2H9MA

Wdr5 in complex with unmodified h3k4 peptide
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
304
structure length
304
Chain Sequence
VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, gene regulation
molecule keywords WD-repeat protein 5
publication title Structural basis for molecular recognition and presentation of histone H3 By WDR5.
pubmed doi rcsb
source organism Homo sapiens
total genus 101
structure length 304
sequence length 304
chains with identical sequence C
ec nomenclature
pdb deposition date 2006-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2h9mA00
4J0XA 3PVUB 3ULEC 3JB9L 2IUVA 2IAAA 3BWSA 2H14A 3I7HA 2H9LA 3UVNA 2P9UC 5C2VB 1NR0A 4ERYA 4J86A 4U7AA 4E5ZA 3UKUC 4FA4D 2P9NC 2YNPA 1TYQC 2UZXB 2CN3A 4JSVC 5HE0B 5FLXg 1JMZB 4A09B 3RSEC 2IUQA 5I5MA 3AL8B 4ESGA 2IWKA 2TRCB 4A7JA 4GZ8A 1U2VC 2MTAH 5TF2A 4JT6C 2O9KA 1PBYB 4GGDA 4JD2C 4UI9R 3V5WB 4BUJC 4IMMA 4FAVD 5AFU3 4A0BB 1XIPA 4BL0A 3DSMA 5FQDA 4QT8A 5I5JA 4O45A 3BG0A 5C2WB 4O1QD 2HJBA 3SVWD 4CZXA 2H6KA 2YBAA 3PSCB 5H17A 3W15A 5IC7A 5CYKB 4X61B 1GXRA 3I7LA 3SCYA 3ORVD 4CZYA 4ZOXA 4FA1D 5C9ZB 2PM9B 3SJLD 3I7KA 5GMKn 5FKRA 3KRXB 1XHMA 4CY2A 2XL3A 4PXWA 3EU7A 3I7NA 4J82A 3EI2A 3J80g 2P9LC 2HKRA 2H13A 2H68A 4A2MA 3JZHA 1MDAH 3C9CA 2AGZA 1U4CA 1SHYB 2AH1A 4E54B 4TZ4A 4O3UB 4U1EI 3I2NA 5HE1B 3F3PA 4ZOYA 3JZGA 2EBSA 5A2Qg 3A0FA 2J57G 4R7AB 4J0WA 3DWLC 5I5IA 4LG9A 3PXWD 4JSXC 2CO0C 3EI4A 4D6VA 1P22A 3J81g 5KDOB 4FHLA 2OVPB 3OL2A 4E5ZB 3MXXA 2AQ5A 5EALA 2H9MA 1FWXA 4PBYA 3FGBA 3VGZA 3IJCA 3SBQA 4O9DA 3SXTD 3BG1A 4YVDA 3OKYA 2AH0A 2IWFA 5FKSA 4CY5A 5FXYA 4GGCA 4GM9A 1XKSA 3IIYA 3C99A 1VYHC 4Y7RA 3N0DA 4QRJA 4H5JA 4A2LA 3UKRC 3MZKA 5EMJB 3CIKB 3NVXA 3IIWA 2BBKH 4O3TB 4N14A 4MK0B 3SHFA 5EMKB 4Z8LA 4L9OA 2H6NA 2H6QA 2Z2NA 3DM0A 3MZLA 4GM3A 4A0AA 5EAMA 3B7FA 2XL2A 3CFSB 3PE7A 3PVWB 4HDJA 4XEIC 5CXCA 4CI3A 4PSXB 4J77A 4LG8A 1RI6A 3I8EA 4J81A 5K1CC 3RFGA 4QQEA 3FM0A 3EI2B 1K8KC 1N6EA 5IJ8E 4ERQA 2Z2PA 2QC5A 4FWWA 3SWSD 4L3HD 3OTTA 4Y5RD 4GQBB 1S4UX 4GMBA 4CZVA 4FA5D 2PM6B 2UZYB 4AEZA 2HYEA 4XYHA 1JMXB 2GNQA 5THAA 1GOTB 4ES0A 3SMRA 3V9FA 3HFQA 5FA5B 5IGOA 5EAPA 3ODTA 4J87A 3UVLA 3AL9A 3EI4B 3GREA 1B9YA 4A08A 3EI3A 4L3GD 5TDHB 2QXVA 5EMMB 3L4MD 3AH8B 4ZOVA 1N6DA 3JPXA 3DXMC 3JZNA 3OL2B 2P9PC 5AJAA 3IJ1A 5CXBB 3MKSB 3KRWB 2P9IC 4OWRA 2I0RA 4EWRA 5K19A 2I3SA 2OK4A 4OZUA 4K3ID 2OIZA 3RN0D 5EM2A 3OKYB 4J73A 3EWEA 1OMWB 5IT9g 4L1QD 3VA6A 1GP2B 3IKOA 3PXSD 1QNIA 3L4OD 4BH6A 3CFVA 4PNKB 2YNOA 1PGUA 1JJUB 5CXBA 5EARA 2OJYA 2AGXA 3I89A 4K3JB 3UVMA 3MKQA 3SBRA 3VH0A 3EMHA 2HJ4A 1NEXB 3I7PA 2CN2A 4JSPC 2W18A 2HESX 3OW8A 2OVQB 3SLED 4A11A 4ERZA 1R5MA 1PI6A 4G56B 2Z2OA 2G9AA 5JWZA 4A0AB 5CXCB 4CI1A 4CI2A 3GFCA 2I0SA 2YB8B 4GGAA 4PSWB 2B4EA 2HXCA 4ZOZA 3PSLA 4KFMB 4CI8A 3I8CA 2AGLA 3UR4A 4X63B 4PBZA 2OVRB 2I3TA 1SQ9A 2B5NA 5GXHA 3UVKA 4GQ2P 2I0TA 2CO0A 1YFQA 1N6FA 5H1MA 3RFHA 3FRXA 5FKTA 2HKMA 4XYIA 4CY1A 3JRPA 3C5MA 3EI1B 1ERJA 3DXKC 4D0KA 5SXMA 3SBPA 4CC9A 3RLMD 2PM7B 2AGWA 4A09A 3I7OA 4J8BA 3AL8A 5GXIA 1SQJA 2B5MA 3K27A 3ZWLB 4IA9A 2XYIA 2H9NA 5AMSA 5IGQA 1Q47A 2XU7A 5B4WA 4GM8A 2GC4A 3U4YA 3SFZA 3P4FA 1TBGA 2IURA 4J8GA 4A08B 3EI1A 3EI3B 3OKTA 1JOFA 4QL1A 2H9PA 2G99A 2P9KC 4A0BA 2PBIB 2BCJB 2OK6A 4GQ1A 5FKQA 2IUPA 4PC0A 4H5IA 4NSXA 4ZN4A 3F3FA 4JXMA 3F3GA 3N0EA 5EM2B 4JT5C 5HYNB 1L0QA 3E0CA 5EMLB 4J78A 5CYKA 1PEVA 4J79A 2YNNA 3V7DB 2P9SC 2H3XA 3C75H 3RN1D 3AFCA 2PM9A 3NVQA 3OKWA 1B9XA 4J84A 3IJ0A 4X60B 4AOWA 3EG6A 3PXTD 1OLZA 1A0RB 5TEEA 1K32A 4X3EA 2AGYA 2CE8A 5HE2B 4FB1D 1MG3A 2GC7A 3JROA 4A11B 5GSAA 5TEFA 3K26A 1GG2B 3UVOA 2CNXA 5HE3B 2H47A 3RMZD 4FAND 5IJ7E 5H14A 2Q7QA 3SN6B 4E54A 5HQGA 1MG2A 2B5LA 3MMYA 2CE9A 3NVNA 4LGNA 2J56H 4FA9D 4CY3A 3RRMC 2YMUA 2J55H 3JAMg 4I79A 4JSNC
