4J78A

Crystal structure of beta'-cop/emp47p complex
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
300
structure length
300
Chain Sequence
KLDIKKTFSNRSDRVKGIDFHPTEPWVLTTLYSGRVEIWNYETQVEVRSIQVTETPVRAGKFIARKNWIIVGSDDFRIRVFNYNTGEKVVDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVKLWNWENNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDRTVKVWSLGQSTPNFTLTTGQERGVNYVDYYPLPDKPYMITASDDLTIKIWDYQTKSCVATLEGHMSNVSFAVFHPTLPIIISGSEDGTLKIWNSSTYKVEKTLNVGLERSWCIATHPTGRKNYIASGFDNGFTVLSLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coatomer subunit beta'
publication title Rules for the recognition of dilysine retrieval motifs by coatomer.
pubmed doi rcsb
molecule tags Protein transport
total genus 89
structure length 300
sequence length 300
ec nomenclature
pdb deposition date 2013-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4j78A01
4GGDA 5EMJB 4ZOVA 4XYIA 2YNOA 1GOTB 3V5WB 4JSXC 4J84A 3I7HA 3MKSB 4HDJA 3NVQA 4O3TB 5CXBA 1U2VC 4J8GA 3OL2B 4X63B 3JZGA 4ES0A 3PVUB 5FKRA 4FHLA 2TRCB 1JMZB 3OKYB 4H5JA 3K27A 2IUPA 3ODTA 4LG8A 3DXKC 3OKWA 4TZ4A 5K19A 1OMWB 3K26A 2I3SA 4QRJA 3IIWA 3SN6B 2B5NA 4CI3A 5K1CC 3AL9A 4G56B 3I7LA 4GZ8A 5EARA 3JRPA 4CI8A 3RMZD 2Z2NA 4J86A 3B7FA 5C9ZB 3PSLA 3IJ0A 3NVNA 2IAAA 3I7PA 3CFSB 2I3TA 4D0KA 4J73A 2YBAA 1XIPA 1GXRA 4YVDA 3VA6A 2G99A 3FM0A 4PBYA 3V9FA 3ZWLB 3RN1D 5H14A 2PBIB 4PBZA 5SXMA 3MZLA 3N0DA 4KFMB 3IJCA 4JXMA 5EALA 4GQ2P 3AL8A 2OVPB 1S4UX 1PI6A 4J8BA 5THAA 2CN2A 3F3PA 3I2NA 4A0AA 2H6NA 3ORVD 2GC7A 3OTTA 3MZKA 3RRMC 1JJUB 2H9NA 3C5MA 2AGWA 4CI2A 4GQ1A 2AQ5A 2CE8A 2AGYA 2HJBA 3C75H 4A09B 5I5MA 3DSMA 3UVOA 5FA5B 3MMYA 2H6KA 4E5ZB 3JZNA 4A08A 3EI4A 4Z8LA 2XYIA 4CY1A 2YNNA 5EMMB 2HKRA 5H1MA 5EM2B 5AMSA 2IUQA 3FGBA 5TDHB 2QXVA 4QL1A 5HE3B 4UI9R 2QC5A 3C9CA 1K8KC 4J0WA 2CE9A 4FAVD 3RFHA 3IJ1A 3EI3A 3KRXB 1OLZA 4A2LA 4JD2C 3SJLD 3UR4A 4CZYA 3SHFA 4CY2A 4A11A 3ULEC 4CZXA 4X3EA 3UKUC 4BUJC 4K3JB 4A0BB 2AGZA 1JMXB 2P9NC 2IWFA 4J0XA 3CFVA 4BL0A 4FA5D 3BWSA 3JZHA 2OIZA 1R5MA 5C2WB 4D6VA 3EI1B 3UVLA 4PNKB 3OW8A 4J81A 1TBGA 1PEVA 4GM9A 3JAMg 5FKSA 4O9DA 2HXCA 1FWXA 3I7KA 2H14A 4XEIC 4A09A 2OJYA 4FWWA 5FKQA 2PM6B 1N6EA 5HE1B 4CI1A 2Q7QA 2H9PA 4A7JA 3VH0A 1TYQC 2H47A 1GP2B 5CXCB 2P9LC 2OVQB 3DM0A 4CY3A 4N14A 4JT6C 4BH6A 2UZXB 1U4CA 5A2Qg 5HQGA 3EI2B 3NVXA 4X61B 2H3XA 3HFQA 3RFGA 3DWLC 2YB8B 3RSEC 2AH0A 3F3GA 4GMBA 4PXWA 5CYKB 5EMKB 1N6DA 3PXTD 3OL2A 2AGLA 3SBRA 2PM7B 3JROA 3OKYA 5IJ7E 5IT9g 4ZN4A 2IWKA 1XHMA 2H68A 5IJ8E 3J81g 5B4WA 5HE2B 3VGZA 4E54B 2I0RA 3F3FA 2OVRB 2AGXA 2J55H 4A2MA 5FXYA 4J87A 4XYHA 5CXBB 2HESX 1VYHC 4NSXA 4QT8A 3I8CA 4GM8A 2H13A 2XL3A 2G9AA 2H9LA 4L3HD 3J80g 2HKMA 3I7NA 4Y5RD 3SXTD 2P9KC 5GSAA 5HE0B 3E0CA 3UVKA 3DXMC 4MK0B 4J78A 5FLXg 2O9KA 4FB1D 3V7DB 4FA9D 4ERQA 3JB9L 1ERJA 1Q47A 1YFQA 2B5MA 3SBPA 4GGAA 5TEFA 4ZOXA 2Z2PA 4LGNA 3RN0D 2B5LA 4IA9A 1NEXB 3I7OA 4CC9A 3UVNA 5C2VB 1MDAH 5IGQA 2YNPA 1PBYB 2UZYB 2PM9B 2CNXA 3IIYA 3SWSD 5AJAA 3KRWB 1RI6A 3EG6A 4OWRA 3EWEA 1K32A 3PSCB 4R7AB 4JSVC 2MTAH 4J77A 4L3GD 4IMMA 4ERZA 2P9PC 1P22A 5I5JA 1N6FA 3EU7A 1GG2B 2EBSA 4O45A 2P9IC 3OKTA 3P4FA 4FAND 5HYNB 4FA4D 3SVWD 3EMHA 2HJ4A 4Y7RA 4E5ZA 3CIKB 3AL8B 3N0EA 5GXHA 4O1QD 5EM2A 1L0QA 3SBQA 4O3UB 5JWZA 4A0AB 2AH1A 2H6QA 3PE7A 5IC7A 3PXSD 1MG2A 1XKSA 3UVMA 3C99A 3GREA 4J79A 4GGCA 3A0FA 2J56H 3BG1A 1SHYB 4H5IA 4ZOYA 3IKOA 2BCJB 4L1QD 4A0BA 2Z2OA 3PXWD 1A0RB 2CO0C 1SQJA 2IUVA 2PM9A 