4J78A

Crystal structure of beta'-cop/emp47p complex
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
300
structure length
300
Chain Sequence
KLDIKKTFSNRSDRVKGIDFHPTEPWVLTTLYSGRVEIWNYETQVEVRSIQVTETPVRAGKFIARKNWIIVGSDDFRIRVFNYNTGEKVVDFEAHPDYIRSIAVHPTKPYVLSGSDDLTVKLWNWENNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDRTVKVWSLGQSTPNFTLTTGQERGVNYVDYYPLPDKPYMITASDDLTIKIWDYQTKSCVATLEGHMSNVSFAVFHPTLPIIISGSEDGTLKIWNSSTYKVEKTLNVGLERSWCIATHPTGRKNYIASGFDNGFTVLSLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Coatomer subunit beta'
publication title Rules for the recognition of dilysine retrieval motifs by coatomer.
pubmed doi rcsb
total genus 89
structure length 300
sequence length 300
ec nomenclature
pdb deposition date 2013-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4j78A01
1SQJA 1OLZA 5I5JA 1N6EA 3I2NA 4O3TB 4L3GD 2W18A 5KDOB 2PM9A 5B4WA 3I7KA 4UI9R 3EI4B 2H3XA 4ES0A 5AMSA 4JSPC 2AQ5A 4J87A 4Y7RA 4E5ZB 4J8GA 2H14A 3PXSD 4J82A 1GP2B 4ZOYA 4CZVA 4N14A 2BBKH 1PEVA 3SBRA 4MK0B 2PM9B 5FLXg 3JZHA 4O45A 1MG2A 3EI2B 4XYHA 4A08A 3BG1A 2YNOA 2P9PC 4QT8A 5EAPA 4TZ4A 3SVWD 2XL3A 3SMRA 3MZLA 3EI1A 3ULEC 4AEZA 3RSEC 3BWSA 4GGAA 4J86A 5CXBA 4FA4D 4FA5D 4XYIA 4ZOXA 1JJUB 3JB9L 1B9YA 4PXWA 4A08B 3DWLC 4A2LA 5GXIA 4CY2A 4K3ID 4JSNC 2I0SA 5CYKA 5K19A 4JSXC 4I79A 3EI1B 4IA9A 5GXHA 3MZKA 1YFQA 5HQGA 3AH8B 3I7OA 3MKSB 3UR4A 1XKSA 5EAMA 3ZWLB 4EWRA 4CI8A 1U4CA 5CXBB 1JMZB 3IIYA 2IUPA 4A0BA 2HKMA 2IUQA 4K3JB 3GREA 5GSAA 3SCYA 3VH0A 4U7AA 2B5LA 2AGXA 2YBAA 1RI6A 4PBYA 3NVQA 3J81g 2OVQB 2AGWA 3PSLA 3OKYA 3UVNA 4GM3A 2HXCA 3F3PA 1B9XA 3ORVD 4J77A 2G9AA 4A0BB 3E0CA 2G99A 3B7FA 3DM0A 4YVDA 4XEIC 2MTAH 1U2VC 3PVUB 4ESGA 4ERYA 3EG6A 1K8KC 5C9ZB 4X63B 4GM8A 3EWEA 2J55H 5K1CC 1L0QA 3I7PA 5H14A 4CY5A 4ERZA 4ZN4A 1SQ9A 5TF2A 3J80g 4G56B 3SLED 5I5IA 2UZYB 3CFVA 2Q7QA 4FB1D 4JT6C 4KFMB 5EMMB 1P22A 4J78A 4BUJC 5HYNB 4JT5C 3DSMA 2IURA 3KRWB 3I7LA 4J73A 1SHYB 2CO0A 2OK4A 4BH6A 3RRMC 4LG8A 4FWWA 1MDAH 5EMLB 2CE9A 2Z2OA 1XHMA 3FM0A 3PE7A 3V9FA 4Y5RD 3DXKC 5IJ7E 3A0FA 4CI3A 3F3GA 4GGDA 4J79A 4ZOVA 2AGLA 4O9DA 5EARA 5EMKB 5HE2B 3SWSD 2OK6A 2I0TA 5H1MA 3OKWA 4A09A 1VYHC 3GFCA 2YNPA 4J84A 3EI3A 3MXXA 3C99A 5TEFA 1TBGA 3IJCA 3SFZA 3IKOA 4PNKB 4CC9A 4HDJA 3K27A 3JZNA 1S4UX 1PBYB 3I7NA 5EM2A 4QQEA 3EU7A 3ODTA 2PM6B 2GC4A 2CO0C 4A09B 3C5MA 3SBQA 2GNQA 3EI3B 3RN0D 4JXMA 4IMMA 4X3EA 3VA6A 4PSWB 4GMBA 2H6KA 2J56H 3V5WB 5IC7A 3I8EA 2H9LA 5HE0B 4OWRA 4ZOZA 5H17A 2H13A 3DXMC 5CYKB 3I8CA 2P9KC 5FKQA 3U4YA 2AGZA 5FQDA 4J0WA 3PXWD 4A0AA 3PSCB 1PI6A 5FA5B 4U1EI 2H9MA 3FRXA 2I3SA 4BL0A 3MMYA 3SXTD 2XU7A 2H47A 2P9IC 2YB8B 5TEEA 3RFGA 3C75H 3HFQA 3SJLD 2O9KA 2QXVA 2HJ4A 3OW8A 3SHFA 2AH0A 4A0AB 3OL2A 3OKYB 5FKRA 3C9CA 4LG9A 3L4OD 2B5MA 5IT9g 3CFSB 5IGQA 1NEXB 1JMXB 2OVRB 3UKUC 3AFCA 3RFHA 3PXTD 4ERQA 4FA1D 4GGCA 4A2MA 2YMUA 3JROA 2HKRA 2Z2PA 2I3TA 3IJ0A 4PBZA 4R7AB 3JAMg 2XL2A 4H5JA 3OL2B 5AJAA 2OJYA 4JSVC 4GQBB 4GQ2P 4L9OA 3FGBA 5AFU3 2P9SC 4PC0A 3VGZA 3N0DA 1GG2B 1N6DA 4QRJA 5FKTA 4A7JA 3IJ1A 3EI2A 2PBIB 5GMKn 3AL8A 2IWFA 2IUVA 3I89A 2J57G 2H68A 5FKSA 2H9NA 2AH1A 5THAA 3JPXA 2H9PA 2CNXA 1OMWB 4D6VA 4O3UB 5HE1B 3RN1D 1N6FA 5FXYA 4CZXA 5I5MA 2XYIA 3I7HA 4X60B 4X61B 3PVWB 1MG3A 1ERJA 4CZYA 3AL8B 4FAND 4A11A 2PM7B 3P4FA 2QC5A 2HESX 5EALA 1GXRA 4J8BA 1GOTB 3AL9A 2P9UC 3OKTA 2CN3A 4NSXA 3UVMA 2P9LC 4CI1A 2I0RA 1R5MA 2UZXB 5SXMA 1Q47A 2B4EA 4O1QD 5JWZA 