chains in the Genus database with same CATH superfamily
4J0XA 4WJKA 2XDWA 3PVUB 3ULEC 3JB9L 2IUVA 1VE6A 2IAAA 3BWSA 2H14A 3I7HA 2H9LA 3UVNA 2P9UC 5C2VB 1NR0A 3MUOA 1O6GA 4ERYA 3FCUA 4J86A 4U7AA 4E5ZA 5HDBA 4WK2A 3UKUC 4FA4D 2P9NC 1I2MB 2YNPA 1TYQC 2UZXB 2CN3A 3EQ9A 4JSVC 5HE0B 5FLXg 1JMZB 4A09B 3RSEC 2IUQA 5I5MA 1UOPA 3AL8B 4ESGA 4DNUA 1E8MA 2IWKA 2TRCB 5M5UA 4A7JA 1U8CA 4GZ8A 1U2VC 2MTAH 5TF2A 4JT6C 2O9KA 1PBYB 4GGDA 4JD2C 4UI9R 3V5WB 4BUJC 3O4IA 4IMMA 4FAVD 5AFU3 4A0BB 1XIPA 2QZPA 4BL0A 3DSMA 4AN1A 5FQDA 4QT8A 5I5JA 4O45A 3BG0A 5C2WB 4O1QD 2HJBA 2JKXA 3SVWD 4CZXA 2H6KA 2VZ3A 2YBAA 3PSCB 5H17A 3W15A 5IC7A 3O4JA 5CYKB 4X61B 4WK4A 1GXRA 1H2XA 3I7LA 3SCYA 3ORVD 3O4GA 4CZYA 4ZOXA 4FA1D 3ZE2A 5C9ZB 2PM9B 3SJLD 3I7KA 5GMKn 5FKRA 4O2WA 3KRXB 2EIBA 1XHMA 4CY2A 2XL3A 4PXWA 3EU7A 3I7NA 5M5SA 4J82A 3EI2A 3J80g 1QFMA 4G1MA 3T3PA 2VDPA 4NBMA 2P9LC 2HKRA 2H13A 2H68A 4A2MA 4G55A 3JZHA 1MDAH 3C9CA 2AGZA 4AN0A 1U4CA 1SHYB 2AH1A 4UM9A 3ZDZA 4MMXA 4E54B 4TZ4A 4O3UB 4U1EI 1GOHA 3I2NA 5HE1B 3F3PA 4ZOYA 3JZGA 2EBSA 5A2Qg 3A0FA 2J57G 2HU8A 1BPOA 3ZE0A 4R7AB 1VE7A 5E6SA 4J0WA 3DWLC 5I5IA 1GOGA 4NENA 5M61A 4LG9A 3PXWD 4JSXC 3IUJA 2CO0C 3EI4A 4D6VA 1P22A 3J81g 1C9LA 2VC2A 5KDOB 4AMZA 4FHLA 2OVPB 3OL2A 4E5ZB 3MXXA 1UOQA 3NIDA 2AQ5A 5EALA 2H9MA 1FWXA 4PBYA 3FGBA 3VGZA 2VDNA 3IJCA 3SBQA 4O9DA 3SXTD 3BG1A 4YVDA 3OKYA 3OF7A 4BP9A 2AH0A 2IWFA 5FKSA 4CY5A 4G1EA 5FXYA 3IUNA 4GGCA 4GM9A 3T3MA 1XKSA 3IIYA 3C99A 1VYHC 4Y7RA 3N0DA 4QRJA 1O6FA 4H5JA 4A2LA 4JHPC 3UKRC 3MZKA 5EMJB 3CIKB 3NVXA 3IIWA 2BBKH 4O3TB 2EIDA 4N14A 4MK0B 3SHFA 5EMKB 5E6UA 4Z8LA 4L9OA 3ZDYA 2H6NA 2H6QA 2Z2NA 3DM0A 3MZLA 4NC4A 4GM3A 4A0AA 5EAMA 3B7FA 2XL2A 3CFSB 3PE7A 3PVWB 4HDJA 4UM8A 4RE5A 4XEIC 5CXCA 4PSXB 4CI3A 4J77A 4LG8A 1RI6A 3I8EA 4J81A 5K1CC 3RFGA 3IUQA 4JHNA 4QQEA 3FM0A 3MUNA 3EI2B 4QAMA 1K8KC 3V4VA 1N6EA 5IJ8E 4ERQA 2Z2PA 2QC5A 4FWWA 3SWSD 4L3HD 4MMYA 3OTTA 4Y5RD 2EIEA 4GQBB 1S4UX 3FCSA 4GMBA 4CZVA 2VDRA 4FA5D 2PM6B 2UZYB 4WK0A 4AEZA 2HYEA 4XYHA 1JMXB 4NAAA 2GNQA 5THAA 1GOTB 4ES0A 3SMRA 3NIGA 4MMZA 3HFQA 3V9FA 3K72A 5FA5B 5IGOA 5EAPA 4Z7QA 3ODTA 4J87A 3QHYB 3UVLA 3AL9A 1A12A 3EI4B 1M1XA 1B9YA 3GREA 4A08A 2VZ1A 3EI3A 4L3GD 5TDHB 2QXVA 5EMMB 3L4MD 3AH8B 4ZOVA 4IRZA 1N6DA 3JPXA 3DXMC 3JZNA 3OL2B 1QFSA 2P9PC 5AJAA 5M5VA 5M5TA 3IJ1A 5CXBB 3MKSB 3KRWB 2P9IC 4OWRA 2I0RA 4EWRA 5K19A 2I3SA 2OK4A 4OZUA 4K3ID 2OIZA 1GOFA 3RN0D 5EM2A 1E8NA 3OKYB 4J73A 3EWEA 1OMWB 3QI0A 4AMYA 5IT9g 4L1QD 3VA6A 1GP2B 3IKOA 3PXSD 1QNIA 2XZGA 3L4OD 4BH6A 3CFVA 4PNKB 4AX4A 2YNOA 1PGUA 1JJUB 5CXBA 5E6RA 2OJYA 4RE6A 5EARA 2AGXA 3I89A 4K3JB 2BKLA 1K3IA 3UVMA 3MKQA 3SBRA 3VH0A 3EMHA 2HJ4A 1NEXB 3I7PA 3EQ8A 2CN2A 4JSPC 4D9SA 2W18A 3O4HA 2HESX 3OW8A 2OVQB 2HU5A 3SLED 4A11A 4ERZA 1R5MA 1H2WA 2VDQA 4L1MA 1PI6A 4G56B 2Z2OA 2VDKA 2G9AA 5JWZA 3NIFA 4A0AB 5CXCB 4CI1A 1UTCA 3K71A 4Z7NA 3GD1I 4CI2A 3GFCA 2I0SA 2YB8B 4GGAA 4PSWB 2B4EA 2HXCA 2HU7A 4ZOZA 3PSLA 4KFMB 3IUMA 4CI8A 3I8CA 2AGLA 3UR4A 3ZDXA 3IULA 4X63B 4PBZA 2OVRB 2I3TA 