8B 4J0WA 1NEXB 5CXCB 1ERJA 3E0CA 4HDJA 4J73A 4QQEA 4PC0A 1QNIA 2H9MA 3K26A 2OVQB 4FA1D 3UVNA 4GGAA 2HJBA 4PNKB 3HFQA 2J56H 4CY3A 5TF2A 5EMKB 4GGCA 5CYKA 3IJCA 4A2MA 4XYHA 1P22A 3UVKA 4CI2A 2MTAH 2YNNA 2TRCB 3AL8A 3L4MD 2B5LA 4Z8LA 2PM6B 4ERYA 3JAMg 5IJ8E 4L3HD 4O3TB 5H14A 4IA9A 5KDOB 5FKQA 3NVXA 3F3PA 4CY1A 4E54B 3I7PA 4ESGA 3MMYA 5TEFA 1JOFA 4J78A 4A0AB 3RSEC 3DWLC 3N0EA 2J57G 5EAPA 2CE8A 3ORVD 3SHFA 2PM9A 2H14A 1SQ9A 3EI1A 5GXIA 4X63B 3GFCA 3PE7A 4X3EA 2B5NA 4FB1D 4JT6C 4QL1A 1A0RB 4IMMA 5CXCA 1B9YA 3V5WB 2H3XA 5GXHA 3W15A 3JRPA 4K3ID 1B9XA 3IIWA 1SHYB 4FAND 3C5MA 4LG9A 1N6FA 2YNOA 4JD2C 2AGYA 3DXMC 3RFHA 2HKMA 4J81A 5IGQA 3MZLA 4X60B 4GM3A 1JMZB 2Z2OA 2UZXB 5FA5B 3SMRA 2O9KA 1FWXA 3OW8A 5THAA 4Y5RD 1XHMA 3I7KA 3OL2B 5SXMA 3FM0A 3I89A 2XL2A 4ERZA 3A0FA 5EARA 3OTTA 1MG2A 3U4YA 3BWSA 4FWWA 3P4FA 4CY2A 4AOWA 4GQ2P 5C9ZB 3EU7A 4CC9A 3ODTA 1PI6A 4XYIA 2XL3A 5AMSA 1XKSA 2G99A 4LGNA 4PBZA 2OJYA 4ES0A 2CN2A 3MXXA 3SWSD 4A0BB 2BCJB 2I3SA 3EMHA 1L0QA 1GP2B 2H68A 2BBKH 4QRJA 4ZOZA 4JT5C 4GMBA 3N0DA 1GG2B 4J0XA 4L3GD 3SBQA 2IWKA 4GM9A 5JWZA 1R5MA 3IJ1A 3I7NA 4D0KA 2I3TA 4PSXB 1OLZA 3AL9A 3UVOA 3JZNA 3IIYA 2HJ4A 2IUPA 3RMZD 3JB9L 2OK4A 4R7AB 2H47A 4ZN4A 1U4CA 3EG6A 3NVNA 3NVQA 4ZOVA 2Z2PA 2GNQA 2PBIB 4U1EI 3B7FA 3RN0D 3JROA 4A11A 4L9OA 5I5JA 1YFQA 4CZYA 4JSXC 2Q7QA 4GZ8A 5H1MA 5AFU3 2HKRA 3OKYB 4A7JA 2H6NA 2XYIA 4AEZA 5C2WB 5EMLB 4QT8A 3JZGA 2H9NA 2YB8B 4CI8A 3PSCB
chains in the Genus database with same CATH superfamily
2B4EA 3SJLD 3I8CA 5TEEA 3PSLA 3CFSB 1H2WA 4CI3A 1JJUB 5HE2B 4H5IA 2P9SC 3PXTD 3ZWLB 5B4WA 4J86A 3O4JA 4A09B 2HU8A 2J55H 2P9UC 4FHLA 2EIEA 3UVLA 5FKTA 1M1XA 3KRXB 5M5SA 5EMJB 1UTCA 2AQ5A 3IKOA 4JSPC 3SN6B 2VDOA 4GM8A 5EMMB 1N6EA 2JKXA 4A2LA 3VGZA 2QC5A 3DM0A 4K3JB 3L4OD 4J79A 2AH0A 3FCSA 2IURA 2YNPA 3OF7A 5E6UA 3EI3B 2CE9A 5IC7A 3GD1I 1MDAH 3T3MA 3RN1D 1K3IA 3GREA 2YMUA 4O3UB 5HE0B 1T2XA 3T3PA 5CXBB 4A08B 2VDPA 4YVDA 3SBRA 4E54A 3SLED 3GC3B 3SVWD 3NIFA 2BKLA 5HYNB 4A0AA 4L1MA 3KCIA 2OIZA 1PGUA 5HE1B 2QXVA 3F3GA 1OMWB 4LG8A 4UI9R 4IRZA 3F3FA 2AGZA 3DDUA 4Z7OA 3AL8B 3V4PA 2P9NC 3CIKB 3I7LA 4JSVC 3K27A 5IGOA 1E8NA 1PBYB 5A2Qg 2XZGA 2OK6A 1RI6A 1YR2A 4L1QD 3OKWA 2CNXA 1UOQA 5M5UA 5GMKn 1N6DA 2IUQA 5EM2B 4H5JA 4I79A 4J82A 2CO0A 1UOPA 2I0SA 3PXWD 3V9FA 3EQ9A 5K19A 2GC7A 4GGDA 1E8MA 1BPOA 2OVRB 5M5RA 4WK0A 5EAMA 3EI4B 1QFSA 1GOTB 2EICA 5HQGA 3V7DB 3IVMA 3K6SA 1K32A 2EBSA 3ULEC 3NIDA 1UOOA 1S4UX 2G9AA 3EI3A 2PM7B 4AMZA 5IT9g 4J8GA 2P9LC 5HE3B 4CZXA 2H6KA 4J87A 3C75H 3EI2B 2HESX 4MK0B 1E5TA 2H9LA 2I0RA 5CXBA 4A08A 3OL2A 1Q47A 5FQDA 3VI4A 3K71A 4E5ZB 3JZHA 3IULA 3C9CA 5TDHB 4PSWB 2AGXA 4D6VA 1K8KC 1TBGA 2UZYB 3VA6A 3RRMC 4CZVA 2AGWA 3RFGA 3KRWB 4UM8A 3JPXA 1GOGA 3OKTA 2GC4A 3I7HA 1GXRA 4CY5A 4BCBA 4XEIC 1U2VC 5FKRA 4OWRA 4DNUA 1VYHC 4AX4A 1PEVA 5IJ7E 4MMXA 4A0BA 2YBAA 3PVUB 5FKSA 3J80g 3IJ0A 1H2YA 3VI3A 5I5MA 1H2XA 3UVMA 5AJAA 3NIGA 3DXKC 3I7OA 4FA5D 4NENA 4G56B 4FA4D 3MKQA 5EM2A 3UKRC 3SXTD 1GOHA 4ZOYA 2P9PC 3DSMA 4WK2A 5K1CC 4ZOXA 2H9PA 3IUMA 1NR0A 4FA9D 4RE5A 2H13A 3EI4A 2W18A 4O1QD 3SFZA 3V4VA 2IWFA 4O9DA 3PXSD 