4U1EI 3W15A 4A08B 2I0SA 2OK4A 3EI4B 4PSWB 4LG9A 5EAPA 3MXXA 2J57G 3EI1A 2B4EA 4GM3A 3BG0A 5EMLB 4ERYA 3PVWB 4JSPC 3UKRC 2OK6A 4PC0A 3EI3B 4CZVA 3GFCA 1B9YA 4AEZA 5FKTA 4L9OA 2CN3A 3L4MD 5I5IA 3SMRA 2HYEA 2XU7A 2GNQA 4A11B 3AH8B 2W18A 2GC4A 5AFU3 3MKQA 2IURA 5H17A 2H9MA 3FRXA 5CXCA 3JPXA 3AFCA 4J82A 3U4YA 2P9SC 1PGUA 4JSNC 4CY5A 5GXIA 4FA1D 5GMKn 4GQBB 4QQEA 2XL2A 4X60B 4ESGA 3EI2A 3L4OD 3SCYA 1MG3A 4AOWA 3I89A 4OZUA 3RLMD 1B9XA 4PSXB 5TF2A 2BBKH 4K3ID 2I0TA 5CYKA 1JOFA 3SLED 4I79A 3SFZA 3I8EA 5IGOA 5KDOB 1QNIA 2P9UC 4EWRA 4JT5C 1NR0A 5FQDA 4U7AA 1SQ9A 5TEEA 2YMUA 2CO0A 4E54A 4ZOZA 5EAMA
chains in the Genus database with same CATH superfamily
3VI4A 4GGDA 5EMJB 3K6SA 3EQ9A 4ZOVA 4XYIA 2YNOA 1GOTB 3V5WB 4DNWA 3GC3B 4JSXC 4J84A 3I7HA 3MKSB 4HDJA 3NVQA 4O3TB 5CXBA 1U2VC 4QAMA 4J8GA 3OL2B 4X63B 1C9IA 3JZGA 4ES0A 3PVUB 5FKRA 4FHLA 2TRCB 3IULA 1JMZB 3OKYB 3QHYB 3IUQA 5M61A 5M5SA 4H5JA 3K27A 2IUPA 3ODTA 4LG8A 3DXKC 3OKWA 4TZ4A 5K19A 3IUMA 1OMWB 3K26A 2I3SA 4QRJA 3IIWA 2VC2A 3SN6B 2B5NA 4CI3A 3V4PA 5K1CC 2QZPA 3AL9A 4G56B 1H2XA 3I7LA 4GZ8A 1BPOA 5EARA 4DNVA 3JRPA 4BCBA 4CI8A 5HDBA 3RMZD 2Z2NA 4J86A 3B7FA 5E6RA 5C9ZB 3PSLA 3IJ0A 3NVNA 2IAAA 3I7PA 4Z7QA 3ZE0A 3CFSB 2I3TA 4D0KA 4J73A 2YBAA 1XIPA 1GXRA 4YVDA 3VA6A 2G99A 3FM0A 4PBYA 3V9FA 3ZWLB 3RN1D 5H14A 2PBIB 4PBZA 5SXMA 3MZLA 1YR2A 3N0DA 4KFMB 2VDOA 1O6GA 3IJCA 4JXMA 2EIDA 3QI0A 4AMZA 5EALA 4GQ2P 1I2MB 3NIDA 3AL8A 2OVPB 1S4UX 1PI6A 4J8BA 5THAA 2CN2A 3F3PA 3I2NA 5M5RA 1H2ZA 4A0AA 2H6NA 3ORVD 2GC7A 3OTTA 3MZKA 3RRMC 1JJUB 4G1EA 3EQ7A 2H9NA 3C5MA 2AGWA 4CI2A 4GQ1A 2AQ5A 2CE8A 2BKLA 2AGYA 2HJBA 3C75H 4A09B 5I5MA 3DSMA 4G55A 3UVOA 4AN0A 5FA5B 3MMYA 3FCSA 2H6KA 4E5ZB 3JZNA 4A08A 3EI4A 4Z8LA 2XYIA 4CY1A 2YNNA 4MMXA 2HKRA 5EMMB 5H1MA 5EM2B 5AMSA 2JKXA 2IUQA 3FGBA 4L1MA 1UTCA 3NIFA 2QXVA 5TDHB 3T3PA 4QL1A 2HU5A 5HE3B 4UI9R 2QC5A 3C9CA 1K8KC 4J0WA 2CE9A 4FAVD 3RFHA 3IJEA 3IJ1A 3EI3A 3KRXB 1OLZA 4A2LA 4JD2C 3SJLD 3UR4A 4WK2A 4CZYA 3IUJA 3SHFA 4CY2A 4A11A 3IVMA 3ULEC 4CZXA 1VZ2A 4X3EA 3UKUC 4BUJC 4K3JB 4UM8A 2VZ3A 4A0BB 2AGZA 2HU7A 1JMXB 2P9NC 2IWFA 4J0XA 3CFVA 4BL0A 4FA5D 3BWSA 3JZHA 2OIZA 1QFMA 1R5MA 1E5TA 5C2WB 4D6VA 3EI1B 3EQ8A 3UVLA 4PNKB 3OW8A 1UOPA 4J81A 1VE6A 1TBGA 1PEVA 4GM9A 3JAMg 5FKSA 4O9DA 2HXCA 1FWXA 3I7KA 2H14A 4XEIC 4A09A 2OJYA 4FWWA 5FKQA 2PM6B 3MUOA 1N6EA 5HE1B 4CI1A 3O4GA 2Q7QA 1H2YA 4MMYA 4Z7NA 2H9PA 4A7JA 3VH0A 1TYQC 2H47A 1GP2B 5CXCB 2XE4A 2P9LC 2OVQB 2VDPA 3DM0A 4BCCA 2EIBA 4CY3A 3ZDXA 4N14A 4JT6C 4AN1A 1L5GA 4BH6A 2UZXB 4AMYA 1U4CA 5A2Qg 4JHPC 3DDUA 4WK4A 1T2XA 5HQGA 3O4HA 3NVXA 3EI2B 4X61B 2H3XA 1H2WA 3HFQA 4NC4A 3RFGA 3DWLC 2YB8B 1K3IA 3RSEC 3IUNA 2AH0A 3F3GA 4GMBA 4PXWA 5CYKB 5EMKB 1N6DA 3PXTD 3OL2A 4DNUA 2AGLA 5C92A 3SBRA 3ZDYA 2PM7B 3JROA 3OKYA 5IJ7E 5IT9g 4ZN4A 1O6FA 2IWKA 1XHMA 2H68A 5C86A 5IJ8E 3J81g 5B4WA 1GOGA 2XZGA 4O2WA 5HE2B 3VGZA 4E54B 2I0RA 4BP8A 3F3FA 2OVRB 2AGXA 2J55H 4A2MA 1E8NA 3MUNA 5FXYA 4J87A 4XYHA 3K72A 5CXBB 2HESX 1VYHC 4NSXA 4QT8A 3I8CA 4GM8A 2VDQA 2H13A 2XL3A 2G9AA 2H9LA 4L3HD 3J80g 2HKMA 3I7NA 4Y5RD 3SXTD 2P9KC 5GSAA 5HE0B 3E0CA 3UVKA 3DXMC 4MK0B 4J78A 5FLXg 2O9KA 3T3MA 4FB1D 3V7DB 4FA9D 4ERQA 3VI3A 3JB9L 4WK0A 1ERJA 1Q47A 1YFQA 2B5MA 3SBPA 4GGAA 5TEFA 1GOFA 2Z2PA 4ZOXA 4LGNA 3RN0D 2B5LA 4IA9A 1NEXB 3I7OA 4CC9A 3MVDK 3UVNA 3NIGA 5C2VB 1UOOA 1MDAH 2EIEA 5IGQA 2YNPA 3O4JA 1PBYB 2UZYB 2PM9B 1E8MA 2CNXA 1C9LA 2VZ1A 3IIYA 3SWSD 5AJAA 3KRWB 