5I5MA

Shewanella denitrificans nitrous oxide reductase, ca2+-reconstituted form
Total Genus 193
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
193
sequence length
575
structure length
575
Chain Sequence
b'SAVVHPGELDEYYGFWSGGHSGEVRILGIPSMRELMRIPVFNIDSATGWGITNESKRIKGDSAHLMTGDSHHPHMSMTDGSYNGKYVFINDKANSRVARIRCDVMKTDKMITIPNVQAIHGLRVQKVPYTKYVICNGEFEIPMNNDGKASLEDVSTYRSLFNVIDAEKMEVAFQVMVDGNLDNTDADYDGKYFFSTCYNSEMGMNLGEMITAERDHVVVFSLERCLAALKAGKFTNYNGNKVPVLDGRKGSDLTRYIPVPKSPHGINTAPDGKYFVANGKLSPTVSVVEIARLDDVFSGKIQPRDAIVAEPELGLGPLHTAFDNKGNAFTTLFLDSQIAKWNIQDAIKAYNGEKVNYLRQKLDVHYQPGHNHTSQGETRDTDGKWLVVLCKFSKDRFLPVGPLRPENDQLIDISGDEMKLVHDGPTFAEPHDCMIVHRSKVKPQKLWTRDDPMFADTVAMAKQDGVTLEMDNKVIRDGNKVRVYMTSIAPNFGMNEFKVKLGDEVTVVVTNLDQVEDVTHGFCMTNHGVQMEVAPQATASVTFIANKPGVQWYYCNWFCHALHMEMRGRMLVEAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nitrous-oxide reductase
molecule tags Oxidoreductase
source organism Shewanella denitrificans (strain os217 / atcc baa-1090 / dsm 15013)
publication title Role of Calcium in Secondary Structure Stabilization during Maturation of Nitrous Oxide Reductase.
pubmed doi rcsb
total genus 193
structure length 575
sequence length 575
chains with identical sequence B
ec nomenclature ec 1.7.2.4: Nitrous-oxide reductase.
pdb deposition date 2016-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18764 nos_propeller Nitrous oxide reductase propeller repeat
A PF18793 nos_propeller_2 Nitrous oxide reductase propeller repeat 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5i5mA02
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5i5mA01
4Q8BA 1ADWA 1JXDA 2G99A 4OZUA 1URIA 2FTAA 5D4HA 5B1JA 4CI8A 8PAZA 1SFDA 4X63B 3AG4B 3ABGA 4I79A 4AOWA 1TEFA 2MRYA 1PCSA 3PAVA 3T6ZA 2QC5A 5GXHA 5TK4A 1T5KA 4NAJA 1OCRB 3EHBB 1WA1X 3UAEA 4BXSV 2BP0A 3QPKA 1RI6A 2EIMB 3PPSA 3IN2A 1S4UX 4GQ1A 3SN6B 4KO7A 3DIVA 3SWSD 1ASQA 2HRGA 5I6NA 3OMNB 5I6KA 2H6QA 2PM9B 2BWDA 2P9LC 3FM0A 1AG6A 1A65A 1RCYA 4JHVA 3FYEB 1PI6A 4L3GD 2BW4A 3SFZA 1ZV2A 3K27A 1B9YA 4A09B 1OE2A 4DP0X 3FQ2A 5PAZA 2UXFA 2AGWA 3ZWLB 2YAQA 2IAAA 3C99A 2OVRB 1R1CA 5GXIA 2IWFA 1JXFA 2GC7C 3JT2A 3OKYB 3K26A 4GM9A 3UVLA 5I5JA 1JZJA 1KBWA 3S8GB 3CFSB 3G5WA 1WA0X 2HKRA 5IGQA 2XWZA 3IBOA 3DKHA 4ES0A 4CI3A 3H4HA 4UI9R 4AKQA 3I89A 2JFCA 4O45A 1JZFA 1GS6X 2GBAA 4GP4B 1NIEA 2AZUA 2CCWA 3I2NA 2YQBA 3X1GA 3IIYA 2J57G 2AGXA 3MZKA 5EALA 3H56A 4HZ1A 4MFHA 3BG1A 4E9SA 1GY1A 4A7JA 1N6EA 2PLTA 2HJBA 4E9YA 2VW6A 4CZXA 4W9ZA 1M9WA 4Y7RA 2ZWNA 2GIMA 3DXMC 1OCOB 3F3FA 3MKQA 4J0XA 4G56B 1PZAA 1PZBA 4DPCX 4DP7X 4BWUA 4H5IA 4ERZA 2PM6B 2PM9A 2TSBA 2AGYA 4J84A 4PCYA 4CSPA 1NIDA 1FWXA 2J5WA 2XXGA 1J9QA 1L9TA 4J86A 3S3BB 4CY1A 4LGNA 2CUAA 4A0BB 2JXMA 4K3JB 2GHZA 2R7EA 3SXTD 4PAZA 4DP1X 3EF4A 1AS7A 5I5IA 5FLXg 2XX0A 2FQGA 3QJUB 1GG2B 3UVNA 5K19A 1K8KC 2UX6A 1IBZA 2WO2B 4Z8LA 3WG7B 1OE3A 2Y1AA 2EIJB 3WKQA 4KNTA 2FT6A 3SBPA 4AX3A 4L0PB 5B1JC 2B5MA 3V9EA 1JZHA 2YAOA 5EMLB 1OOWA 4CY3A 4A68A 1PMYA 7PCYA 3SMRA 1A4BA 3RSEC 4YSAA 1FFTB 1BXVA 4G72B 2H6NA 1A8ZA 3ABKB 4TXVB 5I28A 2AFNA 3I7KA 4H5JA 2IUPA 3NJFA 4G7QB 1SDDA 2UXGA 4HCFA 3UVMA 1TYQC 4AKOA 3UVOA 1EHKB 4J82A 2H9PA 2P9PC 3FYIB 4JSXC 5FKQA 2QPEB 3AG1B 4BWTA 5IC7A 3QJSB 3GFCA 1BQRA 4A09A 2AANA 2AZAA 4FB1D 4O9DA 1BYPA 5KDOB 2IDTA 2CJ3A 3WIAA 1SDDB 3HB3B 4BL0A 2CN2A 2CN3A 4HDJA 4IMMA 5FQDA 4ERYA 3GYRA 4AZUA 1JZIA 1K32A 3ZDWA 3OKYA 2QDVA 4YVNA 3PAUA 3ZX1A 1SHWA 5CYKB 4FA9D 1CYXA 3NSFA 2P9IC 3PVUB 1ET8A 3IJCA 5IGOA 2J55H 4QT8A 2PPEA 1V54B 3EH3B 1CYWA 3UVKA 1N6FA 3NP4A 2AGLA 3UR4A 1AIZA 1IBYA 2BW5A 2IWKA 3I7NA 5E9NA 4Y5RD 3JZHA 2AQ5A 1EZLA 1NIBA 3OKTA 2YARA 4E5ZA 4FA1D 1JZEA 4FAVD 3C75H 4YSDA 2HESX 3AL8A 2B3IA 4CZYA 1V55B 4BH6A 3MZLA 4GGAA 4GYBA 3V9FA 2CBPA 2WSDA 3EH4B 1BQKA 2GSMB 4F2EA 2OK6A 3BQVA 3J80g 4GGCA 4RH4A 3DXKC 1ETJA 2ZONA 3KW8A 5ANHA 2HYEA 2I7SA 3J81g 3IJ1A 1B3IA 4XYHA 1I53A 4JD2C 1NR0A 2PPAA 1AZRA 1ZIBA 4FA4D 2RACA 1GY2A 2P9NC 3QJVB 1NEXB 4J0WA 2HX7A 3I7PA 3PCYA 1JMZB 3ORVD 2R7EB 1SF3A 3UADA 3OD3A 3HEIB 5I26A 4BDVA 2YBAA 2FWLB 4GMBA 4ESGA 4ZN4A 3DTUB 2G9AA 3RLMD 3VA6A 2FNWA 3CDZA 3PXWD 2BZCA 4A2DA 2N0MA 2H14A 5HYNB 4AI7A 1NWOA 3H4FA 1CC3A 4YSTA 1E5ZA 5TDHB 4A0AB 3CFVA 5FC9A 3AW5A 3NT0A 3EI3B 2PPCA 3W15A 4A11B 3FU7B 