3ZDXA 3AFCA 4Y7RA 3EQ8A 5FXYA 4TZ4A 3I8EA 2QR5A 4N14A 2HXCA 2AGLA 3MZKA 3FCUA 4X61B 3EWEA 3RLMD 3MKSB 4O45A 3EI2A 3PVWB 3BG0A 3MUNA 4BCCA 2CN3A 1SQJA 3BG1A 1QFMA 4E5ZA 5CYKB 5FLXg 4KFMB 2CO0C 3ZDZA 3EQ7A 3SBPA 3O4HA 2OVPB 4CI1A 4JSNC 3OKYA 2I0TA 4PXWA 2Z2NA 4FAVD 5EALA 5I5IA 2H6QA 4DNWA 4J77A 5C2VB 1H2ZA 1TYQC 3CFVA 4J84A 3J81g 3I2NA 4J8BA 4G55A 4NSXA 2EIBA 4A11B 5FFGA 1JV2A 3UKUC 2IAAA 4JXMA 4BUJC 4NC4A 4GQBB 2QZPA 2AH1A 4A09A 4BH6A 2IUVA 2XU7A 4ERQA 5GSAA 2PM9B 3C99A 3EI1B 4U7AA 4AN1A 5H17A 1MG3A 4BL0A 2B5MA 1JMXB 3FRXA 4OZUA 4PBYA 1XIPA 3SCYA 4Z7NA 3UR4A 4MMZA 4GQ1A 3VH0A 2P9KC 2HYEA 2EIDA 2P9IC 4EWRA 3FGBA 3AH8B 5FFOA 4J0WA 1NEXB 4DNVA 5CXCB 1ERJA 3E0CA 1C9IA 3IJEA 4MMYA 4HDJA 3O4IA 4JHPC 4J73A 4QQEA 4PC0A 4WK4A 4UM9A 1QNIA 2H9MA 3K26A 2OVQB 4FA1D 3UVNA 4NAAA 4GGAA 2HJBA 4PNKB 1VE7A 3HFQA 2J56H 4CY3A 5TF2A 5EMKB 4GGCA 4O2WA 5CYKA 3IJCA 4A2MA 3IUJA 4XYHA 1GOFA 1P22A 3UVKA 4CI2A 2MTAH 2YNNA 2TRCB 3AL8A 1C9LA 3L4MD 2B5LA 4Z8LA 2PM6B 4ERYA 3JAMg 5IJ8E 4WJKA 4L3HD 4O3TB 5H14A 4IA9A 5KDOB 5FKQA 3IUQA 2VDQA 3NVXA 3F3PA 4CY1A 4E54B 3I7PA 1VZ2A 4ESGA 3MMYA 5TEFA 1JOFA 4J78A 4A0AB 4G1MA 3RSEC 3DWLC 3N0EA 2J57G 5EAPA 2CE8A 3ORVD 3SHFA 2PM9A 3MVDK 2H14A 2VDNA 1SQ9A 3EI1A 5GXIA 2VZ1A 4X63B 3GFCA 1O6FA 3PE7A 4X3EA 2B5NA 3MUOA 4FB1D 4O02A 4BCDA 4JT6C 4QL1A 1A0RB 4IMMA 5CXCA 3ZDYA 1B9YA 3V5WB 2H3XA 5E6SA 5GXHA 3W15A 3JRPA 4K3ID 3IUNA 1B9XA 3IIWA 4AMYA 1SHYB 4FAND 3C5MA 1O6GA 1N6FA 1U8CA 2YNOA 4LG9A 4JD2C 2VDLA 2AGYA 3QHYB 3DXMC 4NBMA 4JHNA 2VZ3A 3RFHA 5HDBA 2HKMA 3ZE1A 4J81A 5IGQA 3MZLA 1L5GA 4X60B 4G1EA 4GM3A 1JMZB 2Z2OA 2UZXB 5FA5B 3SMRA 5M5TA 2O9KA 1FWXA 3OW8A 5THAA 4Y5RD 1XHMA 2VDMA 3I7KA 3OL2B 1VZ3A 3FM0A 5SXMA 5C86A 2VDKA 2VC2A 3I89A 1VE6A 2XL2A 4ERZA 3A0FA 5EARA 2XDWA 4BP8A 3OTTA 1MG2A 3ZE0A 3BWSA 4FWWA 3U4YA 3P4FA 4CY2A 2WQ8A 4AOWA 4GQ2P 5C9ZB 3EU7A 4D9SA 4CC9A 3ODTA 1PI6A 4XYIA 2XL3A 5AMSA 1XKSA 2G99A 4LGNA 4PBZA 2OJYA 4ES0A 2CN2A 3MXXA 3SWSD 4A0BB 2BCJB 2I3SA 3EMHA 1L0QA 1GP2B 2H68A 2BBKH 2HU7A 4QRJA 4ZOZA 4JT5C 4GMBA 3N0DA 1GG2B 4J0XA 4L3GD 3SBQA 2IWKA 4GM9A 4Z7QA 5JWZA 1R5MA 3K72A 3IJ1A 3I7NA 4D0KA 2I3TA 4PSXB 5E6RA 1OLZA 3AL9A 3UVOA 3JZNA 3IIYA 2HJ4A 2IUPA 3RMZD 3JB9L 3ZE2A 2OK4A 2XE4A 4R7AB 2H47A 4ZN4A 3O4GA 1U4CA 4QAMA 5C92A 3EG6A 2VDRA 5M61A 3NVNA 3NVQA 5M5VA 4ZOVA 2Z2PA 3QI0A 2GNQA 4BP9A 2PBIB 1JTDB 1A12A 4U1EI 3B7FA 3RN0D 3JROA 1I2MB 4A11A 4L9OA 4RE6A 1YFQA 5I5JA 4CZYA 3IURA 4JSXC 1TYEA 4AN0A 2Q7QA 4GZ8A 5H1MA 5AFU3 2HKRA 2HU5A 3OKYB 4A7JA 2H6NA 2XYIA 4AEZA 5C2WB 5EMLB 4QT8A 3JZGA 2H9NA 2YB8B 4CI8A 3PSCB
chains in the Genus database with same CATH topology
2B4EA 3SJLD 3I8CA 5TEEA 3PSLA 3CFSB 4CI3A 1JJUB 5HE2B 4H5IA 2P9SC 3PXTD 3ZWLB 5B4WA 4J86A 4A09B 2J55H 2P9UC 4FHLA 3UVLA 5FKTA 3KRXB 5EMJB 2AQ5A 3IKOA 4JSPC 3SN6B 4GM8A 5EMMB 1N6EA 4A2LA 3VGZA 2QC5A 3DM0A 4K3JB 3L4OD 4J79A 2AH0A 2IURA 2YNPA 3EI3B 2CE9A 5IC7A 1MDAH 3RN1D 3GREA 2YMUA 4O3UB 5HE0B 5CXBB 4A08B 4YVDA 3SBRA 4E54A 3SLED 3SVWD 4A0AA 5HYNB 2OIZA 1PGUA 5HE1B 2QXVA 3F3GA 1OMWB 4LG8A 4UI9R 3F3FA 2AGZA 3AL8B 2P9NC 3CIKB 3I7LA 4JSVC 3K27A 5IGOA 