2H9MA

Wdr5 in complex with unmodified h3k4 peptide
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
304
structure length
304
Chain Sequence
b'VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD-repeat protein 5
molecule tags Structural genomics, gene regulation
source organism Homo sapiens
publication title Structural basis for molecular recognition and presentation of histone H3 By WDR5.
pubmed doi rcsb
total genus 101
structure length 304
sequence length 304
chains with identical sequence C
ec nomenclature
pdb deposition date 2006-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2h9mA00
2H3XA 3JZHA 3IIYA 5FA5B 3PSCB 4J0WA 4U7AA 2H14A 3SXTD 3VH0A 5IC7A 3FGBA 3EU7A 3JZGA 5FQDA 3I8EA 2B5NA 3J80g 3DWLC 3PVUB 3ODTA 2I3SA 2P9UC 3OKYA 4J84A 3RN0D 2B4EA 3L4OD 4A7JA 3OL2B 4JSVC 5HQGA 4JSPC 3F3PA 5EMMB 2J55H 5TEFA 1GOTB 1P22A 3PVWB 4NSXA 4JSNC 2H13A 4MK0B 5GSAA 5I5IA 5I5MA 3VGZA 4GQ2P 2YNOA 5EMLB 4X61B 2HJBA 5FKSA 4IMMA 3SBQA 5IGQA 3AL8A 3A0FA 3OKTA 3KRWB 1MDAH 2HJ4A 3IJ0A 1JMXB 4N14A 3EI3B 3AH8B 3PSLA 5AJAA 5A2Qg 3RLMD 3ORVD 2IUVA 4FA5D 2IURA 3P4FA 3V5WB 3MXXA 4X3EA 1SHYB 4ZOZA 4K3JB 4O3UB 2OVRB 3I7NA 2AGZA 4FB1D 2HESX 4LG8A 4JXMA 1ERJA 3W15A 3EI3A 4GGAA 3SFZA 2G9AA 4E5ZA 2CN2A 3ZWLB 1JOFA 2P9NC 2PM7B 4FHLA 2B5MA 3OL2A 4JSXC 4J8GA 2H47A 2AGLA 4FAVD 4CY2A 4A11A 1N6EA 2B5LA 2OIZA 4JT5C 3EI4B 4L1QD 2AH0A 5H14A 2P9IC 3UVOA 2P9SC 3C75H 3OKWA 3OKYB 2OVQB 5C2VB 2IAAA 3RSEC 3SHFA 3SMRA 3I7PA 5GXIA 5EM2B 4LGNA 4GM8A 4BL0A 5IJ7E 5C2WB 2J57G 4BUJC 2IWFA 3F3GA 3I7OA 4GMBA 4J78A 3MZLA 4PXWA 4XEIC 3JROA 4PSWB 3SBRA 3NVNA 1A0RB 2H68A 1YFQA 2AGXA 4L3HD 4Z8LA 4ZOXA 3AFCA 4PBZA 4O9DA 4UI9R 3SWSD 3L4MD 3ULEC 2CN3A 2AQ5A 3SCYA 1PGUA 2GNQA 5IGOA 4G56B 3EWEA 2QXVA 4FA4D 3IJ1A 4CI8A 5HYNB 4X60B 4A0AB 4A11B 2UZXB 2Q7QA 2Z2NA 1K8KC 4PC0A 3FRXA 4L9OA 3V7DB 4FA1D 4A0BB 4J0XA 3UVMA 4ERZA 4U1EI 5TF2A 2O9KA 4A0AA 4QQEA 3JPXA 4O45A 3PE7A 3E0CA 4FWWA 3EMHA 3RN1D 2AGYA 5EM2A 2CE8A 1GG2B 5EMKB 3NVQA 1XIPA 1B9YA 1QNIA 3OW8A 2J56H 2XL2A 3FM0A 4H5JA 4A08B 4GM9A 1OLZA 2YMUA 5HE0B 5SXMA 3IIWA 4QT8A 4PNKB 2YNPA 3IJCA 4CI3A 4A08A 5TDHB 3EI1B 3UKRC 3DXMC 4Y7RA 4A09A 4PBYA 1VYHC 2YNNA 3UKUC 2Z2OA 3B7FA 2CE9A 5EALA 1R5MA 3EI2A 4H5IA 4R7AB 4I79A 4JD2C 4D6VA 4CI1A 3RFGA 3F3FA 4J87A 4J73A 4A0BA 5GXHA 3DM0A 5EAPA 3I2NA 1MG3A 3EG6A 3UVNA 3J81g 2AGWA 2I0RA 2P9KC 5K1CC 4XYIA 5TEEA 4J82A 4ES0A 1MG2A 3V9FA 1JJUB 2EBSA 3MZKA 1L0QA 4QRJA 3UR4A 1RI6A 3C9CA 5EMJB 4ERQA 2IUQA 3C99A 1U2VC 2H6KA 2QC5A 2YBAA 4A2MA 4ZOYA 1PI6A 3EI4A 3C5MA 5C9ZB 2HKRA 2AH1A 5CXCA 4GQ1A 5HE2B 1SQ9A 4E54B 2OK6A 4GM3A 2H9PA 4GQBB 3KRXB 4ESGA 1N6DA 3N0DA 3PXWD 4QL1A 4E54A 2PM9A 3I7KA 3RMZD 4PSXB 3EI1A 1N6FA 5JWZA 3AL9A 5KDOB 3BG1A 2Z2PA 3SVWD 2OK4A 2PM9B 3NVXA 2H9LA 5CXCB 3CIKB 4IA9A 5THAA 2HKMA 1Q47A 3OTTA 4GZ8A 2TRCB 5EAMA 2MTAH 2HYEA 3JRPA 2CO0A 4CY3A 3BG0A 5IJ8E 5IT9g 5AFU3 3IKOA 3SLED 1JMZB 2W18A 2I0TA 5FXYA 4BH6A 5GMKn 3MMYA 1S4UX 2XL3A 5H17A 3GFCA 5FKQA 1K32A 2OJYA 4ZOVA 4TZ4A 4CY1A 4LG9A 4FAND 5FLXg 5B4WA 4J77A 4OWRA 2H9MA 2I3TA 3DSMA 3VA6A 4JT6C 2BBKH 3U4YA 4X63B 1OMWB 3JZNA 5AMSA 5CYKB 5FKRA 3I7HA 3AL8B 2P9LC 4AOWA 4CZYA 4HDJA 4J8BA 1B9XA 1TBGA 2G99A 2H6QA 2HXCA 2UZYB 4AEZA 2BCJB 3SJLD 4J81A 5FKTA 5CXBB 2YB8B 3UVKA 3I89A 3K26A 3BWSA 1U4CA 3I8CA 4GGDA 5EARA 3RFHA 1XHMA 4E5ZB 3K27A 3MKSB 3I7LA 4CZXA 5K19A 4CI2A 2XU7A 5HE3B 4Y5RD 2GC4A 2GC7A 1GXRA 4XYHA 2CNXA 4CC9A 1NR0A 2IUPA 2CO0C 2H6NA 3N0EA 3HFQA 3RRMC 3MKQA 2IWKA 4J86A 3SN6B 2XYIA 4O3TB 4ZN4A 4GGCA 4O1QD 1XKSA 4ERYA 4D0KA 4A2LA 3JB9L 1NEXB 3DXKC 1FWXA 3JAMg 1TYQC 2P9PC 1GP2B 4YVDA 4CY5A 4K3ID 5CYKA 2PM6B 3CFVA 4KFMB 4FA9D 3UVLA 2PBIB 3SBPA 3PXTD 3EI2B 3CFSB 4L3GD 1PEVA 4A09B 4EWRA 5CXBA 2H9NA 3PXSD 5H1MA 3GREA 4OZUA 5HE1B 1SQJA 5I5JA 2OVPB 4CZVA 4J79A 2I0SA 1PBYB