3JZGA 3RLMD 3UVOA 3CIKB 5A2Qg 1K32A 3UKRC 4FA9D 4CY1A 4A11B 3BG0A 3SN6B 5EM2B 2AGYA 3N0EA 3NVXA 3OTTA 4LGNA 5HE3B 4E54A 2OVPB 4CY3A 4GZ8A 3SBPA 3UVKA 5EMJB 2YNNA 4Z8LA 4J0XA 1XIPA 3MKQA 3NVNA 2B5NA 4L3HD 4PSXB 1PGUA 3L4MD 4FHLA 2HYEA 1JOFA 5TDHB 1TYQC 4L1QD 4CI2A 2Z2NA 2IAAA 5C2VB 2H6NA 5CXCA 4OZUA 4JD2C 2IWKA 4H5IA 3K26A 1QNIA 3V7DB 4E54B 2P9NC 2BCJB 2CN2A 1FWXA 4J81A 3W15A 4D0KA 2H6QA 3JRPA 4QL1A 2OIZA 3KRXB 4GM9A 3UVLA 5IJ8E 2TRCB 5IGOA 4FAVD 3EI4A 2GC7A 5C2WB 2CE8A 2HJBA 5CXCB 3IIWA 1NR0A 3RMZD 3F3FA 4GQ1A 4AOWA 1A0RB 2EBSA 4E5ZA 3EMHA
chains in the Genus database with same CATH superfamily
1SQJA 1OLZA 5I5JA 1N6EA 3I2NA 4O3TB 4L3GD 2W18A 5KDOB 3IULA 2PM9A 3ZDXA 4BP8A 5B4WA 2XE4A 4QAMA 3I7KA 4UI9R 1GOGA 3EI4B 2H3XA 4ES0A 2EIEA 5AMSA 4JSPC 2AQ5A 2VDLA 4J87A 4Y7RA 1GOHA 4E5ZB 4J8GA 2H14A 3PXSD 4J82A 1GP2B 4DNVA 4ZOYA 4CZVA 4N14A 2BBKH 2VDQA 3T3PA 1PEVA 3SBRA 4MK0B 2PM9B 4BCCA 4O02A 5FLXg 3JZHA 4O45A 1MG2A 3V4PA 3EI2B 4XYHA 1A12A 1UTCA 4A08A 3BG1A 2YNOA 2P9PC 3KCIA 4QT8A 2BKLA 5EAPA 4TZ4A 4AX4A 3SVWD 4WK4A 2XL3A 3SMRA 3MZLA 3EI1A 3ULEC 4G1MA 4AEZA 4D9SA 3RSEC 3BWSA 3NIFA 4GGAA 4J86A 3ZE2A 5FFOA 5CXBA 4FA4D 4FA5D 4XYIA 4ZOXA 1JJUB 3JB9L 4BCBA 1B9YA 4PXWA 4A08B 3DWLC 4A2LA 5GXIA 4CY2A 4K3ID 4JSNC 2I0SA 5CYKA 5K19A 4JSXC 4I79A 3EI1B 2VDPA 4IA9A 5GXHA 3MZKA 1YFQA 5HQGA 3AH8B 3I7OA 3MKSB 4RE6A 1XKSA 3UR4A 5EAMA 3ZWLB 4WJKA 4EWRA 4CI8A 1U4CA 5CXBB 1JMZB 3IIYA 2IUPA 4A0BA 2HKMA 2IUQA 3QI0A 4K3JB 4O2WA 3GREA 5GSAA 3SCYA 3VH0A 4U7AA 2B5LA 2AGXA 4G1EA 2YBAA 1RI6A 4PBYA 3NVQA 3J81g 2OVQB 2HU5A 2QZPA 1E8NA 2AGWA 3FCSA 3PSLA 3OKYA 3UVNA 4GM3A 2HXCA 2HU7A 3F3PA 1B9XA 3ORVD 4J77A 2XDWA 3IUNA 1E5TA 2G9AA 3E0CA 4A0BB 4WK2A 1VE7A 2G99A 3B7FA 3DM0A 4YVDA 4XEIC 1H2YA 2MTAH 1U2VC 3PVUB 4ESGA 4ERYA 3EG6A 1K8KC 5C9ZB 4X63B 4GM8A 3EWEA 5C92A 2J55H 5K1CC 1L0QA 3QHYB 4NC4A 3I7PA 5H14A 4CY5A 4ERZA 4ZN4A 1SQ9A 5TF2A 3J80g 3K6SA 4G56B 3SLED 1UOQA 5I5IA 2UZYB 3CFVA 2Q7QA 4FB1D 4AMZA 4JT6C 1C9IA 4KFMB 3GD1I 1QFMA 5EMMB 1P22A 4J78A 4BUJC 1T2XA 5HYNB 4JT5C 3IUQA 3DSMA 2IURA 3KRWB 2VDMA 5FFGA 3I7LA 4J73A 3K71A 5M5RA 4JHPC 1SHYB 2CO0A 2OK4A 4BH6A 3RRMC 4LG8A 4FWWA 1MDAH 5EMLB 2CE9A 2Z2OA 1XHMA 3FM0A 3PE7A 3V9FA 4Y5RD 3DXKC 5IJ7E 3A0FA 1VZ3A 4CI3A 3F3GA 4GGDA 4J79A 4ZOVA 2AGLA 4O9DA 5EARA 5EMKB 2EIBA 5HE2B 3MUNA 3SWSD 2OK6A 2I0TA 1L5GA 1TYEA 5H1MA 3OKWA 4A09A 1VYHC 3GFCA 2YNPA 4J84A 3EI3A 3IVMA 3MXXA 3C99A 4Z7NA 5TEFA 1TBGA 3IJCA 3SFZA 3IKOA 4NENA 3VI3A 4PNKB 1UOPA 3OF7A 1E8MA 1VZ2A 4CC9A 4HDJA 3K27A 3JZNA 1S4UX 1PBYB 3I7NA 5EM2A 4MMZA 4QQEA 3EU7A 4BCDA 3ODTA 3ZDZA 2PM6B 2GC4A 5M61A 3ZDYA 2CO0C 4A09B 3C5MA 3ZE1A 3SBQA 2GNQA 3EI3B 2EICA 3RN0D 4JXMA 4AMYA 4IMMA 3K72A 4X3EA 3VA6A 3DDUA 4PSWB 2VDNA 1YR2A 3EQ9A 4GMBA 2H6KA 2J56H 3V5WB 5IC7A 3O4HA 3I8EA 2H9LA 5HE0B 4OWRA 4ZOZA 5H17A 2H13A 3DXMC 5CYKB 4JHNA 3I8CA 2P9KC 5FKQA 3U4YA 2AGZA 5FQDA 4J0WA 4UM9A 3PXWD 4A0AA 3PSCB 1PI6A 3EQ8A 3IUJA 5FA5B 4U1EI 2H9MA 3FRXA 2I3SA 4BL0A 3MMYA 3O4JA 3SXTD 1O6GA 2XU7A 2H47A 4MMYA 2VZ3A 2P9IC 2YB8B 5TEEA 2VDOA 3RFGA 3C75H 3HFQA 3SJLD 2O9KA 2QXVA 1UOOA 1JV2A 2HJ4A 2WQ8A 3OW8A 1O6FA 5M5TA 3SHFA 2AH0A 4A0AB 3OL2A 1H2ZA 3OKYB 5FKRA 3C9CA 4LG9A 3T3MA 3L4OD 2B5MA 5IT9g 3CFSB 5IGQA 1GOFA 1NEXB 1JMXB 2OVRB 3UKUC 3AFCA 3RFHA 3PXTD 4ERQA 4FA1D 4GGCA 4A2MA 4WK0A 2YMUA 3JROA 2HKRA 3GC3B 1QFSA 3NIGA 2Z2PA 2I3TA 3IJ0A 2JKXA 4PBZA 4R7AB 3JAMg 4RE5A 2VZ1A 2XL2A 3O4IA 4H5JA 3OL2B 