1PBYB 5A2Qg 2OK6A 1RI6A 4L1QD 3OKWA 2CNXA 5GMKn 1N6DA 2IUQA 5EM2B 4H5JA 4I79A 4J82A 2CO0A 2I0SA 3PXWD 3V9FA 5K19A 2GC7A 4GGDA 2OVRB 5EAMA 3EI4B 1GOTB 5HQGA 3V7DB 1K32A 2EBSA 3ULEC 1S4UX 2G9AA 3EI3A 2PM7B 5IT9g 4J8GA 2P9LC 5HE3B 4CZXA 2H6KA 4J87A 3C75H 3EI2B 2HESX 4MK0B 2H9LA 2I0RA 5CXBA 4A08A 3OL2A 1Q47A 5FQDA 4E5ZB 3JZHA 3C9CA 5TDHB 4PSWB 2AGXA 4D6VA 1K8KC 1TBGA 2UZYB 3VA6A 3RRMC 4CZVA 2AGWA 3RFGA 3KRWB 3JPXA 3OKTA 2GC4A 3I7HA 1GXRA 4CY5A 4XEIC 1U2VC 5FKRA 4OWRA 1VYHC 1PEVA 5IJ7E 4A0BA 2YBAA 3PVUB 5FKSA 3J80g 3IJ0A 5I5MA 3UVMA 5AJAA 3DXKC 3I7OA 4FA5D 4FA4D 4G56B 3MKQA 5EM2A 3UKRC 3SXTD 4ZOYA 2P9PC 3DSMA 5K1CC 4ZOXA 2H9PA 1NR0A 4FA9D 2H13A 3EI4A 2W18A 4O1QD 3SFZA 2IWFA 4O9DA 3PXSD 3AFCA 4Y7RA 5FXYA 4TZ4A 3I8EA 4N14A 2HXCA 2AGLA 3MZKA 4X61B 3EWEA 3RLMD 3MKSB 4O45A 3EI2A 3PVWB 3BG0A 2CN3A 1SQJA 3BG1A 4E5ZA 5CYKB 5FLXg 4KFMB 2CO0C 3SBPA 2OVPB 4CI1A 4JSNC 3OKYA 2I0TA 4PXWA 2Z2NA 4FAVD 5EALA 5I5IA 2H6QA 4J77A 5C2VB 1TYQC 3CFVA 4J84A 3J81g 3I2NA 4J8BA 4NSXA 4A11B 3UKUC 4JXMA 2IAAA 4BUJC 4GQBB 2AH1A 4A09A 4BH6A 2IUVA 2XU7A 4ERQA 5GSAA 2PM9B 3C99A 3EI1B 4U7AA 5H17A 1MG3A 4BL0A 2B5MA 1JMXB 3FRXA 4OZUA 4PBYA 1XIPA 3SCYA 3UR4A 4GQ1A 3VH0A 2P9KC 2HYEA 2P9IC 4EWRA 3FGBA 3AH8B 4J0WA 1NEXB 5CXCB 1ERJA 3E0CA 4HDJA 4J73A 4QQEA 4PC0A 1QNIA 2H9MA 3K26A 2OVQB 4FA1D 3UVNA 4GGAA 2HJBA 4PNKB 3HFQA 2J56H 4CY3A 5TF2A 5EMKB 4GGCA 5CYKA 3IJCA 4A2MA 4XYHA 1P22A 3UVKA 4CI2A 2MTAH 2YNNA 2TRCB 3AL8A 3L4MD 2B5LA 4Z8LA 2PM6B 4ERYA 3JAMg 5IJ8E 4L3HD 4O3TB 5H14A 4IA9A 5KDOB 5FKQA 3NVXA 3F3PA 4CY1A 4E54B 3I7PA 4ESGA 3MMYA 5TEFA 1JOFA 4J78A 4A0AB 3RSEC 3DWLC 3N0EA 2J57G 5EAPA 2CE8A 3ORVD 3SHFA 2PM9A 2H14A 1SQ9A 3EI1A 5GXIA 4X63B 3GFCA 3PE7A 4X3EA 2B5NA 4FB1D 4JT6C 4QL1A 1A0RB 4IMMA 5CXCA 1B9YA 3V5WB 2H3XA 5GXHA 3W15A 3JRPA 4K3ID 1B9XA 3IIWA 1SHYB 4FAND 3C5MA 4LG9A 1N6FA 2YNOA 4JD2C 2AGYA 3DXMC 3RFHA 2HKMA 4J81A 5IGQA 3MZLA 4X60B 4GM3A 1JMZB 2Z2OA 2UZXB 5FA5B 3SMRA 2O9KA 1FWXA 3OW8A 5THAA 4Y5RD 1XHMA 3I7KA 3OL2B 5SXMA 3FM0A 3I89A 2XL2A 4ERZA 3A0FA 5EARA 3OTTA 1MG2A 3U4YA 3BWSA 4FWWA 3P4FA 4CY2A 4AOWA 4GQ2P 5C9ZB 3EU7A 4CC9A 3ODTA 1PI6A 4XYIA 2XL3A 5AMSA 1XKSA 2G99A 4LGNA 4PBZA 2OJYA 4ES0A 2CN2A 3MXXA 3SWSD 4A0BB 2BCJB 2I3SA 3EMHA 1L0QA 1GP2B 2H68A 2BBKH 4QRJA 4ZOZA 4JT5C 4GMBA 3N0DA 1GG2B 4J0XA 4L3GD 3SBQA 2IWKA 4GM9A 5JWZA 1R5MA 3IJ1A 3I7NA 4D0KA 2I3TA 4PSXB 1OLZA 3AL9A 3UVOA 3JZNA 3IIYA 2HJ4A 2IUPA 3RMZD 3JB9L 2OK4A 4R7AB 2H47A 4ZN4A 1U4CA 3EG6A 3NVNA 3NVQA 4ZOVA 2Z2PA 2GNQA 2PBIB 4U1EI 3B7FA 3RN0D 3JROA 4A11A 4L9OA 5I5JA 1YFQA 4CZYA 4JSXC 2Q7QA 4GZ8A 5H1MA 5AFU3 2HKRA 3OKYB 4A7JA 2H6NA 2XYIA 4AEZA 5C2WB 5EMLB 4QT8A 3JZGA 2H9NA 2YB8B 4CI8A 3PSCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B4E A;  3SJL D;  3I8C A;  5TEE A;  3PSL A;  3CFS B;  4CI3 A;  1JJU B;  5HE2 B;  4H5I A;  2P9S C;  3PXT D;  3ZWL B;  5B4W A;  4J86 A;  4A09 B;  2J55 H;  2P9U C;  4FHL A;  3UVL A;  5FKT A;  3KRX B;  5EMJ B;  2AQ5 A;  3IKO A;  4JSP C;  3SN6 B;  4GM8 A;  5EMM B;  1N6E A;  4A2L A;  3VGZ A;  2QC5 A;  3DM0 A;  4K3J B;  3L4O D;  4J79 A;  2AH0 A;  2IUR A;  2YNP