chains in the Genus database with same CATH superfamily
1C9IA 2H3XA 3JZHA 3IIYA 5FA5B 3PSCB 4J0WA 4U7AA 2H14A 3SXTD 4DNWA 3VH0A 2VZ1A 5IC7A 3FGBA 3EU7A 3JZGA 5FQDA 3I8EA 2B5NA 3J80g 3DWLC 3PVUB 3ODTA 2I3SA 2P9UC 3OKYA 3IUMA 4J84A 3RN0D 2B4EA 3L4OD 4MMZA 4A7JA 3OL2B 4JSVC 5HQGA 4AMYA 4JSPC 3F3PA 5EMMB 2J55H 5TEFA 1GOTB 1P22A 3PVWB 4NSXA 4JSNC 2H13A 3O4GA 1TYEA 4MK0B 5GSAA 5I5IA 5I5MA 3VGZA 4GQ2P 2YNOA 5EMLB 4X61B 3ZE1A 2HJBA 5FKSA 2BKLA 4IMMA 3SBQA 5IGQA 3AL8A 3A0FA 3OKTA 3KRWB 1MDAH 2HJ4A 1E8MA 3IJ0A 1JMXB 4N14A 3EI3B 3AH8B 3PSLA 1H2WA 4UM8A 5AJAA 5A2Qg 3RLMD 3ORVD 5M5VA 2IUVA 1T2XA 4FA5D 2IURA 3P4FA 3V5WB 3MXXA 4X3EA 4UM9A 1SHYB 4ZOZA 4K3JB 4O3UB 2OVRB 3I7NA 2AGZA 4FB1D 2HESX 4LG8A 3ZE0A 4JXMA 1ERJA 3W15A 3EI3A 2XZGA 3V4VA 3VI3A 4GGAA 3SFZA 2G9AA 4E5ZA 2CN2A 3K72A 3ZWLB 1JOFA 2P9NC 2PM7B 4FHLA 2B5MA 3OL2A 4JSXC 4J8GA 2H47A 3ZDYA 2AGLA 4FAVD 4CY2A 4A11A 5M5TA 1VE7A 1N6EA 2B5LA 2OIZA 1GOHA 4JT5C 3EI4B 4L1QD 2AH0A 5H14A 2P9IC 3UVOA 2P9SC 3C75H 3OKWA 3OKYB 5HDBA 1JV2A 2OVQB 4IRZA 5C2VB 2VDOA 2IAAA 3RSEC 3SHFA 3SMRA 3I7PA 5GXIA 5EM2B 4LGNA 4GM8A 4BL0A 5IJ7E 5C2WB 2J57G 4BUJC 2IWFA 3F3GA 3I7OA 4GMBA 4J78A 3MZLA 4PXWA 4XEIC 3JROA 3QI0A 4PSWB 3SBRA 3NVNA 1A0RB 2H68A 2AGXA 1YFQA 4L3HD 4Z8LA 4ZOXA 3AFCA 4PBZA 4O9DA 4UI9R 3SWSD 3L4MD 3ULEC 2CN3A 1E5TA 2AQ5A 3SCYA 1PGUA 2GNQA 5IGOA 4G56B 3IURA 4BP9A 3EWEA 3EQ8A 2QXVA 4FA4D 3IJ1A 4Z7OA 4CI8A 5HYNB 4X60B 5FFOA 4A0AB 4A11B 2UZXB 2Q7QA 2VC2A 1K8KC 2Z2NA 3FRXA 4L9OA 4PC0A 3V7DB 4DNUA 4FA1D 4Z7QA 4A0BB 4J0XA 3UVMA 4ERZA 4U1EI 5TF2A 5E6UA 2O9KA 4A0AA 3JPXA 4QQEA 4O45A 3PE7A 3E0CA 4FWWA 3EMHA 3RN1D 2AGYA 5EM2A 1L5GA 2CE8A 5M5RA 1GG2B 5EMKB 1O6GA 1BPOA 3IVMA 3NVQA 4BCDA 1XIPA 2QZPA 3GD1I 1C9LA 1B9YA 1QNIA 3OW8A 2J56H 2XL2A 3FM0A 4H5JA 3MVDK 4A08B 4GM9A 1OLZA 4RE5A 2YMUA 5HE0B 2VDKA 5SXMA 3IIWA 4G55A 4G1MA 4QT8A 4PNKB 2YNPA 3IJCA 5E6RA 4CI3A 4A08A 5TDHB 3EI1B 3UKRC 1I2MB 3DXMC 4Y7RA 4A09A 4PBYA 1VYHC 2YNNA 3FCSA 3UKUC 2Z2OA 3B7FA 2CE9A 5EALA 1R5MA 3EI2A 4H5IA 2VDRA 4G1EA 2JKXA 4R7AB 4I79A 4JD2C 4D6VA 4CI1A 3ZE2A 3RFGA 3F3FA 4J87A 3IUJA 4J73A 4A0BA 1O6FA 5GXHA 3DM0A 5EAPA 3I2NA 3T3MA 1MG3A 5C86A 3EG6A 3UVNA 3J81g 2AGWA 2I0RA 2VDQA 2P9KC 3O4IA 3O4HA 5K1CC 4Z7NA 4XYIA 5TEEA 4J82A 4ES0A 1MG2A 3V9FA 1JJUB 2EBSA 2HU5A 3MZKA 1L0QA 4QRJA 3UR4A 4L1MA 1RI6A 4MMYA 1QFSA 3C9CA 5EMJB 4ERQA 1UTCA 2IUQA 3C99A 1U2VC 3IULA 2H6KA 2QC5A 4O02A 2YBAA 4A2MA 4ZOYA 1PI6A 3EI4A 3C5MA 5C9ZB 2HKRA 4BCBA 2AH1A 5CXCA 5M61A 3K71A 4GQ1A 5HE2B 1SQ9A 3VI4A 4E54B 2OK6A 4GM3A 2H9PA 1QFMA 3NIFA 4GQBB 3KRXB 4ESGA 4JHPC 1N6DA 2EIDA 3N0DA 3NIDA 3PXWD 3QHYB 4QL1A 4E54A 2PM9A 3I7KA 3RMZD 4PSXB 1GOGA 3EI1A 1N6FA 5JWZA 3AL9A 4O2WA 5KDOB 3BG1A 2Z2PA 3SVWD 2OK4A 2PM9B 3NVXA 2H9LA 5CXCB 3CIKB 4IA9A 3MUOA 5THAA 4AX4A 2HKMA 1Q47A 3OTTA 4GZ8A 1JTDB 2TRCB 5EAMA 2MTAH 2HYEA 1VZ2A 2EIBA 3JRPA 2CO0A 4CY3A 3BG0A 5IJ8E 1U8CA 5IT9g 3K6SA 3ZDZA 5AFU3 1YR2A 1UOPA 3IKOA 3SLED 1JMZB 2W18A 2I0TA 5FXYA 4BH6A 5GMKn 3MMYA 1S4UX 1A12A 2XL3A 5H17A 