3BG1A

Architecture of a coat for the nuclear pore membrane
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
291
structure length
285
Chain Sequence
DMIHDAQMDYYGTRLATCSSDRSVKIFDVRNGGQILIADLRGHEGPVWQVAWAHPMYGNILASCSYDRKVIIWREENGTWEKSHEHAGHDSSVNSVCWAPHDYGLILACGSSDGAISLLTYTGEGQWEVKKINNAHTIGCNAVSWAPAVVPPSGQKPNYIKRFASGGCDNLIKLWKEEEDGQWKEEQKLEAHSDWVRDVAWAPSIGLPTSTIASCSQDGRVFIWTCDDASSNTWSPKLLHKFNDVVWHVSWSITANILAVSGGDNKVTLWKESVDGQWVCISDVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport, hydrolase
molecule keywords Protein SEC13 homolog
publication title Architecture of a coat for the nuclear pore membrane.
pubmed doi rcsb
source organism Homo sapiens
total genus 56
structure length 285
sequence length 291
chains with identical sequence D, E, H
ec nomenclature
pdb deposition date 2007-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3bg1A00
3BG0A 2UZXB 1FWXA 2CE8A 3I8CA 1JMXB 2P9SC 2H6NA 1GOTB 5FXYA 3SXTD 4A0AB 4FAVD 3MZKA 1A0RB 5EMLB 2P9UC 3SBRA 3JZNA 2XL3A 3F3GA 4CI3A 2B5NA 2O9KA 3JRPA 4LG9A 4CZYA 3V5WB 4GQ1A 4IA9A 3I8EA 5K19A 3GFCA 3MZLA 4J0WA 2I0TA 3K27A 3EWEA 3OW8A 1U2VC 2H47A 3OTTA 4J86A 3A0FA 2IURA 3I2NA 2YMUA 3C99A 3RN0D 2Z2OA 3UVLA 2XYIA 2IAAA 3IIYA 5H17A 5GXHA 3PXSD 2CE9A 4OWRA 4E54A 4XEIC 4FB1D 3DXMC 5CXBA 5B4WA 2XU7A 3AL8B 3UVMA 5AJAA 4O45A 2OVPB 3FM0A 4Z8LA 3V7DB 4N14A 3CFSB 2CN3A 2I3SA 2YNOA 3SJLD 3ODTA 3OL2A 3AH8B 4CY3A 3JAMg 2EBSA 3F3FA 5A2Qg 5TF2A 4ZOZA 3EI4B 4ERYA 4K3ID 2AH1A 3NVQA 2H13A 3PVWB 2Z2PA 2H6KA 3J80g 2H14A 1R5MA 5C9ZB 4CC9A 2HJ4A 1K32A 2G99A 4J84A 2J57G 5EAMA 2AQ5A 3RFHA 2H68A 1SQJA 2OK6A 3RLMD 1QNIA 3SWSD 5FA5B 3V9FA 4LG8A 4PBYA 4O3TB 4Y5RD 4L9OA 1GG2B 3EI3A 4J82A 4LGNA 1YFQA 3OKTA 4CI8A 5C2WB 2MTAH 2H9PA 4QL1A 3I7PA 3RSEC 3OKWA 4E5ZB 3OKYB 4E54B 4FA4D 3IIWA 1SHYB 3PSCB 2AGXA 2PM9B 3C75H 2AGLA 4U1EI 4ZN4A 1N6FA 2H9LA 3C9CA 3EI4A 4FAND 4FA5D 2HKMA 3OL2B 1RI6A 4JT6C 3I89A 4Y7RA 3SN6B 4H5JA 4J81A 4U7AA 4A11A 4GZ8A 4BL0A 3RRMC 4JSVC 4GM9A 2W18A 3I7NA 1XHMA 4A0BA 4PC0A 3BG1A 5EMMB 2OK4A 1S4UX 2YBAA 1PBYB 3FRXA 3UVKA 3VA6A 5EARA 1U4CA 2UZYB 3MMYA 4GQBB 3PE7A 5FKTA 4JSXC 4ZOVA 3SLED 5EM2A 5H14A 5C2VB 4GM8A 4ERQA 4CY2A 5TEEA 5HE3B 1XIPA 4E5ZA 3OKYA 4HDJA 4PXWA 4D6VA 4PNKB 3I7OA 3SMRA 3EI3B 5I5IA 4FHLA 2PM9A 4ERZA 4XYIA 2OVQB 2P9KC 1JMZB 4CZVA 2PM6B 5I5MA 4CI1A 4AEZA 2GNQA 1B9YA 4QT8A 3DWLC 4BH6A 3PVUB 1PGUA 4J78A 2PBIB 4R7AB 4A09B 4A7JA 1TYQC 3SBPA 5AFU3 2IUQA 4H5IA 3E0CA 3ORVD 2J55H 3N0DA 5EMJB 3I7LA 5HE1B 3MXXA 3SBQA 5KDOB 4A11B 3EI1B 2AGWA 2H9NA 2HYEA 3VGZA 3CFVA 3J81g 2I3TA 3EI2B 1MG3A 2QXVA 4A0BB 2B4EA 4ZOYA 1Q47A 3UKUC 4CY5A 2CNXA 4GM3A 1ERJA 2BCJB 2B5MA 5FQDA 3F3PA 1TBGA 5FKSA 2AH0A 1SQ9A 4I79A 4J87A 1JJUB 2GC7A 3HFQA 5EALA 5SXMA 4A2LA 3IJCA 2H6QA 4PSWB 5EM2B 5GMKn 5AMSA 3ULEC 2HXCA 4GGCA 2YB8B 5IC7A 4PSXB 2J56H 5HE0B 2CO0A 3UVNA 4MK0B 1P22A 4JSNC 4FA1D 2XL2A 3AFCA 4ESGA 1PI6A 3JZGA 5EMKB 5I5JA 4L3GD 4FA9D 4A09A 3CIKB 4O1QD 3SVWD 2IUVA 4CY1A 3MKQA 2G9AA 5CYKB 3PSLA 3NVXA 4UI9R 4BUJC 4A2MA 2Q7QA 3IJ0A 3EMHA 3EI1A 3SFZA 1B9XA 2P9IC 3SCYA 4J8BA 4JSPC 3EI2A 3EU7A 5TEFA 1K8KC 3P4FA 2I0SA 3KRXB 2GC4A 1N6EA 3N0EA 2OJYA 3I7KA 4X63B 3RMZD 4CI2A 3IJ1A 3K26A 3RFGA 4GMBA 3EG6A 2Z2NA 4GQ2P 1GXRA 4L3HD 3AL9A 4L1QD 4JD2C 4D0KA 5FLXg 3VH0A 2HKRA 4ES0A 3ZWLB 2YNNA 4X60B 3GREA 3PXTD 1MG2A 1OMWB 4JXMA 2OVRB 3FGBA 5FKRA 3UKRC 3DM0A 3C5MA 3NVNA 4O9DA 2H9MA 4QRJA 5HYNB 1NEXB 2BBKH 3IKOA 2H3XA 5CYKA 