2H9MA

Wdr5 in complex with unmodified h3k4 peptide
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
304
structure length
304
Chain Sequence
VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD-repeat protein 5
publication title Structural basis for molecular recognition and presentation of histone H3 By WDR5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural genomics, gene regulation
total genus 101
structure length 304
sequence length 304
chains with identical sequence C
ec nomenclature
pdb deposition date 2006-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2h9mA00
3OL2A 5GXHA 3OW8A 4K3ID 2I0TA 3OL2B 3SWSD 3PVWB 5IT9g 2H68A 3V9FA 1P22A 5TF2A 3SBRA 4KFMB 4FHLA 2H9NA 4X61B 3OKWA 1PEVA 5JWZA 2TRCB 2H9LA 3CFVA 2H13A 2B4EA 4OZUA 4GZ8A 4A11A 2J55H 2H9MA 5THAA 3UVKA 4QL1A 3SXTD 1MG3A 3ORVD 4JXMA 2YMUA 4FA4D 4CY2A 1K32A 2CN3A 4ESGA 3MZLA 4HDJA 5HE1B 3MMYA 4LG9A 3J80g 4PSWB 5AMSA 4BL0A 2OJYA 4A2LA 4ERQA 4U1EI 4CY3A 5FKQA 3SBQA 2XU7A 2GC4A 2YNNA 5EM2A 3OTTA 2H3XA 2PM9A 1R5MA 2Q7QA 4PXWA 5FQDA 3IJ0A 2BBKH 3I8CA 4O1QD 2PM9B 3GFCA 5SXMA 4J87A 4PC0A 5KDOB 3SLED 3B7FA 4QRJA 5CXBA 1NR0A 4CY5A 5GMKn 5IJ7E 1S4UX 1NEXB 5HQGA 3VA6A 3K27A 3NVQA 3N0DA 4J82A 4I79A 4J78A 4J8GA 2OVQB 4ERYA 2IWKA 5EAMA 2XYIA 3PSCB 4LG8A 1ERJA 3F3GA 2HJBA 2AQ5A 1JJUB 5A2Qg 4GM3A 2G99A 3AFCA 5K19A 2Z2NA 3AL9A 3EU7A 3UKRC 5EMLB 5EARA 3FRXA 3U4YA 4R7AB 3UVMA 3EG6A 4A0BB 3RSEC 4YVDA 4ZN4A 2QC5A 3RRMC 2XL2A 2IWFA 2QXVA 5EAPA 3JAMg 3RFHA 3SMRA 4X3EA 4J0WA 4CI8A 3N0EA 3SBPA 3JZHA 2I3SA 4OWRA 4J79A 1FWXA 5FA5B 3DXKC 3VGZA 3MKQA 2H6KA 4Y5RD 3DSMA 4JD2C 2YB8B 4MK0B 4JT6C 3RFGA 2H14A 1U4CA 4L3HD 5IJ8E 1SQJA 3J81g 3W15A 3EI3B 3DXMC 4ES0A 3PXSD 4O3UB 3AL8B 2P9IC 5AFU3 5HE0B 2J57G 3RMZD 1RI6A 2GC7A 5GSAA 4J77A 3K26A 4U7AA 3OKYB 1XIPA 3L4OD 2W18A 4JSXC 1Q47A 4ERZA 4QQEA 4AEZA 3EWEA 2GNQA 3ULEC 5IGOA 5C2WB 2P9KC 2HJ4A 1TBGA 2OVRB 4QT8A 3JPXA 4JSNC 2YNOA 5FXYA 3SN6B 5GXIA 3UVOA 5C9ZB 2HXCA 2AGZA 2P9SC 4GGCA 4GQBB 5IGQA 2P9NC 5FKTA 3C99A 3KRWB 4N14A 4A0AA 4A2MA 4XYIA 4FAVD 1B9YA 2BCJB 2MTAH 4CZVA 4G56B 2OK4A 4E5ZB 3JZNA 2CE9A 2IUQA 5B4WA 2H9PA 1GP2B 2I0RA 4A0AB 4E54B 2EBSA 5HYNB 5EMMB 2UZYB 1MG2A 2H6QA 3EI4B 4XYHA 1JMXB 3UVLA 4BUJC 3C75H 5CXCA 3SCYA 3I7KA 2PBIB 1PBYB 2YNPA 4H5JA 3UKUC 3IJ1A 5AJAA 4GMBA 5EALA 3BG0A 3IKOA 5CXCB 3SVWD 4O9DA 2O9KA 2OK6A 3BG1A 1OLZA 3IIYA 2YBAA 2G9AA 2CE8A 3PXTD 2B5LA 3NVNA 3MKSB 5IC7A 3ZWLB 1N6EA 4FB1D 5EMKB 3FGBA 3JZGA 3C9CA 4A0BA 2AGXA 4UI9R 4XEIC 1VYHC 3P4FA 1MDAH 2Z2PA 1XHMA 1SQ9A 3V7DB 2OVPB 3PE7A 3I89A 2IUPA 3CFSB 4GGDA 3IIWA 2AGLA 4GQ1A 1N6FA 5CYKA 3PXWD 1OMWB 4J81A 3CIKB 5FKRA 1JOFA 4GQ2P 5CYKB 5HE3B 4JSPC 4ZOXA 4Y7RA 3I7LA 1L0QA 3EI3A 4A09B 4IMMA 5H17A 4JSVC 3UR4A 3BWSA 3DWLC 3AL8A 3MXXA 3RN0D 3A0FA 2I3TA 3EMHA 4L3GD 4CC9A 4FA9D 4ZOVA 3OKYA 3RN1D 5I5JA 4CZXA 4L9OA 4J0XA 4ZOZA 4CI3A 1XKSA 3SHFA 3EI2A 3FM0A 2B5MA 2J56H 5I5IA 2HKMA 2IURA 5FLXg 2P9PC 2CO0C 3I2NA 3EI2B 3SJLD 2AGWA 3GREA 1GG2B 5TDHB 4Z8LA 2Z2OA 4A08A 4CY1A 2AH0A 3I7HA 1SHYB 4CI2A 3EI1A 4FA5D 4O45A 2H6NA 4GGAA 4O3TB 4E5ZA 3UVNA 3HFQA 5I5MA 4A08B 5HE2B 4E54A 3EI1B 1PGUA 4FWWA 3I8EA 3EI4A 1YFQA 3JB9L 4H5IA 3I7PA 4X60B 4A11B 3NVXA 1GXRA 2PM6B 2I0SA 4J73A 4D6VA 3PSLA 4BH6A 2P9LC 3E0CA 2HKRA 5EMJB 4FA1D 1A0RB 4J84A 3OKTA 2PM7B 2AH1A 4TZ4A 3I7NA 2CNXA 1N6DA 4CI1A 4GM8A 4AOWA 1B9XA 3L4MD 3SFZA 2UZXB 3IJCA 5EM2B 4L1QD 2AGYA 4JT5C 4J86A 4PNKB 3JRPA 4X63B 5TEFA 3RLMD 2P9UC 3DM0A 4LGNA 5TEEA 1K8KC 5CXBB 1TYQC 2OIZA 4K3JB 3JROA 3VH0A 1U2VC 2HESX 5K1CC 3V5WB 1JMZB 2HYEA 5C2VB 1QNIA 3I7OA 2IUVA 1PI6A 3MZKA 2CO0A 3PVUB 4PSXB 2XL3A 3KRXB 4A09A 4EWRA 2B5NA 3F3PA 2H47A 5FKSA 1GOTB 4J8BA 3ODTA 4A7JA 4CZYA 3F3FA 4ZOYA 5H14A 4D0KA 2CN2A 4IA9A 3AH8B 4NSXA 4PBYA 4GM9A 3C5MA 4PBZA 2IAAA 5H1MA 4FAND