2VDKA 1RI6A 3EG6A 4OWRA 5M5UA 3EWEA 1K32A 1VE7A 3PSCB 3ZE1A 3K71A 4R7AB 1U8CA 5FFOA 4JSVC 1M1XA 2MTAH 4J77A 3ZDZA 4L3GD 4IMMA 4ERZA 2P9PC 1QFSA 1P22A 5I5JA 1N6FA 2WQ8A 3EU7A 5E6UA 1GG2B 2EBSA 4O45A 4BCDA 2P9IC 3OKTA 3P4FA 4G1MA 4FAND 5HYNB 1VZ3A 4FA4D 3SVWD 2VDRA 3EMHA 3GD1I 2HJ4A 4Y7RA 4E5ZA 3CIKB 3AL8B 4AX4A 3N0EA 5GXHA 4O1QD 5EM2A 2HU8A 1L0QA 3SBQA 4O3UB 5JWZA 4A0AB 2AH1A 1JV2A 2H6QA 3PE7A 5IC7A 3PXSD 1MG2A 1XKSA 3UVMA 3C99A 3GREA 4J79A 1UOQA 4GGCA 3A0FA 4RE6A 4WJKA 2J56H 3BG1A 1SHYB 4H5IA 4ZOYA 4NAAA 3IKOA 2BCJB 3KCIA 4L1QD 4A0BA 2Z2OA 3PXWD 2VDLA 1A0RB 2CO0C 1SQJA 2IUVA 2PM9A 4U1EI 3W15A 4A08B 2I0SA 2OK4A 3EI4B 4PSWB 4LG9A 5EAPA 3MXXA 2J57G 3EI1A 2B4EA 4GM3A 2QR5A 3BG0A 5EMLB 2EICA 3ZE2A 4ERYA 3PVWB 4JSPC 2VDNA 4IRZA 4Z7OA 4NENA 3UKRC 2OK6A 4PC0A 3EI3B 4CZVA 3GFCA 1B9YA 4AEZA 5FKTA 4L9OA 3IURA 2CN3A 3L4MD 5I5IA 3SMRA 2HYEA 2XU7A 2GNQA 4JHNA 4A11B 2VDMA 3AH8B 2W18A 2GC4A 5AFU3 3MKQA 2IURA 4UM9A 3V4VA 5H17A 2H9MA 3FRXA 5CXCA 3JPXA 3AFCA 4J82A 4BP9A 3U4YA 1GOHA 2P9SC 1PGUA 4JSNC 1JTDB 4CY5A 2XDWA 5GXIA 4FA1D 5GMKn 4GQBB 4QQEA 2XL2A 4RE5A 4X60B 4ESGA 3EI2A 3L4OD 3OF7A 5M5VA 3SCYA 1MG3A 4AOWA 3I89A 1A12A 4OZUA 3RLMD 1B9XA 4PSXB 5TF2A 2BBKH 4K3ID 2I0TA 5CYKA 1JOFA 3O4IA 4NBMA 3SLED 4O02A 5M5TA 4I79A 3SFZA 3I8EA 5IGOA 3FCUA 5KDOB 1QNIA 2P9UC 4EWRA 4JT5C 1NR0A 5FQDA 4U7AA 1SQ9A 5TEEA 2YMUA 5E6SA 2CO0A 1TYEA 4D9SA 5FFGA 4MMZA 4E54A 4ZOZA 5EAMA
chains in the Genus database with same CATH topology
4GGDA 5EMJB 4ZOVA 4XYIA 2YNOA 1GOTB 3V5WB 4JSXC 4J84A 3I7HA 3MKSB 4HDJA 3NVQA 4O3TB 5CXBA 1U2VC 4J8GA 3OL2B 4X63B 3JZGA 4ES0A 3PVUB 5FKRA 4FHLA 2TRCB 1JMZB 3OKYB 4H5JA 3K27A 2IUPA 3ODTA 4LG8A 3DXKC 3OKWA 4TZ4A 5K19A 1OMWB 3K26A 2I3SA 4QRJA 3IIWA 3SN6B 2B5NA 4CI3A 5K1CC 3AL9A 4G56B 3I7LA 4GZ8A 5EARA 3JRPA 4CI8A 3RMZD 2Z2NA 4J86A 3B7FA 5C9ZB 3PSLA 3IJ0A 3NVNA 2IAAA 3I7PA 3CFSB 2I3TA 4D0KA 4J73A 2YBAA 1XIPA 1GXRA 4YVDA 3VA6A 2G99A 3FM0A 4PBYA 3V9FA 3ZWLB 3RN1D 5H14A 2PBIB 4PBZA 5SXMA 3MZLA 3N0DA 4KFMB 3IJCA 4JXMA 5EALA 4GQ2P 3AL8A 2OVPB 1S4UX 1PI6A 4J8BA 5THAA 2CN2A 3F3PA 3I2NA 4A0AA 2H6NA 3ORVD 2GC7A 3OTTA 3MZKA 3RRMC 1JJUB 2H9NA 3C5MA 2AGWA 4CI2A 4GQ1A 2AQ5A 2CE8A 2AGYA 2HJBA 3C75H 4A09B 5I5MA 3DSMA 3UVOA 5FA5B 3MMYA 2H6KA 4E5ZB 3JZNA 4A08A 3EI4A 4Z8LA 2XYIA 4CY1A 2YNNA 5EMMB 2HKRA 5H1MA 5EM2B 5AMSA 2IUQA 3FGBA 5TDHB 2QXVA 4QL1A 5HE3B 4UI9R 2QC5A 3C9CA 1K8KC 4J0WA 2CE9A 4FAVD 3RFHA 3IJ1A 3EI3A 3KRXB 1OLZA 4A2LA 4JD2C 3SJLD 3UR4A 4CZYA 3SHFA 4CY2A 4A11A 3ULEC 4CZXA 4X3EA 3UKUC 4BUJC 4K3JB 4A0BB 2AGZA 1JMXB 2P9NC 2IWFA 4J0XA 3CFVA 4BL0A 4FA5D 3BWSA 3JZHA 2OIZA 1R5MA 5C2WB 4D6VA 3EI1B 3UVLA 4PNKB 3OW8A 4J81A 1TBGA 1PEVA 4GM9A 3JAMg 5FKSA 4O9DA 2HXCA 1FWXA 3I7KA 2H14A 4XEIC 4A09A 2OJYA 4FWWA 5FKQA 2PM6B 1N6EA 5HE1B 4CI1A 2Q7QA 2H9PA 4A7JA 3VH0A 1TYQC 2H47A 1GP2B 5CXCB 2P9LC 2OVQB 3DM0A 4CY3A 4N14A 4JT6C 4BH6A 2UZXB 1U4CA 5A2Qg 5HQGA 3EI2B 3NVXA 4X61B 2H3XA 3HFQA 3RFGA 3DWLC 2YB8B 3RSEC 2AH0A 3F3GA 4GMBA 4PXWA 5CYKB 5EMKB 1N6DA 3PXTD 3OL2A 2AGLA 3SBRA 2PM7B 3JROA 3OKYA 5IJ7E 5IT9g 4ZN4A 2IWKA 1XHMA 2H68A 5IJ8E 3J81g 5B4WA 5HE2B 3VGZA 4E54B 2I0RA 3F3FA 2OVRB 2AGXA 2J55H 4A2MA 5FXYA 4J87A 4XYHA 5CXBB 2HESX 1VYHC 4NSXA 4QT8A 3I8CA 4GM8A 2H13A 2XL3A 2G9AA 2H9LA 4L3HD 3J80g 2HKMA 3I7NA 4Y5RD 3SXTD 2P9KC 5GSAA 5HE0B 3E0CA 3UVKA 3DXMC 4MK0B 4J78A 5FLXg 2O9KA 4FB1D 3V7DB 4FA9D 4ERQA 3JB9L 1ERJA 1Q47A 1YFQA 2B5MA 3SBPA 4GGAA 5TEFA 4ZOXA 