1SQ9A 1T2XA 2B5NA 3DDUA 3UVKA 5GXHA 4GQ2P 2I0TA 2VDMA 2CO0A 3ZE1A 1YFQA 1N6FA 5H1MA 3RFHA 3FRXA 5FKTA 2HKMA 4XYIA 4CY1A 3JRPA 3C5MA 3EI1B 1ERJA 3DXKC 4D0KA 5SXMA 3SBPA 4CC9A 3RLMD 3IVMA 2PM7B 2VDLA 4Z7OA 2AGWA 4A09A 3EQ7A 3I7OA 4J8BA 3AL8A 5GXIA 4DNVA 1SQJA 2B5MA 3K27A 3ZWLB 3GC3B 4IA9A 2XYIA 2H9NA 5AMSA 5IGQA 1Q47A 2XU7A 5B4WA 4GM8A 2GC4A 3U4YA 3SFZA 3P4FA 1TBGA 2IURA 4J8GA 4A08B 3EI1A 3EI3B 4BCDA 3OKTA 1JOFA 4QL1A 2H9PA 2G99A 2P9KC 5M5RA 2XE4A 4A0BA 2PBIB 2BCJB 2OK6A 4GQ1A 5FKQA 2IUPA 4PC0A 4H5IA 4NSXA 4ZN4A 3F3FA 4JXMA 3F3GA 3N0EA 2WQ8A 5EM2B 4JT5C 5HYNB 3IJEA 1L0QA 3E0CA 5EMLB 4BP8A 4J78A 1H2YA 5CYKA 1PEVA 4J79A 2YNNA 3V7DB 2VDOA 1VZ3A 3VI4A 2P9SC 2H3XA 1UOOA 3C75H 3V4PA 3KCIA 3RN1D 3MVDK 3AFCA 2PM9A 3NVQA 3OKWA 5C92A 1B9XA 4J84A 3IJ0A 1JTDB 4X60B 4AOWA 3EG6A 3PXTD 1OLZA 3IURA 1A0RB 5TEEA 1K32A 3K6SA 4O02A 4X3EA 1YR2A 2AGYA 2CE8A 5HE2B 4FB1D 1MG3A 2GC7A 3JROA 4A11B 5GSAA 1VZ2A 5TEFA 5FFOA 3K26A 1GG2B 3UVOA 2CNXA 5HE3B 2H47A 4BCBA 3RMZD 4FAND 5IJ7E 4DNWA 2QR5A 1E5TA 5H14A 2Q7QA 3SN6B 4E54A 5HQGA 1L5GA 1MG2A 2B5LA 1JV2A 1H2ZA 1TYEA 2EICA 2CE9A 3MMYA 3NVNA 4LGNA 2J56H 5C86A 3VI3A 5FFGA 4CY3A 1C9IA 3RRMC 4FA9D 2YMUA 4BCCA 2J55H 3JAMg 4I79A 4JSNC
chains in the Genus database with same CATH topology
4J0XA 3PVUB 3ULEC 3JB9L 2IUVA 2IAAA 3BWSA 2H14A 3I7HA 2H9LA 3UVNA 2P9UC 5C2VB 1NR0A 4ERYA 4J86A 4U7AA 4E5ZA 3UKUC 4FA4D 2P9NC 2YNPA 1TYQC 2UZXB 2CN3A 4JSVC 5HE0B 5FLXg 1JMZB 4A09B 3RSEC 2IUQA 5I5MA 3AL8B 4ESGA 2IWKA 2TRCB 4A7JA 4GZ8A 1U2VC 2MTAH 5TF2A 4JT6C 2O9KA 1PBYB 4GGDA 4JD2C 4UI9R 3V5WB 4BUJC 4IMMA 4FAVD 5AFU3 4A0BB 1XIPA 4BL0A 3DSMA 5FQDA 4QT8A 5I5JA 4O45A 3BG0A 5C2WB 4O1QD 2HJBA 3SVWD 4CZXA 2H6KA 2YBAA 3PSCB 5H17A 3W15A 5IC7A 5CYKB 4X61B 1GXRA 3I7LA 3SCYA 3ORVD 4CZYA 4ZOXA 4FA1D 5C9ZB 2PM9B 3SJLD 3I7KA 5GMKn 5FKRA 3KRXB 1XHMA 4CY2A 2XL3A 4PXWA 3EU7A 3I7NA 4J82A 3EI2A 3J80g 2P9LC 2HKRA 2H13A 2H68A 4A2MA 3JZHA 1MDAH 3C9CA 2AGZA 1U4CA 1SHYB 2AH1A 4E54B 4TZ4A 4O3UB 4U1EI 3I2NA 5HE1B 3F3PA 4ZOYA 3JZGA 2EBSA 5A2Qg 3A0FA 2J57G 4R7AB 4J0WA 3DWLC 5I5IA 4LG9A 3PXWD 4JSXC 2CO0C 3EI4A 4D6VA 1P22A 3J81g 5KDOB 4FHLA 2OVPB 3OL2A 4E5ZB 3MXXA 2AQ5A 5EALA 2H9MA 1FWXA 4PBYA 3FGBA 3VGZA 3IJCA 3SBQA 4O9DA 3SXTD 3BG1A 4YVDA 3OKYA 2AH0A 2IWFA 5FKSA 4CY5A 5FXYA 4GGCA 4GM9A 1XKSA 3IIYA 3C99A 1VYHC 4Y7RA 3N0DA 4QRJA 4H5JA 4A2LA 3UKRC 3MZKA 5EMJB 3CIKB 3NVXA 3IIWA 2BBKH 4O3TB 4N14A 4MK0B 3SHFA 5EMKB 4Z8LA 4L9OA 2H6NA 2H6QA 2Z2NA 3DM0A 3MZLA 4GM3A 4A0AA 5EAMA 3B7FA 2XL2A 3CFSB 3PE7A 3PVWB 4HDJA 4XEIC 5CXCA 4CI3A 4PSXB 4J77A 4LG8A 1RI6A 3I8EA 4J81A 5K1CC 3RFGA 4QQEA 3FM0A 3EI2B 1K8KC 1N6EA 5IJ8E 4ERQA 2Z2PA 2QC5A 4FWWA 3SWSD 4L3HD 3OTTA 4Y5RD 4GQBB 1S4UX 4GMBA 4CZVA 4FA5D 2PM6B 2UZYB 4AEZA 2HYEA 4XYHA 1JMXB 2GNQA 5THAA 1GOTB 4ES0A 3SMRA 3V9FA 3HFQA 5FA5B 5IGOA 5EAPA 3ODTA 4J87A 3UVLA 3AL9A 3EI4B 3GREA 1B9YA 4A08A 3EI3A 4L3GD 5TDHB 2QXVA 5EMMB 3L4MD 3AH8B 4ZOVA 1N6DA 3JPXA 3DXMC 3JZNA 3OL2B 2P9PC 5AJAA 3IJ1A 5CXBB 3MKSB 3KRWB 2P9IC 4OWRA 2I0RA 4EWRA 5K19A 2I3SA 2OK4A 4OZUA 4K3ID 2OIZA 3RN0D 5EM2A 3OKYB 4J73A 3EWEA 1OMWB 5IT9g 4L1QD 3VA6A 1GP2B 3IKOA 3PXSD 1QNIA 3L4OD 4BH6A 3CFVA 4PNKB 2YNOA 1PGUA 1JJUB 5CXBA 5EARA 2OJYA 2AGXA 3I89A 4K3JB 3UVMA 3MKQA 3SBRA 3VH0A 3EMHA 2HJ4A 1NEXB 3I7PA 2CN2A 4JSPC 2W18A 2HESX 3OW8A 2OVQB 3SLED 4A11A 4ERZA 1R5MA 1PI6A 4G56B 2Z2OA 2G9AA 5JWZA 4A0AB 5CXCB 4CI1A 4CI2A 3GFCA 2I0SA 