5C9ZB 4E9QA 2J56H 3AZUA 3SLED 2H5UA 2IDFA 2AH0A 1JOFA 4J78A 1PF3A 3UACA 1GS8A 2IH9A 4E9VA 4QQEA 5SXMA 2MTAH 4F7KA 3AY2A 3KRXB 1JOIA 3FT0A 3EI1B 4YSCA 4YL4A 2QXVA 1JXGA 5AKRA 1AOZA 1OV8A 4G70B 1PEVA 1A4AA 2XUWA 4WKXA 1AZNA 1F56A 2GC4A 2YB8B 4GQBB 4X3EA 2HJ4A 1N70A 1PNDA 1ZIAA 1N6DA 5H1MA 5TEFA 3ZBMA 1XB3A 1RZPA 2IWEA 1AR1B 2WO3B 1JZGA 4ZOXA 5HE2B 1OCZB 3SBQA 3SQRA 2YAHA 4FAAB 2XL2A 4AEZA 1XMEB 2BWIA 4GM3A 4O1QD 1ET7A 2VW4A 2OV0A 1V10A 4BK5C 2UZXB 4LG8A 3UKRC 5IT9g 4PC0A 3KRWB 2OJ1A 2CO0C 3NSYA 2I0TA 4PBYA 1TKWA 4PSWB 2OVQB 2W18A 3IEAA 3ABLB 4KOBA 3NVQA 5D4IA 3KW7A 1BXAA 1PZCA 4N4YB 3ABMB 4GY4A 1MDAH 3EI4A 1AS8A 4E54A 1ASPA 5AFU3 4K3ID 3FU8A 2YNOA 5K1CC 3EG6A 3JROA 5B3SB 1WS7A 2XXFA 3RRMC 1AAJA 4KNUA 1R5MA 3SVWD 3UABA 2P9SC 3DSMA 5B1BB 3BVDB 3T6VA 1ERJA 4JHUA 1PGUA 1XB6A 2E86A 4M3HA 1J9RA 3V9CA 2FJSA 5I6PA 3OKWA 4YSPA 4E54B 3NSDA 4D0KA 1QNIA 3F3GA 1BQ5A 7PAZA 2J56A 4BXVA 2I7OA 2YNNA 1M57B 3CVDA 2YXVA 3GDCA 3FS9A 4DP2X 4BUJC 1CUOA 4P5SA 4FA7B 4UAHA 5C2WB 1NIAA 2IDSA 1BEXA 3FQ1A 2P9KC 2ZXWB 5HE0B 2IDQA 1YLBB 3QJTB 1X9UA 3WKPA 1PLAA 1FA4A 3JZNA 1B9XA 4KFMB 4O3TB 4A2EA 4AKPA 4HAKA 1SHYB 4DPAX 3CDZB 4CI2A 1BXUA 2FQEA 2BZ7A 3NYKA 4ERQA 3X1BA 5EHFA 1MZYA 2PCFA 4OWRA 1TEGA 4A2HA 4JSNC 2XV3A 3T6WA 1OF0A 2LLNA 4YSUA 3SCYA 4DP5X 2VN3A 5TF2A 3EI4B 4YSOA 4YVDA 2YAFA 1HAWA 4G7SB 2XVBA 5A7EA 3L4MD 2XX1A 5FA5B 1GW0A 3DWLC 3V7DB 3VH0A 2QDWA 3TASA 1SQ9A 6PCYA 1GYCA 1W6WA 4F2FA 4X61B 2H9MA 3CG8A 2XV0A 4ENZA 2GC4C 4A08B 5EAMA 2O9KA 2IH8A 4ZK8A 4NSXA 2PP7A 2XL3A 3FQYA 3CVCA 4PXWA 4CY5A 2YMUA 3N0DA 2B08A 4KO6A 2B4EA 1JERA 4G7RB 2YAPA 3AL8B 4FAND 3PLYA 2TRCB 3RN1D 1KCWA 1GS7A 1NPJA 2BP0B 3NJMA 4A08A 4GM8A 4A11A 3NJHA 3FU7A 2P80D 3GXUB 4N8UA 2CO0A 4A67A 4EF3A 2I0SA 5FKRA 1E5YA 4E9XA 2J57A 3FPYA 2H6KA 3EMHA 4MK0B 5EM2A 3PSCB 4J77A 5HQGA 1SFHA 1NIFA 2HZHA 1IKOP 3TA4D 2OCCB 1L9PA 3AG2B 1L9OA 3IN0A 3UAAA 4YSSA 2HXCA 2PM7B 3F3PA 5AMSA 2UZYB 1KYAA 1M56B 3QJRB 2AGZA 3B7FA 2EILB 1MZZA 3CZUB 4JSPC 1ILSA 4KNSA 4A2LA 4BDVB 2Q7QA 3UKUC 1GSKA 3CVBA 3N55A 1A0RB 3OTTA 5IJ8E 1XKSA 2FT7A 3DM0A 3FPXA 2ZOOA 1U4CA 2I0RA 1Q47A 3C75A 2H9LA 4PNKB 5A2Qg 1KV7A 3NJGA 1BYOA 1AQ8A 3ODTA 3AG3B 1GOTB 4CZVA 5AFAA 1N68A 2H68A 3I7OA 3EI2A 2BP8A 2QPDB 4NB7A 4WTQA 5THAA 1SF5A 1W8EA 4L3HD 3OM3B 3U25A 3U4YA 1A3ZA 4DP4X 5AJAA 2YAEA 3I7HA 3MX0B 4YSQA 2Z2NA 2GB2A 2Q9OA 1XHMA 5FXYA 1ZDSA 3X1FA 2CE9A 1PLCA 3T9WA 1PNCA 4GZ8A 3EI2B 2EINB 3BWSA 1XB8A 4QLWA 4UANA 4HHGA 2DWSA 1J5DA 5I5MA 3NVXA 4PSXB 1MG2C 2JKWA 3FSWA 1OMWB 3NJJA 3RFGA 5PCYA 9PCYA 2XU7A 2X87A 5AZUA 3C9CA 2HRHA 2PBIB 5F7BA 3PAZA 1DYZA 1KDJA 1IC0A 3NJIA 4QL1A 3C5MA 3MMYA 1NICA 2CALA 1NPNA 2NRDA 1YFQA 3MKSB 5B7MA 3EWEA 5H14A 4DP9X 3RFHA 3BG0A 5FKSA 5TEEA 3NJKA 2VMJA 1L9SA 3PXLA 1NINA 1PLBA 1OCCB 4CY2A 1XIPA 2XV2A 3ASOB 4M4RB 4YVUA 1SHXA 2BP8B 3D12B 3FSVA 5D4JA 2DYRB 3EH5B 3MXXA 1A4CA 3PE7A 4JT5C 5CYKA 2DY2A 4U7AA 3NJNA 4L9OA 4PBZA 4HHWA 1JJUB 1DZ0A 1AZUA 3N0EA 3ULEC 6PAZA 2YNPA 4ZOZA 4CC9A 4G71B 1MG2A 1AZBA 1OE1A 2P80A 4ZOYA 2BO0A 1VYHC 3RN0D 1KBVA 4A0BA 3IE9A 3S3DB 3I8CA 1SQJA 3I7LA 4LG9A 5IJ7E 2I85A 5I6LA 3AH8B 4KO9A 3T71A 4N14A 5GMKn 2X88A 4FHLA 2UXTA 2J55A 4Q89A 3NVNA 2UX7A 3T6XA 4A2GA 1UATA 5HE3B 2A3TA 1AS6A 3EI3A 2PP8A 5I6OA 4HIPA 2CE8A 2EIKB 4HCGA 2EBSA 3JZGA 2CNXA 1TU2A 1QLEB 2VW7A 3S3CB 2IUQA 4HCIA 2OK4A 1QHQA 3CIKB 3OW8A 3V5WB 3RYMA 3QQXA 4J81A 1NWPA 2PPDA 4HALA 4JSVC 5EARA 3NP3A 3ZIYA 1J9SA 1IUZA 3UGEA 4UF7C 2I3SA 1NDTA 3WNIA 4JT6C 5B7EA 3FSZA 4QKTA 3VGZA 2HXAA 4FA5D 5EMKB 5EM2B 1HAUA 1KCBA 2DWTA 5H17A 5IY5B 3JTBA 2XYIA 4CI1A 3TBCA 4IA9A 2IUVA 5B7FA 2H47A 3P4FA 4A0AA 3OL2B 1L9QA 2B5LA 4O3UB 1WA2X 5F7AA 1E65A 1J5CA 1CURA 5GSAA 1P22A 2HKMA 3PXTD 5B1AB 4E9RA 2PCYA 1GP2B 1AACA 2AH1A 4GXFA 2HLEB 5CXBA 3SHFA 4J8GA 4L1QD 4NERA 1MDAA 3IJ0A 3WI9A 1AANA 5B1KA 3IIWA 4ZOVA 2BBKH 5HE1B 3JRPA 3AFCA 2Y69B 5EMMB 2DV6A 2H3XC 3IKOA 3FU9A 1ZPUA 3QJQB 5LDUA 1RKRA 2VM4A 3ASNB 3FSAA 1BAWA 2Z2PA 2Q5BA 3HFQA 4XEIC 1WS8A 1ASOA 3SJLD 3NJLA 1RZQA 3OMAB 2H13A 1J9TA 2I3TA 1NZRA 3TBBA 2VSKB 5C2VB 3PXSD 4J73A 5CXCA 5EAPA 4W1TA 1E67A 2HX9A 1AZCA 3JPXA 1L0QA 3I8EA 2PPFA 1OLZA 1TBGA 4X60B 4D6VA 4A66A 4YSEA 2OVPB 5JWZA 2IDUA 1JVLA 3SBRA 3EI1A 3FRXA 3JB9L 4YSRA 2OIZA 5CXCB 1NTDA 4E9WA 3A0FA 2VM3A 4TZ4A 2TSAA 1MG3C 2YXWA 1U2VC 4DP6X 