3GFCA 4WJKA 5FKQA 1K32A 2OJYA 4ZOVA 4WK4A 3O4JA 4TZ4A 1M1XA 4CY1A 4LG9A 4FAND 5FLXg 4WK0A 3KCIA 5B4WA 4J77A 2HU8A 4OWRA 2H9MA 3NIGA 2I3TA 3DSMA 4NC4A 3VA6A 4JT6C 2BBKH 5M5UA 4AMZA 3U4YA 2EICA 4MMXA 1K3IA 1OMWB 3JZNA 4X63B 2HU7A 5CYKB 5AMSA 5FKRA 3I7HA 3AL8B 2P9LC 4AOWA 4CZYA 4HDJA 4J8BA 4AN0A 1B9XA 1TBGA 4NENA 2G99A 2H6QA 2HXCA 2UZYB 4AEZA 1GOFA 2BCJB 3SJLD 3EQ9A 1H2ZA 4J81A 5FKTA 2VDPA 4NBMA 5CXBB 3V4PA 2YB8B 3UVKA 3I89A 3K26A 3BWSA 4AN1A 1U4CA 2WQ8A 3I8CA 3IUNA 4GGDA 5EARA 3RFHA 1XHMA 3T3PA 3K27A 4E5ZB 3MKSB 2VDLA 3I7LA 2XDWA 4QAMA 3FCUA 4CZXA 5K19A 4CI2A 2VDNA 2XU7A 4BP8A 5HE3B 4Y5RD 2GC4A 2GC7A 1GXRA 1VZ3A 4XYHA 2CNXA 2QR5A 1H2YA 3GC3B 4CC9A 1NR0A 4NAAA 2IUPA 2CO0C 2H6NA 3N0EA 5C92A 3HFQA 3RRMC 3MKQA 2IWKA 4J86A 3SN6B 2XYIA 3EQ7A 4O3TB 4ZN4A 4GGCA 4O1QD 1XKSA 4ERYA 4D0KA 4A2LA 3JB9L 1NEXB 3DXKC 3DDUA 1FWXA 5E6SA 3JAMg 1UOQA 1TYQC 2P9PC 2EIEA 3OF7A 3ZDXA 1GP2B 4YVDA 4CY5A 3IJEA 3MUNA 4K3ID 5CYKA 2PM6B 3CFVA 4KFMB 4FA9D 1UOOA 3UVLA 2PBIB 3SBPA 3PXTD 4WK2A 3EI2B 4DNVA 3CFSB 4L3GD 1PEVA 4A09B 2VZ3A 4JHNA 4EWRA 2H9NA 3PXSD 5CXBA 5FFGA 5H1MA 3GREA 4OZUA 5HE1B 1VE6A 1SQJA 4BCCA 5I5JA 5M5SA 2VDMA 2OVPB 1H2XA 3IUQA 4CZVA 4J79A 4D9SA 1E8NA 2XE4A 4RE6A 2I0SA 1PBYB
chains in the Genus database with same CATH topology
2H3XA 3JZHA 3IIYA 5FA5B 3PSCB 4J0WA 4U7AA 2H14A 3SXTD 3VH0A 5IC7A 3FGBA 3EU7A 3JZGA 5FQDA 3I8EA 2B5NA 3J80g 3DWLC 3PVUB 3ODTA 2I3SA 2P9UC 3OKYA 4J84A 3RN0D 2B4EA 3L4OD 4A7JA 3OL2B 4JSVC 5HQGA 4JSPC 3F3PA 5EMMB 2J55H 5TEFA 1GOTB 1P22A 3PVWB 4NSXA 4JSNC 2H13A 4MK0B 5GSAA 5I5IA 5I5MA 3VGZA 4GQ2P 2YNOA 5EMLB 4X61B 2HJBA 5FKSA 4IMMA 3SBQA 5IGQA 3AL8A 3A0FA 3OKTA 3KRWB 1MDAH 2HJ4A 3IJ0A 1JMXB 4N14A 3EI3B 3AH8B 3PSLA 5AJAA 5A2Qg 3RLMD 3ORVD 2IUVA 4FA5D 2IURA 3P4FA 3V5WB 3MXXA 4X3EA 1SHYB 4ZOZA 4K3JB 4O3UB 2OVRB 3I7NA 2AGZA 4FB1D 2HESX 4LG8A 4JXMA 1ERJA 3W15A 3EI3A 4GGAA 3SFZA 2G9AA 4E5ZA 2CN2A 3ZWLB 1JOFA 2P9NC 2PM7B 4FHLA 2B5MA 3OL2A 4JSXC 4J8GA 2H47A 2AGLA 4FAVD 4CY2A 4A11A 1N6EA 2B5LA 2OIZA 4JT5C 3EI4B 4L1QD 2AH0A 5H14A 2P9IC 3UVOA 2P9SC 3C75H 3OKWA 3OKYB 2OVQB 5C2VB 2IAAA 3RSEC 3SHFA 3SMRA 3I7PA 5GXIA 5EM2B 4LGNA 4GM8A 4BL0A 5IJ7E 5C2WB 2J57G 4BUJC 2IWFA 3F3GA 3I7OA 4GMBA 4J78A 3MZLA 4PXWA 4XEIC 3JROA 4PSWB 3SBRA 3NVNA 1A0RB 2H68A 1YFQA 2AGXA 4L3HD 4Z8LA 4ZOXA 3AFCA 4PBZA 4O9DA 4UI9R 3SWSD 3L4MD 3ULEC 2CN3A 2AQ5A 3SCYA 1PGUA 2GNQA 5IGOA 4G56B 3EWEA 2QXVA 4FA4D 3IJ1A 4CI8A 5HYNB 4X60B 4A0AB 4A11B 2UZXB 2Q7QA 2Z2NA 1K8KC 4PC0A 3FRXA 4L9OA 3V7DB 4FA1D 4A0BB 4J0XA 3UVMA 4ERZA 4U1EI 5TF2A 2O9KA 4A0AA 4QQEA 3JPXA 4O45A 3PE7A 3E0CA 4FWWA 3EMHA 3RN1D 2AGYA 5EM2A 2CE8A 1GG2B 5EMKB 3NVQA 1XIPA 1B9YA 1QNIA 3OW8A 2J56H 2XL2A 3FM0A 4H5JA 4A08B 4GM9A 1OLZA 2YMUA 5HE0B 5SXMA 3IIWA 4QT8A 4PNKB 2YNPA 3IJCA 4CI3A 4A08A 5TDHB 3EI1B 3UKRC 3DXMC 4Y7RA 4A09A 4PBYA 1VYHC 2YNNA 3UKUC 2Z2OA 3B7FA 2CE9A 5EALA 1R5MA 3EI2A 4H5IA 4R7AB 4I79A 4JD2C 4D6VA 4CI1A 3RFGA 3F3FA 4J87A 4J73A 4A0BA 5GXHA 3DM0A 5EAPA 3I2NA 1MG3A 3EG6A 3UVNA 3J81g 2AGWA 2I0RA 2P9KC 5K1CC 4XYIA 5TEEA 4J82A 4ES0A 1MG2A 3V9FA 1JJUB 2EBSA 3MZKA 1L0QA 4QRJA 3UR4A 1RI6A 3C9CA 5EMJB 4ERQA 2IUQA 3C99A 1U2VC 2H6KA 2QC5A 2YBAA 4A2MA 4ZOYA 1PI6A 3EI4A 3C5MA 5C9ZB 2HKRA 2AH1A 5CXCA 4GQ1A 5HE2B 1SQ9A 4E54B 2OK6A 4GM3A 2H9PA 4GQBB 3KRXB 4ESGA 1N6DA 3N0DA 3PXWD 4QL1A 4E54A 2PM9A 3I7KA 3RMZD 4PSXB 3EI1A 1N6FA 5JWZA 3AL9A 5KDOB 3BG1A 2Z2PA 3SVWD 2OK4A 