2YB8B 4GGAA 4PSWB 2B4EA 2HXCA 4ZOZA 3PSLA 4KFMB 4CI8A 3I8CA 2AGLA 3UR4A 4X63B 4PBZA 2OVRB 2I3TA 1SQ9A 2B5NA 5GXHA 3UVKA 4GQ2P 2I0TA 2CO0A 1YFQA 1N6FA 5H1MA 3RFHA 3FRXA 5FKTA 2HKMA 4XYIA 4CY1A 3JRPA 3C5MA 3EI1B 1ERJA 3DXKC 4D0KA 5SXMA 3SBPA 4CC9A 3RLMD 2PM7B 2AGWA 4A09A 3I7OA 4J8BA 3AL8A 5GXIA 1SQJA 2B5MA 3K27A 3ZWLB 4IA9A 2XYIA 2H9NA 5AMSA 5IGQA 1Q47A 2XU7A 5B4WA 4GM8A 2GC4A 3U4YA 3SFZA 3P4FA 1TBGA 2IURA 4J8GA 4A08B 3EI1A 3EI3B 3OKTA 1JOFA 4QL1A 2H9PA 2G99A 2P9KC 4A0BA 2PBIB 2BCJB 2OK6A 4GQ1A 5FKQA 2IUPA 4PC0A 4H5IA 4NSXA 4ZN4A 3F3FA 4JXMA 3F3GA 3N0EA 5EM2B 4JT5C 5HYNB 1L0QA 3E0CA 5EMLB 4J78A 5CYKA 1PEVA 4J79A 2YNNA 3V7DB 2P9SC 2H3XA 3C75H 3RN1D 3AFCA 2PM9A 3NVQA 3OKWA 1B9XA 4J84A 3IJ0A 4X60B 4AOWA 3EG6A 3PXTD 1OLZA 1A0RB 5TEEA 1K32A 4X3EA 2AGYA 2CE8A 5HE2B 4FB1D 1MG3A 2GC7A 3JROA 4A11B 5GSAA 5TEFA 3K26A 1GG2B 3UVOA 2CNXA 5HE3B 2H47A 3RMZD 4FAND 5IJ7E 5H14A 2Q7QA 3SN6B 4E54A 5HQGA 1MG2A 2B5LA 3MMYA 2CE9A 3NVNA 4LGNA 2J56H 4FA9D 4CY3A 3RRMC 2YMUA 2J55H 3JAMg 4I79A 4JSNC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J0X A;  3PVU B;  3ULE C;  3JB9 L;  2IUV A;  2IAA A;  3BWS A;  2H14 A;  3I7H A;  2H9L A;  3UVN A;  2P9U C;  5C2V B;  1NR0 A;  4ERY A;  4J86 A;  4U7A A;  4E5Z A;  3UKU C;  4FA4 D;  2P9N C;  2YNP A;  1TYQ C;  2UZX B;  2CN3 A;  4JSV C;  5HE0 B;  5FLX g;  1JMZ B;  4A09 B;  3RSE C;  2IUQ A;  5I5M A;  3AL8 B;  4ESG A;  2IWK A;  2TRC B;  4A7J A;  4GZ8 A;  1U2V C;  2MTA H;  5TF2 A;  4JT6 C;  2O9K A;  1PBY B;  4GGD A;  4JD2 C;  4UI9 R;  3V5W B;  4BUJ C;  4IMM A;  4FAV D;  5AFU 3;  4A0B B;  1XIP A;  4BL0 A;  3DSM A;  5FQD A;  4QT8 A;  5I5J A;  4O45 A;  3BG0 A;  5C2W B;  4O1Q D;  2HJB A;  3SVW D;  4CZX A;  2H6K A;  2YBA A;  3PSC B;  5H17 A;  3W15 A;  5IC7 A;  5CYK B;  4X61 B;  1GXR A;  3I7L A;  3SCY A;  3ORV D;  4CZY A;  4ZOX A;  4FA1 D;  5C9Z B;  2PM9 B;  3SJL D;  3I7K A;  5GMK n;  5FKR A;  3KRX B;  1XHM A;  4CY2 A;  2XL3 A;  4PXW A;  3EU7 A;  3I7N A;  4J82 A;  3EI2 A;  3J80 g;  2P9L C;  2HKR A;  2H13 A;  2H68 A;  4A2M A;  3JZH A;  1MDA H;  3C9C A;  2AGZ A;  1U4C A;  1SHY B;  2AH1 A;  4E54 B;  4TZ4 A;  4O3U B;  4U1E I;  3I2N A;  5HE1 B;  3F3P A;  4ZOY A;  3JZG A;  2EBS A;  5A2Q g;  3A0F A;  2J57 G;  4R7A B;  4J0W A;  3DWL C;  5I5I A;  4LG9 A;  3PXW D;  4JSX C;  2CO0 C;  3EI4 A;  4D6V A;  1P22 A;  3J81 g;  5KDO B;  4FHL A;  2OVP B;  3OL2 A;  4E5Z B;  3MXX A;  2AQ5 A;  5EAL A;  2H9M A;  1FWX A;  4PBY A;  3FGB A;  3VGZ A;  3IJC A;  3SBQ A;  4O9D A;  3SXT D;  3BG1 A;  4YVD A;  3OKY A;  2AH0 A;  2IWF A;  5FKS A;  4CY5 A;  5FXY A;  4GGC A;  4GM9 A;  1XKS A;  3IIY A;  3C99 A;  1VYH C;  4Y7R A;  3N0D A;  4QRJ A;  4H5J A;  4A2L A;  3UKR C;  3MZK A;  5EMJ B;  3CIK B;  3NVX A;  3IIW A;  2BBK H;  4O3T B;  4N14 A;  4MK0 B;  3SHF A;  5EMK B;  4Z8L A;  4L9O A;  2H6N A;  2H6Q A;  2Z2N A;  3DM0 A;  3MZL A;  4GM3 A;  4A0A A;  5EAM A;  3B7F A;  2XL2 A;  3CFS B;  3PE7 A;  3PVW B;  4HDJ A;  4XEI C;  5CXC A;  4CI3 A;  4PSX B;  4J77 A;  4LG8 A;  1RI6 A;  3I8E A;  4J81 A;  5K1C C;  3RFG A;  4QQE A;  3FM0 A;  3EI2 B;  1K8K C;  1N6E A;  5IJ8 E;  4ERQ A;  2Z2P A;  2QC5 A;  4FWW A;  3SWS D;  4L3H D;  3OTT A;  4Y5R D;  4GQB B;  1S4U X;  4GMB A;  4CZV A;  4FA5 D;  2PM6 B;  2UZY B;  4AEZ A;  2HYE A;  4XYH A;  1JMX B;  2GNQ A;  5THA A;  1GOT B;  4ES0 A;  3SMR A;  3V9F A;  3HFQ A;  5FA5 B;  5IGO A;  5EAP A;  