4K9JA 1GXRA 2B5NA 5EMJB 4E9TA 4XYIA 2GC7A 3S8FB 4GGDA 2H3XA 2GNQA 5I6MA 2FQFA 3FGBA 2FQDA 2XYBA 4J79A 2BHFA 4CSZA 2OJYA 4EWRA 3JAMg 1JVOA 2AVFA 4A2FA 3AL9A 1WAEA 2Z2OA 1PY0A 3L4OD 4KO5A 4DP8X 2GI0A 2MTAA 1ILUA 1L9RA 2PP9A 2HX8A 2W8CA 4P5RA 2DYSB 3X1EA 1JMXB 4KOCA 4DPBX 2CAKA 2BCJB 4J8BA 1KDIA 1SJMA 1ZDQA 2XLLA 3MBWB 5TK2A 4JKNA 3E0CA 4GQ2P 4JXMA 1HFUA 2H47C 1VLXA 1MG3A 4FWWA 4U1EI 2XU9A 3OL2A 4J87A 1ID2A 1KGYE 2QT6A 4GP5B 1SNRA 3X1NA 1PBYB 4R7AB 4BWWA 1GR7A 3ERXA 2FT8A 3PSLA 3GREA 2VSMB 3OQRA 2YAMA 3N2JA 4GP8B 3L45A 3WNJA 3EU7A 4A2MA 4E5ZB 1E30A 1PAZA 5CXBB 3X2QB 2H9NA 5FKTA 5B4WA 1W6LA 3RMZD 3TU6A 1ET5A 1X9RA 2IAAC 3NSCA 3OMIB 2UXVA 2IURA 2P9UC 4X4KA 4QRJA 2W88A 3PVWB 1AG0A
chains in the Genus database with same CATH superfamily
4XPAH 4OZHF 2UWEF 1E3ZA 3MLPA 3F2LA 3ZZQA 1EERB 2BY0A 3VGAC 3LV3A 4CAGA 1HH6B 3AG4B 2HA1A 1U42A 3QUXD 4LDEB 5TK4A 5EUKB 2ZCKH 4TNFA 3EHBB 5FHAH 1XD1A 3QUMB 2FDBP 5DVNA 3SGJA 4DGUA 3OLGA 3IPBA 1XGZA 4R4FL 2H6QA 3VD5A 1XZ0A 3MRDA 1RK0A 2IF7A 1TJHL 4K3EH 2CO6A 1B9YA 4M5TA 5PAZA 4KHTL 5IKCB 2AGWA 2X4PB 1X7QB 1IKFH 5DFVC 3WV0A 1MIMH 2IWFA 3DX3A 3C6LA 1FZKB 2VN5A 3W39B 4O2FB 5JMOC 3AS0A 3E1ZA 1CGYA 2OXGA 4JFED 3S2AA 3WTSA 1TZHA 2QZ5A 5EU7E 3P77B 3WE1A 2WANA 2YC1A 5AB2A 5D2NE 5FYJU 3KPRE 3CMGA 1AOHA 1J8KA 4PJAE 2AZUA 3BAEL 1EO8H 2Z8RA 2H1XA 5TH2A 5L7XL 2DQHL 2NY3C 1TQVA 5CJBA 2NW3B 4ZW6A 3ZIMA 1OY3B 3HLAB 1MLCB 3II2A 2BDNL 2O61A 3LKRA 3HN8A 4XMZA 4MRCA 5FA3B 2GIMA 1OCOB 1NL0H 1GYWA 3V6BR 2XVLA 2AGYA 3FTVA 4HKBA 4RRPM 1I3GL 2DYPB 2YMXH 4GOSA 5DUBB 2YMOA 2C3VB 1YEKL 1INDL 4M03A 3WMPA 3DXAE 4KQ3L 5GRUH 1P84K 3KLAB 3FOLA 1QBBA 4P07A 5HHQA 2HPOA 1IBZA 4ZSOB 3RDTD 4HC1L 1A7RL 1FFNB 3PWNB 1T2QH 3QDJB 4B5EA 1QHOA 5J13C 7PCYA 3ULUC 2EXWC 2IADA 3V4PH 5K39B 1G7QB 1YNTF 5DUPL 3KXFA 3MLYL 1HINH 1C5DB 4MJ5B 5TF0A 3EO1A 3OKNB 4KBPA 4E9LA 3ATBA 5J1AA 1RP8A 5KN5A 1C5CH 1FGVL 4WTZG 2VH5L 3QCUH 2ZOTA 1QSFE 4WWKD 4HU8A 3X3FL 4B41A 4QXUL 1RH8A 5EU4A 4NC1C 2DM4A 4YO0B 2GY5A 3UOAB 1D7FA 1XF2A 4FQHB 1ZTXE 3OR7B 5DO2C 4R3SA 1VIWA 4YLQT 4M1GH 1NCAL 3S0PA 2V9UA 1HZHL 1KTDA 1XR8B 1YJDH 2A1WH 1CG9B 4NQVB 4NPKA 3S5LB 1FVEA 1N2RB 2EDXA 4NNPH 5EN3A 4ZFGH 2FLBT 5AW8B 5C0BA 4IMLB 4G3YL 3VGAB 5DJDA 3KW8A 4WNQA 3R0MA 3VCLB 2CNZA 4GAAA 4JG5A 1C5BL 5DJ8B 3IJ1A 4QT8A 1I53A 4U1LA 5JPMB 5HI5C 2FHCA 5D93B 1T22A 3REVB 3T65B 5IV2B 4HS8L 4FLHA 4JNXA 3PCYA 3PWLB 1SQ2N 2ZYIA 3VW3H 5BUGA 2R7EB 4NQCB 1QW8A 4WK0B 4OY9A 5I26A 4RAVA 1KTCA 1IB5A 4DCQB 2OMBA 3IFOB 2NY2D 2VLKB 4J5VA 3N43F 1F2XK 2H14A 4XNDA 3D39B 1IL1B 3C12A 4K7FB 1G6RH 2DTML 3ISWA 5IKCA 3V6ZA 1JYXA 4KRPC 1T6VN 3FT3B 4QRPB 2EXSA 3GDBA 3PDOA 4W81A 3FL7A 4R4NC 1VPOH 4X99A 3ZHDA 4H88H 4GRWB 2P24A 5C70A 1NCJA 4LCYA 1RU9H 5HJDA 1TVDA 4PS4H 4TVSa 3RI5K 3ESOA 4BFNA 3LJ3A 3LMJH 3C5SA 2OCJA 5HDQL 1LE5B 1UQSA 1SVBA 5F8RC 5FW7A 5IJBC 3VFWA 2FSEB 4WKXA 3HCVA 3IVKA 1XGRA 1A7OL 3HRZB 1S7UA 1E43A 4Y4HD 4F20A 5H1MA 5DUMH 4M00A 2UYLA 4XNQB 3PFUA 4XPAL 1UA7A 1F4XL 3SBQA 4NZ8A 4MSWB 2N1KA 4G80A 2I07B 5DHVB 2OQJB 3GO1H 4HMDA 2QSTA 1V10A 3FKUS 3B9EA 4Y1SA 3GMOA 4JFEA 4AGMA 1J1PL 3GC3A 5GZOC 1MNUL 1SRDA 1TKWA 3OAUH 4AIXA 1OCWL 1B0IA 4KOBA 1G7MA 4NFDA 4LDCA 5D4IA 4ZMNA 5BZDB 1XAKA 1PZCA 2GBVA 4NO5A 2YNOA 1BZ9A 5TE6L 1BAFL 3TL5A 3LOWA 4AQ8C 5GZOA 4LSQL 4H26B 1HXMB 2LFGA 1LO4L 2DI7A 3MRIB 3BWZA 4HETA 5JR1L 3QI9C 5JIHA 1PGUA 3TNNA 1QFUH 1RD6A 3ARGC 4DO4A 4TVPE 5HI3D 4GW5A 3GD1C 3OVUB 3NIFA 4BXVA 4CUCA 4AL8C 4HIIB 3WFBL 4P59L 3VXNB 5BV7L 1NGQL 3BD3A 5L7XH 2ADJA 2R29L 2Y07H 1P0SE 2J2ZA 1BXUA 1NA8A 4K3DL 4X4YA 2BZ7A 2B1HH 3N9GH 3PWUA 5HVWA 1TEGA 3IURA 3G5YB 1X5JA 2XV3A 3T6WA 2I5YH 1WWAX 3BGFB 3QPXH 4CC4C 4K73A 4RGMC 4YSOA 4JFDD 4YVDA 1EBPA 3Q6GH 5E51A 4Y19E 3BRFA 5GJTH 3UJIH 4YFEA 2F74A 1KEGH 5LXGH 2JJWA 5G5DA 4D8PB 3MRBA 5GRUL 1JD9A 4HGKC 3MLWH 4H8WH 2YMTA 5CGMA 1G7LA 3AUWB 2NY0C 3BIBX 3T2QA 1G6RL 5EUOB 3AL8B 4G8EB 1T2QL 2FR4B 3BAWA 4IU2B 3B2MA 1A6TA 3EH2A 4ZX4A 1YN6B 4FQ1L 3GSNA 2AEQH 5IJVA 5LUMA 1RJYA 1DLHB 5D55A 5J5EA 1S7QB 4MX7A 5D9SA 2OCCB 4B0MM 3MGOA 4XHJD 1UOPA 4B6ZA 1SOXA 1E27A 4N0FB 4EOWL 3ISRA 2IQ9H 2H2SD 4MMXA 1VA9A 1GSKA 3LRGA 4M8RA 4JGUA 1ETB1 3MLXL 2XQYK 3WIFA 4WWKC 1HXMA 4F7PA 2RIKA 1UH3A 2OSLA 3L3JB 4U1KA 2FE0A 3D09A 3T0WA 4HK3J 5AW5B 3QDMD 3SE9L 2AQSA 4EUPH 1NFDB 2BP8A 2UZPA 1KCUH 