chains in the Genus database with same CATH superfamily
3OL2A 4DNWA 5GXHA 3NIGA 3IUJA 3OW8A 1E8MA 4K3ID 2I0TA 2VDQA 3OL2B 3SWSD 3PVWB 4MMZA 5IT9g 2H68A 3V9FA 1P22A 4NC4A 5TF2A 4NBMA 3SBRA 4Z7NA 4G1EA 4KFMB 4FHLA 2H9NA 4X61B 3OKWA 1PEVA 5JWZA 2TRCB 2H9LA 1E8NA 2H13A 3CFVA 4WK4A 2B4EA 4OZUA 4GZ8A 5FFOA 4A11A 2J55H 1BPOA 4UM9A 2H9MA 4NAAA 5THAA 4G1MA 5HDBA 3UVKA 5M5VA 4IRZA 4QL1A 3SXTD 1L5GA 1MG3A 3FCUA 3ORVD 4JXMA 2YMUA 4FA4D 4CY2A 1K32A 2CN3A 4ESGA 3MZLA 4HDJA 5HE1B 3MMYA 4LG9A 3J80g 4PSWB 5AMSA 4BL0A 2HU7A 2OJYA 4A2LA 4ERQA 4NENA 4U1EI 4CY3A 5FKQA 3SBQA 3V4PA 2XU7A 2GC4A 2YNNA 5EM2A 4BCBA 3OTTA 3K72A 2H3XA 2PM9A 1R5MA 2Q7QA 4PXWA 5FQDA 3IJ0A 3QHYB 1O6GA 2BBKH 2QR5A 2VZ3A 3I8CA 4O1QD 4AX4A 2PM9B 3K71A 3V4VA 3GFCA 5C92A 5SXMA 4J87A 4PC0A 5KDOB 3SLED 3B7FA 4QRJA 5CXBA 1NR0A 4CY5A 5GMKn 5IJ7E 1S4UX 1NEXB 5HQGA 3VA6A 4AMYA 3K27A 3NVQA 2VDPA 3N0DA 3IURA 1I2MB 4J82A 4I79A 4J78A 4AN1A 1TYEA 4J8GA 2OVQB 4ERYA 2IWKA 5EAMA 2XYIA 3ZE0A 3PSCB 4LG8A 1ERJA 3F3GA 2HJBA 2AQ5A 1JJUB 5A2Qg 4GM3A 2G99A 3AFCA 3O4IA 5K19A 2Z2NA 3AL9A 3EU7A 3UKRC 3IUNA 5EMLB 5EARA 3FRXA 4BP8A 3U4YA 4R7AB 4Z7QA 3UVMA 3EG6A 4A0BB 3RSEC 1QFSA 5E6RA 4YVDA 4ZN4A 2QC5A 1H2WA 3RRMC 2XL2A 2IWFA 2QXVA 5EAPA 3ZDYA 3JAMg 3RFHA 3SMRA 4X3EA 4J0WA 4CI8A 3N0EA 3SBPA 3JZHA 2I3SA 3IUMA 4OWRA 4Z7OA 4J79A 1FWXA 5FA5B 3DXKC 3T3MA 3VGZA 3MKQA 2H6KA 4Y5RD 3DSMA 1GOGA 4JD2C 2YB8B 4MK0B 4JT6C 1E5TA 3RFGA 2EICA 1VE7A 1UTCA 5C86A 2H14A 4BCCA 1JV2A 1U4CA 3MUOA 4L3HD 5IJ8E 1SQJA 3J81g 5E6UA 3W15A 3EI3B 3DXMC 5M5UA 4ES0A 3PXSD 4O3UB 2VDLA 3AL8B 2P9IC 5AFU3 5HE0B 2WQ8A 2J57G 3RMZD 1RI6A 2GC7A 5GSAA 4J77A 3K26A 4U7AA 3OKYB 2XDWA 1XIPA 3L4OD 4O2WA 2W18A 4JSXC 1Q47A 3FCSA 4ERZA 5M5TA 4QQEA 4AEZA 3EWEA 2GNQA 3ULEC 5IGOA 5C2WB 2EIBA 2P9KC 2HJ4A 1TBGA 2OVRB 4QT8A 3JPXA 4JSNC 2YNOA 5FXYA 3SN6B 5GXIA 3UVOA 3ZDXA 3IJEA 5C9ZB 2HXCA 2AGZA 1U8CA 2P9SC 4GGCA 4GQBB 5IGQA 2P9NC 5FKTA 3C99A 3KRWB 4N14A 4A0AA 3ZE2A 4A2MA 4XYIA 4FAVD 1B9YA 2BCJB 1QFMA 2MTAH 4CZVA 4G56B 3VI3A 2OK4A 4E5ZB 3JZNA 2CE9A 2IUQA 5E6SA 3EQ9A 2H9PA 1GP2B 2I0RA 5B4WA 4A0AB 1O6FA 4E54B 2EBSA 5HYNB 5EMMB 2UZYB 1MG2A 2H6QA 3EI4B 4BP9A 3EQ7A 4XYHA 1JMXB 3UVLA 4BUJC 3C75H 5CXCA 3SCYA 3I7KA 2PBIB 1PBYB 2YNPA 3NIFA 4H5JA 3UKUC 3IJ1A 5AJAA 4GMBA 5EALA 3BG0A 2XZGA 3IKOA 5CXCB 3SVWD 4O9DA 2O9KA 2OK6A 3BG1A 1OLZA 3IIYA 2YBAA 2G9AA 3NIDA 2CE8A 3PXTD 2B5LA 3NVNA 3MKSB 5IC7A 4DNUA 3ZWLB 1N6EA 4FB1D 5EMKB 3FGBA 3JZGA 3C9CA 4A0BA 2AGXA 4AN0A 1C9LA 2JKXA 4UI9R 3OF7A 4XEIC 3GC3B 4UM8A 1VYHC 3P4FA 1MDAH 2Z2PA 1XHMA 1SQ9A 3V7DB 2OVPB 3K6SA 3PE7A 3I89A 2IUPA 4JHNA 3CFSB 4GGDA 3IIWA 2AGLA 4GQ1A 1N6FA 5CYKA 3PXWD 1OMWB 4J81A 3O4JA 1GOHA 3ZE1A 4BCDA 3CIKB 5FKRA 2BKLA 1K3IA 1JOFA 4GQ2P 5CYKB 5HE3B 4JSPC 1UOOA 1C9IA 4L1MA 4G55A 4ZOXA 4Y7RA 3I7LA 3GD1I 1L0QA 3EI3A 4A09B 4IMMA 5H17A 4JSVC 3UR4A 1H2YA 3BWSA 3DWLC 3MXXA 3AL8A 3IVMA 2EIEA 3RN0D 2HU5A 3A0FA 2I3TA 1GOFA 4RE6A 3EMHA 4L3GD 4CC9A 4FA9D 4ZOVA 3OKYA 3RN1D 1YR2A 5I5JA 4CZXA 4L9OA 4WJKA 4J0XA 4ZOZA 4CI3A 1T2XA 