2CO0C 4CZXA 3JROA 3UVOA 1JOFA 3KRWB 5FKQA 1MDAH 2IUPA 3BWSA 3L4MD 4FWWA 2CN2A 4PBZA 5CXCB 2OIZA 2PM7B 3B7FA 4EWRA 4J8GA 4XYHA 4GGAA 1L0QA 3DSMA 2IWFA 4K3JB 4A08B 5IGQA 4G56B 5HQGA 3JB9L 2HESX 2HJBA 5THAA 3W15A 1GP2B 1VYHC 3PXWD 1OLZA 4A0AA 5TDHB 5GXIA 3JZHA 3I7HA 4J0XA 4QQEA 2I0RA 4X3EA 4OZUA 4YVDA 1XKSA 4GGDA 4AOWA 4ZOXA 5IJ7E 3SHFA 3JPXA 4J79A 4J77A 2YNPA 5IGOA 2QC5A 2P9NC 4O3UB 2P9PC 5GSAA 3L4OD 5HE2B 5EAPA 2P9LC 2B5LA 5JWZA 2IWKA 4IMMA 4JT5C 2TRCB 3RN1D 1NR0A 4J73A 5CXCA 3U4YA 4KFMB 3AL8A 4TZ4A 4A08A 5K1CC 1PEVA 4NSXA 5IJ8E 1N6DA 5H1MA 3UR4A 5CXBB 3MKSB 3DXKC 5IT9g 2AGYA 4X61B 2AGZA
chains in the Genus database with same CATH superfamily
3V4VA 3BG0A 2UZXB 1FWXA 2CE8A 2VDQA 5M5VA 1VE6A 3I8CA 1JMXB 2P9SC 2H6NA 1GOTB 4UM9A 5FXYA 4AMYA 3SXTD 4A0AB 4AN0A 4FAVD 4WK2A 3MZKA 1A0RB 5EMLB 5C92A 1C9IA 3T3PA 2P9UC 3SBRA 3JZNA 2XL3A 3F3GA 4CI3A 2B5NA 2O9KA 3JRPA 4LG9A 4CZYA 3V5WB 4GQ1A 4IA9A 3I8EA 5K19A 2XDWA 3GFCA 3MZLA 4J0WA 3OF7A 1O6FA 2I0TA 4G1EA 2VDKA 3K27A 3EWEA 3OW8A 1U2VC 2H47A 3OTTA 4O02A 4MMZA 4J86A 3NIFA 3A0FA 3IUNA 2IURA 3I2NA 2YMUA 3C99A 3RN0D 4BP8A 2Z2OA 3K71A 4NENA 3UVLA 2XYIA 2IAAA 3IIYA 5H17A 5GXHA 3PXSD 2CE9A 4OWRA 4E54A 1UOPA 4RE5A 4XEIC 4FB1D 3DXMC 5CXBA 5B4WA 2XU7A 3NIDA 5C86A 3V4PA 2QZPA 3AL8B 3UVMA 5AJAA 4O45A 2OVPB 3FM0A 4Z8LA 3V7DB 4N14A 3VI4A 3CFSB 2CN3A 4WK4A 5M5SA 1TYEA 2I3SA 2YNOA 3SJLD 3ODTA 3OL2A 3AH8B 4CY3A 3JAMg 2EBSA 1GOHA 3F3FA 5A2Qg 3EQ8A 5TF2A 4Z7OA 4ZOZA 3EI4B 4ERYA 4K3ID 2AH1A 3NVQA 2H13A 2XZGA 3PVWB 1YR2A 2Z2PA 2H6KA 3J80g 2H14A 1JTDB 1R5MA 5C9ZB 4QAMA 4CC9A 2HJ4A 1K32A 2G99A 4J84A 2J57G 5EAMA 2AQ5A 3IJEA 2H68A 3RFHA 1SQJA 2OK6A 3RLMD 2VDPA 1GOFA 1QNIA 1VZ3A 4L1MA 1JV2A 1E8NA 3SWSD 5FA5B 3V9FA 4LG8A 4PBYA 4O3TB 4Y5RD 4L9OA 1GG2B 2VDLA 3EI3A 4J82A 4LGNA 1YFQA 3OKTA 2JKXA 4CI8A 5C2WB 2QR5A 2MTAH 2H9PA 4QL1A 3I7PA 1VZ2A 3RSEC 3OKWA 4E5ZB 3OKYB 4E54B 2VDMA 4FA4D 3IIWA 3ZE2A 1BPOA 1SHYB 3PSCB 2AGXA 3K72A 4BCBA 2PM9B 3C75H 2AGLA 4U1EI 4ZN4A 1N6FA 2H9LA 3C9CA 3EI4A 4FAND 3QHYB 4FA5D 2HKMA 3OL2B 1RI6A 3K6SA 4JT6C 3DDUA 3I89A 4NAAA 4Y7RA 4BCDA 3SN6B 4H5JA 4J81A 2BKLA 4U7AA 4A11A 4GZ8A 4BL0A 4JHNA 3RRMC 3T3MA 4JSVC 4GM9A 2W18A 3I7NA 1XHMA 1QFMA 4A0BA 4PC0A 4BP9A 3BG1A 4RE6A 5EMMB 2OK4A 1S4UX 2YBAA 1PBYB 3O4HA 4DNVA 3FRXA 3UVKA 3VA6A 5EARA 1U4CA 2UZYB 3MMYA 4GQBB 4AX4A 3PE7A 3EQ9A 4JSXC 5FKTA 4G1MA 4ZOVA 3SLED 3IUQA 5EM2A 4WK0A 5H14A 5C2VB 4GM8A 4ERQA 4CY2A 5TEEA 5HE3B 1XIPA 4E5ZA 3OKYA 4HDJA 3IUMA 4PXWA 4D6VA 4PNKB 3I7OA 3SMRA 3EI3B 1GOGA 5I5IA 4FHLA 2PM9A 3ZDZA 4XYIA 4ERZA 2OVQB 5M5UA 2P9KC 2VDOA 3ZE0A 1JMZB 4CZVA 2PM6B 5M5RA 2VZ3A 5I5MA 4CI1A 4AEZA 2WQ8A 2GNQA 1B9YA 4QT8A 3DWLC 4BH6A 3PVUB 1PGUA 4J78A 2PBIB 4R7AB 4A09B 4A7JA 4JHPC 1TYQC 3SBPA 5AFU3 2IUQA 4H5IA 3E0CA 3ORVD 2J55H 3N0DA 5HDBA 5EMJB 3I7LA 5HE1B 3IURA 3MXXA 3SBQA 5KDOB 4A11B 3EI1B 2AGWA 2H9NA 2HYEA 3VGZA 2EIBA 3CFVA 2I3TA 4WJKA 3J81g 1M1XA 3EI2B 1MG3A 2QXVA 4A0BB 2B4EA 4ZOYA 1Q47A 3UKUC 4CY5A 2CNXA 4GM3A 1ERJA 2BCJB 2B5MA 4IRZA 1E8MA 5FQDA 1VE7A 3F3PA 1C9LA 1TBGA 5FKSA 2AH0A 1SQ9A 4I79A 4J87A 1JJUB 2GC7A 3HFQA 5EALA 5SXMA 4A2LA 3IJCA 2H6QA 4PSWB 5EM2B 5GMKn 5AMSA 3ULEC 2HXCA 4NBMA 4GGCA 2YB8B 5IC7A 2VZ1A 4PSXB 2J56H 5HE0B 2CO0A 3UVNA 4MK0B 1P22A 4JSNC 4UM8A 4FA1D 4BCCA 2XL2A 3AFCA 4ESGA 5E6UA 1PI6A 2VDNA 2EIEA 3JZGA 5EMKB 4L3GD 5I5JA 4AN1A 4FA9D 4A09A 3CIKB 4O1QD 3SVWD 2IUVA 4CY1A 1U8CA 3MKQA 2G9AA 3VI3A 5CYKB 3PSLA 3NVXA 4UI9R 