2Z2PA 4LGNA 3RN0D 2B5LA 4IA9A 1NEXB 3I7OA 4CC9A 3UVNA 5C2VB 1MDAH 5IGQA 2YNPA 1PBYB 2UZYB 2PM9B 2CNXA 3IIYA 3SWSD 5AJAA 3KRWB 1RI6A 3EG6A 4OWRA 3EWEA 1K32A 3PSCB 4R7AB 4JSVC 2MTAH 4J77A 4L3GD 4IMMA 4ERZA 2P9PC 1P22A 5I5JA 1N6FA 3EU7A 1GG2B 2EBSA 4O45A 2P9IC 3OKTA 3P4FA 4FAND 5HYNB 4FA4D 3SVWD 3EMHA 2HJ4A 4Y7RA 4E5ZA 3CIKB 3AL8B 3N0EA 5GXHA 4O1QD 5EM2A 1L0QA 3SBQA 4O3UB 5JWZA 4A0AB 2AH1A 2H6QA 3PE7A 5IC7A 3PXSD 1MG2A 1XKSA 3UVMA 3C99A 3GREA 4J79A 4GGCA 3A0FA 2J56H 3BG1A 1SHYB 4H5IA 4ZOYA 3IKOA 2BCJB 4L1QD 4A0BA 2Z2OA 3PXWD 1A0RB 2CO0C 1SQJA 2IUVA 2PM9A 4U1EI 3W15A 4A08B 2I0SA 2OK4A 3EI4B 4PSWB 4LG9A 5EAPA 3MXXA 2J57G 3EI1A 2B4EA 4GM3A 3BG0A 5EMLB 4ERYA 3PVWB 4JSPC 3UKRC 2OK6A 4PC0A 3EI3B 4CZVA 3GFCA 1B9YA 4AEZA 5FKTA 4L9OA 2CN3A 3L4MD 5I5IA 3SMRA 2HYEA 2XU7A 2GNQA 4A11B 3AH8B 2W18A 2GC4A 5AFU3 3MKQA 2IURA 5H17A 2H9MA 3FRXA 5CXCA 3JPXA 3AFCA 4J82A 3U4YA 2P9SC 1PGUA 4JSNC 4CY5A 5GXIA 4FA1D 5GMKn 4GQBB 4QQEA 2XL2A 4X60B 4ESGA 3EI2A 3L4OD 3SCYA 1MG3A 4AOWA 3I89A 4OZUA 3RLMD 1B9XA 4PSXB 5TF2A 2BBKH 4K3ID 2I0TA 5CYKA 1JOFA 3SLED 4I79A 3SFZA 3I8EA 5IGOA 5KDOB 1QNIA 2P9UC 4EWRA 4JT5C 1NR0A 5FQDA 4U7AA 1SQ9A 5TEEA 2YMUA 2CO0A 4E54A 4ZOZA 5EAMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GGD A;  5EMJ B;  4ZOV A;  4XYI A;  2YNO A;  1GOT B;  3V5W B;  4JSX C;  4J84 A;  3I7H A;  3MKS B;  4HDJ A;  3NVQ A;  4O3T B;  5CXB A;  1U2V C;  4J8G A;  3OL2 B;  4X63 B;  3JZG A;  4ES0 A;  3PVU B;  5FKR A;  4FHL A;  2TRC B;  1JMZ B;  3OKY B;  4H5J A;  3K27 A;  2IUP A;  3ODT A;  4LG8 A;  3DXK C;  3OKW A;  4TZ4 A;  5K19 A;  1OMW B;  3K26 A;  2I3S A;  4QRJ A;  3IIW A;  3SN6 B;  2B5N A;  4CI3 A;  5K1C C;  3AL9 A;  4G56 B;  3I7L A;  4GZ8 A;  5EAR A;  3JRP A;  4CI8 A;  3RMZ D;  2Z2N A;  4J86 A;  3B7F A;  5C9Z B;  3PSL A;  3IJ0 A;  3NVN A;  2IAA A;  3I7P A;  3CFS B;  2I3T A;  4D0K A;  4J73 A;  2YBA A;  1XIP A;  1GXR A;  4YVD A;  3VA6 A;  2G99 A;  3FM0 A;  4PBY A;  3V9F A;  3ZWL B;  3RN1 D;  5H14 A;  2PBI B;  4PBZ A;  5SXM A;  3MZL A;  3N0D A;  4KFM B;  3IJC A;  4JXM A;  5EAL A;  4GQ2 P;  3AL8 A;  2OVP B;  1S4U X;  1PI6 A;  4J8B A;  5THA A;  2CN2 A;  3F3P A;  3I2N A;  4A0A A;  2H6N A;  3ORV D;  2GC7 A;  3OTT A;  3MZK A;  3RRM C;  1JJU B;  2H9N A;  3C5M A;  2AGW A;  4CI2 A;  4GQ1 A;  2AQ5 A;  2CE8 A;  2AGY A;  2HJB A;  3C75 H;  4A09 B;  5I5M A;  3DSM A;  3UVO A;  5FA5 B;  3MMY A;  2H6K A;  4E5Z B;  3JZN A;  4A08 A;  3EI4 A;  4Z8L A;  2XYI A;  4CY1 A;  2YNN A;  5EMM B;  2HKR A;  5H1M A;  5EM2 B;  5AMS A;  2IUQ A;  3FGB A;  5TDH B;  2QXV A;  4QL1 A;  5HE3 B;  4UI9 R;  2QC5 A;  3C9C A;  1K8K C;  4J0W A;  2CE9 A;  4FAV D;  3RFH A;  3IJ1 A;  3EI3 A;  3KRX B;  1OLZ A;  4A2L A;  4JD2 C;  3SJL D;  3UR4 A;  4CZY A;  3SHF A;  4CY2 A;  4A11 A;  3ULE C;  4CZX A;  4X3E A;  3UKU C;  4BUJ C;  4K3J B;  4A0B B;  2AGZ A;  1JMX B;  2P9N C;  2IWF A;  4J0X A;  3CFV A;  4BL0 A;  4FA5 D;  3BWS A;  3JZH A;  2OIZ A;  1R5M A;  5C2W B;  4D6V A;  3EI1 B;  3UVL A;  4PNK B;  3OW8 A;  4J81 A;  1TBG A;  1PEV A;  4GM9 A;  3JAM g;  5FKS A;  4O9D A;  2HXC A;  1FWX A;  3I7K A;  2H14 A;  4XEI C;  4A09 A;  2OJY A;  4FWW A;  5FKQ A;  2PM6 B;  1N6E A;  5HE1 B;  4CI1 A;  2Q7Q A;  2H9P A;  4A7J A;  3VH0 A;  1TYQ C;  2H47 A;  1GP2 B;  5CXC B;  2P9L C;  2OVQ B;  3DM0 A;  4CY3 A;  4N14 A;  4JT6 C;  4BH6 A;  2UZX B;  1U4C A;  5A2Q g;  5HQG A;  3EI2 B;  3NVX A;  4X61 B;  2H3X A;  3HFQ A;  