3ODT A;  4J87 A;  3UVL A;  3AL9 A;  3EI4 B;  3GRE A;  1B9Y A;  4A08 A;  3EI3 A;  4L3G D;  5TDH B;  2QXV A;  5EMM B;  3L4M D;  3AH8 B;  4ZOV A;  1N6D A;  3JPX A;  3DXM C;  3JZN A;  3OL2 B;  2P9P C;  5AJA A;  3IJ1 A;  5CXB B;  3MKS B;  3KRW B;  2P9I C;  4OWR A;  2I0R A;  4EWR A;  5K19 A;  2I3S A;  2OK4 A;  4OZU A;  4K3I D;  2OIZ A;  3RN0 D;  5EM2 A;  3OKY B;  4J73 A;  3EWE A;  1OMW B;  5IT9 g;  4L1Q D;  3VA6 A;  1GP2 B;  3IKO A;  3PXS D;  1QNI A;  3L4O D;  4BH6 A;  3CFV A;  4PNK B;  2YNO A;  1PGU A;  1JJU B;  5CXB A;  5EAR A;  2OJY A;  2AGX A;  3I89 A;  4K3J B;  3UVM A;  3MKQ A;  3SBR A;  3VH0 A;  3EMH A;  2HJ4 A;  1NEX B;  3I7P A;  2CN2 A;  4JSP C;  2W18 A;  2HES X;  3OW8 A;  2OVQ B;  3SLE D;  4A11 A;  4ERZ A;  1R5M A;  1PI6 A;  4G56 B;  2Z2O A;  2G9A A;  5JWZ A;  4A0A B;  5CXC B;  4CI1 A;  4CI2 A;  3GFC A;  2I0S A;  2YB8 B;  4GGA A;  4PSW B;  2B4E A;  2HXC A;  4ZOZ A;  3PSL A;  4KFM B;  4CI8 A;  3I8C A;  2AGL A;  3UR4 A;  4X63 B;  4PBZ A;  2OVR B;  2I3T A;  1SQ9 A;  2B5N A;  5GXH A;  3UVK A;  4GQ2 P;  2I0T A;  2CO0 A;  1YFQ A;  1N6F A;  5H1M A;  3RFH A;  3FRX A;  5FKT A;  2HKM A;  4XYI A;  4CY1 A;  3JRP A;  3C5M A;  3EI1 B;  1ERJ A;  3DXK C;  4D0K A;  5SXM A;  3SBP A;  4CC9 A;  3RLM D;  2PM7 B;  2AGW A;  4A09 A;  3I7O A;  4J8B A;  3AL8 A;  5GXI A;  1SQJ A;  2B5M A;  3K27 A;  3ZWL B;  4IA9 A;  2XYI A;  2H9N A;  5AMS A;  5IGQ A;  1Q47 A;  2XU7 A;  5B4W A;  4GM8 A;  2GC4 A;  3U4Y A;  3SFZ A;  3P4F A;  1TBG A;  2IUR A;  4J8G A;  4A08 B;  3EI1 A;  3EI3 B;  3OKT A;  1JOF A;  4QL1 A;  2H9P A;  2G99 A;  2P9K C;  4A0B A;  2PBI B;  2BCJ B;  2OK6 A;  4GQ1 A;  5FKQ A;  2IUP A;  4PC0 A;  4H5I A;  4NSX A;  4ZN4 A;  3F3F A;  4JXM A;  3F3G A;  3N0E A;  5EM2 B;  4JT5 C;  5HYN B;  1L0Q A;  3E0C A;  5EML B;  4J78 A;  5CYK A;  1PEV A;  4J79 A;  2YNN A;  3V7D B;  2P9S C;  2H3X A;  3C75 H;  3RN1 D;  3AFC A;  2PM9 A;  3NVQ A;  3OKW A;  1B9X A;  4J84 A;  3IJ0 A;  4X60 B;  4AOW A;  3EG6 A;  3PXT D;  1OLZ A;  1A0R B;  5TEE A;  1K32 A;  4X3E A;  2AGY A;  2CE8 A;  5HE2 B;  4FB1 D;  1MG3 A;  2GC7 A;  3JRO A;  4A11 B;  5GSA A;  5TEF A;  3K26 A;  1GG2 B;  3UVO A;  2CNX A;  5HE3 B;  2H47 A;  3RMZ D;  4FAN D;  5IJ7 E;  5H14 A;  2Q7Q A;  3SN6 B;  4E54 A;  5HQG A;  1MG2 A;  2B5L A;  3MMY A;  2CE9 A;  3NVN A;  4LGN A;  2J56 H;  4FA9 D;  4CY3 A;  3RRM C;  2YMU A;  2J55 H;  3JAM g;  4I79 A;  4JSN C; 
#chains in the Genus database with same CATH topology
 4J0X A;  4WJK A;  2XDW A;  3PVU B;  3ULE C;  3JB9 L;  2IUV A;  1VE6 A;  2IAA A;  3BWS A;  2H14 A;  3I7H A;  2H9L A;  3UVN A;  2P9U C;  5C2V B;  1NR0 A;  3MUO A;  1O6G A;  4ERY A;  3FCU A;  4J86 A;  4U7A A;  4E5Z A;  5HDB A;  4WK2 A;  3UKU C;  4FA4 D;  2P9N C;  1I2M B;  2YNP A;  1TYQ C;  2UZX B;  2CN3 A;  3EQ9 A;  4JSV C;  5HE0 B;  5FLX g;  1JMZ B;  4A09 B;  3RSE C;  2IUQ A;  5I5M A;  1UOP A;  3AL8 B;  4ESG A;  4DNU A;  1E8M A;  2IWK A;  2TRC B;  5M5U A;  4A7J A;  1U8C A;  4GZ8 A;  1U2V C;  2MTA H;  5TF2 A;  4JT6 C;  2O9K A;  1PBY B;  4GGD A;  4JD2 C;  4UI9 R;  3V5W B;  4BUJ C;  3O4I A;  4IMM A;  4FAV D;  5AFU 3;  4A0B B;  1XIP A;  2QZP A;  4BL0 A;  3DSM A;  4AN1 A;  5FQD A;  4QT8 A;  5I5J A;  4O45 A;  3BG0 A;  5C2W B;  4O1Q D;  2HJB A;  2JKX A;  3SVW D;  4CZX A;  2H6K A;  2VZ3 A;  2YBA A;  3PSC B;  5H17 A;  3W15 A;  5IC7 A;  3O4J A;  5CYK B;  4X61 B;  4WK4 A;  1GXR