2PM9B 3NVXA 2H9LA 5CXCB 3CIKB 4IA9A 5THAA 2HKMA 1Q47A 3OTTA 4GZ8A 2TRCB 5EAMA 2MTAH 2HYEA 3JRPA 2CO0A 4CY3A 3BG0A 5IJ8E 5IT9g 5AFU3 3IKOA 3SLED 1JMZB 2W18A 2I0TA 5FXYA 4BH6A 5GMKn 3MMYA 1S4UX 2XL3A 5H17A 3GFCA 5FKQA 1K32A 2OJYA 4ZOVA 4TZ4A 4CY1A 4LG9A 4FAND 5FLXg 5B4WA 4J77A 4OWRA 2H9MA 2I3TA 3DSMA 3VA6A 4JT6C 2BBKH 3U4YA 4X63B 1OMWB 3JZNA 5AMSA 5CYKB 5FKRA 3I7HA 3AL8B 2P9LC 4AOWA 4CZYA 4HDJA 4J8BA 1B9XA 1TBGA 2G99A 2H6QA 2HXCA 2UZYB 4AEZA 2BCJB 3SJLD 4J81A 5FKTA 5CXBB 2YB8B 3UVKA 3I89A 3K26A 3BWSA 1U4CA 3I8CA 4GGDA 5EARA 3RFHA 1XHMA 4E5ZB 3K27A 3MKSB 3I7LA 4CZXA 5K19A 4CI2A 2XU7A 5HE3B 4Y5RD 2GC4A 2GC7A 1GXRA 4XYHA 2CNXA 4CC9A 1NR0A 2IUPA 2CO0C 2H6NA 3N0EA 3HFQA 3RRMC 3MKQA 2IWKA 4J86A 3SN6B 2XYIA 4O3TB 4ZN4A 4GGCA 4O1QD 1XKSA 4ERYA 4D0KA 4A2LA 3JB9L 1NEXB 3DXKC 1FWXA 3JAMg 1TYQC 2P9PC 1GP2B 4YVDA 4CY5A 4K3ID 5CYKA 2PM6B 3CFVA 4KFMB 4FA9D 3UVLA 2PBIB 3SBPA 3PXTD 3EI2B 3CFSB 4L3GD 1PEVA 4A09B 4EWRA 5CXBA 2H9NA 3PXSD 5H1MA 3GREA 4OZUA 5HE1B 1SQJA 5I5JA 2OVPB 4CZVA 4J79A 2I0SA 1PBYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H3X A;  3JZH A;  3IIY A;  5FA5 B;  3PSC B;  4J0W A;  4U7A A;  2H14 A;  3SXT D;  3VH0 A;  5IC7 A;  3FGB A;  3EU7 A;  3JZG A;  5FQD A;  3I8E A;  2B5N A;  3J80 g;  3DWL C;  3PVU B;  3ODT A;  2I3S A;  2P9U C;  3OKY A;  4J84 A;  3RN0 D;  2B4E A;  3L4O D;  4A7J A;  3OL2 B;  4JSV C;  5HQG A;  4JSP C;  3F3P A;  5EMM B;  2J55 H;  5TEF A;  1GOT B;  1P22 A;  3PVW B;  4NSX A;  4JSN C;  2H13 A;  4MK0 B;  5GSA A;  5I5I A;  5I5M A;  3VGZ A;  4GQ2 P;  2YNO A;  5EML B;  4X61 B;  2HJB A;  5FKS A;  4IMM A;  3SBQ A;  5IGQ A;  3AL8 A;  3A0F A;  3OKT A;  3KRW B;  1MDA H;  2HJ4 A;  3IJ0 A;  1JMX B;  4N14 A;  3EI3 B;  3AH8 B;  3PSL A;  5AJA A;  5A2Q g;  3RLM D;  3ORV D;  2IUV A;  4FA5 D;  2IUR A;  3P4F A;  3V5W B;  3MXX A;  4X3E A;  1SHY B;  4ZOZ A;  4K3J B;  4O3U B;  2OVR B;  3I7N A;  2AGZ A;  4FB1 D;  2HES X;  4LG8 A;  4JXM A;  1ERJ A;  3W15 A;  3EI3 A;  4GGA A;  3SFZ A;  2G9A A;  4E5Z A;  2CN2 A;  3ZWL B;  1JOF A;  2P9N C;  2PM7 B;  4FHL A;  2B5M A;  3OL2 A;  4JSX C;  4J8G A;  2H47 A;  2AGL A;  4FAV D;  4CY2 A;  4A11 A;  1N6E A;  2B5L A;  2OIZ A;  4JT5 C;  3EI4 B;  4L1Q D;  2AH0 A;  5H14 A;  2P9I C;  3UVO A;  2P9S C;  3C75 H;  3OKW A;  3OKY B;  2OVQ B;  5C2V B;  2IAA A;  3RSE C;  3SHF A;  3SMR A;  3I7P A;  5GXI A;  5EM2 B;  4LGN A;  4GM8 A;  4BL0 A;  5IJ7 E;  5C2W B;  2J57 G;  4BUJ C;  2IWF A;  3F3G A;  3I7O A;  4GMB A;  4J78 A;  3MZL A;  4PXW A;  4XEI C;  3JRO A;  4PSW B;  3SBR A;  3NVN A;  1A0R B;  2H68 A;  1YFQ A;  2AGX A;  4L3H D;  4Z8L A;  4ZOX A;  3AFC A;  4PBZ A;  4O9D A;  4UI9 R;  3SWS D;  3L4M D;  3ULE C;  2CN3 A;  2AQ5 A;  3SCY A;  1PGU A;  2GNQ A;  5IGO A;  4G56 B;  3EWE A;  2QXV A;  4FA4 D;  3IJ1 A;  4CI8 A;  5HYN B;  4X60 B;  4A0A B;  4A11 B;  2UZX B;  2Q7Q A;  2Z2N A;  1K8K C;  4PC0 A;  3FRX A;  4L9O A;  3V7D B;  4FA1 D;  4A0B B;  4J0X A;  3UVM A;  4ERZ A;  4U1E I;  5TF2 A;  2O9K A;  4A0A A;  4QQE A;  3JPX A;  4O45 A;  3PE7 A;  3E0C A;  4FWW A;  3EMH A;  3RN1 D;  2AGY A;  5EM2 A;  2CE8 A;  1GG2 B;  5EMK B;  3NVQ A;  1XIP A;  1B9Y A;  1QNI A;  3OW8 A;  2J56 H;  2XL2 A;  3FM0 A;  4H5J A;  4A08 B;  4GM9 A;  1OLZ A;  2YMU A;  5HE0 B;  5SXM A;  3IIW A;  4QT8 A;  4PNK B;  2YNP A;  3IJC A;  4CI3 A;  4A08 A;  5TDH B;  3EI1 B;  3UKR C;  3DXM C;  4Y7R A;  4A09 A;  4PBY A;  