5AJAA 4IRZA 2OJYA 4JSVC 4GQBB 4GQ2P 4L9OA 3FGBA 4DNUA 5AFU3 2P9SC 5HDBA 3MVDK 4PC0A 5E6SA 3VGZA 3VI4A 3N0DA 1GG2B 1N6DA 4QRJA 5FKTA 4A7JA 3IJ1A 4AN0A 3EI2A 2PBIB 5GMKn 3AL8A 2IWFA 5M5VA 2IUVA 4NBMA 3I89A 2J57G 4MMXA 3IJEA 2H68A 5E6RA 5FKSA 2H9NA 5E6UA 2AH1A 5THAA 3JPXA 2H9PA 2CNXA 1M1XA 1OMWB 4D6VA 4O3UB 3V4VA 5HE1B 3RN1D 1JTDB 1N6FA 2VDRA 5FXYA 2VDKA 4CZXA 5I5MA 2XYIA 3I7HA 4X60B 4X61B 3PVWB 1MG3A 1ERJA 4CZYA 3AL8B 3IUMA 4FAND 4A11A 2PM7B 3P4FA 2QC5A 2HESX 5EALA 1GXRA 3MUOA 4J8BA 1GOTB 3AL9A 2P9UC 3OKTA 4Z7QA 2CN3A 4NSXA 3UVMA 2P9LC 4CI1A 2I0RA 5C86A 1VE6A 1R5MA 2UZXB 1C9LA 4L1MA 5SXMA 4G55A 2VC2A 1Q47A 2B4EA 4O1QD 5JWZA 3JZGA 3RLMD 3UVOA 1H2XA 3CIKB 5A2Qg 1K32A 3UKRC 1K3IA 4FA9D 4CY1A 4A11B 5M5UA 3BG0A 3SN6B 5EM2B 2AGYA 3N0EA 3NVXA 3OTTA 4LGNA 5HE3B 4E54A 4Z7OA 2OVPB 3EQ7A 3FCUA 4CY3A 4GZ8A 3SBPA 3UVKA 5EMJB 2HU8A 2YNNA 4UM8A 4Z8LA 4J0XA 1I2MB 1XIPA 3ZE0A 3MKQA 3NVNA 2B5NA 4L3HD 4PSXB 1PGUA 3L4MD 4FHLA 2XZGA 2HYEA 1JOFA 5TDHB 1BPOA 1TYQC 1H2WA 2Z2NA 4L1QD 4CI2A 3IURA 4DNWA 2IAAA 5C2VB 4NAAA 2H6NA 5CXCA 4OZUA 4JD2C 2IWKA 4H5IA 3K26A 1QNIA 5M5SA 3V7DB 4E54B 2P9NC 2BCJB 2CN2A 1FWXA 4J81A 3W15A 4D0KA 2H6QA 3NIDA 3JRPA 4QL1A 3O4GA 2OIZA 2EIDA 3KRXB 4GM9A 3UVLA 5IJ8E 2QR5A 2TRCB 5IGOA 4FAVD 3EI4A 2GC7A 5C2WB 2CE8A 2HJBA 5CXCB 3IIWA 1NR0A 3RMZD 3F3FA 1U8CA 4GQ1A 4AOWA 1A0RB 4AN1A 2EBSA 4E5ZA 4BP9A 3EMHA
chains in the Genus database with same CATH topology
1SQJA 1OLZA 5I5JA 1N6EA 3I2NA 4O3TB 4L3GD 2W18A 5KDOB 2PM9A 5B4WA 3I7KA 4UI9R 3EI4B 2H3XA 4ES0A 5AMSA 4JSPC 2AQ5A 4J87A 4Y7RA 4E5ZB 4J8GA 2H14A 3PXSD 4J82A 1GP2B 4ZOYA 4CZVA 4N14A 2BBKH 1PEVA 3SBRA 4MK0B 2PM9B 5FLXg 3JZHA 4O45A 1MG2A 3EI2B 4XYHA 4A08A 3BG1A 2YNOA 2P9PC 4QT8A 5EAPA 4TZ4A 3SVWD 2XL3A 3SMRA 3MZLA 3EI1A 3ULEC 4AEZA 3RSEC 3BWSA 4GGAA 4J86A 5CXBA 4FA4D 4FA5D 4XYIA 4ZOXA 1JJUB 3JB9L 1B9YA 4PXWA 4A08B 3DWLC 4A2LA 5GXIA 4CY2A 4K3ID 4JSNC 2I0SA 5CYKA 5K19A 4JSXC 4I79A 3EI1B 4IA9A 5GXHA 3MZKA 1YFQA 5HQGA 3AH8B 3I7OA 3MKSB 3UR4A 1XKSA 5EAMA 3ZWLB 4EWRA 4CI8A 1U4CA 5CXBB 1JMZB 3IIYA 2IUPA 4A0BA 2HKMA 2IUQA 4K3JB 3GREA 5GSAA 3SCYA 3VH0A 4U7AA 2B5LA 2AGXA 2YBAA 1RI6A 4PBYA 3NVQA 3J81g 2OVQB 2AGWA 3PSLA 3OKYA 3UVNA 4GM3A 2HXCA 3F3PA 1B9XA 3ORVD 4J77A 2G9AA 4A0BB 3E0CA 2G99A 3B7FA 3DM0A 4YVDA 4XEIC 2MTAH 1U2VC 3PVUB 4ESGA 4ERYA 3EG6A 1K8KC 5C9ZB 4X63B 4GM8A 3EWEA 2J55H 5K1CC 1L0QA 3I7PA 5H14A 4CY5A 4ERZA 4ZN4A 1SQ9A 5TF2A 3J80g 4G56B 3SLED 5I5IA 2UZYB 3CFVA 2Q7QA 4FB1D 4JT6C 4KFMB 5EMMB 1P22A 4J78A 4BUJC 5HYNB 4JT5C 3DSMA 2IURA 3KRWB 3I7LA 4J73A 1SHYB 2CO0A 2OK4A 4BH6A 3RRMC 4LG8A 4FWWA 1MDAH 5EMLB 2CE9A 2Z2OA 1XHMA 3FM0A 3PE7A 3V9FA 4Y5RD 3DXKC 5IJ7E 3A0FA 4CI3A 3F3GA 4GGDA 4J79A 4ZOVA 2AGLA 4O9DA 5EARA 5EMKB 5HE2B 3SWSD 2OK6A 2I0TA 5H1MA 3OKWA 4A09A 1VYHC 3GFCA 2YNPA 4J84A 3EI3A 3MXXA 3C99A 5TEFA 1TBGA 3IJCA 3SFZA 3IKOA 4PNKB 4CC9A 4HDJA 3K27A 3JZNA 1S4UX 1PBYB 3I7NA 5EM2A 4QQEA 3EU7A 3ODTA 2PM6B 2GC4A 2CO0C 4A09B 3C5MA 3SBQA 2GNQA 3EI3B 3RN0D 4JXMA 4IMMA 4X3EA 3VA6A 4PSWB 4GMBA 2H6KA 2J56H 3V5WB 5IC7A 3I8EA 2H9LA 5HE0B 4OWRA 4ZOZA 5H17A 2H13A 3DXMC 5CYKB 3I8CA 2P9KC 5FKQA 3U4YA 2AGZA 5FQDA 4J0WA 3PXWD 4A0AA 3PSCB 1PI6A 5FA5B 4U1EI 2H9MA 3FRXA 2I3SA 4BL0A 3MMYA 3SXTD 2XU7A 2H47A 2P9IC 2YB8B 5TEEA 3RFGA 3C75H 3HFQA 3SJLD 2O9KA 2QXVA 2HJ4A 3OW8A 3SHFA 2AH0A 4A0AB 3OL2A 3OKYB 5FKRA 3C9CA 4LG9A 3L4OD 2B5MA 5IT9g 3CFSB 5IGQA 1NEXB 1JMXB 2OVRB 3UKUC 3AFCA 3RFHA 