4BUJC 4A2MA 2Q7QA 3KCIA 3IJ0A 3EMHA 5FFOA 3EI1A 1O6GA 3SFZA 1B9XA 2P9IC 3SCYA 4J8BA 3GC3B 4JSPC 3EI2A 3EU7A 4NC4A 5TEFA 1K8KC 3P4FA 2I0SA 3KRXB 2GC4A 1N6EA 3ZDYA 1H2WA 3N0EA 1UTCA 3O4GA 2OJYA 3I7KA 4X63B 3RMZD 1H2ZA 4CI2A 3NIGA 3IJ1A 3IUJA 3K26A 3RFGA 2EICA 4GMBA 3EG6A 2Z2NA 4GQ2P 1GXRA 4L3HD 3AL9A 1E5TA 4L1QD 4JD2C 3MUOA 4D0KA 5FLXg 3VH0A 2HU5A 4Z7QA 2HKRA 2VC2A 4ES0A 3ZWLB 2YNNA 4X60B 3GREA 3PXTD 1MG2A 1L5GA 1OMWB 4JXMA 4Z7NA 3QI0A 1H2YA 2OVRB 3FGBA 5FKRA 1I2MB 3DM0A 3UKRC 3C5MA 3NVNA 4O9DA 2H9MA 4QRJA 5HYNB 1NEXB 2BBKH 3IKOA 2EIDA 2H3XA 5CYKA 2CO0C 4CZXA 1A12A 3JROA 3UVOA 3IVMA 5M5TA 1JOFA 3KRWB 5FKQA 1MDAH 2IUPA 3GD1I 4O2WA 4MMXA 3BWSA 3L4MD 4FWWA 2CN2A 4PBZA 5CXCB 2OIZA 3FCUA 2PM7B 3B7FA 4EWRA 4J8GA 4XYHA 5E6SA 4DNUA 4GGAA 1L0QA 3DSMA 2IWFA 4K3JB 4A08B 5IGQA 4G56B 5HQGA 3JB9L 2HESX 2HJBA 5THAA 3W15A 1GP2B 1VYHC 3MVDK 4MMYA 5E6RA 3PXWD 1OLZA 2HU8A 4A0AA 5TDHB 5GXIA 3JZHA 5FFGA 1UOQA 3O4IA 3I7HA 4J0XA 4QQEA 2I0RA 4D9SA 4X3EA 3IULA 4OZUA 4YVDA 1H2XA 1XKSA 3MUNA 4GGDA 4AOWA 4ZOXA 5IJ7E 3SHFA 3JPXA 4J79A 3EQ7A 4J77A 2YNPA 5IGOA 3FCSA 2QC5A 2P9NC 4O3UB 2HU7A 2P9PC 5GSAA 5M61A 3ZDXA 3L4OD 5HE2B 1K3IA 5EAPA 2P9LC 4G55A 2XE4A 2B5LA 5JWZA 2IWKA 4IMMA 4JT5C 2TRCB 3RN1D 1NR0A 4J73A 5CXCA 3U4YA 4KFMB 3AL8A 4TZ4A 4DNWA 4A08A 3ZE1A 3O4JA 5K1CC 1UOOA 1PEVA 4NSXA 5IJ8E 1N6DA 2VDRA 5H1MA 3UR4A 5CXBB 4AMZA 3MKSB 3DXKC 1QFSA 5IT9g 2AGYA 4X61B 2AGZA 1T2XA
chains in the Genus database with same CATH topology
3BG0A 2UZXB 1FWXA 2CE8A 3I8CA 1JMXB 2P9SC 2H6NA 1GOTB 5FXYA 3SXTD 4A0AB 4FAVD 3MZKA 1A0RB 5EMLB 2P9UC 3SBRA 3JZNA 2XL3A 3F3GA 4CI3A 2B5NA 2O9KA 3JRPA 4LG9A 4CZYA 3V5WB 4GQ1A 4IA9A 3I8EA 5K19A 3GFCA 3MZLA 4J0WA 2I0TA 3K27A 3EWEA 3OW8A 1U2VC 2H47A 3OTTA 4J86A 3A0FA 2IURA 3I2NA 2YMUA 3C99A 3RN0D 2Z2OA 3UVLA 2XYIA 2IAAA 3IIYA 5H17A 5GXHA 3PXSD 2CE9A 4OWRA 4E54A 4XEIC 4FB1D 3DXMC 5CXBA 5B4WA 2XU7A 3AL8B 3UVMA 5AJAA 4O45A 2OVPB 3FM0A 4Z8LA 3V7DB 4N14A 3CFSB 2CN3A 2I3SA 2YNOA 3SJLD 3ODTA 3OL2A 3AH8B 4CY3A 3JAMg 2EBSA 3F3FA 5A2Qg 5TF2A 4ZOZA 3EI4B 4ERYA 4K3ID 2AH1A 3NVQA 2H13A 3PVWB 2Z2PA 2H6KA 3J80g 2H14A 1R5MA 5C9ZB 4CC9A 2HJ4A 1K32A 2G99A 4J84A 2J57G 5EAMA 2AQ5A 3RFHA 2H68A 1SQJA 2OK6A 3RLMD 1QNIA 3SWSD 5FA5B 3V9FA 4LG8A 4PBYA 4O3TB 4Y5RD 4L9OA 1GG2B 3EI3A 4J82A 4LGNA 1YFQA 3OKTA 4CI8A 5C2WB 2MTAH 2H9PA 4QL1A 3I7PA 3RSEC 3OKWA 4E5ZB 3OKYB 4E54B 4FA4D 3IIWA 1SHYB 3PSCB 2AGXA 2PM9B 3C75H 2AGLA 4U1EI 4ZN4A 1N6FA 2H9LA 3C9CA 3EI4A 4FAND 4FA5D 2HKMA 3OL2B 1RI6A 4JT6C 3I89A 4Y7RA 3SN6B 4H5JA 4J81A 4U7AA 4A11A 4GZ8A 4BL0A 3RRMC 4JSVC 4GM9A 2W18A 3I7NA 1XHMA 4A0BA 4PC0A 3BG1A 5EMMB 2OK4A 1S4UX 2YBAA 1PBYB 3FRXA 3UVKA 3VA6A 5EARA 1U4CA 2UZYB 3MMYA 4GQBB 3PE7A 5FKTA 4JSXC 4ZOVA 3SLED 5EM2A 5H14A 5C2VB 4GM8A 4ERQA 4CY2A 5TEEA 5HE3B 1XIPA 4E5ZA 3OKYA 4HDJA 4PXWA 4D6VA 4PNKB 3I7OA 3SMRA 3EI3B 5I5IA 4FHLA 2PM9A 4ERZA 4XYIA 2OVQB 2P9KC 1JMZB 4CZVA 2PM6B 5I5MA 4CI1A 4AEZA 2GNQA 1B9YA 4QT8A 3DWLC 4BH6A 3PVUB 1PGUA 4J78A 2PBIB 4R7AB 4A09B 4A7JA 1TYQC 3SBPA 5AFU3 2IUQA 4H5IA 3E0CA 3ORVD 2J55H 3N0DA 5EMJB 3I7LA 5HE1B 3MXXA 3SBQA 5KDOB 4A11B 3EI1B 2AGWA 2H9NA 2HYEA 3VGZA 3CFVA 3J81g 2I3TA 3EI2B 1MG3A 2QXVA 4A0BB 2B4EA 4ZOYA 1Q47A 3UKUC 4CY5A 2CNXA 4GM3A 1ERJA 2BCJB 2B5MA 5FQDA 3F3PA 1TBGA 5FKSA 2AH0A 1SQ9A 4I79A 4J87A 1JJUB 2GC7A 3HFQA 5EALA 5SXMA 4A2LA 3IJCA 2H6QA 4PSWB 5EM2B 5GMKn 5AMSA 3ULEC 2HXCA 4GGCA 2YB8B 5IC7A 4PSXB 2J56H 5HE0B 2CO0A 3UVNA 