1XKSA 3SHFA 3EI2A 3FM0A 2B5MA 2J56H 5I5IA 3O4GA 2HKMA 5M5SA 2IURA 5FLXg 2P9PC 3I2NA 2CO0C 3EI2B 3SJLD 2AGWA 3EQ8A 1H2ZA 3GREA 1GG2B 5TDHB 4Z8LA 2Z2OA 4A08A 4CY1A 2VDOA 2AH0A 3I7HA 1SHYB 4CI2A 3EI1A 3VI4A 4FA5D 1UOPA 4O45A 2H6NA 4GGAA 4O3TB 4E5ZA 3UVNA 3HFQA 5I5MA 4A08B 5HE2B 4E54A 1M1XA 1H2XA 5M5RA 3EI1B 1PGUA 4FWWA 3I8EA 3EI4A 1YFQA 3JB9L 4H5IA 3I7PA 4X60B 4A11B 1UOQA 3NVXA 1GXRA 2PM6B 4WK0A 1VZ2A 2I0SA 4J73A 4D6VA 3PSLA 4BH6A 4WK2A 2P9LC 3E0CA 2HKRA 5EMJB 4FA1D 1A0RB 4J84A 3OKTA 4AMZA 2VC2A 2PM7B 2AH1A 4MMYA 4TZ4A 3I7NA 2CNXA 1N6DA 4CI1A 4GM8A 4AOWA 1B9XA 3L4MD 3MUNA 3T3PA 3SFZA 2UZXB 3IJCA 5EM2B 4L1QD 2AGYA 4JT5C 2QZPA 4J86A 3O4HA 4PNKB 3JRPA 4X63B 3QI0A 5TEFA 2VZ1A 1JTDB 3RLMD 2XE4A 2P9UC 3IULA 1VZ3A 3DM0A 2VDNA 2VDKA 4LGNA 5TEEA 1K8KC 5CXBB 1TYQC 3DDUA 2OIZA 4K3JB 3JROA 3VH0A 1U2VC 4D9SA 2HESX 4MMXA 5K1CC 3V5WB 4DNVA 1JMZB 2HYEA 5C2VB 1QNIA 3I7OA 2IUVA 1PI6A 5FFGA 3MZKA 2CO0A 4JHPC 3PVUB 4PSXB 4RE5A 2XL3A 3KRXB 4A09A 4EWRA 2B5NA 2HU8A 3F3PA 2H47A 5FKSA 1GOTB 4J8BA 3ODTA 4A7JA 4CZYA 2VDRA 3ZDZA 3IUQA 4O02A 3F3FA 4ZOYA 5H14A 4D0KA 3MVDK 2CN2A 4IA9A 1VE6A 3AH8B 4NSXA 3KCIA 1A12A 4PBYA 4QAMA 4GM9A 3C5MA 5M61A 4PBZA 2IAAA 5H1MA 2EIDA 4FAND 2VDMA
chains in the Genus database with same CATH topology
3OL2A 5GXHA 3OW8A 4K3ID 2I0TA 3OL2B 3SWSD 3PVWB 5IT9g 2H68A 3V9FA 1P22A 5TF2A 3SBRA 4KFMB 4FHLA 2H9NA 4X61B 3OKWA 1PEVA 5JWZA 2TRCB 2H9LA 3CFVA 2H13A 2B4EA 4OZUA 4GZ8A 4A11A 2J55H 2H9MA 5THAA 3UVKA 4QL1A 3SXTD 1MG3A 3ORVD 4JXMA 2YMUA 4FA4D 4CY2A 1K32A 2CN3A 4ESGA 3MZLA 4HDJA 5HE1B 3MMYA 4LG9A 3J80g 4PSWB 5AMSA 4BL0A 2OJYA 4A2LA 4ERQA 4U1EI 4CY3A 5FKQA 3SBQA 2XU7A 2GC4A 2YNNA 5EM2A 3OTTA 2H3XA 2PM9A 1R5MA 2Q7QA 4PXWA 5FQDA 3IJ0A 2BBKH 3I8CA 4O1QD 2PM9B 3GFCA 5SXMA 4J87A 4PC0A 5KDOB 3SLED 3B7FA 4QRJA 5CXBA 1NR0A 4CY5A 5GMKn 5IJ7E 1S4UX 1NEXB 5HQGA 3VA6A 3K27A 3NVQA 3N0DA 4J82A 4I79A 4J78A 4J8GA 2OVQB 4ERYA 2IWKA 5EAMA 2XYIA 3PSCB 4LG8A 1ERJA 3F3GA 2HJBA 2AQ5A 1JJUB 5A2Qg 4GM3A 2G99A 3AFCA 5K19A 2Z2NA 3AL9A 3EU7A 3UKRC 5EMLB 5EARA 3FRXA 3U4YA 4R7AB 3UVMA 3EG6A 4A0BB 3RSEC 4YVDA 4ZN4A 2QC5A 3RRMC 2XL2A 2IWFA 2QXVA 5EAPA 3JAMg 3RFHA 3SMRA 4X3EA 4J0WA 4CI8A 3N0EA 3SBPA 3JZHA 2I3SA 4OWRA 4J79A 1FWXA 5FA5B 3DXKC 3VGZA 3MKQA 2H6KA 4Y5RD 3DSMA 4JD2C 2YB8B 4MK0B 4JT6C 3RFGA 2H14A 1U4CA 4L3HD 5IJ8E 1SQJA 3J81g 3W15A 3EI3B 3DXMC 4ES0A 3PXSD 4O3UB 3AL8B 2P9IC 5AFU3 5HE0B 2J57G 3RMZD 1RI6A 2GC7A 5GSAA 4J77A 3K26A 4U7AA 3OKYB 1XIPA 3L4OD 2W18A 4JSXC 1Q47A 4ERZA 4QQEA 4AEZA 3EWEA 2GNQA 3ULEC 5IGOA 5C2WB 2P9KC 2HJ4A 1TBGA 2OVRB 4QT8A 3JPXA 4JSNC 2YNOA 5FXYA 3SN6B 5GXIA 3UVOA 5C9ZB 2HXCA 2AGZA 2P9SC 4GGCA 4GQBB 5IGQA 2P9NC 5FKTA 3C99A 3KRWB 4N14A 4A0AA 4A2MA 4XYIA 4FAVD 1B9YA 2BCJB 2MTAH 4CZVA 4G56B 2OK4A 4E5ZB 3JZNA 2CE9A 2IUQA 5B4WA 2H9PA 1GP2B 2I0RA 4A0AB 4E54B 2EBSA 5HYNB 5EMMB 2UZYB 1MG2A 2H6QA 3EI4B 4XYHA 1JMXB 3UVLA 4BUJC 3C75H 5CXCA 3SCYA 3I7KA 2PBIB 1PBYB 2YNPA 4H5JA 3UKUC 3IJ1A 5AJAA 4GMBA 5EALA 3BG0A 3IKOA 5CXCB 3SVWD 4O9DA 2O9KA 2OK6A 3BG1A 1OLZA 3IIYA 2YBAA 2G9AA 2CE8A 3PXTD 2B5LA 3NVNA 3MKSB 5IC7A 3ZWLB 1N6EA 4FB1D 5EMKB 3FGBA 3JZGA 3C9CA 4A0BA 2AGXA 4UI9R 4XEIC 1VYHC 3P4FA 1MDAH 2Z2PA 1XHMA 1SQ9A 3V7DB 2OVPB 3PE7A 3I89A 2IUPA 3CFSB 4GGDA 3IIWA 2AGLA 4GQ1A 1N6FA 5CYKA 3PXWD 1OMWB 4J81A 3CIKB 5FKRA 1JOFA 4GQ2P 5CYKB 5HE3B 4JSPC 4ZOXA 4Y7RA 3I7LA 1L0QA 3EI3A 4A09B 4IMMA 5H17A 4JSVC 3UR4A 3BWSA 