A;  1H2X A;  3I7L A;  3SCY A;  3ORV D;  3O4G A;  4CZY A;  4ZOX A;  4FA1 D;  3ZE2 A;  5C9Z B;  2PM9 B;  3SJL D;  3I7K A;  5GMK n;  5FKR A;  4O2W A;  3KRX B;  2EIB A;  1XHM A;  4CY2 A;  2XL3 A;  4PXW A;  3EU7 A;  3I7N A;  5M5S A;  4J82 A;  3EI2 A;  3J80 g;  1QFM A;  4G1M A;  3T3P A;  2VDP A;  4NBM A;  2P9L C;  2HKR A;  2H13 A;  2H68 A;  4A2M A;  4G55 A;  3JZH A;  1MDA H;  3C9C A;  2AGZ A;  4AN0 A;  1U4C A;  1SHY B;  2AH1 A;  4UM9 A;  3ZDZ A;  4MMX A;  4E54 B;  4TZ4 A;  4O3U B;  4U1E I;  1GOH A;  3I2N A;  5HE1 B;  3F3P A;  4ZOY A;  3JZG A;  2EBS A;  5A2Q g;  3A0F A;  2J57 G;  2HU8 A;  1BPO A;  3ZE0 A;  4R7A B;  1VE7 A;  5E6S A;  4J0W A;  3DWL C;  5I5I A;  1GOG A;  4NEN A;  5M61 A;  4LG9 A;  3PXW D;  4JSX C;  3IUJ A;  2CO0 C;  3EI4 A;  4D6V A;  1P22 A;  3J81 g;  1C9L A;  2VC2 A;  5KDO B;  4AMZ A;  4FHL A;  2OVP B;  3OL2 A;  4E5Z B;  3MXX A;  1UOQ A;  3NID A;  2AQ5 A;  5EAL A;  2H9M A;  1FWX A;  4PBY A;  3FGB A;  3VGZ A;  2VDN A;  3IJC A;  3SBQ A;  4O9D A;  3SXT D;  3BG1 A;  4YVD A;  3OKY A;  3OF7 A;  4BP9 A;  2AH0 A;  2IWF A;  5FKS A;  4CY5 A;  4G1E A;  5FXY A;  3IUN A;  4GGC A;  4GM9 A;  3T3M A;  1XKS A;  3IIY A;  3C99 A;  1VYH C;  4Y7R A;  3N0D A;  4QRJ A;  1O6F A;  4H5J A;  4A2L A;  4JHP C;  3UKR C;  3MZK A;  5EMJ B;  3CIK B;  3NVX A;  3IIW A;  2BBK H;  4O3T B;  2EID A;  4N14 A;  4MK0 B;  3SHF A;  5EMK B;  5E6U A;  4Z8L A;  4L9O A;  3ZDY A;  2H6N A;  2H6Q A;  2Z2N A;  3DM0 A;  3MZL A;  4NC4 A;  4GM3 A;  4A0A A;  5EAM A;  3B7F A;  2XL2 A;  3CFS B;  3PE7 A;  3PVW B;  4HDJ A;  4UM8 A;  4RE5 A;  4XEI C;  5CXC A;  4PSX B;  4CI3 A;  4J77 A;  4LG8 A;  1RI6 A;  3I8E A;  4J81 A;  5K1C C;  3RFG A;  3IUQ A;  4JHN A;  4QQE A;  3FM0 A;  3MUN A;  3EI2 B;  4QAM A;  1K8K C;  3V4V A;  1N6E A;  5IJ8 E;  4ERQ A;  2Z2P A;  2QC5 A;  4FWW A;  3SWS D;  4L3H D;  4MMY A;  3OTT A;  4Y5R D;  2EIE A;  4GQB B;  1S4U X;  3FCS A;  4GMB A;  4CZV A;  2VDR A;  4FA5 D;  2PM6 B;  2UZY B;  4WK0 A;  4AEZ A;  2HYE A;  4XYH A;  1JMX B;  4NAA A;  2GNQ A;  5THA A;  1GOT B;  4ES0 A;  3SMR A;  3NIG A;  4MMZ A;  3HFQ A;  3V9F A;  3K72 A;  5FA5 B;  5IGO A;  5EAP A;  4Z7Q A;  3ODT A;  4J87 A;  3QHY B;  3UVL A;  3AL9 A;  1A12 A;  3EI4 B;  1M1X A;  1B9Y A;  3GRE A;  4A08 A;  2VZ1 A;  3EI3 A;  4L3G D;  5TDH B;  2QXV A;  5EMM B;  3L4M D;  3AH8 B;  4ZOV A;  4IRZ A;  1N6D A;  3JPX A;  3DXM C;  3JZN A;  3OL2 B;  1QFS A;  2P9P C;  5AJA A;  5M5V A;  5M5T A;  3IJ1 A;  5CXB B;  3MKS B;  3KRW B;  2P9I C;  4OWR A;  2I0R A;  4EWR A;  5K19 A;  2I3S A;  2OK4 A;  4OZU A;  4K3I D;  2OIZ A;  1GOF A;  3RN0 D;  5EM2 A;  1E8N A;  3OKY B;  4J73 A;  3EWE A;  1OMW B;  3QI0 A;  4AMY A;  5IT9 g;  4L1Q D;  3VA6 A;  1GP2 B;  3IKO A;  3PXS D;  1QNI A;  2XZG A;  3L4O D;  4BH6 A;  3CFV A;  4PNK B;  4AX4 A;  2YNO A;  1PGU A;  1JJU B;  5CXB A;  5E6R A;  2OJY A;  4RE6 A;  5EAR A;  2AGX A;  3I89 A;  4K3J B;  2BKL A;  1K3I A;  3UVM A;  3MKQ A;  3SBR A;  3VH0 A;  3EMH A;  2HJ4 A;  1NEX B;  3I7P A;  3EQ8 A;  2CN2 A;  4JSP C;  4D9S A;  2W18 A;  3O4H A;  2HES X;  3OW8 A;  2OVQ B;  2HU5 A;  3SLE D;  4A11 A;  4ERZ A;  1R5M A;  1H2W A;  2VDQ A;  4L1M A;  1PI6 A;  4G56 B;  2Z2O A;  2VDK A;  2G9A A;  5JWZ A;  3NIF A;  4A0A B;  5CXC B;  4CI1 A;  1UTC A;  3K71 A;  4Z7N A;  3GD1 I;  4CI2 A;  3GFC A;  2I0S A;  2YB8 B;  4GGA A;  4PSW B;  2B4E A;  2HXC A;  2HU7 A;  4ZOZ A;  3PSL