3PXTD 4ERQA 4FA1D 4GGCA 4A2MA 2YMUA 3JROA 2HKRA 2Z2PA 2I3TA 3IJ0A 4PBZA 4R7AB 3JAMg 2XL2A 4H5JA 3OL2B 5AJAA 2OJYA 4JSVC 4GQBB 4GQ2P 4L9OA 3FGBA 5AFU3 2P9SC 4PC0A 3VGZA 3N0DA 1GG2B 1N6DA 4QRJA 5FKTA 4A7JA 3IJ1A 3EI2A 2PBIB 5GMKn 3AL8A 2IWFA 2IUVA 3I89A 2J57G 2H68A 5FKSA 2H9NA 2AH1A 5THAA 3JPXA 2H9PA 2CNXA 1OMWB 4D6VA 4O3UB 5HE1B 3RN1D 1N6FA 5FXYA 4CZXA 5I5MA 2XYIA 3I7HA 4X60B 4X61B 3PVWB 1MG3A 1ERJA 4CZYA 3AL8B 4FAND 4A11A 2PM7B 3P4FA 2QC5A 2HESX 5EALA 1GXRA 4J8BA 1GOTB 3AL9A 2P9UC 3OKTA 2CN3A 4NSXA 3UVMA 2P9LC 4CI1A 2I0RA 1R5MA 2UZXB 5SXMA 1Q47A 2B4EA 4O1QD 5JWZA 3JZGA 3RLMD 3UVOA 3CIKB 5A2Qg 1K32A 3UKRC 4FA9D 4CY1A 4A11B 3BG0A 3SN6B 5EM2B 2AGYA 3N0EA 3NVXA 3OTTA 4LGNA 5HE3B 4E54A 2OVPB 4CY3A 4GZ8A 3SBPA 3UVKA 5EMJB 2YNNA 4Z8LA 4J0XA 1XIPA 3MKQA 3NVNA 2B5NA 4L3HD 4PSXB 1PGUA 3L4MD 4FHLA 2HYEA 1JOFA 5TDHB 1TYQC 4L1QD 4CI2A 2Z2NA 2IAAA 5C2VB 2H6NA 5CXCA 4OZUA 4JD2C 2IWKA 4H5IA 3K26A 1QNIA 3V7DB 4E54B 2P9NC 2BCJB 2CN2A 1FWXA 4J81A 3W15A 4D0KA 2H6QA 3JRPA 4QL1A 2OIZA 3KRXB 4GM9A 3UVLA 5IJ8E 2TRCB 5IGOA 4FAVD 3EI4A 2GC7A 5C2WB 2CE8A 2HJBA 5CXCB 3IIWA 1NR0A 3RMZD 3F3FA 4GQ1A 4AOWA 1A0RB 2EBSA 4E5ZA 3EMHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SQJ A;  1OLZ A;  5I5J A;  1N6E A;  3I2N A;  4O3T B;  4L3G D;  2W18 A;  5KDO B;  2PM9 A;  5B4W A;  3I7K A;  4UI9 R;  3EI4 B;  2H3X A;  4ES0 A;  5AMS A;  4JSP C;  2AQ5 A;  4J87 A;  4Y7R A;  4E5Z B;  4J8G A;  2H14 A;  3PXS D;  4J82 A;  1GP2 B;  4ZOY A;  4CZV A;  4N14 A;  2BBK H;  1PEV A;  3SBR A;  4MK0 B;  2PM9 B;  5FLX g;  3JZH A;  4O45 A;  1MG2 A;  3EI2 B;  4XYH A;  4A08 A;  3BG1 A;  2YNO A;  2P9P C;  4QT8 A;  5EAP A;  4TZ4 A;  3SVW D;  2XL3 A;  3SMR A;  3MZL A;  3EI1 A;  3ULE C;  4AEZ A;  3RSE C;  3BWS A;  4GGA A;  4J86 A;  5CXB A;  4FA4 D;  4FA5 D;  4XYI A;  4ZOX A;  1JJU B;  3JB9 L;  1B9Y A;  4PXW A;  4A08 B;  3DWL C;  4A2L A;  5GXI A;  4CY2 A;  4K3I D;  4JSN C;  2I0S A;  5CYK A;  5K19 A;  4JSX C;  4I79 A;  3EI1 B;  4IA9 A;  5GXH A;  3MZK A;  1YFQ A;  5HQG A;  3AH8 B;  3I7O A;  3MKS B;  3UR4 A;  1XKS A;  5EAM A;  3ZWL B;  4EWR A;  4CI8 A;  1U4C A;  5CXB B;  1JMZ B;  3IIY A;  2IUP A;  4A0B A;  2HKM A;  2IUQ A;  4K3J B;  3GRE A;  5GSA A;  3SCY A;  3VH0 A;  4U7A A;  2B5L A;  2AGX A;  2YBA A;  1RI6 A;  4PBY A;  3NVQ A;  3J81 g;  2OVQ B;  2AGW A;  3PSL A;  3OKY A;  3UVN A;  4GM3 A;  2HXC A;  3F3P A;  1B9X A;  3ORV D;  4J77 A;  2G9A A;  4A0B B;  3E0C A;  2G99 A;  3B7F A;  3DM0 A;  4YVD A;  4XEI C;  2MTA H;  1U2V C;  3PVU B;  4ESG A;  4ERY A;  3EG6 A;  1K8K C;  5C9Z B;  4X63 B;  4GM8 A;  3EWE A;  2J55 H;  5K1C C;  1L0Q A;  3I7P A;  5H14 A;  4CY5 A;  4ERZ A;  4ZN4 A;  1SQ9 A;  5TF2 A;  3J80 g;  4G56 B;  3SLE D;  5I5I A;  2UZY B;  3CFV A;  2Q7Q A;  4FB1 D;  4JT6 C;  4KFM B;  5EMM B;  1P22 A;  4J78 A;  4BUJ C;  5HYN B;  4JT5 C;  3DSM A;  2IUR A;  3KRW B;  3I7L A;  4J73 A;  1SHY B;  2CO0 A;  2OK4 A;  4BH6 A;  3RRM C;  4LG8 A;  4FWW A;  1MDA H;  5EML B;  2CE9 A;  2Z2O A;  1XHM A;  3FM0 A;  3PE7 A;  3V9F A;  4Y5R D;  3DXK C;  5IJ7 E;  3A0F A;  4CI3 A;  3F3G A;  4GGD A;  4J79 A;  4ZOV A;  2AGL A;  4O9D A;  5EAR A;  5EMK B;  5HE2 B;  3SWS D;  2OK6 A;  2I0T A;  5H1M A;  3OKW A;  4A09 A;  1VYH C;  3GFC A;  2YNP A;  4J84 A;  3EI3 A;  3MXX A;  3C99 A;  5TEF A;  1TBG A;  3IJC A;  3SFZ A;  3IKO A;  4PNK B;  4CC9 A;  4HDJ A;  3K27 A;  3JZN A;  1S4U X;  1PBY B;  3I7N A;  5EM2 A;  