4F58L 1NCAH 4HXAH 3GD1I 1W8EA 1KIRA 4L4TE 1B4JL 3NIGA 5FDYA 2JCCB 3F83A 5FXYA 4YR6B 1KPUA 1MKFA 2P48B 2FO8A 4G8AC 2RGSA 3CE1A 4Y19D 5EA0L 3KWTA 1J8SA 3ZZLA 4BK5A 1CXFA 4DEPB 1Z3GL 3GKWH 1Q9LA 4NN6B 1EAJA 4PJHA 2D7TL 2UYLB 5CJOH 3AACA 2XXCB 4P2YA 5I1AA 3KYNB 3EZJB 4NFBA 4YHPA 2IPKA 4ESKA 1KBPA 1JWMB 4HU2A 5CS7A 3RGVC 1IT9L 2D73A 1YR2A 5H14A 4Q6YA 1K5NB 1IQWL 2ZX9A 4NHCL 2W0KA 3ZMEA 3JWNH 4HWNA 1PLBA 2BIPA 3BSZH 4N2EA 2G5BA 5F7NC 1EFXB 4ZUTA 3FRPG 1U3HD 1INEH 3D2UB 5FKAB 2H7WA 4KRPD 3RTQB 3EH5B 5CYKA 2CLVB 1JHTB 2DY2A 4LPCA 4S1QH 4IKKA 4QHLB 1IEAB 3RURA 2WBJB 2K9UA 2HAZA 3DUHA 3FH7A 4AQZA 5LXVA 1A22B 4ZAKB 5C7XL 1RZ7H 5EOCL 4W9LC 1UZ8B 2BO0A 4JUSA 4KH2A 3KL3A 2PWGA 3JYBA 3G6AB 3ELQA 5LWYH 1UEMA 2OXHA 4L3EB 3SIKA 2V5MA 1F2QA 4WCYH 1MVYA 4JO4H 3VWKB 3HC2A 1QLEB 4OLVH 3CIKB 4KRMB 3QDMA 3IMWA 1OSEA 3TA3D 2A4ZA 1H6TA 4MXVE 1XV8A 5E4EB 4PGZA 2F58H 4YGVA 2ZOUA 5E9DD 4AY0A 3VGZA 4FOMA 1BWMA 2W80C 1LD9A 3QUXC 3PDDA 3WEAA 2H47A 3FO2B 1K4DA 1E4XI 1H3TA 1E65A 2OI9B 2KZBA 3D6GA 4PJDA 3N42F 1ZVSA 1BJMA 4N68A 3SDDA 4YDKH 3QULA 4BP8A 4LVNB 2D31B 4JN1H 1EV2E 4D0CB 5IJKA 5I1KH 43C9B 2BLFA 3MJ8A 4ZOVA 3EJUA 4BYHA 1ZPUA 2OKMA 4YUEL 4J39A 3FSAA 1DDHB 4XNBA 4RAHA 5KSUA 3C5XA 3GF8A 5HDBA 1WS8A 1F02I 1OO2A 3SKNA 2WXOA 2H13A 3GJFH 4QXWA 1WFNA 4LCVA 4B97A 3RPKA 4NO0A 2APFA 2Q8AL 2H0JA 4R7VA 4Q4IA 3WO4C 3LH2H 4HV8A 4GRLD 1S9VA 2O6EA 1P5VB 3QPXL 5ETUB 3VXUB 1TBGA 4J3OC 3SBRA 3EJTA 5K9KA 3G9VA 4WDIA 2BHUA 1IKNA 3SY0B 3DTXB 1T6BX 3PWVB 4ZXBA 5KVGE 5BV7C 1SUJA 3IDNA 4NQSB 3WFHB 2HRPL 5J1TC 1JNLL 3I6LE 2HJLA 1FRGL 4MJIA 1T3FA 2XVGA 2VAAA 1D5BB 4JO1L 2JCCA 3RVUC 2Y06H 4JPSA 2E3VA 3VG0H 3DBXB 3CSYA 3T3MA 4N5UA 4RVBA 2AKRA 2W92A 2BHFA 4XXCC 5JHDD 4XBGB 3MA9L 5GSRB 4B9GA 1OAUL 4YDIH 2HKFH 2VSCA 1R3HA 3MACH 4PJ5D 4XNAA 1A7PL 5DTFB 4GQ9L 3X1EA 4ZMZA 3CJJA 5KVFL 2XDHA 4DPBX 5T5FL 1KDIA 1KJVB 2VR6A 3MBWB 5FIEA 4WGKA 4PJFF 4PR5B 4UU9B 2XU9A 4NQDE 1PZSA 1R5IA 4YPGA 5DJCB 5SX4I 1LWHA 3OF6D 3N2JA 2GJ6B 3L45A 2VR4A 3E6HB 1ZLSH 3JYCA 4NO3B 1PIGA 5CILH 2W88A 4EZLA 1KLFA 1H6UA 1LMKA 4NI3A 1JXDA 3VJ6B 1F18A 4Q74A 5DK2B 1NCWH 4MA7L 3DX4A 3H0TB 1WK0A 2WOYA 1OCRB 4DAGH 4TULL 3N0PB 1IGMH 5KS9A 1JMXA 1S4UX 2DIAA 5G4OA 4GQ1A 1QPPA 3TC9A 4OF0A 4P3DA 1IEBA 4HIXH 3V5HB 2P9LC 5T33L 1PI6A 5JOEA 1UD4A 3U36B 1ZV2A 4BFEA 3NIDE 5T1JA 3TT3H 2C7UB 2JB6A 2DQGL 3HPLA 3BFQG 3A6BH 3TIEB 4AW4A 1T7YA 3TZVC 4TYUA 2GC7C 2LT9A 4NZUH 2DEWX 5IGXL 3SPVB 1D5IL 3DOHA 4JFPA 4MWFA 3RPBA 1QTYT 4HS8H 4H5SB 2DICA 5JW4M 3H4HA 5LBSH 4UI9R 3ULAB 3BZFA 3HUJB 3BVUA 5JW4Q 4A7JA 4WFFD 3CDGA 4BFRA 4HXBL 2VN6A 2VW6A 4XNZC 5AW1B 1TQWA 3OZKA 1RERA 4OCXL 1WHPA 2EUWA 3QUYC 2NX5E 4H88L 2WBJC 2AS5M 4PS4L 4J84A 2BVYA 4KY1H 5D1QE 1NIDA 3ABZA 1J5OL 1RSFA 1U2YA 3QORD 1EXUA 1L9TA 4L23A 1BBDH 3T1FB 4NM4L 1AS7A 5FLXg 3L3DA 3O2WL 2FWUA 4PVLA 4U1GB 4UQIM 2NDFA 2BINA 1AIFA 5C0JA 3A6CH 1R19A 3MUJA 1C5DA 2VUOA 4HK0A 4UUJB 3C60B 3UTZA 1D5ZA 4D8OA 2EIJB 4HGMA 3ULUF 4RX4A 4K3HA 4TQPA 5HGHB 2ARJQ 1DL7L 4OCMC 1A4BA 4A6YB 3RSEC 5DD5H 1ZGLM 1BXVA 2VDPH 2XN0A 2KUTA 2IQAB 1QFMA 3KDMA 5GISL 1TYQC 3HJ0A 4FI7A 3VFMA 5C3TA 3G08A 2P9PC 5D7SL 2WNGA 4FQCL 3FT1A 1QTPA 1BZ8A 2LU4A 3AG1B 4HFUL 5BO1L 3JWDL 3WL9B 3QUHA 1BQRA 2ZSVB 2MMXA 4FB1D 5DD6A 1I7RA 5M5RA 4ZSOE 4BGDA 3WIAA 3JXAA 1FLRH 3CVIL 4KVCH 3C08L 4XWGH 5CYKB 4FKKA 3ULVC 2BKLA 2QFPA 5HHNA 3QHFH 3SDXE 3F6LA 4KKLC 3O8XD 4Q97A 1A25A 5C0EA 4AWJC 3U9PL 5IFJA 2YK1L 1E5CA 3PL6C 1I3VA 1MCPL 4AGLA 2BNQE 2B14A 1G0DA 4XGZA 3U46A 3AAZA 2GJ6A 4XAKD 1XSOA 1BF5A 2H3NB 4NCC1 1OHQA 1SMDA 1BEYH 1T1XA 2DQFA 2VMDA 4Q6IB 5AB1A 3MJ9A 3TIDA 5IQOA 2NY0D 1AH1A 2I5YL 5DRNA 5D1XE 1JNLH 3J80g 1G9ML 3MV8E 5CP3H 1M1SA 5KYYB 3TESA 4MCMA 4QIRA 3VO0A 1UZ6E 2BCMA 1UWGL 5FYLD 4MKTA 4X4MA 2BVOA 2F68X 3BSHA 1LQBC 5GRXG 1S7TB 4HUUB 1GY2A 4PJEF 3QQ3B 3L1FA 1JMZB 2FUTA 3WN5C 1MAKA 5M5VA 5H2BB 5HJGA 2KLTA 3VA6A 1SHMA 2EABA 1Z9OA 2PCPB 2ADIA 4MLSA 4TTDC 5K33A 1KTRL 5INCB 2EXTA 4PJ8C 1R34A 3SKOB 5FGBA 5FAAA 4KUZL 5GGVH 4R90H 3W15A 2J56H 3FJTA 5DYFA 3K6FA 4XOBA 1UTDA 1NOLA 4V2BA 2N59A 4FXTA 5AKTA 3S36H 1A1OB 2D31A 4YSCA 1IX2A 4DKFH 4HG4K 4IGBC 3J2PA 1OM9A 2M1KA 5KG9A 4WHTA 5CU5A 1ZHBA 3DUUA 5IP4A 2YN3A 3T0ED 4TNVF 4JJHA 1R5VB 1XMEB 4ODUA 4IEFB 5D7IF 4EMZA 4NO5B 2C1OA 3EDEA 2VDPL 2JSFA 2CO0C 4S1DD 1DEEB 3UBXA 3X13B 