A;  4KFM B;  3IUM A;  4CI8 A;  3I8C A;  2AGL A;  3UR4 A;  3ZDX A;  3IUL A;  4X63 B;  4PBZ A;  2OVR B;  2I3T A;  1SQ9 A;  1T2X A;  2B5N A;  3DDU A;  3UVK A;  5GXH A;  4GQ2 P;  2I0T A;  2VDM A;  2CO0 A;  3ZE1 A;  1YFQ A;  1N6F A;  5H1M A;  3RFH A;  3FRX A;  5FKT A;  2HKM A;  4XYI A;  4CY1 A;  3JRP A;  3C5M A;  3EI1 B;  1ERJ A;  3DXK C;  4D0K A;  5SXM A;  3SBP A;  4CC9 A;  3RLM D;  3IVM A;  2PM7 B;  2VDL A;  4Z7O A;  2AGW A;  4A09 A;  3EQ7 A;  3I7O A;  4J8B A;  3AL8 A;  5GXI A;  4DNV A;  1SQJ A;  2B5M A;  3K27 A;  3ZWL B;  3GC3 B;  4IA9 A;  2XYI A;  2H9N A;  5AMS A;  5IGQ A;  1Q47 A;  2XU7 A;  5B4W A;  4GM8 A;  2GC4 A;  3U4Y A;  3SFZ A;  3P4F A;  1TBG A;  2IUR A;  4J8G A;  4A08 B;  3EI1 A;  3EI3 B;  4BCD A;  3OKT A;  1JOF A;  4QL1 A;  2H9P A;  2G99 A;  2P9K C;  5M5R A;  2XE4 A;  4A0B A;  2PBI B;  2BCJ B;  2OK6 A;  4GQ1 A;  5FKQ A;  2IUP A;  4PC0 A;  4H5I A;  4NSX A;  4ZN4 A;  3F3F A;  4JXM A;  3F3G A;  3N0E A;  2WQ8 A;  5EM2 B;  4JT5 C;  5HYN B;  3IJE A;  1L0Q A;  3E0C A;  5EML B;  4BP8 A;  4J78 A;  1H2Y A;  5CYK A;  1PEV A;  4J79 A;  2YNN A;  3V7D B;  2VDO A;  1VZ3 A;  3VI4 A;  2P9S C;  2H3X A;  1UOO A;  3C75 H;  3V4P A;  3KCI A;  3RN1 D;  3MVD K;  3AFC A;  2PM9 A;  3NVQ A;  3OKW A;  5C92 A;  1B9X A;  4J84 A;  3IJ0 A;  1JTD B;  4X60 B;  4AOW A;  3EG6 A;  3PXT D;  1OLZ A;  3IUR A;  1A0R B;  5TEE A;  1K32 A;  3K6S A;  4O02 A;  4X3E A;  1YR2 A;  2AGY A;  2CE8 A;  5HE2 B;  4FB1 D;  1MG3 A;  2GC7 A;  3JRO A;  4A11 B;  5GSA A;  1VZ2 A;  5TEF A;  5FFO A;  3K26 A;  1GG2 B;  3UVO A;  2CNX A;  5HE3 B;  2H47 A;  4BCB A;  3RMZ D;  4FAN D;  5IJ7 E;  4DNW A;  2QR5 A;  1E5T A;  5H14 A;  2Q7Q A;  3SN6 B;  4E54 A;  5HQG A;  1L5G A;  1MG2 A;  2B5L A;  1JV2 A;  1H2Z A;  1TYE A;  2EIC A;  2CE9 A;  3MMY A;  3NVN A;  4LGN A;  2J56 H;  5C86 A;  3VI3 A;  5FFG A;  4CY3 A;  1C9I A;  3RRM C;  4FA9 D;  2YMU A;  4BCC A;  2J55 H;  3JAM g;  4I79 A;  4JSN C; 
#chains in the Genus database with same CATH homology
 4J0X A;  3PVU B;  3ULE C;  3JB9 L;  2IUV A;  2IAA A;  3BWS A;  2H14 A;  3I7H A;  2H9L A;  3UVN A;  2P9U C;  5C2V B;  1NR0 A;  4ERY A;  4J86 A;  4U7A A;  4E5Z A;  3UKU C;  4FA4 D;  2P9N C;  2YNP A;  1TYQ C;  2UZX B;  2CN3 A;  4JSV C;  5HE0 B;  5FLX g;  1JMZ B;  4A09 B;  3RSE C;  2IUQ A;  5I5M A;  3AL8 B;  4ESG A;  2IWK A;  2TRC B;  4A7J A;  4GZ8 A;  1U2V C;  2MTA H;  5TF2 A;  4JT6 C;  2O9K A;  1PBY B;  4GGD A;  4JD2 C;  4UI9 R;  3V5W B;  4BUJ C;  4IMM A;  4FAV D;  5AFU 3;  4A0B B;  1XIP A;  4BL0 A;  3DSM A;  5FQD A;  4QT8 A;  5I5J A;  4O45 A;  3BG0 A;  5C2W B;  4O1Q D;  2HJB A;  3SVW D;  4CZX A;  2H6K A;  2YBA A;  3PSC B;  5H17 A;  3W15 A;  5IC7 A;  5CYK B;  4X61 B;  1GXR A;  3I7L A;  3SCY A;  3ORV D;  4CZY A;  4ZOX A;  4FA1 D;  5C9Z B;  2PM9 B;  3SJL D;  3I7K A;  5GMK n;  5FKR A;  3KRX B;  1XHM A;  4CY2 A;  2XL3 A;  4PXW A;  3EU7 A;  3I7N A;  4J82 A;  3EI2 A;  3J80 g;  2P9L C;  2HKR A;  2H13 A;  2H68 A;  4A2M A;  3JZH A;  1MDA H;  3C9C A;  2AGZ A;  1U4C A;  1SHY B;  2AH1 A;  4E54 B;  4TZ4 A;  4O3U B;  4U1E I;  3I2N A;  5HE1 B;  3F3P A;  4ZOY A;  3JZG A;  2EBS A;  5A2Q g;  3A0F A;  2J57 G;  4R7A B;  4J0W A;  3DWL C;  5I5I A;  4LG9 A;  3PXW D;  4JSX C;  2CO0 C;  3EI4 A;  4D6V A;  1P22 A;  3J81 g;  5KDO B;  4FHL A;  2OVP B;  3OL2 A;  4E5Z B;  3MXX A;  2AQ5 A;  5EAL A;  2H9M A;  1FWX A;  4PBY A;  3FGB A;  