4QQE A;  3EU7 A;  3ODT A;  2PM6 B;  2GC4 A;  2CO0 C;  4A09 B;  3C5M A;  3SBQ A;  2GNQ A;  3EI3 B;  3RN0 D;  4JXM A;  4IMM A;  4X3E A;  3VA6 A;  4PSW B;  4GMB A;  2H6K A;  2J56 H;  3V5W B;  5IC7 A;  3I8E A;  2H9L A;  5HE0 B;  4OWR A;  4ZOZ A;  5H17 A;  2H13 A;  3DXM C;  5CYK B;  3I8C A;  2P9K C;  5FKQ A;  3U4Y A;  2AGZ A;  5FQD A;  4J0W A;  3PXW D;  4A0A A;  3PSC B;  1PI6 A;  5FA5 B;  4U1E I;  2H9M A;  3FRX A;  2I3S A;  4BL0 A;  3MMY A;  3SXT D;  2XU7 A;  2H47 A;  2P9I C;  2YB8 B;  5TEE A;  3RFG A;  3C75 H;  3HFQ A;  3SJL D;  2O9K A;  2QXV A;  2HJ4 A;  3OW8 A;  3SHF A;  2AH0 A;  4A0A B;  3OL2 A;  3OKY B;  5FKR A;  3C9C A;  4LG9 A;  3L4O D;  2B5M A;  5IT9 g;  3CFS B;  5IGQ A;  1NEX B;  1JMX B;  2OVR B;  3UKU C;  3AFC A;  3RFH A;  3PXT D;  4ERQ A;  4FA1 D;  4GGC A;  4A2M A;  2YMU A;  3JRO A;  2HKR A;  2Z2P A;  2I3T A;  3IJ0 A;  4PBZ A;  4R7A B;  3JAM g;  2XL2 A;  4H5J A;  3OL2 B;  5AJA A;  2OJY A;  4JSV C;  4GQB B;  4GQ2 P;  4L9O A;  3FGB A;  5AFU 3;  2P9S C;  4PC0 A;  3VGZ A;  3N0D A;  1GG2 B;  1N6D A;  4QRJ A;  5FKT A;  4A7J A;  3IJ1 A;  3EI2 A;  2PBI B;  5GMK n;  3AL8 A;  2IWF A;  2IUV A;  3I89 A;  2J57 G;  2H68 A;  5FKS A;  2H9N A;  2AH1 A;  5THA A;  3JPX A;  2H9P A;  2CNX A;  1OMW B;  4D6V A;  4O3U B;  5HE1 B;  3RN1 D;  1N6F A;  5FXY A;  4CZX A;  5I5M A;  2XYI A;  3I7H A;  4X60 B;  4X61 B;  3PVW B;  1MG3 A;  1ERJ A;  4CZY A;  3AL8 B;  4FAN D;  4A11 A;  2PM7 B;  3P4F A;  2QC5 A;  2HES X;  5EAL A;  1GXR A;  4J8B A;  1GOT B;  3AL9 A;  2P9U C;  3OKT A;  2CN3 A;  4NSX A;  3UVM A;  2P9L C;  4CI1 A;  2I0R A;  1R5M A;  2UZX B;  5SXM A;  1Q47 A;  2B4E A;  4O1Q D;  5JWZ A;  3JZG A;  3RLM D;  3UVO A;  3CIK B;  5A2Q g;  1K32 A;  3UKR C;  4FA9 D;  4CY1 A;  4A11 B;  3BG0 A;  3SN6 B;  5EM2 B;  2AGY A;  3N0E A;  3NVX A;  3OTT A;  4LGN A;  5HE3 B;  4E54 A;  2OVP B;  4CY3 A;  4GZ8 A;  3SBP A;  3UVK A;  5EMJ B;  2YNN A;  4Z8L A;  4J0X A;  1XIP A;  3MKQ A;  3NVN A;  2B5N A;  4L3H D;  4PSX B;  1PGU A;  3L4M D;  4FHL A;  2HYE A;  1JOF A;  5TDH B;  1TYQ C;  4L1Q D;  4CI2 A;  2Z2N A;  2IAA A;  5C2V B;  2H6N A;  5CXC A;  4OZU A;  4JD2 C;  2IWK A;  4H5I A;  3K26 A;  1QNI A;  3V7D B;  4E54 B;  2P9N C;  2BCJ B;  2CN2 A;  1FWX A;  4J81 A;  3W15 A;  4D0K A;  2H6Q A;  3JRP A;  4QL1 A;  2OIZ A;  3KRX B;  4GM9 A;  3UVL A;  5IJ8 E;  2TRC B;  5IGO A;  4FAV D;  3EI4 A;  2GC7 A;  5C2W B;  2CE8 A;  2HJB A;  5CXC B;  3IIW A;  1NR0 A;  3RMZ D;  3F3F A;  4GQ1 A;  4AOW A;  1A0R B;  2EBS A;  4E5Z A;  3EMH A; 
#chains in the Genus database with same CATH topology
 1SQJ A;  1OLZ A;  5I5J A;  1N6E A;  3I2N A;  4O3T B;  4L3G D;  2W18 A;  5KDO B;  3IUL A;  2PM9 A;  3ZDX A;  4BP8 A;  5B4W A;  2XE4 A;  4QAM A;  3I7K A;  4UI9 R;  1GOG A;  3EI4 B;  2H3X A;  4ES0 A;  2EIE A;  5AMS A;  4JSP C;  2AQ5 A;  2VDL A;  4J87 A;  4Y7R A;  1GOH A;  4E5Z B;  4J8G A;  2H14 A;  3PXS D;  4J82 A;  1GP2 B;  4DNV A;  4ZOY A;  4CZV A;  4N14 A;  2BBK H;  2VDQ A;  3T3P A;  1PEV A;  3SBR A;  4MK0 B;  2PM9 B;  4BCC A;  4O02 A;  5FLX g;  3JZH A;  4O45 A;  1MG2 A;  3V4P A;  3EI2 B;  4XYH A;  1A12 A;  1UTC A;  4A08 A;  3BG1 A;  2YNO A;  2P9P C;  3KCI A;  4QT8 A;  2BKL A;  5EAP A;  4TZ4 A;  4AX4 A;  3SVW D;  4WK4 A;  2XL3 A;  3SMR A;  3MZL A;  3EI1 A;  3ULE C;  4G1M A;  4AEZ A;  4D9S A;  3RSE C;  3BWS A;  3NIF A;  4GGA A;  4J86 A;  3ZE2 A;  5FFO A;  5CXB A;  4FA4 D;  4FA5 D;  4XYI