3DWLC 3AL8A 3MXXA 3RN0D 3A0FA 2I3TA 3EMHA 4L3GD 4CC9A 4FA9D 4ZOVA 3OKYA 3RN1D 5I5JA 4CZXA 4L9OA 4J0XA 4ZOZA 4CI3A 1XKSA 3SHFA 3EI2A 3FM0A 2B5MA 2J56H 5I5IA 2HKMA 2IURA 5FLXg 2P9PC 2CO0C 3I2NA 3EI2B 3SJLD 2AGWA 3GREA 1GG2B 5TDHB 4Z8LA 2Z2OA 4A08A 4CY1A 2AH0A 3I7HA 1SHYB 4CI2A 3EI1A 4FA5D 4O45A 2H6NA 4GGAA 4O3TB 4E5ZA 3UVNA 3HFQA 5I5MA 4A08B 5HE2B 4E54A 3EI1B 1PGUA 4FWWA 3I8EA 3EI4A 1YFQA 3JB9L 4H5IA 3I7PA 4X60B 4A11B 3NVXA 1GXRA 2PM6B 2I0SA 4J73A 4D6VA 3PSLA 4BH6A 2P9LC 3E0CA 2HKRA 5EMJB 4FA1D 1A0RB 4J84A 3OKTA 2PM7B 2AH1A 4TZ4A 3I7NA 2CNXA 1N6DA 4CI1A 4GM8A 4AOWA 1B9XA 3L4MD 3SFZA 2UZXB 3IJCA 5EM2B 4L1QD 2AGYA 4JT5C 4J86A 4PNKB 3JRPA 4X63B 5TEFA 3RLMD 2P9UC 3DM0A 4LGNA 5TEEA 1K8KC 5CXBB 1TYQC 2OIZA 4K3JB 3JROA 3VH0A 1U2VC 2HESX 5K1CC 3V5WB 1JMZB 2HYEA 5C2VB 1QNIA 3I7OA 2IUVA 1PI6A 3MZKA 2CO0A 3PVUB 4PSXB 2XL3A 3KRXB 4A09A 4EWRA 2B5NA 3F3PA 2H47A 5FKSA 1GOTB 4J8BA 3ODTA 4A7JA 4CZYA 3F3FA 4ZOYA 5H14A 4D0KA 2CN2A 4IA9A 3AH8B 4NSXA 4PBYA 4GM9A 3C5MA 4PBZA 2IAAA 5H1MA 4FAND
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OL2 A;  5GXH A;  3OW8 A;  4K3I D;  2I0T A;  3OL2 B;  3SWS D;  3PVW B;  5IT9 g;  2H68 A;  3V9F A;  1P22 A;  5TF2 A;  3SBR A;  4KFM B;  4FHL A;  2H9N A;  4X61 B;  3OKW A;  1PEV A;  5JWZ A;  2TRC B;  2H9L A;  3CFV A;  2H13 A;  2B4E A;  4OZU A;  4GZ8 A;  4A11 A;  2J55 H;  2H9M A;  5THA A;  3UVK A;  4QL1 A;  3SXT D;  1MG3 A;  3ORV D;  4JXM A;  2YMU A;  4FA4 D;  4CY2 A;  1K32 A;  2CN3 A;  4ESG A;  3MZL A;  4HDJ A;  5HE1 B;  3MMY A;  4LG9 A;  3J80 g;  4PSW B;  5AMS A;  4BL0 A;  2OJY A;  4A2L A;  4ERQ A;  4U1E I;  4CY3 A;  5FKQ A;  3SBQ A;  2XU7 A;  2GC4 A;  2YNN A;  5EM2 A;  3OTT A;  2H3X A;  2PM9 A;  1R5M A;  2Q7Q A;  4PXW A;  5FQD A;  3IJ0 A;  2BBK H;  3I8C A;  4O1Q D;  2PM9 B;  3GFC A;  5SXM A;  4J87 A;  4PC0 A;  5KDO B;  3SLE D;  3B7F A;  4QRJ A;  5CXB A;  1NR0 A;  4CY5 A;  5GMK n;  5IJ7 E;  1S4U X;  1NEX B;  5HQG A;  3VA6 A;  3K27 A;  3NVQ A;  3N0D A;  4J82 A;  4I79 A;  4J78 A;  4J8G A;  2OVQ B;  4ERY A;  2IWK A;  5EAM A;  2XYI A;  3PSC B;  4LG8 A;  1ERJ A;  3F3G A;  2HJB A;  2AQ5 A;  1JJU B;  5A2Q g;  4GM3 A;  2G99 A;  3AFC A;  5K19 A;  2Z2N A;  3AL9 A;  3EU7 A;  3UKR C;  5EML B;  5EAR A;  3FRX A;  3U4Y A;  4R7A B;  3UVM A;  3EG6 A;  4A0B B;  3RSE C;  4YVD A;  4ZN4 A;  2QC5 A;  3RRM C;  2XL2 A;  2IWF A;  2QXV A;  5EAP A;  3JAM g;  3RFH A;  3SMR A;  4X3E A;  4J0W A;  4CI8 A;  3N0E A;  3SBP A;  3JZH A;  2I3S A;  4OWR A;  4J79 A;  1FWX A;  5FA5 B;  3DXK C;  3VGZ A;  3MKQ A;  2H6K A;  4Y5R D;  3DSM A;  4JD2 C;  2YB8 B;  4MK0 B;  4JT6 C;  3RFG A;  2H14 A;  1U4C A;  4L3H D;  5IJ8 E;  1SQJ A;  3J81 g;  3W15 A;  3EI3 B;  3DXM C;  4ES0 A;  3PXS D;  4O3U B;  3AL8 B;  2P9I C;  5AFU 3;  5HE0 B;  2J57 G;  3RMZ D;  1RI6 A;  2GC7 A;  5GSA A;  4J77 A;  3K26 A;  4U7A A;  3OKY B;  1XIP A;  3L4O D;  2W18 A;  4JSX C;  1Q47 A;  4ERZ A;  4QQE A;  4AEZ A;  3EWE A;  2GNQ A;  3ULE C;  5IGO A;  5C2W B;  2P9K C;  2HJ4 A;  1TBG A;  2OVR B;  4QT8 A;  3JPX A;  4JSN C;  2YNO A;  5FXY A;  3SN6 B;  5GXI A;  3UVO A;  5C9Z B;  2HXC A;  2AGZ A;  2P9S C;  4GGC A;  4GQB B;  5IGQ A;  2P9N C;  5FKT A;  3C99 A;  3KRW B;  4N14 A;  4A0A A;  4A2M A;  4XYI A;  4FAV D;  1B9Y A;  2BCJ B;  2MTA H;  4CZV A;  4G56 B;  2OK4 A;  4E5Z B;  3JZN A;  2CE9 A;  2IUQ A;  5B4W A;  2H9P A;  1GP2 B;  2I0R A;  4A0A B;  4E54 