A;  3EI3 B;  2CE9 A;  5IC7 A;  1MDA H;  3RN1 D;  3GRE A;  2YMU A;  4O3U B;  5HE0 B;  5CXB B;  4A08 B;  4YVD A;  3SBR A;  4E54 A;  3SLE D;  3SVW D;  4A0A A;  5HYN B;  2OIZ A;  1PGU A;  5HE1 B;  2QXV A;  3F3G A;  1OMW B;  4LG8 A;  4UI9 R;  3F3F A;  2AGZ A;  3AL8 B;  2P9N C;  3CIK B;  3I7L A;  4JSV C;  3K27 A;  5IGO A;  1PBY B;  5A2Q g;  2OK6 A;  1RI6 A;  4L1Q D;  3OKW A;  2CNX A;  5GMK n;  1N6D A;  2IUQ A;  5EM2 B;  4H5J A;  4I79 A;  4J82 A;  2CO0 A;  2I0S A;  3PXW D;  3V9F A;  5K19 A;  2GC7 A;  4GGD A;  2OVR B;  5EAM A;  3EI4 B;  1GOT B;  5HQG A;  3V7D B;  1K32 A;  2EBS A;  3ULE C;  1S4U X;  2G9A A;  3EI3 A;  2PM7 B;  5IT9 g;  4J8G A;  2P9L C;  5HE3 B;  4CZX A;  2H6K A;  4J87 A;  3C75 H;  3EI2 B;  2HES X;  4MK0 B;  2H9L A;  2I0R A;  5CXB A;  4A08 A;  3OL2 A;  1Q47 A;  5FQD A;  4E5Z B;  3JZH A;  3C9C A;  5TDH B;  4PSW B;  2AGX A;  4D6V A;  1K8K C;  1TBG A;  2UZY B;  3VA6 A;  3RRM C;  4CZV A;  2AGW A;  3RFG A;  3KRW B;  3JPX A;  3OKT A;  2GC4 A;  3I7H A;  1GXR A;  4CY5 A;  4XEI C;  1U2V C;  5FKR A;  4OWR A;  1VYH C;  1PEV A;  5IJ7 E;  4A0B A;  2YBA A;  3PVU B;  5FKS A;  3J80 g;  3IJ0 A;  5I5M A;  3UVM A;  5AJA A;  3DXK C;  3I7O A;  4FA5 D;  4FA4 D;  4G56 B;  3MKQ A;  5EM2 A;  3UKR C;  3SXT D;  4ZOY A;  2P9P C;  3DSM A;  5K1C C;  4ZOX A;  2H9P A;  1NR0 A;  4FA9 D;  2H13 A;  3EI4 A;  2W18 A;  4O1Q D;  3SFZ A;  2IWF A;  4O9D A;  3PXS D;  3AFC A;  4Y7R A;  5FXY A;  4TZ4 A;  3I8E A;  4N14 A;  2HXC A;  2AGL A;  3MZK A;  4X61 B;  3EWE A;  3RLM D;  3MKS B;  4O45 A;  3EI2 A;  3PVW B;  3BG0 A;  2CN3 A;  1SQJ A;  3BG1 A;  4E5Z A;  5CYK B;  5FLX g;  4KFM B;  2CO0 C;  3SBP A;  2OVP B;  4CI1 A;  4JSN C;  3OKY A;  2I0T A;  4PXW A;  2Z2N A;  4FAV D;  5EAL A;  5I5I A;  2H6Q A;  4J77 A;  5C2V B;  1TYQ C;  3CFV A;  4J84 A;  3J81 g;  3I2N A;  4J8B A;  4NSX A;  4A11 B;  3UKU C;  4JXM A;  2IAA A;  4BUJ C;  4GQB B;  2AH1 A;  4A09 A;  4BH6 A;  2IUV A;  2XU7 A;  4ERQ A;  5GSA A;  2PM9 B;  3C99 A;  3EI1 B;  4U7A A;  5H17 A;  1MG3 A;  4BL0 A;  2B5M A;  1JMX B;  3FRX A;  4OZU A;  4PBY A;  1XIP A;  3SCY A;  3UR4 A;  4GQ1 A;  3VH0 A;  2P9K C;  2HYE A;  2P9I C;  4EWR A;  3FGB A;  3AH8 B;  4J0W A;  1NEX B;  5CXC B;  1ERJ A;  3E0C A;  4HDJ A;  4J73 A;  4QQE A;  4PC0 A;  1QNI A;  2H9M A;  3K26 A;  2OVQ B;  4FA1 D;  3UVN A;  4GGA A;  2HJB A;  4PNK B;  3HFQ A;  2J56 H;  4CY3 A;  5TF2 A;  5EMK B;  4GGC A;  5CYK A;  3IJC A;  4A2M A;  4XYH A;  1P22 A;  3UVK A;  4CI2 A;  2MTA H;  2YNN A;  2TRC B;  3AL8 A;  3L4M D;  2B5L A;  4Z8L A;  2PM6 B;  4ERY A;  3JAM g;  5IJ8 E;  4L3H D;  4O3T B;  5H14 A;  4IA9 A;  5KDO B;  5FKQ A;  3NVX A;  3F3P A;  4CY1 A;  4E54 B;  3I7P A;  4ESG A;  3MMY A;  5TEF A;  1JOF A;  4J78 A;  4A0A B;  3RSE C;  3DWL C;  3N0E A;  2J57 G;  5EAP A;  2CE8 A;  3ORV D;  3SHF A;  2PM9 A;  2H14 A;  1SQ9 A;  3EI1 A;  5GXI A;  4X63 B;  3GFC A;  3PE7 A;  4X3E A;  2B5N A;  4FB1 D;  4JT6 C;  4QL1 A;  1A0R B;  4IMM A;  5CXC A;  1B9Y A;  3V5W B;  2H3X A;  5GXH A;  3W15 A;  3JRP A;  4K3I D;  1B9X A;  3IIW A;  1SHY B;  4FAN D;  3C5M A;  4LG9 A;  