4MK0B 1P22A 4JSNC 4FA1D 2XL2A 3AFCA 4ESGA 1PI6A 3JZGA 5EMKB 5I5JA 4L3GD 4FA9D 4A09A 3CIKB 4O1QD 3SVWD 2IUVA 4CY1A 3MKQA 2G9AA 5CYKB 3PSLA 3NVXA 4UI9R 4BUJC 4A2MA 2Q7QA 3IJ0A 3EMHA 3EI1A 3SFZA 1B9XA 2P9IC 3SCYA 4J8BA 4JSPC 3EI2A 3EU7A 5TEFA 1K8KC 3P4FA 2I0SA 3KRXB 2GC4A 1N6EA 3N0EA 2OJYA 3I7KA 4X63B 3RMZD 4CI2A 3IJ1A 3K26A 3RFGA 4GMBA 3EG6A 2Z2NA 4GQ2P 1GXRA 4L3HD 3AL9A 4L1QD 4JD2C 4D0KA 5FLXg 3VH0A 2HKRA 4ES0A 3ZWLB 2YNNA 4X60B 3GREA 3PXTD 1MG2A 1OMWB 4JXMA 2OVRB 3FGBA 5FKRA 3UKRC 3DM0A 3C5MA 3NVNA 4O9DA 2H9MA 4QRJA 5HYNB 1NEXB 2BBKH 3IKOA 2H3XA 5CYKA 2CO0C 4CZXA 3JROA 3UVOA 1JOFA 3KRWB 5FKQA 1MDAH 2IUPA 3BWSA 3L4MD 4FWWA 2CN2A 4PBZA 5CXCB 2OIZA 2PM7B 3B7FA 4EWRA 4J8GA 4XYHA 4GGAA 1L0QA 3DSMA 2IWFA 4K3JB 4A08B 5IGQA 4G56B 5HQGA 3JB9L 2HESX 2HJBA 5THAA 3W15A 1GP2B 1VYHC 3PXWD 1OLZA 4A0AA 5TDHB 5GXIA 3JZHA 3I7HA 4J0XA 4QQEA 2I0RA 4X3EA 4OZUA 4YVDA 1XKSA 4GGDA 4AOWA 4ZOXA 5IJ7E 3SHFA 3JPXA 4J79A 4J77A 2YNPA 5IGOA 2QC5A 2P9NC 4O3UB 2P9PC 5GSAA 3L4OD 5HE2B 5EAPA 2P9LC 2B5LA 5JWZA 2IWKA 4IMMA 4JT5C 2TRCB 3RN1D 1NR0A 4J73A 5CXCA 3U4YA 4KFMB 3AL8A 4TZ4A 4A08A 5K1CC 1PEVA 4NSXA 5IJ8E 1N6DA 5H1MA 3UR4A 5CXBB 3MKSB 3DXKC 5IT9g 2AGYA 4X61B 2AGZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BG0 A;  2UZX B;  1FWX A;  2CE8 A;  3I8C A;  1JMX B;  2P9S C;  2H6N A;  1GOT B;  5FXY A;  3SXT D;  4A0A B;  4FAV D;  3MZK A;  1A0R B;  5EML B;  2P9U C;  3SBR A;  3JZN A;  2XL3 A;  3F3G A;  4CI3 A;  2B5N A;  2O9K A;  3JRP A;  4LG9 A;  4CZY A;  3V5W B;  4GQ1 A;  4IA9 A;  3I8E A;  5K19 A;  3GFC A;  3MZL A;  4J0W A;  2I0T A;  3K27 A;  3EWE A;  3OW8 A;  1U2V C;  2H47 A;  3OTT A;  4J86 A;  3A0F A;  2IUR A;  3I2N A;  2YMU A;  3C99 A;  3RN0 D;  2Z2O A;  3UVL A;  2XYI A;  2IAA A;  3IIY A;  5H17 A;  5GXH A;  3PXS D;  2CE9 A;  4OWR A;  4E54 A;  4XEI C;  4FB1 D;  3DXM C;  5CXB A;  5B4W A;  2XU7 A;  3AL8 B;  3UVM A;  5AJA A;  4O45 A;  2OVP B;  3FM0 A;  4Z8L A;  3V7D B;  4N14 A;  3CFS B;  2CN3 A;  2I3S A;  2YNO A;  3SJL D;  3ODT A;  3OL2 A;  3AH8 B;  4CY3 A;  3JAM g;  2EBS A;  3F3F A;  5A2Q g;  5TF2 A;  4ZOZ A;  3EI4 B;  4ERY A;  4K3I D;  2AH1 A;  3NVQ A;  2H13 A;  3PVW B;  2Z2P A;  2H6K A;  3J80 g;  2H14 A;  1R5M A;  5C9Z B;  4CC9 A;  2HJ4 A;  1K32 A;  2G99 A;  4J84 A;  2J57 G;  5EAM A;  2AQ5 A;  3RFH A;  2H68 A;  1SQJ A;  2OK6 A;  3RLM D;  1QNI A;  3SWS D;  5FA5 B;  3V9F A;  4LG8 A;  4PBY A;  4O3T B;  4Y5R D;  4L9O A;  1GG2 B;  3EI3 A;  4J82 A;  4LGN A;  1YFQ A;  3OKT A;  4CI8 A;  5C2W B;  2MTA H;  2H9P A;  4QL1 A;  3I7P A;  3RSE C;  3OKW A;  4E5Z B;  3OKY B;  4E54 B;  4FA4 D;  3IIW A;  1SHY B;  3PSC B;  2AGX A;  2PM9 B;  3C75 H;  2AGL A;  4U1E I;  4ZN4 A;  1N6F A;  2H9L A;  3C9C A;  3EI4 A;  4FAN D;  4FA5 D;  2HKM A;  3OL2 B;  1RI6 A;  4JT6 C;  3I89 A;  4Y7R A;  3SN6 B;  4H5J A;  4J81 A;  4U7A A;  4A11 A;  4GZ8 A;  4BL0 A;  3RRM C;  4JSV C;  4GM9 A;  2W18 A;  3I7N A;  1XHM A;  4A0B A;  4PC0 A;  3BG1 A;  5EMM B;  2OK4 A;  1S4U X;  2YBA A;  1PBY B;  3FRX A;  3UVK A;  3VA6 A;  5EAR A;  1U4C A;  2UZY B;  3MMY A;  4GQB B;  3PE7 A;  5FKT A;  4JSX C;  4ZOV A;  3SLE D;  5EM2 A;  5H14 A;  5C2V B;  4GM8 A;  4ERQ A;  4CY2 A;  5TEE A;  5HE3 B;  1XIP A;  4E5Z A;  3OKY A;  4HDJ A;  4PXW A;  4D6V A;  4PNK B;  3I7O A;  3SMR A;  3EI3 B;  5I5I A;  4FHL A;  2PM9 A;  4ERZ A;  4XYI A;  2OVQ B;  2P9K C;  1JMZ B;  4CZV A;  2PM6 B;  5I5M A;  4CI1 A;  4AEZ A;  2GNQ A;  