3RFG A;  3DWL C;  2YB8 B;  3RSE C;  2AH0 A;  3F3G A;  4GMB A;  4PXW A;  5CYK B;  5EMK B;  1N6D A;  3PXT D;  3OL2 A;  2AGL A;  3SBR A;  2PM7 B;  3JRO A;  3OKY A;  5IJ7 E;  5IT9 g;  4ZN4 A;  2IWK A;  1XHM A;  2H68 A;  5IJ8 E;  3J81 g;  5B4W A;  5HE2 B;  3VGZ A;  4E54 B;  2I0R A;  3F3F A;  2OVR B;  2AGX A;  2J55 H;  4A2M A;  5FXY A;  4J87 A;  4XYH A;  5CXB B;  2HES X;  1VYH C;  4NSX A;  4QT8 A;  3I8C A;  4GM8 A;  2H13 A;  2XL3 A;  2G9A A;  2H9L A;  4L3H D;  3J80 g;  2HKM A;  3I7N A;  4Y5R D;  3SXT D;  2P9K C;  5GSA A;  5HE0 B;  3E0C A;  3UVK A;  3DXM C;  4MK0 B;  4J78 A;  5FLX g;  2O9K A;  4FB1 D;  3V7D B;  4FA9 D;  4ERQ A;  3JB9 L;  1ERJ A;  1Q47 A;  1YFQ A;  2B5M A;  3SBP A;  4GGA A;  5TEF A;  4ZOX A;  2Z2P A;  4LGN A;  3RN0 D;  2B5L A;  4IA9 A;  1NEX B;  3I7O A;  4CC9 A;  3UVN A;  5C2V B;  1MDA H;  5IGQ A;  2YNP A;  1PBY B;  2UZY B;  2PM9 B;  2CNX A;  3IIY A;  3SWS D;  5AJA A;  3KRW B;  1RI6 A;  3EG6 A;  4OWR A;  3EWE A;  1K32 A;  3PSC B;  4R7A B;  4JSV C;  2MTA H;  4J77 A;  4L3G D;  4IMM A;  4ERZ A;  2P9P C;  1P22 A;  5I5J A;  1N6F A;  3EU7 A;  1GG2 B;  2EBS A;  4O45 A;  2P9I C;  3OKT A;  3P4F A;  4FAN D;  5HYN B;  4FA4 D;  3SVW D;  3EMH A;  2HJ4 A;  4Y7R A;  4E5Z A;  3CIK B;  3AL8 B;  3N0E A;  5GXH A;  4O1Q D;  5EM2 A;  1L0Q A;  3SBQ A;  4O3U B;  5JWZ A;  4A0A B;  2AH1 A;  2H6Q A;  3PE7 A;  5IC7 A;  3PXS D;  1MG2 A;  1XKS A;  3UVM A;  3C99 A;  3GRE A;  4J79 A;  4GGC A;  3A0F A;  2J56 H;  3BG1 A;  1SHY B;  4H5I A;  4ZOY A;  3IKO A;  2BCJ B;  4L1Q D;  4A0B A;  2Z2O A;  3PXW D;  1A0R B;  2CO0 C;  1SQJ A;  2IUV A;  2PM9 A;  4U1E I;  3W15 A;  4A08 B;  2I0S A;  2OK4 A;  3EI4 B;  4PSW B;  4LG9 A;  5EAP A;  3MXX A;  2J57 G;  3EI1 A;  2B4E A;  4GM3 A;  3BG0 A;  5EML B;  4ERY A;  3PVW B;  4JSP C;  3UKR C;  2OK6 A;  4PC0 A;  3EI3 B;  4CZV A;  3GFC A;  1B9Y A;  4AEZ A;  5FKT A;  4L9O A;  2CN3 A;  3L4M D;  5I5I A;  3SMR A;  2HYE A;  2XU7 A;  2GNQ A;  4A11 B;  3AH8 B;  2W18 A;  2GC4 A;  5AFU 3;  3MKQ A;  2IUR A;  5H17 A;  2H9M A;  3FRX A;  5CXC A;  3JPX A;  3AFC A;  4J82 A;  3U4Y A;  2P9S C;  1PGU A;  4JSN C;  4CY5 A;  5GXI A;  4FA1 D;  5GMK n;  4GQB B;  4QQE A;  2XL2 A;  4X60 B;  4ESG A;  3EI2 A;  3L4O D;  3SCY A;  1MG3 A;  4AOW A;  3I89 A;  4OZU A;  3RLM D;  1B9X A;  4PSX B;  5TF2 A;  2BBK H;  4K3I D;  2I0T A;  5CYK A;  1JOF A;  3SLE D;  4I79 A;  3SFZ A;  3I8E A;  5IGO A;  5KDO B;  1QNI A;  2P9U C;  4EWR A;  4JT5 C;  1NR0 A;  5FQD A;  4U7A A;  1SQ9 A;  5TEE A;  2YMU A;  2CO0 A;  4E54 A;  4ZOZ A;  5EAM A; 
#chains in the Genus database with same CATH topology
 3VI4 A;  4GGD A;  5EMJ B;  3K6S A;  3EQ9 A;  4ZOV A;  4XYI A;  2YNO A;  1GOT B;  3V5W B;  4DNW A;  3GC3 B;  4JSX C;  4J84 A;  3I7H A;  3MKS B;  4HDJ A;  3NVQ A;  4O3T B;  5CXB A;  1U2V C;  4QAM A;  4J8G A;  3OL2 B;  4X63 B;  1C9I A;  3JZG A;  4ES0 A;  3PVU B;  5FKR A;  4FHL A;  2TRC B;  3IUL A;  1JMZ B;  3OKY B;  3QHY B;  3IUQ A;  5M61 A;  5M5S A;  4H5J A;  3K27 A;  2IUP A;  3ODT A;  4LG8 A;  3DXK C;  3OKW A;  4TZ4 A;  5K19 A;  3IUM A;  1OMW B;  3K26 A;  2I3S A;  4QRJ A;  3IIW A;  2VC2 A;  3SN6 B;  2B5N A;  4CI3 A;  3V4P A;  5K1C C;  2QZP A;  3AL9 A;  4G56 B;  1H2X A;  3I7L A;  4GZ8 A;  1BPO A;  5EAR A;  4DNV A;  3JRP A;  4BCB A;  4CI8 A;  5HDB A;  3RMZ D;  2Z2N A;  4J86 A;  3B7F A;  5E6R A;  5C9Z B;  3PSL A;  3IJ0 A;  3NVN A;  2IAA A;  3I7P A;  4Z7Q A;  3ZE0 A;  3CFS