1N6F A;  2YNO A;  4JD2 C;  2AGY A;  3DXM C;  3RFH A;  2HKM A;  4J81 A;  5IGQ A;  3MZL A;  4X60 B;  4GM3 A;  1JMZ B;  2Z2O A;  2UZX B;  5FA5 B;  3SMR A;  2O9K A;  1FWX A;  3OW8 A;  5THA A;  4Y5R D;  1XHM A;  3I7K A;  3OL2 B;  5SXM A;  3FM0 A;  3I89 A;  2XL2 A;  4ERZ A;  3A0F A;  5EAR A;  3OTT A;  1MG2 A;  3U4Y A;  3BWS A;  4FWW A;  3P4F A;  4CY2 A;  4AOW A;  4GQ2 P;  5C9Z B;  3EU7 A;  4CC9 A;  3ODT A;  1PI6 A;  4XYI A;  2XL3 A;  5AMS A;  1XKS A;  2G99 A;  4LGN A;  4PBZ A;  2OJY A;  4ES0 A;  2CN2 A;  3MXX A;  3SWS D;  4A0B B;  2BCJ B;  2I3S A;  3EMH A;  1L0Q A;  1GP2 B;  2H68 A;  2BBK H;  4QRJ A;  4ZOZ A;  4JT5 C;  4GMB A;  3N0D A;  1GG2 B;  4J0X A;  4L3G D;  3SBQ A;  2IWK A;  4GM9 A;  5JWZ A;  1R5M A;  3IJ1 A;  3I7N A;  4D0K A;  2I3T A;  4PSX B;  1OLZ A;  3AL9 A;  3UVO A;  3JZN A;  3IIY A;  2HJ4 A;  2IUP A;  3RMZ D;  3JB9 L;  2OK4 A;  4R7A B;  2H47 A;  4ZN4 A;  1U4C A;  3EG6 A;  3NVN A;  3NVQ A;  4ZOV A;  2Z2P A;  2GNQ A;  2PBI B;  4U1E I;  3B7F A;  3RN0 D;  3JRO A;  4A11 A;  4L9O A;  5I5J A;  1YFQ A;  4CZY A;  4JSX C;  2Q7Q A;  4GZ8 A;  5H1M A;  5AFU 3;  2HKR A;  3OKY B;  4A7J A;  2H6N A;  2XYI A;  4AEZ A;  5C2W B;  5EML B;  4QT8 A;  3JZG A;  2H9N A;  2YB8 B;  4CI8 A;  3PSC B; 
#chains in the Genus database with same CATH topology
 2B4E A;  3SJL D;  3I8C A;  5TEE A;  3PSL A;  3CFS B;  1H2W A;  4CI3 A;  1JJU B;  5HE2 B;  4H5I A;  2P9S C;  3PXT D;  3ZWL B;  5B4W A;  4J86 A;  3O4J A;  4A09 B;  2HU8 A;  2J55 H;  2P9U C;  4FHL A;  2EIE A;  3UVL A;  5FKT A;  1M1X A;  3KRX B;  5M5S A;  5EMJ B;  1UTC A;  2AQ5 A;  3IKO A;  4JSP C;  3SN6 B;  2VDO A;  4GM8 A;  5EMM B;  1N6E A;  2JKX A;  4A2L A;  3VGZ A;  2QC5 A;  3DM0 A;  4K3J B;  3L4O D;  4J79 A;  2AH0 A;  3FCS A;  2IUR A;  2YNP A;  3OF7 A;  5E6U A;  3EI3 B;  2CE9 A;  5IC7 A;  3GD1 I;  1MDA H;  3T3M A;  3RN1 D;  1K3I A;  3GRE A;  2YMU A;  4O3U B;  5HE0 B;  1T2X A;  3T3P A;  5CXB B;  4A08 B;  2VDP A;  4YVD A;  3SBR A;  4E54 A;  3SLE D;  3GC3 B;  3SVW D;  3NIF A;  2BKL A;  5HYN B;  4A0A A;  4L1M A;  3KCI A;  2OIZ A;  1PGU A;  5HE1 B;  2QXV A;  3F3G A;  1OMW B;  4LG8 A;  4UI9 R;  4IRZ A;  3F3F A;  2AGZ A;  3DDU A;  4Z7O A;  3AL8 B;  3V4P A;  2P9N C;  3CIK B;  3I7L A;  4JSV C;  3K27 A;  5IGO A;  1E8N A;  1PBY B;  5A2Q g;  2XZG A;  2OK6 A;  1RI6 A;  1YR2 A;  4L1Q D;  3OKW A;  2CNX A;  1UOQ A;  5M5U A;  5GMK n;  1N6D A;  2IUQ A;  5EM2 B;  4H5J A;  4I79 A;  4J82 A;  2CO0 A;  1UOP A;  2I0S A;  3PXW D;  3V9F A;  3EQ9 A;  5K19 A;  2GC7 A;  4GGD A;  1E8M A;  1BPO A;  2OVR B;  5M5R A;  4WK0 A;  5EAM A;  3EI4 B;  1QFS A;  1GOT B;  2EIC A;  5HQG A;  3V7D B;  3IVM A;  3K6S A;  1K32 A;  2EBS A;  3ULE C;  3NID A;  1UOO A;  1S4U X;  2G9A A;  3EI3 A;  2PM7 B;  4AMZ A;  5IT9 g;  4J8G A;  2P9L C;  5HE3 B;  4CZX A;  2H6K A;  4J87 A;  3C75 H;  3EI2 B;  2HES X;  4MK0 B;  1E5T A;  2H9L A;  2I0R A;  5CXB A;  4A08 A;  3OL2 A;  1Q47 A;  5FQD A;  3VI4 A;  3K71 A;  4E5Z B;  3JZH A;  3IUL A;  3C9C A;  5TDH B;  4PSW B;  2AGX A;  4D6V A;  1K8K C;  1TBG A;  2UZY B;  3VA6 A;  3RRM C;  4CZV A;  2AGW A;  