1VYH C;  2YNN A;  3UKU C;  2Z2O A;  3B7F A;  2CE9 A;  5EAL A;  1R5M A;  3EI2 A;  4H5I A;  4R7A B;  4I79 A;  4JD2 C;  4D6V A;  4CI1 A;  3RFG A;  3F3F A;  4J87 A;  4J73 A;  4A0B A;  5GXH A;  3DM0 A;  5EAP A;  3I2N A;  1MG3 A;  3EG6 A;  3UVN A;  3J81 g;  2AGW A;  2I0R A;  2P9K C;  5K1C C;  4XYI A;  5TEE A;  4J82 A;  4ES0 A;  1MG2 A;  3V9F A;  1JJU B;  2EBS A;  3MZK A;  1L0Q A;  4QRJ A;  3UR4 A;  1RI6 A;  3C9C A;  5EMJ B;  4ERQ A;  2IUQ A;  3C99 A;  1U2V C;  2H6K A;  2QC5 A;  2YBA A;  4A2M A;  4ZOY A;  1PI6 A;  3EI4 A;  3C5M A;  5C9Z B;  2HKR A;  2AH1 A;  5CXC A;  4GQ1 A;  5HE2 B;  1SQ9 A;  4E54 B;  2OK6 A;  4GM3 A;  2H9P A;  4GQB B;  3KRX B;  4ESG A;  1N6D A;  3N0D A;  3PXW D;  4QL1 A;  4E54 A;  2PM9 A;  3I7K A;  3RMZ D;  4PSX B;  3EI1 A;  1N6F A;  5JWZ A;  3AL9 A;  5KDO B;  3BG1 A;  2Z2P A;  3SVW D;  2OK4 A;  2PM9 B;  3NVX A;  2H9L A;  5CXC B;  3CIK B;  4IA9 A;  5THA A;  2HKM A;  1Q47 A;  3OTT A;  4GZ8 A;  2TRC B;  5EAM A;  2MTA H;  2HYE A;  3JRP A;  2CO0 A;  4CY3 A;  3BG0 A;  5IJ8 E;  5IT9 g;  5AFU 3;  3IKO A;  3SLE D;  1JMZ B;  2W18 A;  2I0T A;  5FXY A;  4BH6 A;  5GMK n;  3MMY A;  1S4U X;  2XL3 A;  5H17 A;  3GFC A;  5FKQ A;  1K32 A;  2OJY A;  4ZOV A;  4TZ4 A;  4CY1 A;  4LG9 A;  4FAN D;  5FLX g;  5B4W A;  4J77 A;  4OWR A;  2H9M A;  2I3T A;  3DSM A;  3VA6 A;  4JT6 C;  2BBK H;  3U4Y A;  4X63 B;  1OMW B;  3JZN A;  5AMS A;  5CYK B;  5FKR A;  3I7H A;  3AL8 B;  2P9L C;  4AOW A;  4CZY A;  4HDJ A;  4J8B A;  1B9X A;  1TBG A;  2G99 A;  2H6Q A;  2HXC A;  2UZY B;  4AEZ A;  2BCJ B;  3SJL D;  4J81 A;  5FKT A;  5CXB B;  2YB8 B;  3UVK A;  3I89 A;  3K26 A;  3BWS A;  1U4C A;  3I8C A;  4GGD A;  5EAR A;  3RFH A;  1XHM A;  4E5Z B;  3K27 A;  3MKS B;  3I7L A;  4CZX A;  5K19 A;  4CI2 A;  2XU7 A;  5HE3 B;  4Y5R D;  2GC4 A;  2GC7 A;  1GXR A;  4XYH A;  2CNX A;  4CC9 A;  1NR0 A;  2IUP A;  2CO0 C;  2H6N A;  3N0E A;  3HFQ A;  3RRM C;  3MKQ A;  2IWK A;  4J86 A;  3SN6 B;  2XYI A;  4O3T B;  4ZN4 A;  4GGC A;  4O1Q D;  1XKS A;  4ERY A;  4D0K A;  4A2L A;  3JB9 L;  1NEX B;  3DXK C;  1FWX A;  3JAM g;  1TYQ C;  2P9P C;  1GP2 B;  4YVD A;  4CY5 A;  4K3I D;  5CYK A;  2PM6 B;  3CFV A;  4KFM B;  4FA9 D;  3UVL A;  2PBI B;  3SBP A;  3PXT D;  3EI2 B;  3CFS B;  4L3G D;  1PEV A;  4A09 B;  4EWR A;  5CXB A;  2H9N A;  3PXS D;  5H1M A;  3GRE A;  4OZU A;  5HE1 B;  1SQJ A;  5I5J A;  2OVP B;  4CZV A;  4J79 A;  2I0S A;  1PBY B; 
#chains in the Genus database with same CATH topology
 1C9I A;  2H3X A;  3JZH A;  3IIY A;  5FA5 B;  3PSC B;  4J0W A;  4U7A A;  2H14 A;  3SXT D;  4DNW A;  3VH0 A;  2VZ1 A;  5IC7 A;  3FGB A;  3EU7 A;  3JZG A;  5FQD A;  3I8E A;  2B5N A;  3J80 g;  3DWL C;  3PVU B;  3ODT A;  2I3S A;  2P9U C;  3OKY A;  3IUM A;  4J84 A;  3RN0 D;  2B4E A;  3L4O D;  4MMZ A;  4A7J A;  3OL2 B;  4JSV C;  5HQG A;  4AMY A;  4JSP C;  3F3P A;  5EMM B;  2J55 H;  5TEF A;  1GOT B;  1P22 A;  3PVW B;  4NSX A;  4JSN C;  2H13 A;  3O4G A;  1TYE A;  4MK0 B;  5GSA A;  5I5I A;  5I5M A;  3VGZ A;  4GQ2 P;  2YNO A;  5EML B;  4X61 B;  3ZE1 A;  2HJB A;  5FKS A;  2BKL A;  4IMM A;  3SBQ A;  5IGQ A;  3AL8 A;  3A0F A;  3OKT A;  3KRW B;  1MDA H;  2HJ4 A;  1E8M A;  3IJ0 A;  1JMX B;  4N14 A;  3EI3 B;  3AH8 B;  3PSL A;  1H2W A;  4UM8 A;  5AJA A;  5A2Q g;  3RLM D;  3ORV D;  5M5V A;  2IUV A;  1T2X A;  4FA5 D;  2IUR A;  3P4F A;  3V5W B;  3MXX A;  4X3E A;  4UM9 A;  1SHY