B;  2I3T A;  4D0K A;  4J73 A;  2YBA A;  1XIP A;  1GXR A;  4YVD A;  3VA6 A;  2G99 A;  3FM0 A;  4PBY A;  3V9F A;  3ZWL B;  3RN1 D;  5H14 A;  2PBI B;  4PBZ A;  5SXM A;  3MZL A;  1YR2 A;  3N0D A;  4KFM B;  2VDO A;  1O6G A;  3IJC A;  4JXM A;  2EID A;  3QI0 A;  4AMZ A;  5EAL A;  4GQ2 P;  1I2M B;  3NID A;  3AL8 A;  2OVP B;  1S4U X;  1PI6 A;  4J8B A;  5THA A;  2CN2 A;  3F3P A;  3I2N A;  5M5R A;  1H2Z A;  4A0A A;  2H6N A;  3ORV D;  2GC7 A;  3OTT A;  3MZK A;  3RRM C;  1JJU B;  4G1E A;  3EQ7 A;  2H9N A;  3C5M A;  2AGW A;  4CI2 A;  4GQ1 A;  2AQ5 A;  2CE8 A;  2BKL A;  2AGY A;  2HJB A;  3C75 H;  4A09 B;  5I5M A;  3DSM A;  4G55 A;  3UVO A;  4AN0 A;  5FA5 B;  3MMY A;  3FCS A;  2H6K A;  4E5Z B;  3JZN A;  4A08 A;  3EI4 A;  4Z8L A;  2XYI A;  4CY1 A;  2YNN A;  4MMX A;  2HKR A;  5EMM B;  5H1M A;  5EM2 B;  5AMS A;  2JKX A;  2IUQ A;  3FGB A;  4L1M A;  1UTC A;  3NIF A;  2QXV A;  5TDH B;  3T3P A;  4QL1 A;  2HU5 A;  5HE3 B;  4UI9 R;  2QC5 A;  3C9C A;  1K8K C;  4J0W A;  2CE9 A;  4FAV D;  3RFH A;  3IJE A;  3IJ1 A;  3EI3 A;  3KRX B;  1OLZ A;  4A2L A;  4JD2 C;  3SJL D;  3UR4 A;  4WK2 A;  4CZY A;  3IUJ A;  3SHF A;  4CY2 A;  4A11 A;  3IVM A;  3ULE C;  4CZX A;  1VZ2 A;  4X3E A;  3UKU C;  4BUJ C;  4K3J B;  4UM8 A;  2VZ3 A;  4A0B B;  2AGZ A;  2HU7 A;  1JMX B;  2P9N C;  2IWF A;  4J0X A;  3CFV A;  4BL0 A;  4FA5 D;  3BWS A;  3JZH A;  2OIZ A;  1QFM A;  1R5M A;  1E5T A;  5C2W B;  4D6V A;  3EI1 B;  3EQ8 A;  3UVL A;  4PNK B;  3OW8 A;  1UOP A;  4J81 A;  1VE6 A;  1TBG A;  1PEV A;  4GM9 A;  3JAM g;  5FKS A;  4O9D A;  2HXC A;  1FWX A;  3I7K A;  2H14 A;  4XEI C;  4A09 A;  2OJY A;  4FWW A;  5FKQ A;  2PM6 B;  3MUO A;  1N6E A;  5HE1 B;  4CI1 A;  3O4G A;  2Q7Q A;  1H2Y A;  4MMY A;  4Z7N A;  2H9P A;  4A7J A;  3VH0 A;  1TYQ C;  2H47 A;  1GP2 B;  5CXC B;  2XE4 A;  2P9L C;  2OVQ B;  2VDP A;  3DM0 A;  4BCC A;  2EIB A;  4CY3 A;  3ZDX A;  4N14 A;  4JT6 C;  4AN1 A;  1L5G A;  4BH6 A;  2UZX B;  4AMY A;  1U4C A;  5A2Q g;  4JHP C;  3DDU A;  4WK4 A;  1T2X A;  5HQG A;  3O4H A;  3NVX A;  3EI2 B;  4X61 B;  2H3X A;  1H2W A;  3HFQ A;  4NC4 A;  3RFG A;  3DWL C;  2YB8 B;  1K3I A;  3RSE C;  3IUN A;  2AH0 A;  3F3G A;  4GMB A;  4PXW A;  5CYK B;  5EMK B;  1N6D A;  3PXT D;  3OL2 A;  4DNU A;  2AGL A;  5C92 A;  3SBR A;  3ZDY A;  2PM7 B;  3JRO A;  3OKY A;  5IJ7 E;  5IT9 g;  4ZN4 A;  1O6F A;  2IWK A;  1XHM A;  2H68 A;  5C86 A;  5IJ8 E;  3J81 g;  5B4W A;  1GOG A;  2XZG A;  4O2W A;  5HE2 B;  3VGZ A;  4E54 B;  2I0R A;  4BP8 A;  3F3F A;  2OVR B;  2AGX A;  2J55 H;  4A2M A;  1E8N A;  3MUN A;  5FXY A;  4J87 A;  4XYH A;  3K72 A;  5CXB B;  2HES X;  1VYH C;  4NSX A;  4QT8 A;  3I8C A;  4GM8 A;  2VDQ A;  2H13 A;  2XL3 A;  2G9A A;  2H9L A;  4L3H D;  3J80 g;  2HKM A;  3I7N A;  4Y5R D;  3SXT D;  2P9K C;  5GSA A;  5HE0 B;  3E0C A;  3UVK A;  3DXM C;  4MK0 B;  4J78 A;  5FLX g;  2O9K A;  3T3M A;  4FB1 D;  3V7D B;  4FA9 D;  4ERQ A;  3VI3 A;  3JB9 L;  4WK0 A;  1ERJ A;  1Q47 A;  1YFQ A;  2B5M A;  3SBP A;  4GGA A;  5TEF A;  1GOF A;  2Z2P A;  4ZOX A;  4LGN A;  3RN0 D;  2B5L A;  4IA9 A;  1NEX B;  3I7O A;  4CC9 A;  3MVD K;  3UVN A;  3NIG A;  5C2V B;  1UOO A;  1MDA H;  2EIE A;  5IGQ A;  2YNP A;  3O4J A;  1PBY B;  2UZY B;  2PM9 B;  1E8M A;  2CNX A;  1C9L A;  2VZ1 A;  3IIY A;  3SWS D;  5AJA A;  3KRW B;  2VDK A;  1RI6 A;  3EG6 A;  4OWR A;  5M5U A;  3EWE A;  1K32 A;  1VE7 A;  3PSC B;  3ZE1 A;  3K71 A;  4R7A B;  1U8C A;  