3RFG A;  3KRW B;  4UM8 A;  3JPX A;  1GOG A;  3OKT A;  2GC4 A;  3I7H A;  1GXR A;  4CY5 A;  4BCB A;  4XEI C;  1U2V C;  5FKR A;  4OWR A;  4DNU A;  1VYH C;  4AX4 A;  1PEV A;  5IJ7 E;  4MMX A;  4A0B A;  2YBA A;  3PVU B;  5FKS A;  3J80 g;  3IJ0 A;  1H2Y A;  3VI3 A;  5I5M A;  1H2X A;  3UVM A;  5AJA A;  3NIG A;  3DXK C;  3I7O A;  4FA5 D;  4NEN A;  4G56 B;  4FA4 D;  3MKQ A;  5EM2 A;  3UKR C;  3SXT D;  1GOH A;  4ZOY A;  2P9P C;  3DSM A;  4WK2 A;  5K1C C;  4ZOX A;  2H9P A;  3IUM A;  1NR0 A;  4FA9 D;  4RE5 A;  2H13 A;  3EI4 A;  2W18 A;  4O1Q D;  3SFZ A;  3V4V A;  2IWF A;  4O9D A;  3PXS D;  3ZDX A;  3AFC A;  4Y7R A;  3EQ8 A;  5FXY A;  4TZ4 A;  3I8E A;  2QR5 A;  4N14 A;  2HXC A;  2AGL A;  3MZK A;  3FCU A;  4X61 B;  3EWE A;  3RLM D;  3MKS B;  4O45 A;  3EI2 A;  3PVW B;  3BG0 A;  3MUN A;  4BCC A;  2CN3 A;  1SQJ A;  3BG1 A;  1QFM A;  4E5Z A;  5CYK B;  5FLX g;  4KFM B;  2CO0 C;  3ZDZ A;  3EQ7 A;  3SBP A;  3O4H A;  2OVP B;  4CI1 A;  4JSN C;  3OKY A;  2I0T A;  4PXW A;  2Z2N A;  4FAV D;  5EAL A;  5I5I A;  2H6Q A;  4DNW A;  4J77 A;  5C2V B;  1H2Z A;  1TYQ C;  3CFV A;  4J84 A;  3J81 g;  3I2N A;  4J8B A;  4G55 A;  4NSX A;  2EIB A;  4A11 B;  5FFG A;  1JV2 A;  3UKU C;  2IAA A;  4JXM A;  4BUJ C;  4NC4 A;  4GQB B;  2QZP A;  2AH1 A;  4A09 A;  4BH6 A;  2IUV A;  2XU7 A;  4ERQ A;  5GSA A;  2PM9 B;  3C99 A;  3EI1 B;  4U7A A;  4AN1 A;  5H17 A;  1MG3 A;  4BL0 A;  2B5M A;  1JMX B;  3FRX A;  4OZU A;  4PBY A;  1XIP A;  3SCY A;  4Z7N A;  3UR4 A;  4MMZ A;  4GQ1 A;  3VH0 A;  2P9K C;  2HYE A;  2EID A;  2P9I C;  4EWR A;  3FGB A;  3AH8 B;  5FFO A;  4J0W A;  1NEX B;  4DNV A;  5CXC B;  1ERJ A;  3E0C A;  1C9I A;  3IJE A;  4MMY A;  4HDJ A;  3O4I A;  4JHP C;  4J73 A;  4QQE A;  4PC0 A;  4WK4 A;  4UM9 A;  1QNI A;  2H9M A;  3K26 A;  2OVQ B;  4FA1 D;  3UVN A;  4NAA A;  4GGA A;  2HJB A;  4PNK B;  1VE7 A;  3HFQ A;  2J56 H;  4CY3 A;  5TF2 A;  5EMK B;  4GGC A;  4O2W A;  5CYK A;  3IJC A;  4A2M A;  3IUJ A;  4XYH A;  1GOF A;  1P22 A;  3UVK A;  4CI2 A;  2MTA H;  2YNN A;  2TRC B;  3AL8 A;  1C9L A;  3L4M D;  2B5L A;  4Z8L A;  2PM6 B;  4ERY A;  3JAM g;  5IJ8 E;  4WJK A;  4L3H D;  4O3T B;  5H14 A;  4IA9 A;  5KDO B;  5FKQ A;  3IUQ A;  2VDQ A;  3NVX A;  3F3P A;  4CY1 A;  4E54 B;  3I7P A;  1VZ2 A;  4ESG A;  3MMY A;  5TEF A;  1JOF A;  4J78 A;  4A0A B;  4G1M A;  3RSE C;  3DWL C;  3N0E A;  2J57 G;  5EAP A;  2CE8 A;  3ORV D;  3SHF A;  2PM9 A;  3MVD K;  2H14 A;  2VDN A;  1SQ9 A;  3EI1 A;  5GXI A;  2VZ1 A;  4X63 B;  3GFC A;  1O6F A;  3PE7 A;  4X3E A;  2B5N A;  3MUO A;  4FB1 D;  4O02 A;  4BCD A;  4JT6 C;  4QL1 A;  1A0R B;  4IMM A;  5CXC A;  3ZDY A;  1B9Y A;  3V5W B;  2H3X A;  5E6S A;  5GXH A;  3W15 A;  3JRP A;  4K3I D;  3IUN A;  1B9X A;  3IIW A;  4AMY A;  1SHY B;  4FAN D;  3C5M A;  1O6G A;  1N6F A;  1U8C A;  2YNO A;  4LG9 A;  4JD2 C;  2VDL A;  2AGY A;  3QHY B;  3DXM C;  4NBM A;  4JHN A;  2VZ3 A;  3RFH A;  5HDB A;  2HKM A;  3ZE1 A;  4J81 A;  5IGQ A;  3MZL A;  1L5G A;  4X60 B;  4G1E A;  4GM3 A;  1JMZ B;  2Z2O A;  2UZX B;  5FA5 B;  3SMR A;  5M5T A;  2O9K A;  1FWX A;  3OW8 A;  5THA A;  