1B9Y A;  4QT8 A;  3DWL C;  4BH6 A;  3PVU B;  1PGU A;  4J78 A;  2PBI B;  4R7A B;  4A09 B;  4A7J A;  1TYQ C;  3SBP A;  5AFU 3;  2IUQ A;  4H5I A;  3E0C A;  3ORV D;  2J55 H;  3N0D A;  5EMJ B;  3I7L A;  5HE1 B;  3MXX A;  3SBQ A;  5KDO B;  4A11 B;  3EI1 B;  2AGW A;  2H9N A;  2HYE A;  3VGZ A;  3CFV A;  3J81 g;  2I3T A;  3EI2 B;  1MG3 A;  2QXV A;  4A0B B;  2B4E A;  4ZOY A;  1Q47 A;  3UKU C;  4CY5 A;  2CNX A;  4GM3 A;  1ERJ A;  2BCJ B;  2B5M A;  5FQD A;  3F3P A;  1TBG A;  5FKS A;  2AH0 A;  1SQ9 A;  4I79 A;  4J87 A;  1JJU B;  2GC7 A;  3HFQ A;  5EAL A;  5SXM A;  4A2L A;  3IJC A;  2H6Q A;  4PSW B;  5EM2 B;  5GMK n;  5AMS A;  3ULE C;  2HXC A;  4GGC A;  2YB8 B;  5IC7 A;  4PSX B;  2J56 H;  5HE0 B;  2CO0 A;  3UVN A;  4MK0 B;  1P22 A;  4JSN C;  4FA1 D;  2XL2 A;  3AFC A;  4ESG A;  1PI6 A;  3JZG A;  5EMK B;  5I5J A;  4L3G D;  4FA9 D;  4A09 A;  3CIK B;  4O1Q D;  3SVW D;  2IUV A;  4CY1 A;  3MKQ A;  2G9A A;  5CYK B;  3PSL A;  3NVX A;  4UI9 R;  4BUJ C;  4A2M A;  2Q7Q A;  3IJ0 A;  3EMH A;  3EI1 A;  3SFZ A;  1B9X A;  2P9I C;  3SCY A;  4J8B A;  4JSP C;  3EI2 A;  3EU7 A;  5TEF A;  1K8K C;  3P4F A;  2I0S A;  3KRX B;  2GC4 A;  1N6E A;  3N0E A;  2OJY A;  3I7K A;  4X63 B;  3RMZ D;  4CI2 A;  3IJ1 A;  3K26 A;  3RFG A;  4GMB A;  3EG6 A;  2Z2N A;  4GQ2 P;  1GXR A;  4L3H D;  3AL9 A;  4L1Q D;  4JD2 C;  4D0K A;  5FLX g;  3VH0 A;  2HKR A;  4ES0 A;  3ZWL B;  2YNN A;  4X60 B;  3GRE A;  3PXT D;  1MG2 A;  1OMW B;  4JXM A;  2OVR B;  3FGB A;  5FKR A;  3UKR C;  3DM0 A;  3C5M A;  3NVN A;  4O9D A;  2H9M A;  4QRJ A;  5HYN B;  1NEX B;  2BBK H;  3IKO A;  2H3X A;  5CYK A;  2CO0 C;  4CZX A;  3JRO A;  3UVO A;  1JOF A;  3KRW B;  5FKQ A;  1MDA H;  2IUP A;  3BWS A;  3L4M D;  4FWW A;  2CN2 A;  4PBZ A;  5CXC B;  2OIZ A;  2PM7 B;  3B7F A;  4EWR A;  4J8G A;  4XYH A;  4GGA A;  1L0Q A;  3DSM A;  2IWF A;  4K3J B;  4A08 B;  5IGQ A;  4G56 B;  5HQG A;  3JB9 L;  2HES X;  2HJB A;  5THA A;  3W15 A;  1GP2 B;  1VYH C;  3PXW D;  1OLZ A;  4A0A A;  5TDH B;  5GXI A;  3JZH A;  3I7H A;  4J0X A;  4QQE A;  2I0R A;  4X3E A;  4OZU A;  4YVD A;  1XKS A;  4GGD A;  4AOW A;  4ZOX A;  5IJ7 E;  3SHF A;  3JPX A;  4J79 A;  4J77 A;  2YNP A;  5IGO A;  2QC5 A;  2P9N C;  4O3U B;  2P9P C;  5GSA A;  3L4O D;  5HE2 B;  5EAP A;  2P9L C;  2B5L A;  5JWZ A;  2IWK A;  4IMM A;  4JT5 C;  2TRC B;  3RN1 D;  1NR0 A;  4J73 A;  5CXC A;  3U4Y A;  4KFM B;  3AL8 A;  4TZ4 A;  4A08 A;  5K1C C;  1PEV A;  4NSX A;  5IJ8 E;  1N6D A;  5H1M A;  3UR4 A;  5CXB B;  3MKS B;  3DXK C;  5IT9 g;  2AGY A;  4X61 B;  2AGZ A; 
#chains in the Genus database with same CATH topology
 3V4V A;  3BG0 A;  2UZX B;  1FWX A;  2CE8 A;  2VDQ A;  5M5V A;  1VE6 A;  3I8C A;  1JMX B;  2P9S C;  2H6N A;  1GOT B;  4UM9 A;  5FXY A;  4AMY A;  3SXT D;  4A0A B;  4AN0 A;  4FAV D;  4WK2 A;  3MZK A;  1A0R B;  5EML B;  5C92 A;  1C9I A;  3T3P A;  2P9U C;  3SBR A;  3JZN A;  2XL3 A;  3F3G A;  4CI3 A;  2B5N A;  2O9K A;  3JRP A;  4LG9 A;  4CZY A;  3V5W B;  4GQ1 A;  4IA9 A;  3I8E A;  5K19 A;  2XDW A;  3GFC A;  3MZL A;  4J0W A;  3OF7 A;  1O6F A;  2I0T A;  4G1E A;  2VDK A;  3K27 A;  3EWE A;  3OW8 A;  1U2V C;  2H47 A;  3OTT A;  4O02 A;  4MMZ A;  4J86 A;  3NIF A;  3A0F A;  3IUN A;  2IUR A;  3I2N A;  2YMU A;  3C99 A;  3RN0 D;  4BP8 A;  2Z2O A;  3K71 A;  4NEN A;  3UVL A;  2XYI A;  2IAA A;  3IIY A;  5H17 A;  5GXH A;  3PXS D;  2CE9 A;  4OWR A;  4E54 A;  1UOP A;  4RE5 A;  4XEI C;  4FB1 