5FFO A;  4JSV C;  1M1X A;  2MTA H;  4J77 A;  3ZDZ A;  4L3G D;  4IMM A;  4ERZ A;  2P9P C;  1QFS A;  1P22 A;  5I5J A;  1N6F A;  2WQ8 A;  3EU7 A;  5E6U A;  1GG2 B;  2EBS A;  4O45 A;  4BCD A;  2P9I C;  3OKT A;  3P4F A;  4G1M A;  4FAN D;  5HYN B;  1VZ3 A;  4FA4 D;  3SVW D;  2VDR A;  3EMH A;  3GD1 I;  2HJ4 A;  4Y7R A;  4E5Z A;  3CIK B;  3AL8 B;  4AX4 A;  3N0E A;  5GXH A;  4O1Q D;  5EM2 A;  2HU8 A;  1L0Q A;  3SBQ A;  4O3U B;  5JWZ A;  4A0A B;  2AH1 A;  1JV2 A;  2H6Q A;  3PE7 A;  5IC7 A;  3PXS D;  1MG2 A;  1XKS A;  3UVM A;  3C99 A;  3GRE A;  4J79 A;  1UOQ A;  4GGC A;  3A0F A;  4RE6 A;  4WJK A;  2J56 H;  3BG1 A;  1SHY B;  4H5I A;  4ZOY A;  4NAA A;  3IKO A;  2BCJ B;  3KCI A;  4L1Q D;  4A0B A;  2Z2O A;  3PXW D;  2VDL A;  1A0R B;  2CO0 C;  1SQJ A;  2IUV A;  2PM9 A;  4U1E I;  3W15 A;  4A08 B;  2I0S A;  2OK4 A;  3EI4 B;  4PSW B;  4LG9 A;  5EAP A;  3MXX A;  2J57 G;  3EI1 A;  2B4E A;  4GM3 A;  2QR5 A;  3BG0 A;  5EML B;  2EIC A;  3ZE2 A;  4ERY A;  3PVW B;  4JSP C;  2VDN A;  4IRZ A;  4Z7O A;  4NEN A;  3UKR C;  2OK6 A;  4PC0 A;  3EI3 B;  4CZV A;  3GFC A;  1B9Y A;  4AEZ A;  5FKT A;  4L9O A;  3IUR A;  2CN3 A;  3L4M D;  5I5I A;  3SMR A;  2HYE A;  2XU7 A;  2GNQ A;  4JHN A;  4A11 B;  2VDM A;  3AH8 B;  2W18 A;  2GC4 A;  5AFU 3;  3MKQ A;  2IUR A;  4UM9 A;  3V4V A;  5H17 A;  2H9M A;  3FRX A;  5CXC A;  3JPX A;  3AFC A;  4J82 A;  4BP9 A;  3U4Y A;  1GOH A;  2P9S C;  1PGU A;  4JSN C;  1JTD B;  4CY5 A;  2XDW A;  5GXI A;  4FA1 D;  5GMK n;  4GQB B;  4QQE A;  2XL2 A;  4RE5 A;  4X60 B;  4ESG A;  3EI2 A;  3L4O D;  3OF7 A;  5M5V A;  3SCY A;  1MG3 A;  4AOW A;  3I89 A;  1A12 A;  4OZU A;  3RLM D;  1B9X A;  4PSX B;  5TF2 A;  2BBK H;  4K3I D;  2I0T A;  5CYK A;  1JOF A;  3O4I A;  4NBM A;  3SLE D;  4O02 A;  5M5T A;  4I79 A;  3SFZ A;  3I8E A;  5IGO A;  3FCU A;  5KDO B;  1QNI A;  2P9U C;  4EWR A;  4JT5 C;  1NR0 A;  5FQD A;  4U7A A;  1SQ9 A;  5TEE A;  2YMU A;  5E6S A;  2CO0 A;  1TYE A;  4D9S A;  5FFG A;  4MMZ A;  4E54 A;  4ZOZ A;  5EAM A; 
#chains in the Genus database with same CATH homology
 4GGD A;  5EMJ B;  4ZOV A;  4XYI A;  2YNO A;  1GOT B;  3V5W B;  4JSX C;  4J84 A;  3I7H A;  3MKS B;  4HDJ A;  3NVQ A;  4O3T B;  5CXB A;  1U2V C;  4J8G A;  3OL2 B;  4X63 B;  3JZG A;  4ES0 A;  3PVU B;  5FKR A;  4FHL A;  2TRC B;  1JMZ B;  3OKY B;  4H5J A;  3K27 A;  2IUP A;  3ODT A;  4LG8 A;  3DXK C;  3OKW A;  4TZ4 A;  5K19 A;  1OMW B;  3K26 A;  2I3S A;  4QRJ A;  3IIW A;  3SN6 B;  2B5N A;  4CI3 A;  5K1C C;  3AL9 A;  4G56 B;  3I7L A;  4GZ8 A;  5EAR A;  3JRP A;  4CI8 A;  3RMZ D;  2Z2N A;  4J86 A;  3B7F A;  5C9Z B;  3PSL A;  3IJ0 A;  3NVN A;  2IAA A;  3I7P A;  3CFS B;  2I3T A;  4D0K A;  4J73 A;  2YBA A;  1XIP A;  1GXR A;  4YVD A;  3VA6 A;  2G99 A;  3FM0 A;  4PBY A;  3V9F A;  3ZWL B;  3RN1 D;  5H14 A;  2PBI B;  4PBZ A;  5SXM A;  3MZL A;  3N0D A;  4KFM B;  3IJC A;  4JXM A;  5EAL A;  4GQ2 P;  3AL8 A;  2OVP B;  1S4U X;  1PI6 A;  4J8B A;  5THA A;  2CN2 A;  3F3P A;  3I2N A;  4A0A A;  2H6N A;  3ORV D;  2GC7 A;  3OTT A;  3MZK A;  3RRM C;  1JJU B;  2H9N A;  3C5M A;  2AGW A;  4CI2 A;  4GQ1 A;  2AQ5 A;  2CE8 A;  2AGY A;  2HJB A;  3C75 H;  4A09 B;  5I5M A;  3DSM A;  3UVO A;  5FA5 B;  3MMY A;  2H6K A;  4E5Z B;  3JZN A;  4A08 A;  3EI4 A;  4Z8L A;  2XYI A;  4CY1 A;  2YNN A;  5EMM B;  2HKR A;  5H1M A;  5EM2 B;  5AMS A;  2IUQ A;  3FGB A;  5TDH B;  2QXV A;  4QL1 A;  5HE3 B;  4UI9 R;  2QC5 A;  