B;  4ZOZ A;  4K3J B;  4O3U B;  2OVR B;  3I7N A;  2AGZ A;  4FB1 D;  2HES X;  4LG8 A;  3ZE0 A;  4JXM A;  1ERJ A;  3W15 A;  3EI3 A;  2XZG A;  3V4V A;  3VI3 A;  4GGA A;  3SFZ A;  2G9A A;  4E5Z A;  2CN2 A;  3K72 A;  3ZWL B;  1JOF A;  2P9N C;  2PM7 B;  4FHL A;  2B5M A;  3OL2 A;  4JSX C;  4J8G A;  2H47 A;  3ZDY A;  2AGL A;  4FAV D;  4CY2 A;  4A11 A;  5M5T A;  1VE7 A;  1N6E A;  2B5L A;  2OIZ A;  1GOH A;  4JT5 C;  3EI4 B;  4L1Q D;  2AH0 A;  5H14 A;  2P9I C;  3UVO A;  2P9S C;  3C75 H;  3OKW A;  3OKY B;  5HDB A;  1JV2 A;  2OVQ B;  4IRZ A;  5C2V B;  2VDO A;  2IAA A;  3RSE C;  3SHF A;  3SMR A;  3I7P A;  5GXI A;  5EM2 B;  4LGN A;  4GM8 A;  4BL0 A;  5IJ7 E;  5C2W B;  2J57 G;  4BUJ C;  2IWF A;  3F3G A;  3I7O A;  4GMB A;  4J78 A;  3MZL A;  4PXW A;  4XEI C;  3JRO A;  3QI0 A;  4PSW B;  3SBR A;  3NVN A;  1A0R B;  2H68 A;  2AGX A;  1YFQ A;  4L3H D;  4Z8L A;  4ZOX A;  3AFC A;  4PBZ A;  4O9D A;  4UI9 R;  3SWS D;  3L4M D;  3ULE C;  2CN3 A;  1E5T A;  2AQ5 A;  3SCY A;  1PGU A;  2GNQ A;  5IGO A;  4G56 B;  3IUR A;  4BP9 A;  3EWE A;  3EQ8 A;  2QXV A;  4FA4 D;  3IJ1 A;  4Z7O A;  4CI8 A;  5HYN B;  4X60 B;  5FFO A;  4A0A B;  4A11 B;  2UZX B;  2Q7Q A;  2VC2 A;  1K8K C;  2Z2N A;  3FRX A;  4L9O A;  4PC0 A;  3V7D B;  4DNU A;  4FA1 D;  4Z7Q A;  4A0B B;  4J0X A;  3UVM A;  4ERZ A;  4U1E I;  5TF2 A;  5E6U A;  2O9K A;  4A0A A;  3JPX A;  4QQE A;  4O45 A;  3PE7 A;  3E0C A;  4FWW A;  3EMH A;  3RN1 D;  2AGY A;  5EM2 A;  1L5G A;  2CE8 A;  5M5R A;  1GG2 B;  5EMK B;  1O6G A;  1BPO A;  3IVM A;  3NVQ A;  4BCD A;  1XIP A;  2QZP A;  3GD1 I;  1C9L A;  1B9Y A;  1QNI A;  3OW8 A;  2J56 H;  2XL2 A;  3FM0 A;  4H5J A;  3MVD K;  4A08 B;  4GM9 A;  1OLZ A;  4RE5 A;  2YMU A;  5HE0 B;  2VDK A;  5SXM A;  3IIW A;  4G55 A;  4G1M A;  4QT8 A;  4PNK B;  2YNP A;  3IJC A;  5E6R A;  4CI3 A;  4A08 A;  5TDH B;  3EI1 B;  3UKR C;  1I2M B;  3DXM C;  4Y7R A;  4A09 A;  4PBY A;  1VYH C;  2YNN A;  3FCS A;  3UKU C;  2Z2O A;  3B7F A;  2CE9 A;  5EAL A;  1R5M A;  3EI2 A;  4H5I A;  2VDR A;  4G1E A;  2JKX A;  4R7A B;  4I79 A;  4JD2 C;  4D6V A;  4CI1 A;  3ZE2 A;  3RFG A;  3F3F A;  4J87 A;  3IUJ A;  4J73 A;  4A0B A;  1O6F A;  5GXH A;  3DM0 A;  5EAP A;  3I2N A;  3T3M A;  1MG3 A;  5C86 A;  3EG6 A;  3UVN A;  3J81 g;  2AGW A;  2I0R A;  2VDQ A;  2P9K C;  3O4I A;  3O4H A;  5K1C C;  4Z7N A;  4XYI A;  5TEE A;  4J82 A;  4ES0 A;  1MG2 A;  3V9F A;  1JJU B;  2EBS A;  2HU5 A;  3MZK A;  1L0Q A;  4QRJ A;  3UR4 A;  4L1M A;  1RI6 A;  4MMY A;  1QFS A;  3C9C A;  5EMJ B;  4ERQ A;  1UTC A;  2IUQ A;  3C99 A;  1U2V C;  3IUL A;  2H6K A;  2QC5 A;  4O02 A;  2YBA A;  4A2M A;  4ZOY A;  1PI6 A;  3EI4 A;  3C5M A;  5C9Z B;  2HKR A;  4BCB A;  2AH1 A;  5CXC A;  5M61 A;  3K71 A;  4GQ1 A;  5HE2 B;  1SQ9 A;  3VI4 A;  4E54 B;  2OK6 A;  4GM3 A;  2H9P A;  1QFM A;  3NIF A;  4GQB B;  3KRX B;  4ESG A;  4JHP C;  1N6D A;  2EID A;  3N0D A;  3NID A;  3PXW D;  3QHY B;  4QL1 A;  4E54 A;  2PM9 A;  3I7K A;  3RMZ D;  4PSX B;  1GOG A;  3EI1 A;  1N6F A;  5JWZ A;  3AL9 A;  4O2W A;  5KDO B;  3BG1 A;  2Z2P A;  3SVW D;  2OK4 A;  2PM9 B;  3NVX A;  2H9L A;  5CXC B;  3CIK B;  4IA9 A;  3MUO A;  5THA A;  4AX4 A;  2HKM A;  1Q47 A;  3OTT A;  4GZ8 A;  1JTD B;  2TRC B;  5EAM A;  2MTA H;  2HYE A;  1VZ2 A;  2EIB A;  3JRP A;  2CO0 A;  4CY3 A;  3BG0 A;  5IJ8 E;  1U8C A;  5IT9 g;  3K6S A;  3ZDZ A;  5AFU 3;  1YR2 A;  1UOP A;  3IKO A;  3SLE