4Y5R D;  1XHM A;  2VDM A;  3I7K A;  3OL2 B;  1VZ3 A;  3FM0 A;  5SXM A;  5C86 A;  2VDK A;  2VC2 A;  3I89 A;  1VE6 A;  2XL2 A;  4ERZ A;  3A0F A;  5EAR A;  2XDW A;  4BP8 A;  3OTT A;  1MG2 A;  3ZE0 A;  3BWS A;  4FWW A;  3U4Y A;  3P4F A;  4CY2 A;  2WQ8 A;  4AOW A;  4GQ2 P;  5C9Z B;  3EU7 A;  4D9S A;  4CC9 A;  3ODT A;  1PI6 A;  4XYI A;  2XL3 A;  5AMS A;  1XKS A;  2G99 A;  4LGN A;  4PBZ A;  2OJY A;  4ES0 A;  2CN2 A;  3MXX A;  3SWS D;  4A0B B;  2BCJ B;  2I3S A;  3EMH A;  1L0Q A;  1GP2 B;  2H68 A;  2BBK H;  2HU7 A;  4QRJ A;  4ZOZ A;  4JT5 C;  4GMB A;  3N0D A;  1GG2 B;  4J0X A;  4L3G D;  3SBQ A;  2IWK A;  4GM9 A;  4Z7Q A;  5JWZ A;  1R5M A;  3K72 A;  3IJ1 A;  3I7N A;  4D0K A;  2I3T A;  4PSX B;  5E6R A;  1OLZ A;  3AL9 A;  3UVO A;  3JZN A;  3IIY A;  2HJ4 A;  2IUP A;  3RMZ D;  3JB9 L;  3ZE2 A;  2OK4 A;  2XE4 A;  4R7A B;  2H47 A;  4ZN4 A;  3O4G A;  1U4C A;  4QAM A;  5C92 A;  3EG6 A;  2VDR A;  5M61 A;  3NVN A;  3NVQ A;  5M5V A;  4ZOV A;  2Z2P A;  3QI0 A;  2GNQ A;  4BP9 A;  2PBI B;  1JTD B;  1A12 A;  4U1E I;  3B7F A;  3RN0 D;  3JRO A;  1I2M B;  4A11 A;  4L9O A;  4RE6 A;  1YFQ A;  5I5J A;  4CZY A;  3IUR A;  4JSX C;  1TYE A;  4AN0 A;  2Q7Q A;  4GZ8 A;  5H1M A;  5AFU 3;  2HKR A;  2HU5 A;  3OKY B;  4A7J A;  2H6N A;  2XYI A;  4AEZ A;  5C2W B;  5EML B;  4QT8 A;  3JZG A;  2H9N A;  2YB8 B;  4CI8 A;  3PSC B; 
#chains in the Genus database with same CATH homology
 2B4E A;  3SJL D;  3I8C A;  5TEE A;  3PSL A;  3CFS B;  4CI3 A;  1JJU B;  5HE2 B;  4H5I A;  2P9S C;  3PXT D;  3ZWL B;  5B4W A;  4J86 A;  4A09 B;  2J55 H;  2P9U C;  4FHL A;  3UVL A;  5FKT A;  3KRX B;  5EMJ B;  2AQ5 A;  3IKO A;  4JSP C;  3SN6 B;  4GM8 A;  5EMM B;  1N6E A;  4A2L A;  3VGZ A;  2QC5 A;  3DM0 A;  4K3J B;  3L4O D;  4J79 A;  2AH0 A;  2IUR A;  2YNP A;  3EI3 B;  2CE9 A;  5IC7 A;  1MDA H;  3RN1 D;  3GRE A;  2YMU A;  4O3U B;  5HE0 B;  5CXB B;  4A08 B;  4YVD A;  3SBR A;  4E54 A;  3SLE D;  3SVW D;  4A0A A;  5HYN B;  2OIZ A;  1PGU A;  5HE1 B;  2QXV A;  3F3G A;  1OMW B;  4LG8 A;  4UI9 R;  3F3F A;  2AGZ A;  3AL8 B;  2P9N C;  3CIK B;  3I7L A;  4JSV C;  3K27 A;  5IGO A;  1PBY B;  5A2Q g;  2OK6 A;  1RI6 A;  4L1Q D;  3OKW A;  2CNX A;  5GMK n;  1N6D A;  2IUQ A;  5EM2 B;  4H5J A;  4I79 A;  4J82 A;  2CO0 A;  2I0S A;  3PXW D;  3V9F A;  5K19 A;  2GC7 A;  4GGD A;  2OVR B;  5EAM A;  3EI4 B;  1GOT B;  5HQG A;  3V7D B;  1K32 A;  2EBS A;  3ULE C;  1S4U X;  2G9A A;  3EI3 A;  2PM7 B;  5IT9 g;  4J8G A;  2P9L C;  5HE3 B;  4CZX A;  2H6K A;  4J87 A;  3C75 H;  3EI2 B;  2HES X;  4MK0 B;  2H9L A;  2I0R A;  5CXB A;  4A08 A;  3OL2 A;  1Q47 A;  5FQD A;  4E5Z B;  3JZH A;  3C9C A;  5TDH B;  4PSW B;  2AGX A;  4D6V A;  1K8K C;  1TBG A;  2UZY B;  3VA6 A;  3RRM C;  4CZV A;  2AGW A;  3RFG A;  3KRW B;  3JPX A;  3OKT A;  2GC4 A;  3I7H A;  1GXR A;  4CY5 A;  4XEI C;  1U2V C;  5FKR A;  4OWR A;  1VYH C;  1PEV A;  5IJ7 E;  4A0B A;  2YBA A;  3PVU B;  5FKS A;  3J80 g;  3IJ0 A;  5I5M A;  3UVM A;  5AJA A;  3DXK C;  3I7O A;  4FA5 D;  4FA4 D;  4G56 B;  3MKQ A;  5EM2 A;  3UKR C;  3SXT D;  4ZOY A;  2P9P C;  3DSM A;  5K1C