B;  2EBS A;  5HYN B;  5EMM B;  2UZY B;  1MG2 A;  2H6Q A;  3EI4 B;  4XYH A;  1JMX B;  3UVL A;  4BUJ C;  3C75 H;  5CXC A;  3SCY A;  3I7K A;  2PBI B;  1PBY B;  2YNP A;  4H5J A;  3UKU C;  3IJ1 A;  5AJA A;  4GMB A;  5EAL A;  3BG0 A;  3IKO A;  5CXC B;  3SVW D;  4O9D A;  2O9K A;  2OK6 A;  3BG1 A;  1OLZ A;  3IIY A;  2YBA A;  2G9A A;  2CE8 A;  3PXT D;  2B5L A;  3NVN A;  3MKS B;  5IC7 A;  3ZWL B;  1N6E A;  4FB1 D;  5EMK B;  3FGB A;  3JZG A;  3C9C A;  4A0B A;  2AGX A;  4UI9 R;  4XEI C;  1VYH C;  3P4F A;  1MDA H;  2Z2P A;  1XHM A;  1SQ9 A;  3V7D B;  2OVP B;  3PE7 A;  3I89 A;  2IUP A;  3CFS B;  4GGD A;  3IIW A;  2AGL A;  4GQ1 A;  1N6F A;  5CYK A;  3PXW D;  1OMW B;  4J81 A;  3CIK B;  5FKR A;  1JOF A;  4GQ2 P;  5CYK B;  5HE3 B;  4JSP C;  4ZOX A;  4Y7R A;  3I7L A;  1L0Q A;  3EI3 A;  4A09 B;  4IMM A;  5H17 A;  4JSV C;  3UR4 A;  3BWS A;  3DWL C;  3AL8 A;  3MXX A;  3RN0 D;  3A0F A;  2I3T A;  3EMH A;  4L3G D;  4CC9 A;  4FA9 D;  4ZOV A;  3OKY A;  3RN1 D;  5I5J A;  4CZX A;  4L9O A;  4J0X A;  4ZOZ A;  4CI3 A;  1XKS A;  3SHF A;  3EI2 A;  3FM0 A;  2B5M A;  2J56 H;  5I5I A;  2HKM A;  2IUR A;  5FLX g;  2P9P C;  2CO0 C;  3I2N A;  3EI2 B;  3SJL D;  2AGW A;  3GRE A;  1GG2 B;  5TDH B;  4Z8L A;  2Z2O A;  4A08 A;  4CY1 A;  2AH0 A;  3I7H A;  1SHY B;  4CI2 A;  3EI1 A;  4FA5 D;  4O45 A;  2H6N A;  4GGA A;  4O3T B;  4E5Z A;  3UVN A;  3HFQ A;  5I5M A;  4A08 B;  5HE2 B;  4E54 A;  3EI1 B;  1PGU A;  4FWW A;  3I8E A;  3EI4 A;  1YFQ A;  3JB9 L;  4H5I A;  3I7P A;  4X60 B;  4A11 B;  3NVX A;  1GXR A;  2PM6 B;  2I0S A;  4J73 A;  4D6V A;  3PSL A;  4BH6 A;  2P9L C;  3E0C A;  2HKR A;  5EMJ B;  4FA1 D;  1A0R B;  4J84 A;  3OKT A;  2PM7 B;  2AH1 A;  4TZ4 A;  3I7N A;  2CNX A;  1N6D A;  4CI1 A;  4GM8 A;  4AOW A;  1B9X A;  3L4M D;  3SFZ A;  2UZX B;  3IJC A;  5EM2 B;  4L1Q D;  2AGY A;  4JT5 C;  4J86 A;  4PNK B;  3JRP A;  4X63 B;  5TEF A;  3RLM D;  2P9U C;  3DM0 A;  4LGN A;  5TEE A;  1K8K C;  5CXB B;  1TYQ C;  2OIZ A;  4K3J B;  3JRO A;  3VH0 A;  1U2V C;  2HES X;  5K1C C;  3V5W B;  1JMZ B;  2HYE A;  5C2V B;  1QNI A;  3I7O A;  2IUV A;  1PI6 A;  3MZK A;  2CO0 A;  3PVU B;  4PSX B;  2XL3 A;  3KRX B;  4A09 A;  4EWR A;  2B5N A;  3F3P A;  2H47 A;  5FKS A;  1GOT B;  4J8B A;  3ODT A;  4A7J A;  4CZY A;  3F3F A;  4ZOY A;  5H14 A;  4D0K A;  2CN2 A;  4IA9 A;  3AH8 B;  4NSX A;  4PBY A;  4GM9 A;  3C5M A;  4PBZ A;  2IAA A;  5H1M A;  4FAN D; 
#chains in the Genus database with same CATH topology
 3OL2 A;  4DNW A;  5GXH A;  3NIG A;  3IUJ A;  3OW8 A;  1E8M A;  4K3I D;  2I0T A;  2VDQ A;  3OL2 B;  3SWS D;  3PVW B;  4MMZ A;  5IT9 g;  2H68 A;  3V9F A;  1P22 A;  4NC4 A;  5TF2 A;  4NBM A;  3SBR A;  4Z7N A;  4G1E A;  4KFM B;  4FHL A;  2H9N A;  4X61 B;  3OKW A;  1PEV A;  5JWZ A;  2TRC B;  2H9L A;  1E8N A;  2H13 A;  3CFV A;  4WK4 A;  2B4E A;  4OZU A;  4GZ8 A;  5FFO A;  4A11 A;  2J55 H;  1BPO A;  4UM9 A;  2H9M A;  4NAA A;  5THA A;  4G1M A;  5HDB A;  3UVK A;  5M5V A;  4IRZ A;  4QL1 A;  3SXT D;  1L5G A;  1MG3 A;  3FCU A;  3ORV D;  4JXM A;  2YMU A;  4FA4 D;  4CY2 A;  1K32 A;  2CN3 A;  4ESG A;  3MZL A;  4HDJ A;  5HE1 B;  3MMY A;  4LG9 A;  3J80 g;  4PSW B;  5AMS A;  4BL0 A;  2HU7 A;  2OJY A;  4A2L A;  4ERQ A;  4NEN A;  4U1E I;  4CY3 A;  5FKQ A;  3SBQ A;  3V4P A;  2XU7 A;  2GC4 A;  2YNN A;  5EM2 A;  4BCB A;  3OTT A;  3K72 A;  2H3X A;  2PM9 A;  1R5M A;  2Q7Q A;  4PXW A;  5FQD