D;  3DXM C;  5CXB A;  5B4W A;  2XU7 A;  3NID A;  5C86 A;  3V4P A;  2QZP A;  3AL8 B;  3UVM A;  5AJA A;  4O45 A;  2OVP B;  3FM0 A;  4Z8L A;  3V7D B;  4N14 A;  3VI4 A;  3CFS B;  2CN3 A;  4WK4 A;  5M5S A;  1TYE A;  2I3S A;  2YNO A;  3SJL D;  3ODT A;  3OL2 A;  3AH8 B;  4CY3 A;  3JAM g;  2EBS A;  1GOH A;  3F3F A;  5A2Q g;  3EQ8 A;  5TF2 A;  4Z7O A;  4ZOZ A;  3EI4 B;  4ERY A;  4K3I D;  2AH1 A;  3NVQ A;  2H13 A;  2XZG A;  3PVW B;  1YR2 A;  2Z2P A;  2H6K A;  3J80 g;  2H14 A;  1JTD B;  1R5M A;  5C9Z B;  4QAM A;  4CC9 A;  2HJ4 A;  1K32 A;  2G99 A;  4J84 A;  2J57 G;  5EAM A;  2AQ5 A;  3IJE A;  2H68 A;  3RFH A;  1SQJ A;  2OK6 A;  3RLM D;  2VDP A;  1GOF A;  1QNI A;  1VZ3 A;  4L1M A;  1JV2 A;  1E8N A;  3SWS D;  5FA5 B;  3V9F A;  4LG8 A;  4PBY A;  4O3T B;  4Y5R D;  4L9O A;  1GG2 B;  2VDL A;  3EI3 A;  4J82 A;  4LGN A;  1YFQ A;  3OKT A;  2JKX A;  4CI8 A;  5C2W B;  2QR5 A;  2MTA H;  2H9P A;  4QL1 A;  3I7P A;  1VZ2 A;  3RSE C;  3OKW A;  4E5Z B;  3OKY B;  4E54 B;  2VDM A;  4FA4 D;  3IIW A;  3ZE2 A;  1BPO A;  1SHY B;  3PSC B;  2AGX A;  3K72 A;  4BCB A;  2PM9 B;  3C75 H;  2AGL A;  4U1E I;  4ZN4 A;  1N6F A;  2H9L A;  3C9C A;  3EI4 A;  4FAN D;  3QHY B;  4FA5 D;  2HKM A;  3OL2 B;  1RI6 A;  3K6S A;  4JT6 C;  3DDU A;  3I89 A;  4NAA A;  4Y7R A;  4BCD A;  3SN6 B;  4H5J A;  4J81 A;  2BKL A;  4U7A A;  4A11 A;  4GZ8 A;  4BL0 A;  4JHN A;  3RRM C;  3T3M A;  4JSV C;  4GM9 A;  2W18 A;  3I7N A;  1XHM A;  1QFM A;  4A0B A;  4PC0 A;  4BP9 A;  3BG1 A;  4RE6 A;  5EMM B;  2OK4 A;  1S4U X;  2YBA A;  1PBY B;  3O4H A;  4DNV A;  3FRX A;  3UVK A;  3VA6 A;  5EAR A;  1U4C A;  2UZY B;  3MMY A;  4GQB B;  4AX4 A;  3PE7 A;  3EQ9 A;  4JSX C;  5FKT A;  4G1M A;  4ZOV A;  3SLE D;  3IUQ A;  5EM2 A;  4WK0 A;  5H14 A;  5C2V B;  4GM8 A;  4ERQ A;  4CY2 A;  5TEE A;  5HE3 B;  1XIP A;  4E5Z A;  3OKY A;  4HDJ A;  3IUM A;  4PXW A;  4D6V A;  4PNK B;  3I7O A;  3SMR A;  3EI3 B;  1GOG A;  5I5I A;  4FHL A;  2PM9 A;  3ZDZ A;  4XYI A;  4ERZ A;  2OVQ B;  5M5U A;  2P9K C;  2VDO A;  3ZE0 A;  1JMZ B;  4CZV A;  2PM6 B;  5M5R A;  2VZ3 A;  5I5M A;  4CI1 A;  4AEZ A;  2WQ8 A;  2GNQ A;  1B9Y A;  4QT8 A;  3DWL C;  4BH6 A;  3PVU B;  1PGU A;  4J78 A;  2PBI B;  4R7A B;  4A09 B;  4A7J A;  4JHP C;  1TYQ C;  3SBP A;  5AFU 3;  2IUQ A;  4H5I A;  3E0C A;  3ORV D;  2J55 H;  3N0D A;  5HDB A;  5EMJ B;  3I7L A;  5HE1 B;  3IUR A;  3MXX A;  3SBQ A;  5KDO B;  4A11 B;  3EI1 B;  2AGW A;  2H9N A;  2HYE A;  3VGZ A;  2EIB A;  3CFV A;  2I3T A;  4WJK A;  3J81 g;  1M1X A;  3EI2 B;  1MG3 A;  2QXV A;  4A0B B;  2B4E A;  4ZOY A;  1Q47 A;  3UKU C;  4CY5 A;  2CNX A;  4GM3 A;  1ERJ A;  2BCJ B;  2B5M A;  4IRZ A;  1E8M A;  5FQD A;  1VE7 A;  3F3P A;  1C9L A;  1TBG A;  5FKS A;  2AH0 A;  1SQ9 A;  4I79 A;  4J87 A;  1JJU B;  2GC7 A;  3HFQ A;  5EAL A;  5SXM A;  4A2L A;  3IJC A;  2H6Q A;  4PSW B;  5EM2 B;  5GMK n;  5AMS A;  3ULE C;  2HXC A;  4NBM A;  4GGC A;  2YB8 B;  5IC7 A;  2VZ1 A;  4PSX B;  2J56 H;  5HE0 B;  2CO0 A;  3UVN A;  4MK0 B;  1P22 A;  4JSN C;  4UM8 A;  4FA1 D;  4BCC A;  2XL2 A;  3AFC A;  4ESG A;  5E6U A;  1PI6 A;  2VDN A;  2EIE A;  3JZG A;  5EMK B;  4L3G D;  5I5J A;  4AN1 A;  4FA9 D;  4A09 A;  3CIK B;  4O1Q D;  3SVW D;  2IUV A;  4CY1 A;  1U8C A;  3MKQ A;  2G9A A;  3VI3 A;  5CYK B;  3PSL A;  3NVX A;  4UI9 R;  4BUJ C;  4A2M A;  2Q7Q A;  3KCI A;  3IJ0 A;  3EMH A;  5FFO A;  3EI1 A;  1O6G A;  3SFZ A;  1B9X A;  2P9I C;  3SCY A;  