A;  4ZOX A;  1JJU B;  3JB9 L;  4BCB A;  1B9Y A;  4PXW A;  4A08 B;  3DWL C;  4A2L A;  5GXI A;  4CY2 A;  4K3I D;  4JSN C;  2I0S A;  5CYK A;  5K19 A;  4JSX C;  4I79 A;  3EI1 B;  2VDP A;  4IA9 A;  5GXH A;  3MZK A;  1YFQ A;  5HQG A;  3AH8 B;  3I7O A;  3MKS B;  4RE6 A;  1XKS A;  3UR4 A;  5EAM A;  3ZWL B;  4WJK A;  4EWR A;  4CI8 A;  1U4C A;  5CXB B;  1JMZ B;  3IIY A;  2IUP A;  4A0B A;  2HKM A;  2IUQ A;  3QI0 A;  4K3J B;  4O2W A;  3GRE A;  5GSA A;  3SCY A;  3VH0 A;  4U7A A;  2B5L A;  2AGX A;  4G1E A;  2YBA A;  1RI6 A;  4PBY A;  3NVQ A;  3J81 g;  2OVQ B;  2HU5 A;  2QZP A;  1E8N A;  2AGW A;  3FCS A;  3PSL A;  3OKY A;  3UVN A;  4GM3 A;  2HXC A;  2HU7 A;  3F3P A;  1B9X A;  3ORV D;  4J77 A;  2XDW A;  3IUN A;  1E5T A;  2G9A A;  3E0C A;  4A0B B;  4WK2 A;  1VE7 A;  2G99 A;  3B7F A;  3DM0 A;  4YVD A;  4XEI C;  1H2Y A;  2MTA H;  1U2V C;  3PVU B;  4ESG A;  4ERY A;  3EG6 A;  1K8K C;  5C9Z B;  4X63 B;  4GM8 A;  3EWE A;  5C92 A;  2J55 H;  5K1C C;  1L0Q A;  3QHY B;  4NC4 A;  3I7P A;  5H14 A;  4CY5 A;  4ERZ A;  4ZN4 A;  1SQ9 A;  5TF2 A;  3J80 g;  3K6S A;  4G56 B;  3SLE D;  1UOQ A;  5I5I A;  2UZY B;  3CFV A;  2Q7Q A;  4FB1 D;  4AMZ A;  4JT6 C;  1C9I A;  4KFM B;  3GD1 I;  1QFM A;  5EMM B;  1P22 A;  4J78 A;  4BUJ C;  1T2X A;  5HYN B;  4JT5 C;  3IUQ A;  3DSM A;  2IUR A;  3KRW B;  2VDM A;  5FFG A;  3I7L A;  4J73 A;  3K71 A;  5M5R A;  4JHP C;  1SHY B;  2CO0 A;  2OK4 A;  4BH6 A;  3RRM C;  4LG8 A;  4FWW A;  1MDA H;  5EML B;  2CE9 A;  2Z2O A;  1XHM A;  3FM0 A;  3PE7 A;  3V9F A;  4Y5R D;  3DXK C;  5IJ7 E;  3A0F A;  1VZ3 A;  4CI3 A;  3F3G A;  4GGD A;  4J79 A;  4ZOV A;  2AGL A;  4O9D A;  5EAR A;  5EMK B;  2EIB A;  5HE2 B;  3MUN A;  3SWS D;  2OK6 A;  2I0T A;  1L5G A;  1TYE A;  5H1M A;  3OKW A;  4A09 A;  1VYH C;  3GFC A;  2YNP A;  4J84 A;  3EI3 A;  3IVM A;  3MXX A;  3C99 A;  4Z7N A;  5TEF A;  1TBG A;  3IJC A;  3SFZ A;  3IKO A;  4NEN A;  3VI3 A;  4PNK B;  1UOP A;  3OF7 A;  1E8M A;  1VZ2 A;  4CC9 A;  4HDJ A;  3K27 A;  3JZN A;  1S4U X;  1PBY B;  3I7N A;  5EM2 A;  4MMZ A;  4QQE A;  3EU7 A;  4BCD A;  3ODT A;  3ZDZ A;  2PM6 B;  2GC4 A;  5M61 A;  3ZDY A;  2CO0 C;  4A09 B;  3C5M A;  3ZE1 A;  3SBQ A;  2GNQ A;  3EI3 B;  2EIC A;  3RN0 D;  4JXM A;  4AMY A;  4IMM A;  3K72 A;  4X3E A;  3VA6 A;  3DDU A;  4PSW B;  2VDN A;  1YR2 A;  3EQ9 A;  4GMB A;  2H6K A;  2J56 H;  3V5W B;  5IC7 A;  3O4H A;  3I8E A;  2H9L A;  5HE0 B;  4OWR A;  4ZOZ A;  5H17 A;  2H13 A;  3DXM C;  5CYK B;  4JHN A;  3I8C A;  2P9K C;  5FKQ A;  3U4Y A;  2AGZ A;  5FQD A;  4J0W A;  4UM9 A;  3PXW D;  4A0A A;  3PSC B;  1PI6 A;  3EQ8 A;  3IUJ A;  5FA5 B;  4U1E I;  2H9M A;  3FRX A;  2I3S A;  4BL0 A;  3MMY A;  3O4J A;  3SXT D;  1O6G A;  2XU7 A;  2H47 A;  4MMY A;  2VZ3 A;  2P9I C;  2YB8 B;  5TEE A;  2VDO A;  3RFG A;  3C75 H;  3HFQ A;  3SJL D;  2O9K A;  2QXV A;  1UOO A;  1JV2 A;  2HJ4 A;  2WQ8 A;  3OW8 A;  1O6F A;  5M5T A;  3SHF A;  2AH0 A;  4A0A B;  3OL2 A;  1H2Z A;  3OKY B;  5FKR A;  3C9C A;  4LG9 A;  3T3M A;  3L4O D;  2B5M A;  5IT9 g;  3CFS B;  5IGQ A;  1GOF A;  1NEX B;  1JMX B;  2OVR B;  3UKU C;  3AFC A;  3RFH A;  3PXT D;  4ERQ A;  4FA1 D;  4GGC A;  4A2M A;  4WK0 A;  2YMU A;  3JRO A;  2HKR A;  3GC3 B;  1QFS A;  3NIG A;  2Z2P A;  2I3T A;  3IJ0 A;  2JKX A;  4PBZ A;  4R7A B;  3JAM g;  4RE5 A;  2VZ1 A;  2XL2 A;  3O4I A;  4H5J A;  3OL2 B;  5AJA A;  4IRZ A;  2OJY A;  4JSV C;  4GQB B;  4GQ2 P;  4L9O A;  3FGB