A;  3IJ0 A;  3QHY B;  1O6G A;  2BBK H;  2QR5 A;  2VZ3 A;  3I8C A;  4O1Q D;  4AX4 A;  2PM9 B;  3K71 A;  3V4V A;  3GFC A;  5C92 A;  5SXM A;  4J87 A;  4PC0 A;  5KDO B;  3SLE D;  3B7F A;  4QRJ A;  5CXB A;  1NR0 A;  4CY5 A;  5GMK n;  5IJ7 E;  1S4U X;  1NEX B;  5HQG A;  3VA6 A;  4AMY A;  3K27 A;  3NVQ A;  2VDP A;  3N0D A;  3IUR A;  1I2M B;  4J82 A;  4I79 A;  4J78 A;  4AN1 A;  1TYE A;  4J8G A;  2OVQ B;  4ERY A;  2IWK A;  5EAM A;  2XYI A;  3ZE0 A;  3PSC B;  4LG8 A;  1ERJ A;  3F3G A;  2HJB A;  2AQ5 A;  1JJU B;  5A2Q g;  4GM3 A;  2G99 A;  3AFC A;  3O4I A;  5K19 A;  2Z2N A;  3AL9 A;  3EU7 A;  3UKR C;  3IUN A;  5EML B;  5EAR A;  3FRX A;  4BP8 A;  3U4Y A;  4R7A B;  4Z7Q A;  3UVM A;  3EG6 A;  4A0B B;  3RSE C;  1QFS A;  5E6R A;  4YVD A;  4ZN4 A;  2QC5 A;  1H2W A;  3RRM C;  2XL2 A;  2IWF A;  2QXV A;  5EAP A;  3ZDY A;  3JAM g;  3RFH A;  3SMR A;  4X3E A;  4J0W A;  4CI8 A;  3N0E A;  3SBP A;  3JZH A;  2I3S A;  3IUM A;  4OWR A;  4Z7O A;  4J79 A;  1FWX A;  5FA5 B;  3DXK C;  3T3M A;  3VGZ A;  3MKQ A;  2H6K A;  4Y5R D;  3DSM A;  1GOG A;  4JD2 C;  2YB8 B;  4MK0 B;  4JT6 C;  1E5T A;  3RFG A;  2EIC A;  1VE7 A;  1UTC A;  5C86 A;  2H14 A;  4BCC A;  1JV2 A;  1U4C A;  3MUO A;  4L3H D;  5IJ8 E;  1SQJ A;  3J81 g;  5E6U A;  3W15 A;  3EI3 B;  3DXM C;  5M5U A;  4ES0 A;  3PXS D;  4O3U B;  2VDL A;  3AL8 B;  2P9I C;  5AFU 3;  5HE0 B;  2WQ8 A;  2J57 G;  3RMZ D;  1RI6 A;  2GC7 A;  5GSA A;  4J77 A;  3K26 A;  4U7A A;  3OKY B;  2XDW A;  1XIP A;  3L4O D;  4O2W A;  2W18 A;  4JSX C;  1Q47 A;  3FCS A;  4ERZ A;  5M5T A;  4QQE A;  4AEZ A;  3EWE A;  2GNQ A;  3ULE C;  5IGO A;  5C2W B;  2EIB A;  2P9K C;  2HJ4 A;  1TBG A;  2OVR B;  4QT8 A;  3JPX A;  4JSN C;  2YNO A;  5FXY A;  3SN6 B;  5GXI A;  3UVO A;  3ZDX A;  3IJE A;  5C9Z B;  2HXC A;  2AGZ A;  1U8C A;  2P9S C;  4GGC A;  4GQB B;  5IGQ A;  2P9N C;  5FKT A;  3C99 A;  3KRW B;  4N14 A;  4A0A A;  3ZE2 A;  4A2M A;  4XYI A;  4FAV D;  1B9Y A;  2BCJ B;  1QFM A;  2MTA H;  4CZV A;  4G56 B;  3VI3 A;  2OK4 A;  4E5Z B;  3JZN A;  2CE9 A;  2IUQ A;  5E6S A;  3EQ9 A;  2H9P A;  1GP2 B;  2I0R A;  5B4W A;  4A0A B;  1O6F A;  4E54 B;  2EBS A;  5HYN B;  5EMM B;  2UZY B;  1MG2 A;  2H6Q A;  3EI4 B;  4BP9 A;  3EQ7 A;  4XYH A;  1JMX B;  3UVL A;  4BUJ C;  3C75 H;  5CXC A;  3SCY A;  3I7K A;  2PBI B;  1PBY B;  2YNP A;  3NIF A;  4H5J A;  3UKU C;  3IJ1 A;  5AJA A;  4GMB A;  5EAL A;  3BG0 A;  2XZG A;  3IKO A;  5CXC B;  3SVW D;  4O9D A;  2O9K A;  2OK6 A;  3BG1 A;  1OLZ A;  3IIY A;  2YBA A;  2G9A A;  3NID A;  2CE8 A;  3PXT D;  2B5L A;  3NVN A;  3MKS B;  5IC7 A;  4DNU A;  3ZWL B;  1N6E A;  4FB1 D;  5EMK B;  3FGB A;  3JZG A;  3C9C A;  4A0B A;  2AGX A;  4AN0 A;  1C9L A;  2JKX A;  4UI9 R;  3OF7 A;  4XEI C;  3GC3 B;  4UM8 A;  1VYH C;  3P4F A;  1MDA H;  2Z2P A;  1XHM A;  1SQ9 A;  3V7D B;  2OVP B;  3K6S A;  3PE7 A;  3I89 A;  2IUP A;  4JHN A;  3CFS B;  4GGD A;  3IIW A;  2AGL A;  4GQ1 A;  1N6F A;  5CYK A;  3PXW D;  1OMW B;  4J81 A;  3O4J A;  1GOH A;  3ZE1 A;  4BCD A;  3CIK B;  5FKR A;  2BKL A;  1K3I A;  1JOF A;  4GQ2 P;  5CYK B;  5HE3 B;  4JSP C;  1UOO A;  1C9I A;  4L1M A;  4G55 A;  4ZOX A;  4Y7R A;  3I7L A;  3GD1 I;  1L0Q A;  3EI3 A;  4A09 B;  4IMM A;  5H17 A;  4JSV C;  3UR4 A;  1H2Y A;  3BWS A;  3DWL C;  3MXX A;  3AL8 A;  3IVM A;  2EIE A;  3RN0 D;  2HU5 A;  3A0F A;  2I3T A;  1GOF A;  4RE6 A;  3EMH A;  4L3G D;  4CC9 A;  4FA9 