C;  4ZOX A;  2H9P A;  1NR0 A;  4FA9 D;  2H13 A;  3EI4 A;  2W18 A;  4O1Q D;  3SFZ A;  2IWF A;  4O9D A;  3PXS D;  3AFC A;  4Y7R A;  5FXY A;  4TZ4 A;  3I8E A;  4N14 A;  2HXC A;  2AGL A;  3MZK A;  4X61 B;  3EWE A;  3RLM D;  3MKS B;  4O45 A;  3EI2 A;  3PVW B;  3BG0 A;  2CN3 A;  1SQJ A;  3BG1 A;  4E5Z A;  5CYK B;  5FLX g;  4KFM B;  2CO0 C;  3SBP A;  2OVP B;  4CI1 A;  4JSN C;  3OKY A;  2I0T A;  4PXW A;  2Z2N A;  4FAV D;  5EAL A;  5I5I A;  2H6Q A;  4J77 A;  5C2V B;  1TYQ C;  3CFV A;  4J84 A;  3J81 g;  3I2N A;  4J8B A;  4NSX A;  4A11 B;  3UKU C;  4JXM A;  2IAA A;  4BUJ C;  4GQB B;  2AH1 A;  4A09 A;  4BH6 A;  2IUV A;  2XU7 A;  4ERQ A;  5GSA A;  2PM9 B;  3C99 A;  3EI1 B;  4U7A A;  5H17 A;  1MG3 A;  4BL0 A;  2B5M A;  1JMX B;  3FRX A;  4OZU A;  4PBY A;  1XIP A;  3SCY A;  3UR4 A;  4GQ1 A;  3VH0 A;  2P9K C;  2HYE A;  2P9I C;  4EWR A;  3FGB A;  3AH8 B;  4J0W A;  1NEX B;  5CXC B;  1ERJ A;  3E0C A;  4HDJ A;  4J73 A;  4QQE A;  4PC0 A;  1QNI A;  2H9M A;  3K26 A;  2OVQ B;  4FA1 D;  3UVN A;  4GGA A;  2HJB A;  4PNK B;  3HFQ A;  2J56 H;  4CY3 A;  5TF2 A;  5EMK B;  4GGC A;  5CYK A;  3IJC A;  4A2M A;  4XYH A;  1P22 A;  3UVK A;  4CI2 A;  2MTA H;  2YNN A;  2TRC B;  3AL8 A;  3L4M D;  2B5L A;  4Z8L A;  2PM6 B;  4ERY A;  3JAM g;  5IJ8 E;  4L3H D;  4O3T B;  5H14 A;  4IA9 A;  5KDO B;  5FKQ A;  3NVX A;  3F3P A;  4CY1 A;  4E54 B;  3I7P A;  4ESG A;  3MMY A;  5TEF A;  1JOF A;  4J78 A;  4A0A B;  3RSE C;  3DWL C;  3N0E A;  2J57 G;  5EAP A;  2CE8 A;  3ORV D;  3SHF A;  2PM9 A;  2H14 A;  1SQ9 A;  3EI1 A;  5GXI A;  4X63 B;  3GFC A;  3PE7 A;  4X3E A;  2B5N A;  4FB1 D;  4JT6 C;  4QL1 A;  1A0R B;  4IMM A;  5CXC A;  1B9Y A;  3V5W B;  2H3X A;  5GXH A;  3W15 A;  3JRP A;  4K3I D;  1B9X A;  3IIW A;  1SHY B;  4FAN D;  3C5M A;  4LG9 A;  1N6F A;  2YNO A;  4JD2 C;  2AGY A;  3DXM C;  3RFH A;  2HKM A;  4J81 A;  5IGQ A;  3MZL A;  4X60 B;  4GM3 A;  1JMZ B;  2Z2O A;  2UZX B;  5FA5 B;  3SMR A;  2O9K A;  1FWX A;  3OW8 A;  5THA A;  4Y5R D;  1XHM A;  3I7K A;  3OL2 B;  5SXM A;  3FM0 A;  3I89 A;  2XL2 A;  4ERZ A;  3A0F A;  5EAR A;  3OTT A;  1MG2 A;  3U4Y A;  3BWS A;  4FWW A;  3P4F A;  4CY2 A;  4AOW A;  4GQ2 P;  5C9Z B;  3EU7 A;  4CC9 A;  3ODT A;  1PI6 A;  4XYI A;  2XL3 A;  5AMS A;  1XKS A;  2G99 A;  4LGN A;  4PBZ A;  2OJY A;  4ES0 A;  2CN2 A;  3MXX A;  3SWS D;  4A0B B;  2BCJ B;  2I3S A;  3EMH A;  1L0Q A;  1GP2 B;  2H68 A;  2BBK H;  4QRJ A;  4ZOZ A;  4JT5 C;  4GMB A;  3N0D A;  1GG2 B;  4J0X A;  4L3G D;  3SBQ A;  2IWK A;  4GM9 A;  5JWZ A;  1R5M A;  3IJ1 A;  3I7N A;  4D0K A;  2I3T A;  4PSX B;  1OLZ A;  3AL9 A;  3UVO A;  3JZN A;  3IIY A;  2HJ4 A;  2IUP A;  3RMZ D;  3JB9 L;  2OK4 A;  4R7A B;  2H47 A;  4ZN4 A;  1U4C A;  3EG6 A;  3NVN A;  3NVQ A;  4ZOV A;  2Z2P A;  2GNQ A;  2PBI B;  4U1E I;  3B7F A;  3RN0 D;  3JRO A;  4A11 A;  4L9O A;  5I5J A;  1YFQ A;  4CZY A;  4JSX C;  2Q7Q A;  4GZ8 A;  5H1M A;  5AFU 3;  2HKR A;  3OKY B;  4A7J A;  2H6N A;  2XYI A;  4AEZ A;  5C2W B;  5EML B;  4QT8 A;  3JZG A;  2H9N A;  2YB8 B;  4CI8 A;  3PSC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...