D;  1JMZ B;  2W18 A;  2I0T A;  5FXY A;  4BH6 A;  5GMK n;  3MMY A;  1S4U X;  1A12 A;  2XL3 A;  5H17 A;  3GFC A;  4WJK A;  5FKQ A;  1K32 A;  2OJY A;  4ZOV A;  4WK4 A;  3O4J A;  4TZ4 A;  1M1X A;  4CY1 A;  4LG9 A;  4FAN D;  5FLX g;  4WK0 A;  3KCI A;  5B4W A;  4J77 A;  2HU8 A;  4OWR A;  2H9M A;  3NIG A;  2I3T A;  3DSM A;  4NC4 A;  3VA6 A;  4JT6 C;  2BBK H;  5M5U A;  4AMZ A;  3U4Y A;  2EIC A;  4MMX A;  1K3I A;  1OMW B;  3JZN A;  4X63 B;  2HU7 A;  5CYK B;  5AMS A;  5FKR A;  3I7H A;  3AL8 B;  2P9L C;  4AOW A;  4CZY A;  4HDJ A;  4J8B A;  4AN0 A;  1B9X A;  1TBG A;  4NEN A;  2G99 A;  2H6Q A;  2HXC A;  2UZY B;  4AEZ A;  1GOF A;  2BCJ B;  3SJL D;  3EQ9 A;  1H2Z A;  4J81 A;  5FKT A;  2VDP A;  4NBM A;  5CXB B;  3V4P A;  2YB8 B;  3UVK A;  3I89 A;  3K26 A;  3BWS A;  4AN1 A;  1U4C A;  2WQ8 A;  3I8C A;  3IUN A;  4GGD A;  5EAR A;  3RFH A;  1XHM A;  3T3P A;  3K27 A;  4E5Z B;  3MKS B;  2VDL A;  3I7L A;  2XDW A;  4QAM A;  3FCU A;  4CZX A;  5K19 A;  4CI2 A;  2VDN A;  2XU7 A;  4BP8 A;  5HE3 B;  4Y5R D;  2GC4 A;  2GC7 A;  1GXR A;  1VZ3 A;  4XYH A;  2CNX A;  2QR5 A;  1H2Y A;  3GC3 B;  4CC9 A;  1NR0 A;  4NAA A;  2IUP A;  2CO0 C;  2H6N A;  3N0E A;  5C92 A;  3HFQ A;  3RRM C;  3MKQ A;  2IWK A;  4J86 A;  3SN6 B;  2XYI A;  3EQ7 A;  4O3T B;  4ZN4 A;  4GGC A;  4O1Q D;  1XKS A;  4ERY A;  4D0K A;  4A2L A;  3JB9 L;  1NEX B;  3DXK C;  3DDU A;  1FWX A;  5E6S A;  3JAM g;  1UOQ A;  1TYQ C;  2P9P C;  2EIE A;  3OF7 A;  3ZDX A;  1GP2 B;  4YVD A;  4CY5 A;  3IJE A;  3MUN A;  4K3I D;  5CYK A;  2PM6 B;  3CFV A;  4KFM B;  4FA9 D;  1UOO A;  3UVL A;  2PBI B;  3SBP A;  3PXT D;  4WK2 A;  3EI2 B;  4DNV A;  3CFS B;  4L3G D;  1PEV A;  4A09 B;  2VZ3 A;  4JHN A;  4EWR A;  2H9N A;  3PXS D;  5CXB A;  5FFG A;  5H1M A;  3GRE A;  4OZU A;  5HE1 B;  1VE6 A;  1SQJ A;  4BCC A;  5I5J A;  5M5S A;  2VDM A;  2OVP B;  1H2X A;  3IUQ A;  4CZV A;  4J79 A;  4D9S A;  1E8N A;  2XE4 A;  4RE6 A;  2I0S A;  1PBY B; 
#chains in the Genus database with same CATH homology
 2H3X A;  3JZH A;  3IIY A;  5FA5 B;  3PSC B;  4J0W A;  4U7A A;  2H14 A;  3SXT D;  3VH0 A;  5IC7 A;  3FGB A;  3EU7 A;  3JZG A;  5FQD A;  3I8E A;  2B5N A;  3J80 g;  3DWL C;  3PVU B;  3ODT A;  2I3S A;  2P9U C;  3OKY A;  4J84 A;  3RN0 D;  2B4E A;  3L4O D;  4A7J A;  3OL2 B;  4JSV C;  5HQG A;  4JSP C;  3F3P A;  5EMM B;  2J55 H;  5TEF A;  1GOT B;  1P22 A;  3PVW B;  4NSX A;  4JSN C;  2H13 A;  4MK0 B;  5GSA A;  5I5I A;  5I5M A;  3VGZ A;  4GQ2 P;  2YNO A;  5EML B;  4X61 B;  2HJB A;  5FKS A;  4IMM A;  3SBQ A;  5IGQ A;  3AL8 A;  3A0F A;  3OKT A;  3KRW B;  1MDA H;  2HJ4 A;  3IJ0 A;  1JMX B;  4N14 A;  3EI3 B;  3AH8 B;  3PSL A;  5AJA A;  5A2Q g;  3RLM D;  3ORV D;  2IUV A;  4FA5 D;  2IUR A;  3P4F A;  3V5W B;  3MXX A;  4X3E A;  1SHY B;  4ZOZ A;  4K3J B;  4O3U B;  2OVR B;  3I7N A;  2AGZ A;  4FB1 D;  2HES X;  4LG8 A;  4JXM A;  1ERJ A;  3W15 A;  3EI3 A;  4GGA A;  3SFZ A;  2G9A A;  4E5Z A;  2CN2 A;  3ZWL B;  1JOF A;  2P9N C;  2PM7 B;  4FHL A;  2B5M A;  3OL2 A;  4JSX C;  4J8G A;  2H47 A;  2AGL A;  4FAV D;  4CY2 A;  4A11 A;  1N6E A;  2B5L A;  2OIZ A;  4JT5 C;  3EI4 B;  4L1Q D;  2AH0 A;  5H14 A;  2P9I C;  3UVO A;  2P9S C;  3C75 H;  3OKW A;  3OKY B;  2OVQ B;  5C2V B;  2IAA A;  3RSE C;  3SHF A;  3SMR A;  3I7P A;  5GXI A;  5EM2 B;  4LGN A;  4GM8 A;  4BL0 A;  5IJ7 E;  5C2W B;  2J57 G;  4BUJ C;  2IWF A;  3F3G A;  3I7O A;  4GMB