D;  4ZOV A;  3OKY A;  3RN1 D;  1YR2 A;  5I5J A;  4CZX A;  4L9O A;  4WJK A;  4J0X A;  4ZOZ A;  4CI3 A;  1T2X A;  1XKS A;  3SHF A;  3EI2 A;  3FM0 A;  2B5M A;  2J56 H;  5I5I A;  3O4G A;  2HKM A;  5M5S A;  2IUR A;  5FLX g;  2P9P C;  3I2N A;  2CO0 C;  3EI2 B;  3SJL D;  2AGW A;  3EQ8 A;  1H2Z A;  3GRE A;  1GG2 B;  5TDH B;  4Z8L A;  2Z2O A;  4A08 A;  4CY1 A;  2VDO A;  2AH0 A;  3I7H A;  1SHY B;  4CI2 A;  3EI1 A;  3VI4 A;  4FA5 D;  1UOP A;  4O45 A;  2H6N A;  4GGA A;  4O3T B;  4E5Z A;  3UVN A;  3HFQ A;  5I5M A;  4A08 B;  5HE2 B;  4E54 A;  1M1X A;  1H2X A;  5M5R A;  3EI1 B;  1PGU A;  4FWW A;  3I8E A;  3EI4 A;  1YFQ A;  3JB9 L;  4H5I A;  3I7P A;  4X60 B;  4A11 B;  1UOQ A;  3NVX A;  1GXR A;  2PM6 B;  4WK0 A;  1VZ2 A;  2I0S A;  4J73 A;  4D6V A;  3PSL A;  4BH6 A;  4WK2 A;  2P9L C;  3E0C A;  2HKR A;  5EMJ B;  4FA1 D;  1A0R B;  4J84 A;  3OKT A;  4AMZ A;  2VC2 A;  2PM7 B;  2AH1 A;  4MMY A;  4TZ4 A;  3I7N A;  2CNX A;  1N6D A;  4CI1 A;  4GM8 A;  4AOW A;  1B9X A;  3L4M D;  3MUN A;  3T3P A;  3SFZ A;  2UZX B;  3IJC A;  5EM2 B;  4L1Q D;  2AGY A;  4JT5 C;  2QZP A;  4J86 A;  3O4H A;  4PNK B;  3JRP A;  4X63 B;  3QI0 A;  5TEF A;  2VZ1 A;  1JTD B;  3RLM D;  2XE4 A;  2P9U C;  3IUL A;  1VZ3 A;  3DM0 A;  2VDN A;  2VDK A;  4LGN A;  5TEE A;  1K8K C;  5CXB B;  1TYQ C;  3DDU A;  2OIZ A;  4K3J B;  3JRO A;  3VH0 A;  1U2V C;  4D9S A;  2HES X;  4MMX A;  5K1C C;  3V5W B;  4DNV A;  1JMZ B;  2HYE A;  5C2V B;  1QNI A;  3I7O A;  2IUV A;  1PI6 A;  5FFG A;  3MZK A;  2CO0 A;  4JHP C;  3PVU B;  4PSX B;  4RE5 A;  2XL3 A;  3KRX B;  4A09 A;  4EWR A;  2B5N A;  2HU8 A;  3F3P A;  2H47 A;  5FKS A;  1GOT B;  4J8B A;  3ODT A;  4A7J A;  4CZY A;  2VDR A;  3ZDZ A;  3IUQ A;  4O02 A;  3F3F A;  4ZOY A;  5H14 A;  4D0K A;  3MVD K;  2CN2 A;  4IA9 A;  1VE6 A;  3AH8 B;  4NSX A;  3KCI A;  1A12 A;  4PBY A;  4QAM A;  4GM9 A;  3C5M A;  5M61 A;  4PBZ A;  2IAA A;  5H1M A;  2EID A;  4FAN D;  2VDM A; 
#chains in the Genus database with same CATH homology
 3OL2 A;  5GXH A;  3OW8 A;  4K3I D;  2I0T A;  3OL2 B;  3SWS D;  3PVW B;  5IT9 g;  2H68 A;  3V9F A;  1P22 A;  5TF2 A;  3SBR A;  4KFM B;  4FHL A;  2H9N A;  4X61 B;  3OKW A;  1PEV A;  5JWZ A;  2TRC B;  2H9L A;  3CFV A;  2H13 A;  2B4E A;  4OZU A;  4GZ8 A;  4A11 A;  2J55 H;  2H9M A;  5THA A;  3UVK A;  4QL1 A;  3SXT D;  1MG3 A;  3ORV D;  4JXM A;  2YMU A;  4FA4 D;  4CY2 A;  1K32 A;  2CN3 A;  4ESG A;  3MZL A;  4HDJ A;  5HE1 B;  3MMY A;  4LG9 A;  3J80 g;  4PSW B;  5AMS A;  4BL0 A;  2OJY A;  4A2L A;  4ERQ A;  4U1E I;  4CY3 A;  5FKQ A;  3SBQ A;  2XU7 A;  2GC4 A;  2YNN A;  5EM2 A;  3OTT A;  2H3X A;  2PM9 A;  1R5M A;  2Q7Q A;  4PXW A;  5FQD A;  3IJ0 A;  2BBK H;  3I8C A;  4O1Q D;  2PM9 B;  3GFC A;  5SXM A;  4J87 A;  4PC0 A;  5KDO B;  3SLE D;  3B7F A;  4QRJ A;  5CXB A;  1NR0 A;  4CY5 A;  5GMK n;  5IJ7 E;  1S4U X;  1NEX B;  5HQG A;  3VA6 A;  3K27 A;  3NVQ A;  3N0D A;  4J82 A;  4I79 A;  4J78 A;  4J8G A;  2OVQ B;  4ERY A;  2IWK A;  5EAM A;  2XYI A;  3PSC B;  4LG8 A;  1ERJ A;  3F3G A;  2HJB A;  2AQ5 A;  1JJU B;  5A2Q g;  4GM3 A;  2G99 A;  3AFC A;  5K19 A;  2Z2N A;  3AL9 A;  3EU7 A;  3UKR C;  5EML B;  5EAR A;  3FRX A;  3U4Y A;  4R7A B;  3UVM A;  3EG6 A;  4A0B B;  3RSE C;  4YVD A;  4ZN4 A;  2QC5 A;  3RRM C;  2XL2 A;  2IWF A;  2QXV A;  5EAP A;  3JAM g;  3RFH A;  3SMR A;  4X3E A;  4J0W A;  4CI8 A;  3N0E A;  3SBP A;  3JZH A;  