3C9C A;  1K8K C;  4J0W A;  2CE9 A;  4FAV D;  3RFH A;  3IJ1 A;  3EI3 A;  3KRX B;  1OLZ A;  4A2L A;  4JD2 C;  3SJL D;  3UR4 A;  4CZY A;  3SHF A;  4CY2 A;  4A11 A;  3ULE C;  4CZX A;  4X3E A;  3UKU C;  4BUJ C;  4K3J B;  4A0B B;  2AGZ A;  1JMX B;  2P9N C;  2IWF A;  4J0X A;  3CFV A;  4BL0 A;  4FA5 D;  3BWS A;  3JZH A;  2OIZ A;  1R5M A;  5C2W B;  4D6V A;  3EI1 B;  3UVL A;  4PNK B;  3OW8 A;  4J81 A;  1TBG A;  1PEV A;  4GM9 A;  3JAM g;  5FKS A;  4O9D A;  2HXC A;  1FWX A;  3I7K A;  2H14 A;  4XEI C;  4A09 A;  2OJY A;  4FWW A;  5FKQ A;  2PM6 B;  1N6E A;  5HE1 B;  4CI1 A;  2Q7Q A;  2H9P A;  4A7J A;  3VH0 A;  1TYQ C;  2H47 A;  1GP2 B;  5CXC B;  2P9L C;  2OVQ B;  3DM0 A;  4CY3 A;  4N14 A;  4JT6 C;  4BH6 A;  2UZX B;  1U4C A;  5A2Q g;  5HQG A;  3EI2 B;  3NVX A;  4X61 B;  2H3X A;  3HFQ A;  3RFG A;  3DWL C;  2YB8 B;  3RSE C;  2AH0 A;  3F3G A;  4GMB A;  4PXW A;  5CYK B;  5EMK B;  1N6D A;  3PXT D;  3OL2 A;  2AGL A;  3SBR A;  2PM7 B;  3JRO A;  3OKY A;  5IJ7 E;  5IT9 g;  4ZN4 A;  2IWK A;  1XHM A;  2H68 A;  5IJ8 E;  3J81 g;  5B4W A;  5HE2 B;  3VGZ A;  4E54 B;  2I0R A;  3F3F A;  2OVR B;  2AGX A;  2J55 H;  4A2M A;  5FXY A;  4J87 A;  4XYH A;  5CXB B;  2HES X;  1VYH C;  4NSX A;  4QT8 A;  3I8C A;  4GM8 A;  2H13 A;  2XL3 A;  2G9A A;  2H9L A;  4L3H D;  3J80 g;  2HKM A;  3I7N A;  4Y5R D;  3SXT D;  2P9K C;  5GSA A;  5HE0 B;  3E0C A;  3UVK A;  3DXM C;  4MK0 B;  4J78 A;  5FLX g;  2O9K A;  4FB1 D;  3V7D B;  4FA9 D;  4ERQ A;  3JB9 L;  1ERJ A;  1Q47 A;  1YFQ A;  2B5M A;  3SBP A;  4GGA A;  5TEF A;  4ZOX A;  2Z2P A;  4LGN A;  3RN0 D;  2B5L A;  4IA9 A;  1NEX B;  3I7O A;  4CC9 A;  3UVN A;  5C2V B;  1MDA H;  5IGQ A;  2YNP A;  1PBY B;  2UZY B;  2PM9 B;  2CNX A;  3IIY A;  3SWS D;  5AJA A;  3KRW B;  1RI6 A;  3EG6 A;  4OWR A;  3EWE A;  1K32 A;  3PSC B;  4R7A B;  4JSV C;  2MTA H;  4J77 A;  4L3G D;  4IMM A;  4ERZ A;  2P9P C;  1P22 A;  5I5J A;  1N6F A;  3EU7 A;  1GG2 B;  2EBS A;  4O45 A;  2P9I C;  3OKT A;  3P4F A;  4FAN D;  5HYN B;  4FA4 D;  3SVW D;  3EMH A;  2HJ4 A;  4Y7R A;  4E5Z A;  3CIK B;  3AL8 B;  3N0E A;  5GXH A;  4O1Q D;  5EM2 A;  1L0Q A;  3SBQ A;  4O3U B;  5JWZ A;  4A0A B;  2AH1 A;  2H6Q A;  3PE7 A;  5IC7 A;  3PXS D;  1MG2 A;  1XKS A;  3UVM A;  3C99 A;  3GRE A;  4J79 A;  4GGC A;  3A0F A;  2J56 H;  3BG1 A;  1SHY B;  4H5I A;  4ZOY A;  3IKO A;  2BCJ B;  4L1Q D;  4A0B A;  2Z2O A;  3PXW D;  1A0R B;  2CO0 C;  1SQJ A;  2IUV A;  2PM9 A;  4U1E I;  3W15 A;  4A08 B;  2I0S A;  2OK4 A;  3EI4 B;  4PSW B;  4LG9 A;  5EAP A;  3MXX A;  2J57 G;  3EI1 A;  2B4E A;  4GM3 A;  3BG0 A;  5EML B;  4ERY A;  3PVW B;  4JSP C;  3UKR C;  2OK6 A;  4PC0 A;  3EI3 B;  4CZV A;  3GFC A;  1B9Y A;  4AEZ A;  5FKT A;  4L9O A;  2CN3 A;  3L4M D;  5I5I A;  3SMR A;  2HYE A;  2XU7 A;  2GNQ A;  4A11 B;  3AH8 B;  2W18 A;  2GC4 A;  5AFU 3;  3MKQ A;  2IUR A;  5H17 A;  2H9M A;  3FRX A;  5CXC A;  3JPX A;  3AFC A;  4J82 A;  3U4Y A;  2P9S C;  1PGU A;  4JSN C;  4CY5 A;  5GXI A;  4FA1 D;  5GMK n;  4GQB B;  4QQE A;  2XL2 A;  4X60 B;  4ESG A;  3EI2 A;  3L4O D;  3SCY A;  1MG3 A;  4AOW A;  3I89 A;  4OZU A;  3RLM D;  1B9X A;  4PSX B;  5TF2 A;  2BBK H;  4K3I D;  2I0T A;  5CYK A;  1JOF A;  3SLE D;  4I79 A;  3SFZ A;  3I8E A;  5IGO A;  5KDO B;  1QNI A;  2P9U C;  4EWR A;  4JT5 C;  1NR0 A;  5FQD A;  4U7A A;  1SQ9 A;  5TEE A;  2YMU A;  2CO0 A;  4E54 A;  4ZOZ A;  5EAM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...