A;  4J78 A;  3MZL A;  4PXW A;  4XEI C;  3JRO A;  4PSW B;  3SBR A;  3NVN A;  1A0R B;  2H68 A;  1YFQ A;  2AGX A;  4L3H D;  4Z8L A;  4ZOX A;  3AFC A;  4PBZ A;  4O9D A;  4UI9 R;  3SWS D;  3L4M D;  3ULE C;  2CN3 A;  2AQ5 A;  3SCY A;  1PGU A;  2GNQ A;  5IGO A;  4G56 B;  3EWE A;  2QXV A;  4FA4 D;  3IJ1 A;  4CI8 A;  5HYN B;  4X60 B;  4A0A B;  4A11 B;  2UZX B;  2Q7Q A;  2Z2N A;  1K8K C;  4PC0 A;  3FRX A;  4L9O A;  3V7D B;  4FA1 D;  4A0B B;  4J0X A;  3UVM A;  4ERZ A;  4U1E I;  5TF2 A;  2O9K A;  4A0A A;  4QQE A;  3JPX A;  4O45 A;  3PE7 A;  3E0C A;  4FWW A;  3EMH A;  3RN1 D;  2AGY A;  5EM2 A;  2CE8 A;  1GG2 B;  5EMK B;  3NVQ A;  1XIP A;  1B9Y A;  1QNI A;  3OW8 A;  2J56 H;  2XL2 A;  3FM0 A;  4H5J A;  4A08 B;  4GM9 A;  1OLZ A;  2YMU A;  5HE0 B;  5SXM A;  3IIW A;  4QT8 A;  4PNK B;  2YNP A;  3IJC A;  4CI3 A;  4A08 A;  5TDH B;  3EI1 B;  3UKR C;  3DXM C;  4Y7R A;  4A09 A;  4PBY A;  1VYH C;  2YNN A;  3UKU C;  2Z2O A;  3B7F A;  2CE9 A;  5EAL A;  1R5M A;  3EI2 A;  4H5I A;  4R7A B;  4I79 A;  4JD2 C;  4D6V A;  4CI1 A;  3RFG A;  3F3F A;  4J87 A;  4J73 A;  4A0B A;  5GXH A;  3DM0 A;  5EAP A;  3I2N A;  1MG3 A;  3EG6 A;  3UVN A;  3J81 g;  2AGW A;  2I0R A;  2P9K C;  5K1C C;  4XYI A;  5TEE A;  4J82 A;  4ES0 A;  1MG2 A;  3V9F A;  1JJU B;  2EBS A;  3MZK A;  1L0Q A;  4QRJ A;  3UR4 A;  1RI6 A;  3C9C A;  5EMJ B;  4ERQ A;  2IUQ A;  3C99 A;  1U2V C;  2H6K A;  2QC5 A;  2YBA A;  4A2M A;  4ZOY A;  1PI6 A;  3EI4 A;  3C5M A;  5C9Z B;  2HKR A;  2AH1 A;  5CXC A;  4GQ1 A;  5HE2 B;  1SQ9 A;  4E54 B;  2OK6 A;  4GM3 A;  2H9P A;  4GQB B;  3KRX B;  4ESG A;  1N6D A;  3N0D A;  3PXW D;  4QL1 A;  4E54 A;  2PM9 A;  3I7K A;  3RMZ D;  4PSX B;  3EI1 A;  1N6F A;  5JWZ A;  3AL9 A;  5KDO B;  3BG1 A;  2Z2P A;  3SVW D;  2OK4 A;  2PM9 B;  3NVX A;  2H9L A;  5CXC B;  3CIK B;  4IA9 A;  5THA A;  2HKM A;  1Q47 A;  3OTT A;  4GZ8 A;  2TRC B;  5EAM A;  2MTA H;  2HYE A;  3JRP A;  2CO0 A;  4CY3 A;  3BG0 A;  5IJ8 E;  5IT9 g;  5AFU 3;  3IKO A;  3SLE D;  1JMZ B;  2W18 A;  2I0T A;  5FXY A;  4BH6 A;  5GMK n;  3MMY A;  1S4U X;  2XL3 A;  5H17 A;  3GFC A;  5FKQ A;  1K32 A;  2OJY A;  4ZOV A;  4TZ4 A;  4CY1 A;  4LG9 A;  4FAN D;  5FLX g;  5B4W A;  4J77 A;  4OWR A;  2H9M A;  2I3T A;  3DSM A;  3VA6 A;  4JT6 C;  2BBK H;  3U4Y A;  4X63 B;  1OMW B;  3JZN A;  5AMS A;  5CYK B;  5FKR A;  3I7H A;  3AL8 B;  2P9L C;  4AOW A;  4CZY A;  4HDJ A;  4J8B A;  1B9X A;  1TBG A;  2G99 A;  2H6Q A;  2HXC A;  2UZY B;  4AEZ A;  2BCJ B;  3SJL D;  4J81 A;  5FKT A;  5CXB B;  2YB8 B;  3UVK A;  3I89 A;  3K26 A;  3BWS A;  1U4C A;  3I8C A;  4GGD A;  5EAR A;  3RFH A;  1XHM A;  4E5Z B;  3K27 A;  3MKS B;  3I7L A;  4CZX A;  5K19 A;  4CI2 A;  2XU7 A;  5HE3 B;  4Y5R D;  2GC4 A;  2GC7 A;  1GXR A;  4XYH A;  2CNX A;  4CC9 A;  1NR0 A;  2IUP A;  2CO0 C;  2H6N A;  3N0E A;  3HFQ A;  3RRM C;  3MKQ A;  2IWK A;  4J86 A;  3SN6 B;  2XYI A;  4O3T B;  4ZN4 A;  4GGC A;  4O1Q D;  1XKS A;  4ERY A;  4D0K A;  4A2L A;  3JB9 L;  1NEX B;  3DXK C;  1FWX A;  3JAM g;  1TYQ C;  2P9P C;  1GP2 B;  4YVD A;  4CY5 A;  4K3I D;  5CYK A;  2PM6 B;  3CFV A;  4KFM B;  4FA9 D;  3UVL A;  2PBI B;  3SBP A;  3PXT D;  3EI2 B;  3CFS B;  4L3G D;  1PEV A;  4A09 B;  4EWR A;  5CXB A;  2H9N A;  3PXS D;  5H1M A;  3GRE A;  4OZU A;  5HE1 B;  1SQJ A;  5I5J A;  2OVP B;  4CZV A;  4J79 A;  2I0S A;  1PBY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...