3MV9B 2G75B 1X5GA 4XCYA 1BXAA 1L9NA 3RL1A 3QUYD 4FQCH 4HFUH 1BMGA 2ESVE 5JXAL 2VSDA 4KHTH 4ZXBB 4ACPA 1V3KA 3BMWA 2AJ3B 1HJCA 1NM9A 4MMZC 4WW1A 5HHVH 2P9SC 4MZ3A 4OQTL 1ERJA 2NW3A 3QDAA 3OJVC 1RVFL 1RIHL 1ECZA 1KTLA 1U95B 3CPLA 3NSDA 4ZTEA 1LE9A 4L29B 1KZYA 2J2ZB 1X5FA 1BQ5A 3CFEA 4KK6C 2A4CA 3VI3B 1RZ8A 4LHUA 3BD5A 5I82A 3KPSB 1A3RL 1G7JA 5I1GH 4Q2ZB 4KY2A 3OSKA 1NOFA 3S35L 5C97A 4A2EA 4QRUB 2KZWA 4AKPA 5J11C 3F05A 1MCWM 2VE6B 1QSZA 5T1DL 4U1MA 2L3BA 5IESH 1MZYA 2YUXA 5I1LB 1NBZA 2JCWA 5INCA 5JIQA 1RZ7L 2LLNA 3GB7B 4WWOA 2YAFA 4Y4FD 3L5XH 4JQVC 5F1NB 3ZGIA 2RCSL 3TTYA 2AGJH 3CFMA 2IEPA 3WD5L 3TPKA 3FB5A 4EI6A 4K94C 2GJPA 4AK1A 4JHNA 1DANT 4F9PA 1Z9LA 3DGGB 2BIOA 2O9KA 2DPKA 3CLEL 3U6XA 3NCCB 4L8BB 4P9MH 1I9JH 2PN5A 3ARBC 1TITA 3N0DA 2B08A 3L5WA 2B4EA 3UPCA 6CGTA 4HD9A 2AQPA 1DL7H 2VXQH 4OF3A 4IKJA 2MCAA 2ESVA 2ROYA 4GM8A 3FU7A 3HW7A 3UAFA 1H2ZA 1Z1WA 4NEHB 2Z31B 1KCKA 2BS8A 4WIQA 5CNHA 4FFYH 3O9WA 1L9PA 2HXCA 1R24A 2ZSWB 4BCZA 1MCSA 2F2HA 5ID1A 5C0AA 3K0YA 3PGDB 2ZPKL 4L9DA 3SZKC 1RULL 2J6WA 3FT4A 4I0PA 1ZE3H 1RXLA 2F19H 4HSCX 3DPBB 1YRKA 5C0BB 3FO1A 2O26U 4PTTA 1FC1A 2DAVA 1MVUA 1LO3H 3QIWA 1FF5A 1JHKL 1BD2B 3GSWA 4DW2L 1HHGA 1KTJA 1HSAB 3UVMA 1DVFA 4YSQA 4OQ1A 1W72H 2EH7L 2P7TA 3BVNA 5A2LH 5SWSB 5HHVL 5B4MC 4ODWA 1MPAL 3BWSA 4NLAA 3D85B 4HHGA 3F7VB 1JZ8A 3KEDA 1RUQL 4Z7UA 2EDNA 1UXWB 4DGWC 1VRSA 1NOAA 1IL1A 4K7FA 5PCYA 5HXMA 1N0LA 5F7BA 3ZQ9A 3HR5B 5I24A 4FQ2H 2G2PA 1NPNA 3VXRB 3EWEA 2D0HA 4DP9X 4IBQA 1WWWX 3X13A 5C0JB 1DQJB 4RA0C 2JCCE 3OJMB 3WSQL 1FDLL 1VADA 1JF5A 4OSUL 5JPNA 4HS6B 3EJSA 2Y5QA 3DX1A 3W11D 4B7IA 4Z76B 4WUUA 3LHAA 3ET9F 3FSVA 5MENE 2ENSA 4PGBA 5CCGE 4DQAA 2DQDH 4NRZB 2VLKE 1ORSA 1SXAA 3HHSA 1XF4B 3CFJB 2XY2A 4JFXB 3I6KA 1HQRB 5EU3B 1MQKH 4S2SA 1NM4A 3GSNH 3UYRH 4ALAL 1MHHA 3QDMB 3PNRB 4PJXA 4AE0A 3NRPA 3CLEH 2GT9A 3AREC 1ND0B 5DLML 2DJMA 3GRWL 3EXLA 1Z9PA 4UCFA 5T1KD 4DKTA 4CJ1A 5I6OA 3BN9D 1QACA 2YSSB 3ME0B 1JFHA 1YMMD 2WGNB 2OK4A 5C0NC 3DURB 3LIZA 6FABH 5TH2B 1MNUH 4AIZA 2VL5A 1DQML 3Q2NA 3DARA 2DLGA 1MLCA 3WGVB 1K4DB 3QDJE 1E4KC 1T89C 1JZ6A 1U8QA 3LNDA 5GZNC 3IPEA 1GYVA 2J20A 5E9DA 3VXSA 4XGZB 4JFTA 4Y16C 4XN8A 1KPRA 4K5NA 2PYEA 5IY5B 4BINA 5KBPA 2ZPKH 3D5OF 3GMRB 3ZDXB 1E4KA 3KCPA 3CFUA 4H0GA 2V5TA 5FO8A 5KSAB 5KYYA 4Y16A 2JQMA 5C0CD 4BKLA 2VUKA 4GXFA 2B2XH 1KYUA 3KPSD 3WI9A 5CGTA 3SGKC 2RBLA 2VDNB 2HLFC 4P23A 5BRQA 1UUSA 3WUZA 2OMVA 5GS1C 4XMKL 3W5NA 4FDWA 3TWYA 1P7KB 2AJYL 4HWUA 2Z7YA 1QRND 2W91A 3IDIB 3CVHB 3EYQC 2R69H 4ELKB 3JVGA 4UOW0 1JS4A 4U0QB 4NKOA 2HX9A 4FNLL 4Q6IC 2FIKB 1RUMH 1FC2D 1TDQA 1TQTA 1IU1A 2PPFA 3B7TA 4R7DB 1BJ1J 4Z8FH 3KPOA 5FM5M 2E9GA 1HL5A 1WYJA 2YA2A 1UG9A 3CK0L 3PJSB 4GEIA 3LZLA 3P4NA 2RQ8A 1BMWA 4IKLA 2TSAA 3O9WD 1LP9A 4KH9A 2O5XL 1OPOA 1XDTT 2QL1A 4JO5A 5EZIH 4NQCE 4WUKL 1WD9A 2W60A 1AQDB 2VNCA 3PABA 4Y2NA 3V52L 4E41D 2ICCA 2AK1H 3S5LA 5EU7C 4JPIB 5ILTH 4HJUA 1BLNB 1FL3A 1JNHB 5AZ2L 2A9DA 2K45A 4G5ZL 4LHUG 2HH0H 4KVPA 3WKYA 3BKYL 3QH3B 4UDUA 2CAKA 1E8WA 1BA9A 2JB5L 1AMXA 2XSKA 4HIQA 4JKNA 5EIIB 3BPLB 3FH8A 4JX0A 2IH3B 1SNRA 2FUQA 2I9TA 1T0NB 2OMYB 2VSMB 2YAMA 3TTSA 1RPKA 5FLVA 4KXCA 4G6AD 5T3XL 5J6GB 1TNNA 5F1OB 2IAAC 4JGJA 1FZMB 4PH8A 2OMWA 3T0AA 2V33A 4PUBL 4JBSA 3FFCD 4JFXA 1BQHB 2R2EB 5G2NA 4C83A 1HYRC 4YXHH 4QRPD 3K91A 2WMPB 3LRKA 3V4VL 2P8MA 3RU8L 2Q86A 3KH4A 1YNLH 1J0YA 3BWAA 4XP6H 4EIZC 4UOZA 2YK1H 5KBMA 3RBGA 4BXSV 4L8DA 1X9LA 2E7HA 2DH3A 4XWOD 5KYXA 2VT0A 2EDOA 4HH9B 1ONQA 4EO5A 2BWDA 3FM0A 1X5AA 3H6AA 4LBEA 1SEBA 5H37H 5EWIH 4AJVA 1CL7I 3FC8A 1E8YA 5C0DA 4YDJB 2UXFA 3IGKA 2CHZA 4FRWA 2V17H 1VCBC 3GPEA 4WEBL 4PJ9D 5IJ8E 5IEKB 4X5XB 3N50A 2EJ1A 3S8GB 2FATL 4TQ8A 3X12A 2FL5B 3FU3A 1EIBA 4IJ3C 2J73A 3PABB 2D2CC 2RFXB 3C8HA 4M9PA 2XG4A 3M7OA 3DX7A 5TQ2H 4Z8FL 3L9RA 1UXSA 3NIFF 2CBOA 5T3ZE 5EALA 3LQZB 2C3WA 4IK6A 4MFHA 2CDEA 2BNRB 4WU5A 5IVXF 1BXXA 2PUQT 3QCVL 5TDOB 2X9WA 4Y7RA 2HRLA 1RI8A 4X7FC 2R51A 3O4LD 4OLVL 5AL8A 3K2KA 1UOWA 4XP9L 5JA8B 1CBJA 1E6JL 5DD1H 5H4YA 3FRPB 4LPUA 3FO1B 3NZUA 2GAZA 4A0BB 5B22A 3HI6H 4XNXL 2P43B 1NCBH 4H1LB 1IC4L 2OR7A 1WRFA 4GEJA 4PJGE 4C47A 5EIQA 2XIIA 3KPMA 4Y4HC 4AX3A 4N86A 3V9EA 1U8NA 1K8IA 1HXYB 1OTUC 1HH9B 4ATTA 3GI9L 1UOLA 3G5XA 4JZJB 2W38A 4RWHA 4YE4H 3QK0A 2Z91B 1UYWH 1LEKB 1HDMA 4D9SA 4PGEA 4OV5A 4R7LA 