2I3S A;  4OWR A;  4J79 A;  1FWX A;  5FA5 B;  3DXK C;  3VGZ A;  3MKQ A;  2H6K A;  4Y5R D;  3DSM A;  4JD2 C;  2YB8 B;  4MK0 B;  4JT6 C;  3RFG A;  2H14 A;  1U4C A;  4L3H D;  5IJ8 E;  1SQJ A;  3J81 g;  3W15 A;  3EI3 B;  3DXM C;  4ES0 A;  3PXS D;  4O3U B;  3AL8 B;  2P9I C;  5AFU 3;  5HE0 B;  2J57 G;  3RMZ D;  1RI6 A;  2GC7 A;  5GSA A;  4J77 A;  3K26 A;  4U7A A;  3OKY B;  1XIP A;  3L4O D;  2W18 A;  4JSX C;  1Q47 A;  4ERZ A;  4QQE A;  4AEZ A;  3EWE A;  2GNQ A;  3ULE C;  5IGO A;  5C2W B;  2P9K C;  2HJ4 A;  1TBG A;  2OVR B;  4QT8 A;  3JPX A;  4JSN C;  2YNO A;  5FXY A;  3SN6 B;  5GXI A;  3UVO A;  5C9Z B;  2HXC A;  2AGZ A;  2P9S C;  4GGC A;  4GQB B;  5IGQ A;  2P9N C;  5FKT A;  3C99 A;  3KRW B;  4N14 A;  4A0A A;  4A2M A;  4XYI A;  4FAV D;  1B9Y A;  2BCJ B;  2MTA H;  4CZV A;  4G56 B;  2OK4 A;  4E5Z B;  3JZN A;  2CE9 A;  2IUQ A;  5B4W A;  2H9P A;  1GP2 B;  2I0R A;  4A0A B;  4E54 B;  2EBS A;  5HYN B;  5EMM B;  2UZY B;  1MG2 A;  2H6Q A;  3EI4 B;  4XYH A;  1JMX B;  3UVL A;  4BUJ C;  3C75 H;  5CXC A;  3SCY A;  3I7K A;  2PBI B;  1PBY B;  2YNP A;  4H5J A;  3UKU C;  3IJ1 A;  5AJA A;  4GMB A;  5EAL A;  3BG0 A;  3IKO A;  5CXC B;  3SVW D;  4O9D A;  2O9K A;  2OK6 A;  3BG1 A;  1OLZ A;  3IIY A;  2YBA A;  2G9A A;  2CE8 A;  3PXT D;  2B5L A;  3NVN A;  3MKS B;  5IC7 A;  3ZWL B;  1N6E A;  4FB1 D;  5EMK B;  3FGB A;  3JZG A;  3C9C A;  4A0B A;  2AGX A;  4UI9 R;  4XEI C;  1VYH C;  3P4F A;  1MDA H;  2Z2P A;  1XHM A;  1SQ9 A;  3V7D B;  2OVP B;  3PE7 A;  3I89 A;  2IUP A;  3CFS B;  4GGD A;  3IIW A;  2AGL A;  4GQ1 A;  1N6F A;  5CYK A;  3PXW D;  1OMW B;  4J81 A;  3CIK B;  5FKR A;  1JOF A;  4GQ2 P;  5CYK B;  5HE3 B;  4JSP C;  4ZOX A;  4Y7R A;  3I7L A;  1L0Q A;  3EI3 A;  4A09 B;  4IMM A;  5H17 A;  4JSV C;  3UR4 A;  3BWS A;  3DWL C;  3AL8 A;  3MXX A;  3RN0 D;  3A0F A;  2I3T A;  3EMH A;  4L3G D;  4CC9 A;  4FA9 D;  4ZOV A;  3OKY A;  3RN1 D;  5I5J A;  4CZX A;  4L9O A;  4J0X A;  4ZOZ A;  4CI3 A;  1XKS A;  3SHF A;  3EI2 A;  3FM0 A;  2B5M A;  2J56 H;  5I5I A;  2HKM A;  2IUR A;  5FLX g;  2P9P C;  2CO0 C;  3I2N A;  3EI2 B;  3SJL D;  2AGW A;  3GRE A;  1GG2 B;  5TDH B;  4Z8L A;  2Z2O A;  4A08 A;  4CY1 A;  2AH0 A;  3I7H A;  1SHY B;  4CI2 A;  3EI1 A;  4FA5 D;  4O45 A;  2H6N A;  4GGA A;  4O3T B;  4E5Z A;  3UVN A;  3HFQ A;  5I5M A;  4A08 B;  5HE2 B;  4E54 A;  3EI1 B;  1PGU A;  4FWW A;  3I8E A;  3EI4 A;  1YFQ A;  3JB9 L;  4H5I A;  3I7P A;  4X60 B;  4A11 B;  3NVX A;  1GXR A;  2PM6 B;  2I0S A;  4J73 A;  4D6V A;  3PSL A;  4BH6 A;  2P9L C;  3E0C A;  2HKR A;  5EMJ B;  4FA1 D;  1A0R B;  4J84 A;  3OKT A;  2PM7 B;  2AH1 A;  4TZ4 A;  3I7N A;  2CNX A;  1N6D A;  4CI1 A;  4GM8 A;  4AOW A;  1B9X A;  3L4M D;  3SFZ A;  2UZX B;  3IJC A;  5EM2 B;  4L1Q D;  2AGY A;  4JT5 C;  4J86 A;  4PNK B;  3JRP A;  4X63 B;  5TEF A;  3RLM D;  2P9U C;  3DM0 A;  4LGN A;  5TEE A;  1K8K C;  5CXB B;  1TYQ C;  2OIZ A;  4K3J B;  3JRO A;  3VH0 A;  1U2V C;  2HES X;  5K1C C;  3V5W B;  1JMZ B;  2HYE A;  5C2V B;  1QNI A;  3I7O A;  2IUV A;  1PI6 A;  3MZK A;  2CO0 A;  3PVU B;  4PSX B;  2XL3 A;  3KRX B;  4A09 A;  4EWR A;  2B5N A;  3F3P A;  2H47 A;  5FKS A;  1GOT B;  4J8B A;  3ODT A;  4A7J A;  4CZY A;  3F3F A;  4ZOY A;  5H14 A;  4D0K A;  2CN2 A;  4IA9 A;  3AH8 B;  4NSX A;  4PBY A;  4GM9 A;  3C5M A;  4PBZ A;  2IAA A;  5H1M A;  4FAN D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...