4J8B A;  3GC3 B;  4JSP C;  3EI2 A;  3EU7 A;  4NC4 A;  5TEF A;  1K8K C;  3P4F A;  2I0S A;  3KRX B;  2GC4 A;  1N6E A;  3ZDY A;  1H2W A;  3N0E A;  1UTC A;  3O4G A;  2OJY A;  3I7K A;  4X63 B;  3RMZ D;  1H2Z A;  4CI2 A;  3NIG A;  3IJ1 A;  3IUJ A;  3K26 A;  3RFG A;  2EIC A;  4GMB A;  3EG6 A;  2Z2N A;  4GQ2 P;  1GXR A;  4L3H D;  3AL9 A;  1E5T A;  4L1Q D;  4JD2 C;  3MUO A;  4D0K A;  5FLX g;  3VH0 A;  2HU5 A;  4Z7Q A;  2HKR A;  2VC2 A;  4ES0 A;  3ZWL B;  2YNN A;  4X60 B;  3GRE A;  3PXT D;  1MG2 A;  1L5G A;  1OMW B;  4JXM A;  4Z7N A;  3QI0 A;  1H2Y A;  2OVR B;  3FGB A;  5FKR A;  1I2M B;  3DM0 A;  3UKR C;  3C5M A;  3NVN A;  4O9D A;  2H9M A;  4QRJ A;  5HYN B;  1NEX B;  2BBK H;  3IKO A;  2EID A;  2H3X A;  5CYK A;  2CO0 C;  4CZX A;  1A12 A;  3JRO A;  3UVO A;  3IVM A;  5M5T A;  1JOF A;  3KRW B;  5FKQ A;  1MDA H;  2IUP A;  3GD1 I;  4O2W A;  4MMX A;  3BWS A;  3L4M D;  4FWW A;  2CN2 A;  4PBZ A;  5CXC B;  2OIZ A;  3FCU A;  2PM7 B;  3B7F A;  4EWR A;  4J8G A;  4XYH A;  5E6S A;  4DNU A;  4GGA A;  1L0Q A;  3DSM A;  2IWF A;  4K3J B;  4A08 B;  5IGQ A;  4G56 B;  5HQG A;  3JB9 L;  2HES X;  2HJB A;  5THA A;  3W15 A;  1GP2 B;  1VYH C;  3MVD K;  4MMY A;  5E6R A;  3PXW D;  1OLZ A;  2HU8 A;  4A0A A;  5TDH B;  5GXI A;  3JZH A;  5FFG A;  1UOQ A;  3O4I A;  3I7H A;  4J0X A;  4QQE A;  2I0R A;  4D9S A;  4X3E A;  3IUL A;  4OZU A;  4YVD A;  1H2X A;  1XKS A;  3MUN A;  4GGD A;  4AOW A;  4ZOX A;  5IJ7 E;  3SHF A;  3JPX A;  4J79 A;  3EQ7 A;  4J77 A;  2YNP A;  5IGO A;  3FCS A;  2QC5 A;  2P9N C;  4O3U B;  2HU7 A;  2P9P C;  5GSA A;  5M61 A;  3ZDX A;  3L4O D;  5HE2 B;  1K3I A;  5EAP A;  2P9L C;  4G55 A;  2XE4 A;  2B5L A;  5JWZ A;  2IWK A;  4IMM A;  4JT5 C;  2TRC B;  3RN1 D;  1NR0 A;  4J73 A;  5CXC A;  3U4Y A;  4KFM B;  3AL8 A;  4TZ4 A;  4DNW A;  4A08 A;  3ZE1 A;  3O4J A;  5K1C C;  1UOO A;  1PEV A;  4NSX A;  5IJ8 E;  1N6D A;  2VDR A;  5H1M A;  3UR4 A;  5CXB B;  4AMZ A;  3MKS B;  3DXK C;  1QFS A;  5IT9 g;  2AGY A;  4X61 B;  2AGZ A;  1T2X A; 
#chains in the Genus database with same CATH homology
 3BG0 A;  2UZX B;  1FWX A;  2CE8 A;  3I8C A;  1JMX B;  2P9S C;  2H6N A;  1GOT B;  5FXY A;  3SXT D;  4A0A B;  4FAV D;  3MZK A;  1A0R B;  5EML B;  2P9U C;  3SBR A;  3JZN A;  2XL3 A;  3F3G A;  4CI3 A;  2B5N A;  2O9K A;  3JRP A;  4LG9 A;  4CZY A;  3V5W B;  4GQ1 A;  4IA9 A;  3I8E A;  5K19 A;  3GFC A;  3MZL A;  4J0W A;  2I0T A;  3K27 A;  3EWE A;  3OW8 A;  1U2V C;  2H47 A;  3OTT A;  4J86 A;  3A0F A;  2IUR A;  3I2N A;  2YMU A;  3C99 A;  3RN0 D;  2Z2O A;  3UVL A;  2XYI A;  2IAA A;  3IIY A;  5H17 A;  5GXH A;  3PXS D;  2CE9 A;  4OWR A;  4E54 A;  4XEI C;  4FB1 D;  3DXM C;  5CXB A;  5B4W A;  2XU7 A;  3AL8 B;  3UVM A;  5AJA A;  4O45 A;  2OVP B;  3FM0 A;  4Z8L A;  3V7D B;  4N14 A;  3CFS B;  2CN3 A;  2I3S A;  2YNO A;  3SJL D;  3ODT A;  3OL2 A;  3AH8 B;  4CY3 A;  3JAM g;  2EBS A;  3F3F A;  5A2Q g;  5TF2 A;  4ZOZ A;  3EI4 B;  4ERY A;  4K3I D;  2AH1 A;  3NVQ A;  2H13 A;  3PVW B;  2Z2P A;  2H6K A;  3J80 g;  2H14 A;  1R5M A;  5C9Z B;  4CC9 A;  2HJ4 A;  1K32 A;  2G99 A;  4J84 A;  2J57 G;  5EAM A;  2AQ5 A;  3RFH A;  2H68 A;  1SQJ A;  2OK6 A;  3RLM D;  1QNI A;  3SWS D;  5FA5 B;  3V9F A;  4LG8 A;  4PBY A;  4O3T B;  4Y5R D;  4L9O A;  1GG2 B;  3EI3 A;  4J82 A;  4LGN A;  1YFQ A;  3OKT A;  4CI8 A;  5C2W B;  2MTA H;  2H9P A;  4QL1 A;  3I7P A;  3RSE C;  3OKW A;  4E5Z B;  3OKY B;  4E54 B;  4FA4 D;  