1JZ5A 4F37F 1G9HA 5F7WC 1CFVH 3OR6B 1IVTA 1ZY9A 4WJ5B 3EGXA 4UINL 4KZEH 2IDTA 1A6TB 3C6LD 2CSPA 3IFPB 5IFJB 3HB3B 3HFML 1G6RA 3L4ZA 5E08H 2VC2H 4X7TB 3IXTA 4JKWA 1IC7L 1QSEA 1OXYA 3I75A 3AAZB 4XVOA 2D7PA 2C26A 3OKYA 3Q6FB 4FFYA 4LLVB 4OZIA 1MRFL 3DX8B 4MDIA 3RY4A 1ET8A 3L3IB 4PRPE 5C9JA 4NT6A 4ZAKD 1A9BA 1VEOA 2QVKA 4JM2B 1HHKA 3TZVD 3WFBH 4X9HA 1YZZA 2L7EA 4MMXB 5FYKD 1CLYL 3DJTA 3G5ZA 3EOTH 1SJEA 3L81A 1DO5A 4JQIA 4M5ZL 4AZ8A 4B53A 3VFVB 1J12A 4AEHH 1NC2D 1AC6A 1NC4B 3MDJA 2D7MA 1NEZB 4ETYA 3QJOA 5B39G 4JE4B 3G5VA 2BRQA 2PR9A 2VABB 1MCBA 4IS6B 3KPTA 5CGBA 1E3FA 4NC2B 5D1ZA 3B1UA 2VXSL 3WXVL 3J81g 4XYHA 3ZQXA 3ARED 2ZKYA 3P0VH 3A47A 1KELH 3M1BB 4CSSA 3QJVB 2BSDA 4IMLA 1OAZH 1CI3M 2GAZB 4KXAA 4FQLH 4OFYD 5E4AA 1F11B 1VERA 4LNRA 5F89A 4GAJH 4W9FC 2BVQA 5KS9F 3HNVL 2IANA 1IJ9A 2DMCA 1IZJA 2N0MA 1CICB 3EHBD 5C08B 2RMNA 4WJKA 3K80A 5ITBL 2F54A 2VXQL 4QRSB 1DEDA 2DMKA 4OLXH 2DBJA 3GSNB 1IFHH 3T6QC 1P6FA 2A74C 3VDAA 5DD1L 4XOEA 3KJ4B 4U1HB 4LMQE 5J9PA 1JOFA 5EU6E 3SY6A 4E9VA 4WKZA 4PLOB 5FEBA 3AVEA 1EHNA 4XVTL 4PPTA 3ULUD 5EO1B 4UM9B 2P1YA 1TF4A 2P5WE 4NBYB 3O6KL 4ZO9A 4PUBH 1HL8A 2WBJA 1AR1B 1QFWI 1EUTA 3O3AA 4HEME 3CSBA 1XCQA 2ZCZA 4AEZA 2BY1A 2X7LA 1BM3L 1IGML 3HE7B 5EBLB 5B4MD 4NKOB 2WSKA 1YNLL 3AXLA 1S7UB 3V6FB 2WB7A 2WGXA 3D25B 2E74C 1KCUL 4W68A 3WDIA 4OGYH 4F7EA 2DN7A 2HYMA 2DQIL 3ABLB 3R4DA 3ABMB 3KGSA 3QG6B 1WE5A 1TTGA 1Z7JA 2EAEA 4MDJA 4X6DE 3OZ9H 2YGPA 4I4WB 2WVTA 2C9RA 3KPRB 3T04D 4O4YL 1AAJA 4FXGA 5AYQA 3UO8B 1B0RB 4NJAH 3LNIA 3ZL4L 5B1BB 1M1XA 5FKPA 1W72B 3T77B 5F2FA 4PJGA 3VSVA 2R0WL 4JPQA 4ONFL 3UC0L 3OKWA 1VCAA 1T03L 4PRAB 3V0AC 2KZ1B 2ODHA 5BO0D 2Z93A 5A1AA 4YDNA 2DM7A 4PRNA 4N3TA 3FS9A 4UOQA 2QV4A 4DP2X 1AGFB 2VZSA 4JFFD 4JRXE 3IJ8A 3G5XB 1CLYH 2IDSA 3EFFA 1GSMA 3HHMA 3DGDA 3C9NA 1LNUB 1B9XA 3TJEL 3NFPA 4AQ1B 4DPAX 4NXSA 1MCOL 1ED3B 4G6KL 4BSWB 1CF1A 1DR9A 3EW3B 1BFOA 4DK6A 3PL6A 2IVFC 1YPZB 4LLDA 4EN2A 2QDWA 2YD6A 4LCUB 3TASA 3Q06A 4X2UA 1J0HA 4M5YL 2ZAHA 2A9NL 3E9TA 4RFNC 5DMYA 1T0OA 1VZIA 4A38A 3B6SB 5HDBE 1XCTA 2ITDB 1IC4H 4YX2L 4DEWA 2WUBL 4Y4FC 5HD8C 4ZK8A 4WLCA 2XL3A 4G1EB 4PXWA 1MJUH 2P8LB 2CA3A 2YMUA 4UIKH 4GAYB 4OLXL 4LQFL 5ANMB 1TZIA 1ZA3B 3SGEI 3DOSB 4L8DB 4M7ZC 2DS4A 2WXKA 4U33A 3PFQA 1MVFA 4LCCA 1N0XL 4MS8D 4ILDA 5F88B 2BOLA 1RFDL 2R39A 3ZE2E 3KLLA 3T8VA 1FNHA 3RWEB 1C8QA 4J77A 2XHNA 4J23A 1T1YA 1IKOP 1D6EB 4X5WB 3QXAA 4Y2DA 4KZ0A 4TUJB 1KJMA 3D7PA 1WQVT 2G0KA 1KYAA 3VFPB 1BQLH 3S96A 1BW8A 3T3PB 1UKSA 1MZZA 5E2WL 4OJFH 4LNRB 3UKUC 1WT5C 2NY0B 2B2XL 5G4NA 3C75A 2N7AA 4JREB 1AQ8A 1X6NA 2UWEE 5FUOL 1HHIB 1JTTA 5ENWB 5HYIA 2E7MA 4J8QA 3O2DL 3JV0A 3D69B 1T0MB 5F6HJ 5HGAB 3L9RB 3X14B 1OARL 2F8IA 4H13C 4PJ7B 1YUHB 1HCVA 1ZT7A 3OM3B 1G7IA 3W81A 4TS6A 5D1XC 3I7HA 3FU0A 5H37A 4P99A 1PLCA 3BZEB 4JB9L 2WNKA 2FZ3B 4EN3D 3EBHA 3H7LA 4TVPH 1ES0B 1O7DC 1DVQA 4RGNB 1J1XL 1AJ7L 1X7SA 1JFQH 2DL9A 4NQXB 3ORJA 4IBWA 1COBA 1U36A 5IHZB 1F90L 4BUQA 5HHXH 2HRHA 3LQMA 2PBIB 5IJKC 3VJ6A 3E3QE 3Q0HA 3FTUA 3BKJH 3MKSB 4L8CB 4ZMAT 1U3HA 4GRWE 1PYWB 4ZUUB 4A6YL 5I30H 3NJKA 1H8SA 1JRHI 1NCGA 2BSSA 4I3GA 1ETA1 3GHEL 4KKBC 1R0AL 2LFEA 3KYNA 5MEOA 5H94B 3EFOB 2XV2A 2FLMA 5IFHH 5DHVH 2ENJA 1A4CA 2BSTB 4MNQE 1JJUB 3FHQA 4TUKL 2CE6A 3HIZA 4MJ2A 3POHA 2G5BB 2P5EE 4S1RL 4FQXC 4I1RA 5DXWA 2RALA 4J3OG 1SLWA 1IM9D 3MUZ1 4YBQC 4JDVB 5DVKA 3SPVA 1AHWB 2VRQA 4XP1L 5AVWB 2WUBH 5HHQB 4DKEL 2J55A 3MOBL 5HI4C 3NIGF 4H8PA 5KUMA 1IQDB 4NQEA 4OJEH 4CDHA 3EI3A 1J05B 4KITB 3KM1A 4KU1A 2Y5TA 2MCG1 3SYOA 3EQ7A 4WY7H 4OCRH 2JV6A 4OLYL 4BP9A 5D7JB 2YKKA 4J7RA 1H5BB 3PHQA 3TVMB 2FJHB 5EMYA 2PYED 4KZCA 4X80L 4XN4A 5B8CB 1BFOB 5HYFA 1IZKA 4WFGE 3QXDA 4QO1A 2OJZL 5DZJA 2FEJA 1TETL 3H3BC 5T1LD 3H55A 2VLRA 3TOPA 4E5XA 1RZ8B 4YHYB 2XFGB 1FO0L 4RZCB 2YD8A 1I1AB 4DK5A 1FAIL 4LZKA 2NNAA 2GUOA 2Y1ZA 2AH1A 3O2DH 1CD1B 3F85A 2G3XA 4LHQB 4P2QB 4GO9A 4CN4A 4R97C 3PDGA 3Q44A 2AI0H 2J6EL 4KKPA 2VUYA 2Y7SA 4OKVB 3RUGF 1U6AL 1AO7E 2VL4A 1VKXA 1IGCL 2FIKA 3IKOA 3FU9A 4PRBA 1H9VA 4NC4A 2VITB 2VM4A 5HYNB 2AJVH 4JQIH 1UD3A 4HAFA 5DEJA 1NJ9B 2PW2A 4LSTL 5TF1L 1JPFA 2VB5A 5EAPA 1RUPH 2D3NA 4AL8H 3FMGH 3ZE2B 1YMHA 5JLZA 4UQBA 4TNVK 4OM1L 4BSVA 4TM9A 3WBDA 3HS8A 1IAIL 1CB4A 4QAMB 4AQEB 4GQRA 3KYOA 3QIUB 4WO0A 2OSWA 3Q8CA 15C8L 1AHKA 2B5NA 5J89A 1Q0XL 5E2TL 