A;  4DNU A;  5AFU 3;  2P9S C;  5HDB A;  3MVD K;  4PC0 A;  5E6S A;  3VGZ A;  3VI4 A;  3N0D A;  1GG2 B;  1N6D A;  4QRJ A;  5FKT A;  4A7J A;  3IJ1 A;  4AN0 A;  3EI2 A;  2PBI B;  5GMK n;  3AL8 A;  2IWF A;  5M5V A;  2IUV A;  4NBM A;  3I89 A;  2J57 G;  4MMX A;  3IJE A;  2H68 A;  5E6R A;  5FKS A;  2H9N A;  5E6U A;  2AH1 A;  5THA A;  3JPX A;  2H9P A;  2CNX A;  1M1X A;  1OMW B;  4D6V A;  4O3U B;  3V4V A;  5HE1 B;  3RN1 D;  1JTD B;  1N6F A;  2VDR A;  5FXY A;  2VDK A;  4CZX A;  5I5M A;  2XYI A;  3I7H A;  4X60 B;  4X61 B;  3PVW B;  1MG3 A;  1ERJ A;  4CZY A;  3AL8 B;  3IUM A;  4FAN D;  4A11 A;  2PM7 B;  3P4F A;  2QC5 A;  2HES X;  5EAL A;  1GXR A;  3MUO A;  4J8B A;  1GOT B;  3AL9 A;  2P9U C;  3OKT A;  4Z7Q A;  2CN3 A;  4NSX A;  3UVM A;  2P9L C;  4CI1 A;  2I0R A;  5C86 A;  1VE6 A;  1R5M A;  2UZX B;  1C9L A;  4L1M A;  5SXM A;  4G55 A;  2VC2 A;  1Q47 A;  2B4E A;  4O1Q D;  5JWZ A;  3JZG A;  3RLM D;  3UVO A;  1H2X A;  3CIK B;  5A2Q g;  1K32 A;  3UKR C;  1K3I A;  4FA9 D;  4CY1 A;  4A11 B;  5M5U A;  3BG0 A;  3SN6 B;  5EM2 B;  2AGY A;  3N0E A;  3NVX A;  3OTT A;  4LGN A;  5HE3 B;  4E54 A;  4Z7O A;  2OVP B;  3EQ7 A;  3FCU A;  4CY3 A;  4GZ8 A;  3SBP A;  3UVK A;  5EMJ B;  2HU8 A;  2YNN A;  4UM8 A;  4Z8L A;  4J0X A;  1I2M B;  1XIP A;  3ZE0 A;  3MKQ A;  3NVN A;  2B5N A;  4L3H D;  4PSX B;  1PGU A;  3L4M D;  4FHL A;  2XZG A;  2HYE A;  1JOF A;  5TDH B;  1BPO A;  1TYQ C;  1H2W A;  2Z2N A;  4L1Q D;  4CI2 A;  3IUR A;  4DNW A;  2IAA A;  5C2V B;  4NAA A;  2H6N A;  5CXC A;  4OZU A;  4JD2 C;  2IWK A;  4H5I A;  3K26 A;  1QNI A;  5M5S A;  3V7D B;  4E54 B;  2P9N C;  2BCJ B;  2CN2 A;  1FWX A;  4J81 A;  3W15 A;  4D0K A;  2H6Q A;  3NID A;  3JRP A;  4QL1 A;  3O4G A;  2OIZ A;  2EID A;  3KRX B;  4GM9 A;  3UVL A;  5IJ8 E;  2QR5 A;  2TRC B;  5IGO A;  4FAV D;  3EI4 A;  2GC7 A;  5C2W B;  2CE8 A;  2HJB A;  5CXC B;  3IIW A;  1NR0 A;  3RMZ D;  3F3F A;  1U8C A;  4GQ1 A;  4AOW A;  1A0R B;  4AN1 A;  2EBS A;  4E5Z A;  4BP9 A;  3EMH A; 
#chains in the Genus database with same CATH homology
 1SQJ A;  1OLZ A;  5I5J A;  1N6E A;  3I2N A;  4O3T B;  4L3G D;  2W18 A;  5KDO B;  2PM9 A;  5B4W A;  3I7K A;  4UI9 R;  3EI4 B;  2H3X A;  4ES0 A;  5AMS A;  4JSP C;  2AQ5 A;  4J87 A;  4Y7R A;  4E5Z B;  4J8G A;  2H14 A;  3PXS D;  4J82 A;  1GP2 B;  4ZOY A;  4CZV A;  4N14 A;  2BBK H;  1PEV A;  3SBR A;  4MK0 B;  2PM9 B;  5FLX g;  3JZH A;  4O45 A;  1MG2 A;  3EI2 B;  4XYH A;  4A08 A;  3BG1 A;  2YNO A;  2P9P C;  4QT8 A;  5EAP A;  4TZ4 A;  3SVW D;  2XL3 A;  3SMR A;  3MZL A;  3EI1 A;  3ULE C;  4AEZ A;  3RSE C;  3BWS A;  4GGA A;  4J86 A;  5CXB A;  4FA4 D;  4FA5 D;  4XYI A;  4ZOX A;  1JJU B;  3JB9 L;  1B9Y A;  4PXW A;  4A08 B;  3DWL C;  4A2L A;  5GXI A;  4CY2 A;  4K3I D;  4JSN C;  2I0S A;  5CYK A;  5K19 A;  4JSX C;  4I79 A;  3EI1 B;  4IA9 A;  5GXH A;  3MZK A;  1YFQ A;  5HQG A;  3AH8 B;  3I7O A;  3MKS B;  3UR4 A;  1XKS A;  5EAM A;  3ZWL B;  4EWR A;  4CI8 A;  1U4C A;  5CXB B;  1JMZ B;  3IIY A;  2IUP A;  4A0B A;  2HKM A;  2IUQ A;  4K3J B;  3GRE A;  5GSA A;  3SCY A;  3VH0 A;  4U7A A;  2B5L A;  2AGX A;  2YBA A;  1RI6 A;  4PBY A;  3NVQ A;  3J81 g;  2OVQ B;  2AGW A;  3PSL A;  3OKY A;  3UVN A;  4GM3 A;  2HXC A;  3F3P A;  1B9X A;  3ORV D;  4J77 A;  2G9A A;  4A0B B;  3E0C A;  2G99 A;  3B7F A;  3DM0 A;  4YVD A;  4XEI C;  2MTA H;  1U2V C;  3PVU B;  4ESG A;  4ERY A;  3EG6 A;  1K8K C;  5C9Z B;  4X63 B;  