3IIW A;  1SHY B;  3PSC B;  2AGX A;  2PM9 B;  3C75 H;  2AGL A;  4U1E I;  4ZN4 A;  1N6F A;  2H9L A;  3C9C A;  3EI4 A;  4FAN D;  4FA5 D;  2HKM A;  3OL2 B;  1RI6 A;  4JT6 C;  3I89 A;  4Y7R A;  3SN6 B;  4H5J A;  4J81 A;  4U7A A;  4A11 A;  4GZ8 A;  4BL0 A;  3RRM C;  4JSV C;  4GM9 A;  2W18 A;  3I7N A;  1XHM A;  4A0B A;  4PC0 A;  3BG1 A;  5EMM B;  2OK4 A;  1S4U X;  2YBA A;  1PBY B;  3FRX A;  3UVK A;  3VA6 A;  5EAR A;  1U4C A;  2UZY B;  3MMY A;  4GQB B;  3PE7 A;  5FKT A;  4JSX C;  4ZOV A;  3SLE D;  5EM2 A;  5H14 A;  5C2V B;  4GM8 A;  4ERQ A;  4CY2 A;  5TEE A;  5HE3 B;  1XIP A;  4E5Z A;  3OKY A;  4HDJ A;  4PXW A;  4D6V A;  4PNK B;  3I7O A;  3SMR A;  3EI3 B;  5I5I A;  4FHL A;  2PM9 A;  4ERZ A;  4XYI A;  2OVQ B;  2P9K C;  1JMZ B;  4CZV A;  2PM6 B;  5I5M A;  4CI1 A;  4AEZ A;  2GNQ A;  1B9Y A;  4QT8 A;  3DWL C;  4BH6 A;  3PVU B;  1PGU A;  4J78 A;  2PBI B;  4R7A B;  4A09 B;  4A7J A;  1TYQ C;  3SBP A;  5AFU 3;  2IUQ A;  4H5I A;  3E0C A;  3ORV D;  2J55 H;  3N0D A;  5EMJ B;  3I7L A;  5HE1 B;  3MXX A;  3SBQ A;  5KDO B;  4A11 B;  3EI1 B;  2AGW A;  2H9N A;  2HYE A;  3VGZ A;  3CFV A;  3J81 g;  2I3T A;  3EI2 B;  1MG3 A;  2QXV A;  4A0B B;  2B4E A;  4ZOY A;  1Q47 A;  3UKU C;  4CY5 A;  2CNX A;  4GM3 A;  1ERJ A;  2BCJ B;  2B5M A;  5FQD A;  3F3P A;  1TBG A;  5FKS A;  2AH0 A;  1SQ9 A;  4I79 A;  4J87 A;  1JJU B;  2GC7 A;  3HFQ A;  5EAL A;  5SXM A;  4A2L A;  3IJC A;  2H6Q A;  4PSW B;  5EM2 B;  5GMK n;  5AMS A;  3ULE C;  2HXC A;  4GGC A;  2YB8 B;  5IC7 A;  4PSX B;  2J56 H;  5HE0 B;  2CO0 A;  3UVN A;  4MK0 B;  1P22 A;  4JSN C;  4FA1 D;  2XL2 A;  3AFC A;  4ESG A;  1PI6 A;  3JZG A;  5EMK B;  5I5J A;  4L3G D;  4FA9 D;  4A09 A;  3CIK B;  4O1Q D;  3SVW D;  2IUV A;  4CY1 A;  3MKQ A;  2G9A A;  5CYK B;  3PSL A;  3NVX A;  4UI9 R;  4BUJ C;  4A2M A;  2Q7Q A;  3IJ0 A;  3EMH A;  3EI1 A;  3SFZ A;  1B9X A;  2P9I C;  3SCY A;  4J8B A;  4JSP C;  3EI2 A;  3EU7 A;  5TEF A;  1K8K C;  3P4F A;  2I0S A;  3KRX B;  2GC4 A;  1N6E A;  3N0E A;  2OJY A;  3I7K A;  4X63 B;  3RMZ D;  4CI2 A;  3IJ1 A;  3K26 A;  3RFG A;  4GMB A;  3EG6 A;  2Z2N A;  4GQ2 P;  1GXR A;  4L3H D;  3AL9 A;  4L1Q D;  4JD2 C;  4D0K A;  5FLX g;  3VH0 A;  2HKR A;  4ES0 A;  3ZWL B;  2YNN A;  4X60 B;  3GRE A;  3PXT D;  1MG2 A;  1OMW B;  4JXM A;  2OVR B;  3FGB A;  5FKR A;  3UKR C;  3DM0 A;  3C5M A;  3NVN A;  4O9D A;  2H9M A;  4QRJ A;  5HYN B;  1NEX B;  2BBK H;  3IKO A;  2H3X A;  5CYK A;  2CO0 C;  4CZX A;  3JRO A;  3UVO A;  1JOF A;  3KRW B;  5FKQ A;  1MDA H;  2IUP A;  3BWS A;  3L4M D;  4FWW A;  2CN2 A;  4PBZ A;  5CXC B;  2OIZ A;  2PM7 B;  3B7F A;  4EWR A;  4J8G A;  4XYH A;  4GGA A;  1L0Q A;  3DSM A;  2IWF A;  4K3J B;  4A08 B;  5IGQ A;  4G56 B;  5HQG A;  3JB9 L;  2HES X;  2HJB A;  5THA A;  3W15 A;  1GP2 B;  1VYH C;  3PXW D;  1OLZ A;  4A0A A;  5TDH B;  5GXI A;  3JZH A;  3I7H A;  4J0X A;  4QQE A;  2I0R A;  4X3E A;  4OZU A;  4YVD A;  1XKS A;  4GGD A;  4AOW A;  4ZOX A;  5IJ7 E;  3SHF A;  3JPX A;  4J79 A;  4J77 A;  2YNP A;  5IGO A;  2QC5 A;  2P9N C;  4O3U B;  2P9P C;  5GSA A;  3L4O D;  5HE2 B;  5EAP A;  2P9L C;  2B5L A;  5JWZ A;  2IWK A;  4IMM A;  4JT5 C;  2TRC B;  3RN1 D;  1NR0 A;  4J73 A;  5CXC A;  3U4Y A;  4KFM B;  3AL8 A;  4TZ4 A;  4A08 A;  5K1C C;  1PEV A;  4NSX A;  5IJ8 E;  1N6D A;  5H1M A;  3UR4 A;  5CXB B;  3MKS B;  3DXK C;  5IT9 g;  2AGY A;  4X61 B;  2AGZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...