1VFBA 4ETQA 1C9SA 2C1PB 5D7EA 2FX8H 1DQKA 3HE7D 3TNNB 2BIMA 3C2AL 4J4PA 5BRZE 3PGCB 1EO5A 3ARVA 3CNKA 3NSXA 3SPJA 1NCBL 2AV1B 3O4HA 5TTRA 3HNSL 3ZKMD 3MAWA 3U4AA 2MTAA 4AC4A 2PP9A 4C58B 3HC0B 3DROB 3PWPE 2OMUB 4O2CB 4XI5C 5F3HB 3PYCA 4OUUA 3GSWB 4JXMA 1H3PH 5HDBF 4L4TB 4UTAA 1UOOA 5E8NB 3V2AR 2QT6A 5DUBA 3BUPA 1DQIA 1YQ2A 2WBKA 3C6EA 1R3IH 3EFOA 5DO8A 5CJ5A 3MMYA 2A6DA 3OQRA 1KGCD 4PP2B 3WNJA 5JHLA 1KXQE 4C8XA 3BEVB 3WN5B 3AFLA 2GBTA 3LZOA 3CXDH 1I8LC 1CD1A 3VGGA 2ADIB 1A1NB 1NSNL 3MCYA 4FE9A 4I18B 4JO3L 3VH8B 4BEIA 5KYWB 2V2XB 1KPVA 1AG0A 4FABH 4R0LA 4WO4C 2C34A 5LBVA 3ZPDA 1PKOA 1SFDA 2ZP8A 3EBAA 5FECA 1MFDH 1QRNA 3IJEA 2YD3A 1KJ2H 5ESAA 1CDYA 3WIHL 2AEWA 2APXA 2DQTL 4PGCB 3FTYA 4WO4A 2HRGA 5I6KA 4QHUB 3BUYB 3KCIA 1RCYA 1CI5A 4L3ED 4NKDA 3TIDB 1Z32X 3Q8BA 4PJCF 2MEJB 1JGIA 2JIXD 3HZVB 4HQQL 4N5EC 2W94A 2HJFB 2PYFB 3UMTA 3EGDA 2H0EA 2MNWA 4KJYB 1JXFA 1U33A 1YEGL 4IOFC 4GM9A 3WNOA 3CFSB 3DSFL 2H9GB 5E4IA 5IFHL 3LRSB 1MJJB 5D5ME 3U7WL 3VI4A 1XTMA 1YEKH 3ZW3A 4RMWA 1PQZA 2LU7A 4O45A 4JDEA 1GJUA 3KL0A 1A6ZB 1NIEA 1EAPA 4HWEH 2MIZA 2K6ZA 3E1F1 2CGZA 3TO4B 5B38A 1JXKA 2ARJA 3RWEA 4E9SA 3MNWA 3WJJC 1MNNA 4FQIL 4M3KB 5K9QI 4DNLA 4W9ZA 4P0DA 1KY6A 3DXMC 4N0YH 3HMWL 4ERZA 2NXZB 4GRWF 3UCRA 5HE3B 2PM6B 1D7BA 4MB4A 5SWQA 1B0GA 2ZXEB 1UOKA 2FRGP 5ISZD 2FYVA 4YHPB 4X8JA 1KZQA 2CUIA 3NA9H 5F9WB 2FEEI 1HWHB 2V7HB 3SXTD 3B7RL 2EICA 2FEDD 3BEVA 1JGDB 2W07A 3WN5A 3WY4A 3VGFA 1TTBA 5C09E 1VESA 2J8OA 2JNZA 4EXKA 1BV8A 4Z8LA 3L3KB 5C0AE 1F42A 4Z3JA 3BZEA 2NQ3A 1CTNA 1QFPA 3NJXA 4J6IA 1S7SB 3U4KA 2VZUA 5IHUH 4A68A 4CU7A 2NY4D 5EZPA 1NCHA 3WU1A 2BWQA 2R8SH 4NXKA 3NJFA 4G7QB 4XVJL 4OZIF 4YZWA 4AV5A 3UVOA 3B9DA 3VCLA 3ZDXE 1V3JA 4GT0A 5CN2A 4A7SA 2ZXAA 2VAJA 4JRYE 2NY4B 3EBGA 3CHSA 4KKCD 5C07B 1KCSL 1PKQB 3L16A 1HOCB 4IRSC 4U6YB 4FABL 4A09A 2FO4B 2PWDA 4GW4B 4NC1E 3UBFA 1F13A 3E0GA 5T1KA 3RVXC 5MEOB 1ZHKB 3ETTA 4GSRA 4NN7C 3CTTA 3TZVB 5E1AB 4O9HL 4P4KB 5ICUA 4AT6A 3K4ZA 1CL7H 4LMQI 1JE6A 4LLQA 1ZPLA 2NXYB 4M1DL 4NP4L 2CKNA 4WV1A 4Y5VB 3QRBA 5EZLA 5I9QB 5IHWA 3UVKA 2Z8VC 3D33A 3NP4A 3GJEA 3D0LA 1ZVNA 1DJYA 4IRZL 1A3RH 5L0QB 1Z5LA 1I7TB 3SE6A 4Y5RD 3CZGA 2Y23A 5CJXA 2YPKA 1SOKA 2NXYD 3QNYB 3MLUL 4MNQA 4QD2E 1T20A 4Y19B 3SDCA 4E5XG 2ZUQB 5F7FA 5L8KB 15C8H 2RD0A 4MA1B 2OK6A 1MJ8H 3BPCA 4OM0H 2GJZA 3MV7B 4OBSA 3VXRE 3HS0A 3UERA 2GSIA 5FUCC 1ODAA 1E9QB 3D06A 4XBMA 3WNKA 4C55A 1NR0A 1Q1PA 1L5GB 5M94B 2C3GA 3WEXA 1MAJA 2LR4A 1NLDL 3DTUB 3RLMD 2CO2A 5DZLA 5L2KB 3ZE1E 4Z7UB 3W38A 3KDPB 2BFVH 2RHEA 5EO9A 1FN4A 3IFLL 4QRRD 5FPIA 1NMCC 2HP4A 4GKNA 2SODB 3C6LB 4JGMA 5HVHB 2PMZA 1O6GA 1GS8A 2FO1A 1JUFA 3MROB 1Q9WA 2PXYD 4OD3L 1G5AA 4RISH 4N8CH 3ARRA 2QHRL 1S9WB 3LZQA 1DJGA 5DQJA 5E5MA 4MQTB 2AXFB 4ZFZB 3SQRA 1V5JA 4MYPA 2YMXL 2JVUA 1SVCP 2VW4A 3Q1SL 2I9LA 2WKLA 4Y4KD 1DQQB 1I8UA 4ZNEA 3HJEA 1BVKB 5BV7B 3KL5A 4Z7QF 4AN1A 3KRWB 2YPLD 5IMOB 1INQB 3BFOA 4PBYA 3BP7B 4NN5C 1I1AD 2CXKA 3QFJA 1UKQA 3O9WC 1E27B 3K81A 4O51A 1EQWA 1S9YA 4IOSD 5AFU3 3QJFB 1W9XA 1FGNH 1KT2B 1OAQH 3Q9PA 4MJHA 3U2SB 4U1SA 2WB1A 4R26L 3WHE1 3GSRA 5TD4A 5DVOA 5I1IL 3QWRD 4EUPA 1X5IA 2FHFA 4JS7A 3VGHA 5BMFL 2Z7UA 3HAEA 2B0SH 2GUYA 3NH7L 4PGDB 4WNQB 3RWDA 5DVPA 3RWGB 1VSCA 5LXGL 5FO7B 3WUWG 1A4KB 4UQAA 5JQ6L 5FFGA 4F57L 5C71A 3O45A 1HKLL 1TG8A 5IB3A 2LU5A 3FFCB 3FUIA 1LO5B 4OSUH 5J1AB 4ANUA 1IAII 2NLJA 3IFOA 3JWNC 2R23B 3ZHLA 3QIUD 4XP9H 2V2WB 1NCCL 2F7OA 5JXEA 1OF0A 2VOTA 5CR1A 1XF4A 3TV3H 3DX9B 2VR8A 5FA5B 3MRNB 3VXPA 1HT6A 2CJTA 4AW7A 3H1ZA 1PVHA 5I0XA 3V10A 3BQUB 4P2QD 2E75C 2GC4C 5DLMH 1FVCB 4A08B 1UT2A 4HDIB 2IH8A 1PU0A 4QRFA 3U7YH 1F0LA 4DVRL 4UV4L 3STZA 2QV2A 5E8OB 1NPJA 3GXMA 2O6CA 1DQMH 4LSSL 2VDLH 3DGGA 4QHKJ 2XTJD 3A67L 3W82A 3L1GA 1SYSB 1QFWH 3SKUD 4NYLB 5F9JA 5HQGA 2DIEA 3ROOB 4JHWH 3AG2B 4ZDHB 1J7VR 5ENWA 1NDGA 5HHOA 3X11A 2UZYB 2DWEB 5KYUB 4ZPVA 5MEQA 4JW3A 5ICXB 4KNSA 2ZG3A 2BIIA 4KTEH 3F7QA 5EBWA 1DVSA 1TU2B 2YD9A 4BDVB 1XF5B 2AABH 3ALXA 4G7YL 5FM8A 5D2NB 3SOTA 2NZ9D 5AD0A 1TQBC 3SDAC 3D4GA 2IV9A 1YAIA 4UMGA 2JJTA 3IJYA 4ZOAA 2NY6D 1PY4A 3IKKA 4NB7A 2Y5EA 3ATDA 3KYAA 5AVUB 5ACZB 5CN3A 2D7NA 3W3BA 2KERA 3GRGA 4XMKH 2AHIA 5BW7C 2ED7A 3MJ7A 4ENED 2Q10A 4HPYH 1GAFL 4XXDA 2EACA 3EYUH 5GRJH 2F1EA 3KEHA 5E5MB 1H15A 2JELL 5EOCH 4OAWA 3NJJA 4RMVA 3F00A 4WWKA 2XU7A 