3VGZ A;  3IJC A;  3SBQ A;  4O9D A;  3SXT D;  3BG1 A;  4YVD A;  3OKY A;  2AH0 A;  2IWF A;  5FKS A;  4CY5 A;  5FXY A;  4GGC A;  4GM9 A;  1XKS A;  3IIY A;  3C99 A;  1VYH C;  4Y7R A;  3N0D A;  4QRJ A;  4H5J A;  4A2L A;  3UKR C;  3MZK A;  5EMJ B;  3CIK B;  3NVX A;  3IIW A;  2BBK H;  4O3T B;  4N14 A;  4MK0 B;  3SHF A;  5EMK B;  4Z8L A;  4L9O A;  2H6N A;  2H6Q A;  2Z2N A;  3DM0 A;  3MZL A;  4GM3 A;  4A0A A;  5EAM A;  3B7F A;  2XL2 A;  3CFS B;  3PE7 A;  3PVW B;  4HDJ A;  4XEI C;  5CXC A;  4CI3 A;  4PSX B;  4J77 A;  4LG8 A;  1RI6 A;  3I8E A;  4J81 A;  5K1C C;  3RFG A;  4QQE A;  3FM0 A;  3EI2 B;  1K8K C;  1N6E A;  5IJ8 E;  4ERQ A;  2Z2P A;  2QC5 A;  4FWW A;  3SWS D;  4L3H D;  3OTT A;  4Y5R D;  4GQB B;  1S4U X;  4GMB A;  4CZV A;  4FA5 D;  2PM6 B;  2UZY B;  4AEZ A;  2HYE A;  4XYH A;  1JMX B;  2GNQ A;  5THA A;  1GOT B;  4ES0 A;  3SMR A;  3V9F A;  3HFQ A;  5FA5 B;  5IGO A;  5EAP A;  3ODT A;  4J87 A;  3UVL A;  3AL9 A;  3EI4 B;  3GRE A;  1B9Y A;  4A08 A;  3EI3 A;  4L3G D;  5TDH B;  2QXV A;  5EMM B;  3L4M D;  3AH8 B;  4ZOV A;  1N6D A;  3JPX A;  3DXM C;  3JZN A;  3OL2 B;  2P9P C;  5AJA A;  3IJ1 A;  5CXB B;  3MKS B;  3KRW B;  2P9I C;  4OWR A;  2I0R A;  4EWR A;  5K19 A;  2I3S A;  2OK4 A;  4OZU A;  4K3I D;  2OIZ A;  3RN0 D;  5EM2 A;  3OKY B;  4J73 A;  3EWE A;  1OMW B;  5IT9 g;  4L1Q D;  3VA6 A;  1GP2 B;  3IKO A;  3PXS D;  1QNI A;  3L4O D;  4BH6 A;  3CFV A;  4PNK B;  2YNO A;  1PGU A;  1JJU B;  5CXB A;  5EAR A;  2OJY A;  2AGX A;  3I89 A;  4K3J B;  3UVM A;  3MKQ A;  3SBR A;  3VH0 A;  3EMH A;  2HJ4 A;  1NEX B;  3I7P A;  2CN2 A;  4JSP C;  2W18 A;  2HES X;  3OW8 A;  2OVQ B;  3SLE D;  4A11 A;  4ERZ A;  1R5M A;  1PI6 A;  4G56 B;  2Z2O A;  2G9A A;  5JWZ A;  4A0A B;  5CXC B;  4CI1 A;  4CI2 A;  3GFC A;  2I0S A;  2YB8 B;  4GGA A;  4PSW B;  2B4E A;  2HXC A;  4ZOZ A;  3PSL A;  4KFM B;  4CI8 A;  3I8C A;  2AGL A;  3UR4 A;  4X63 B;  4PBZ A;  2OVR B;  2I3T A;  1SQ9 A;  2B5N A;  5GXH A;  3UVK A;  4GQ2 P;  2I0T A;  2CO0 A;  1YFQ A;  1N6F A;  5H1M A;  3RFH A;  3FRX A;  5FKT A;  2HKM A;  4XYI A;  4CY1 A;  3JRP A;  3C5M A;  3EI1 B;  1ERJ A;  3DXK C;  4D0K A;  5SXM A;  3SBP A;  4CC9 A;  3RLM D;  2PM7 B;  2AGW A;  4A09 A;  3I7O A;  4J8B A;  3AL8 A;  5GXI A;  1SQJ A;  2B5M A;  3K27 A;  3ZWL B;  4IA9 A;  2XYI A;  2H9N A;  5AMS A;  5IGQ A;  1Q47 A;  2XU7 A;  5B4W A;  4GM8 A;  2GC4 A;  3U4Y A;  3SFZ A;  3P4F A;  1TBG A;  2IUR A;  4J8G A;  4A08 B;  3EI1 A;  3EI3 B;  3OKT A;  1JOF A;  4QL1 A;  2H9P A;  2G99 A;  2P9K C;  4A0B A;  2PBI B;  2BCJ B;  2OK6 A;  4GQ1 A;  5FKQ A;  2IUP A;  4PC0 A;  4H5I A;  4NSX A;  4ZN4 A;  3F3F A;  4JXM A;  3F3G A;  3N0E A;  5EM2 B;  4JT5 C;  5HYN B;  1L0Q A;  3E0C A;  5EML B;  4J78 A;  5CYK A;  1PEV A;  4J79 A;  2YNN A;  3V7D B;  2P9S C;  2H3X A;  3C75 H;  3RN1 D;  3AFC A;  2PM9 A;  3NVQ A;  3OKW A;  1B9X A;  4J84 A;  3IJ0 A;  4X60 B;  4AOW A;  3EG6 A;  3PXT D;  1OLZ A;  1A0R B;  5TEE A;  1K32 A;  4X3E A;  2AGY A;  2CE8 A;  5HE2 B;  4FB1 D;  1MG3 A;  2GC7 A;  3JRO A;  4A11 B;  5GSA A;  5TEF A;  3K26 A;  1GG2 B;  3UVO A;  2CNX A;  5HE3 B;  2H47 A;  3RMZ D;  4FAN D;  5IJ7 E;  5H14 A;  2Q7Q A;  3SN6 B;  4E54 A;  5HQG A;  1MG2 A;  2B5L A;  3MMY A;  2CE9 A;  3NVN A;  4LGN A;  2J56 H;  4FA9 D;  4CY3 A;  3RRM C;  2YMU A;  2J55 H;  3JAM g;  4I79 A;  4JSN C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...