4GM8 A;  3EWE A;  2J55 H;  5K1C C;  1L0Q A;  3I7P A;  5H14 A;  4CY5 A;  4ERZ A;  4ZN4 A;  1SQ9 A;  5TF2 A;  3J80 g;  4G56 B;  3SLE D;  5I5I A;  2UZY B;  3CFV A;  2Q7Q A;  4FB1 D;  4JT6 C;  4KFM B;  5EMM B;  1P22 A;  4J78 A;  4BUJ C;  5HYN B;  4JT5 C;  3DSM A;  2IUR A;  3KRW B;  3I7L A;  4J73 A;  1SHY B;  2CO0 A;  2OK4 A;  4BH6 A;  3RRM C;  4LG8 A;  4FWW A;  1MDA H;  5EML B;  2CE9 A;  2Z2O A;  1XHM A;  3FM0 A;  3PE7 A;  3V9F A;  4Y5R D;  3DXK C;  5IJ7 E;  3A0F A;  4CI3 A;  3F3G A;  4GGD A;  4J79 A;  4ZOV A;  2AGL A;  4O9D A;  5EAR A;  5EMK B;  5HE2 B;  3SWS D;  2OK6 A;  2I0T A;  5H1M A;  3OKW A;  4A09 A;  1VYH C;  3GFC A;  2YNP A;  4J84 A;  3EI3 A;  3MXX A;  3C99 A;  5TEF A;  1TBG A;  3IJC A;  3SFZ A;  3IKO A;  4PNK B;  4CC9 A;  4HDJ A;  3K27 A;  3JZN A;  1S4U X;  1PBY B;  3I7N A;  5EM2 A;  4QQE A;  3EU7 A;  3ODT A;  2PM6 B;  2GC4 A;  2CO0 C;  4A09 B;  3C5M A;  3SBQ A;  2GNQ A;  3EI3 B;  3RN0 D;  4JXM A;  4IMM A;  4X3E A;  3VA6 A;  4PSW B;  4GMB A;  2H6K A;  2J56 H;  3V5W B;  5IC7 A;  3I8E A;  2H9L A;  5HE0 B;  4OWR A;  4ZOZ A;  5H17 A;  2H13 A;  3DXM C;  5CYK B;  3I8C A;  2P9K C;  5FKQ A;  3U4Y A;  2AGZ A;  5FQD A;  4J0W A;  3PXW D;  4A0A A;  3PSC B;  1PI6 A;  5FA5 B;  4U1E I;  2H9M A;  3FRX A;  2I3S A;  4BL0 A;  3MMY A;  3SXT D;  2XU7 A;  2H47 A;  2P9I C;  2YB8 B;  5TEE A;  3RFG A;  3C75 H;  3HFQ A;  3SJL D;  2O9K A;  2QXV A;  2HJ4 A;  3OW8 A;  3SHF A;  2AH0 A;  4A0A B;  3OL2 A;  3OKY B;  5FKR A;  3C9C A;  4LG9 A;  3L4O D;  2B5M A;  5IT9 g;  3CFS B;  5IGQ A;  1NEX B;  1JMX B;  2OVR B;  3UKU C;  3AFC A;  3RFH A;  3PXT D;  4ERQ A;  4FA1 D;  4GGC A;  4A2M A;  2YMU A;  3JRO A;  2HKR A;  2Z2P A;  2I3T A;  3IJ0 A;  4PBZ A;  4R7A B;  3JAM g;  2XL2 A;  4H5J A;  3OL2 B;  5AJA A;  2OJY A;  4JSV C;  4GQB B;  4GQ2 P;  4L9O A;  3FGB A;  5AFU 3;  2P9S C;  4PC0 A;  3VGZ A;  3N0D A;  1GG2 B;  1N6D A;  4QRJ A;  5FKT A;  4A7J A;  3IJ1 A;  3EI2 A;  2PBI B;  5GMK n;  3AL8 A;  2IWF A;  2IUV A;  3I89 A;  2J57 G;  2H68 A;  5FKS A;  2H9N A;  2AH1 A;  5THA A;  3JPX A;  2H9P A;  2CNX A;  1OMW B;  4D6V A;  4O3U B;  5HE1 B;  3RN1 D;  1N6F A;  5FXY A;  4CZX A;  5I5M A;  2XYI A;  3I7H A;  4X60 B;  4X61 B;  3PVW B;  1MG3 A;  1ERJ A;  4CZY A;  3AL8 B;  4FAN D;  4A11 A;  2PM7 B;  3P4F A;  2QC5 A;  2HES X;  5EAL A;  1GXR A;  4J8B A;  1GOT B;  3AL9 A;  2P9U C;  3OKT A;  2CN3 A;  4NSX A;  3UVM A;  2P9L C;  4CI1 A;  2I0R A;  1R5M A;  2UZX B;  5SXM A;  1Q47 A;  2B4E A;  4O1Q D;  5JWZ A;  3JZG A;  3RLM D;  3UVO A;  3CIK B;  5A2Q g;  1K32 A;  3UKR C;  4FA9 D;  4CY1 A;  4A11 B;  3BG0 A;  3SN6 B;  5EM2 B;  2AGY A;  3N0E A;  3NVX A;  3OTT A;  4LGN A;  5HE3 B;  4E54 A;  2OVP B;  4CY3 A;  4GZ8 A;  3SBP A;  3UVK A;  5EMJ B;  2YNN A;  4Z8L A;  4J0X A;  1XIP A;  3MKQ A;  3NVN A;  2B5N A;  4L3H D;  4PSX B;  1PGU A;  3L4M D;  4FHL A;  2HYE A;  1JOF A;  5TDH B;  1TYQ C;  4L1Q D;  4CI2 A;  2Z2N A;  2IAA A;  5C2V B;  2H6N A;  5CXC A;  4OZU A;  4JD2 C;  2IWK A;  4H5I A;  3K26 A;  1QNI A;  3V7D B;  4E54 B;  2P9N C;  2BCJ B;  2CN2 A;  1FWX A;  4J81 A;  3W15 A;  4D0K A;  2H6Q A;  3JRP A;  4QL1 A;  2OIZ A;  3KRX B;  4GM9 A;  3UVL A;  5IJ8 E;  2TRC B;  5IGO A;  4FAV D;  3EI4 A;  2GC7 A;  5C2W B;  2CE8 A;  2HJB A;  5CXC B;  3IIW A;  1NR0 A;  3RMZ D;  3F3F A;  4GQ1 A;  4AOW A;  1A0R B;  2EBS A;  4E5Z A;  3EMH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...