1RZGB 2A0LD 2A9AA 4FQLL 4E2OA 1DYZA 2ZUVA 4JFEB 3STLB 3BZFB 1NICA 1CZ8H 1NMBL 2CCLA 3VX0A 5ABZA 4ZX6A 3C5MA 2EIZA 4JPVH 5D70L 3VFNA 1KB9J 2WBJD 5DD6B 2XN9A 3VXME 5DRWA 4B7LA 3QGVA 1S46A 4W6YB 4BZ2A 3EYOB 3UGUA 1XIPA 4LVOC 4MXWL 4P2CG 3CD4A 5TE4L 3AMKA 1BZ9B 2VJXA 2JCCF 3D12B 3QIBA 1RJLB 3PWJB 3DIDA 4U1SB 3LHPH 1AZUA 5C0RH 5C0EB 4TOYH 4WEMB 2A73B 4Z0XA 1PSKH 2OK0L 2IXQA 2GEEA 3BKYH 3EJRA 4M6NL 4DJMA 1ZV9A 4GRWH 3AXLB 5I15H 5HGBA 2EDYA 4FCHA 3T71A 2X88A 5D7JD 3FQXB 1E4JA 3QR1A 3FQTA 4RCAA 4KWUA 1UATA 4Z5RB 2OMTA 4OFPA 2E9JA 3ZZ1A 1ZKAA 4X5LA 4Q9CA 2CE8A 2F7QA 1CF8H 4I4WA 3V55A 3LZNA 3UJIL 2ICWA 3S37H 4KJPD 3OW8A 4U1KB 1IV8A 1ML0A 1PX4A 4LP4A 2E56A 2DQIH 4U7KA 4Z7UF 5TDOA 1OF2A 3MRRB 3BH9A 1L6PA 4Y9BA 3UGEA 4E36A 5B7EA 2HXAA 2YSSA 2Z3FA 3ME0A 4PJDE 5DQ9B 2VXUH 5T5NG 5DD3H 3ZE0B 1WTLA 2QZQA 5EMKB 3B2VL 3DO3A 4F3FB 2VZ3A 4LCWB 3B9KB 4UU9A 3P4FA 1JWSA 1XQ4A 3WNPA 5F7AA 1N18A 3RE0A 4ZQTA 3HS0B 1RZJH 4PLNC 4QAWA 2VDNH 5B1AB 5HDLA 3SHFA 5C09A 4R4BA 1EJ8A 3RL2B 5D1QB 5B1KA 1PIFA 4Y2DC 4YDJA 3HZKB 1YN6A 1EDHA 3QUML 1MELA 4FXKB 3B7SA 1KXTA 1RKRA 4IIQB 1E4WH 4B3VA 3QI9B 4P4RA 2VDRH 1AR1D 4WI6A 1A6UH 4APQA 4IHOA 1M2OA 2CRYA 1KGXA 4FKHA 3PXSD 1CK0H 3IJHB 3HG0A 1PZ5A 3IDYC 1KGWA 4XB3A 2Z7ZA 1OSYA 1TMCB 2EE3A 4L4VD 3BLBA 3RVWD 4GKZB 2QKIB 1EUUA 3E8VA 4PCSA 3FQNB 3FRXA 1YNTB 4JY6A 1HQ4A 5F9OH 3TWCL 4W6XB 4JPVL 1KLGA 2AEPH 5D5MA 3VI4E 2ED6A 1ZLDA 4OZIB 2AV1A 1FFOA 5EBMA 3DDGA 1YPZE 2C9PA 1KIPB 4JFPB 1U8MA 4MWFB 4OTXL 4PJ9A 2YRPA 3CSPA 5TGBA 3QNXA 3HAEG 1IM3D 1Y6KR 3CFCH 2OJYA 1WZ1L 1J11A 1EO8L 2AVFA 3PHAA 4XNXH 1NC4A 1KBGH 3H6JA 1PY0A 1TVHA 3L4OD 4KO5A 1NC4D 2B5MA 3M8OL 3NFNB 4P5RA 2YD7A 1JMXB 5EMMB 4TUUA 4KRPB 3MRHA 4RSVA 1K5NA 3IUNA 4PJHF 1HFUA 3MBXL 4P9HH 3A23A 3P0GB 1XCXA 2NY1C 3LRMA 3CDCA 2WSPA 3MBEC 4G9DB 5IT2L 3QW9A 1AKJA 2HG5B 3DJRA 3RIAK 3RWGA 3SE4C 1Q0YL 5IROC 5LWYL 2QADD 3M45A 2VMEA 4FNUA 1CICA 4FTDA 3NMEA 5DMGD 3NSCA 2UY6A 1J5IA 3PQYA 3MMEA 3WLBB 3O45B 1A3LH 3KNBA 4G9FD 4LKCB 4MXQC 4PJBE 4X4KA 3DXAB 1B2YA 3RUGB 4QRJA 2C4FU 1LO5A 3Q7JA 4Y4HA 4OZUA 4CI8A 2ZWZA 5EO0A 1A9EA 3E38A 4WFED 5BQ7B 4ZX3A 5C9JB 4XN7A 4L3EA 3BW9B 2W65A 4ORGA 1ACYH 4WSKA 1YEWA 3ZHFA 4MCNA 1CDJA 1DZBA 2MKWA 4PHZA 4WO4D 5E5UB 3BP4A 4Z0BL 3TF7C 3IFNL 3MV9D 1BFVL 3MNVB 4YIQB 3KWWB 1FNEA 3BKJL 4J8RA 4GMBA 5GS0H 3VFVA 4X7CC 3K27A 2DBLH 1VFUA 1ZJBA 3HE7A 3ZQWA 1PQZB 4F7CA 3VXMA 1WWBX 3KS0H 3ZOAA 3MBED 1XL6A 5IHBA 2XOTA 1T3FB 4WU7A 2CU9A 3PUCA 4QTHB 5A6IA 4NM4H 4UOJA 2WIIA 5IHLB 4WAFA 3GZOA 2KDYA 4GP4B 1M6UA 3CV5A 4PJDB 2DJUA 5GGTL 1UJ3B 5F6IB 2J57G 3VXSD 3V0VB 3GHPA 4IDLA 2BFVL 1I8MA 2G9HB 2EC8A 1L9MA 4ZQKA 2ZWNA 3QJZA 4DGYH 1UA3A 3QUKA 4Q0XL 2VDLA 1A0QH 5DJ6B 1IFHL 2CRZA 5HDBB 3L5WB 4CSPA 1I85A 3CN2A 1YEDA 1MLBA 4RAUB 1NBYA 1S7RA 1ECYA 1SEQL 3ZYOA 3OMZA 3QDGE 2XWRA 4PAZA 3L95B 4QMEA 1P6AB 3L4CA 3T1WA 3FO9A 1W0WA 4JDTL 2WO2B 4P5KA 3HNTL 1OE3A 1YNTA 1MW2A 2R0ZH 3GBNH 3MJ7B 3MV9E 4HKZA 4JY6B 4FMKA 4P2OD 4UQDA 5JORB 3UGXA 2DM2A 12E8L 3SMRA 3V6FA 2ARWA 3MXWH 3MA7B 1FFTB 2HJLB 4MJIB 5FB8A 1N6UA 1QVOB 3S4SA 4R7XA 3MACL 2AI0L 2VDRA 3CIQA 2Q7YB 3TBTA 3X3GH 1P7QA 3GXDA 3D05A 1LEGB 2WLZA 5DEFA 1U91A 2XDWA 4PJ8D 1IC5H 4R3SB 5TQ0H 3U9UB 3WY3A 1T5XB 3DO7A 4HKJA 4JDZB 1KULA 4AX4A 3WTUA 4EVNA 4LSTH 2CN2A 4HDJA 4EDWH 3WTWA 1MUJA 1YUKB 1K32A 3OPZH 3RKDD 2I26N 2XBTA 4QY8A 3D85A 4ZBJA 3UC0H 2EYSA 3JWNE 4KTDL 4P2RB 3T2OA 2J55H 4ELMA 1F3RB 2X44D 1YEEH 4KRNA 1N6FA 2AERT 3FULA 1AIZA 1N0LB 1CXEA 3O4LA 3KBHE 4LNVA 1JZDC 4R0LC 1NCWL 3BDYL 5HGBB 2ZZUT 2F8VA 4J1UA 4LIQL 3WE6A 1NGZA 1JYWA 2BFGA 3FCBA 4JE0A 2OZ4H 3LQAL 4U1IA 2Q87A 4PCKA 5EPMA 3Q3GA 3WMSA 4HX1B 5E6RA 1NMAH 2ZF8A 4F8NA 5GRZA 5ELIA 4K07A 3FB7B 1WZ1H 3LN5A 4HS3A 3FBKA 2HX7A 2ZNXA 5BV7H 3ESVF 2ZP0T 1NAMA 2Y7MA 4Z7WB 4NHUA 1FL5A 3R8QA 2E27L 1IEBB 3GS4A 4NZUL 4D9QE 1OK8A 2BZCA 4U1MB 1CC3A 4DFIA 2PO6B 3VFSA 2ZJSL 5AYUH 2GTWA 4OLWH 2VDQB 5EZJA 1RZKH 5ICYB 5LBSL 5BZWB 1D9KA 3DUSA 3ZKQD 4E9QA 4JR9H 4F93B 1IAOB 5D4QA 5CCJA 2XZCL 4GI9A 1PF3A 5IT2H 2W95A 3CN3A 3L54A 4MAYC 5DFAA 5HYSB 3CPLB 4RE6A 1L3WA 1A4AA 3DDUA 2I60H 4PG9A 3LKSA 3RNKA 5ADOL 4PJBA 5DC9B 2XCMC 3Q8FA 1JZGA 2FSDA 3FQUA 2NNRA 1HVXA 1SLVA 3HG3A 2COQA 3FQRA 4GJTB 4XE5B 4FZEH 3VYNA 4A1RA 2XL2A 3MRMB 2EDBA 3SKJL 2EECA 5SWSE 4RAVB 3I6LD 4HOWA 2DI9A 4FD0A 1ACYL 5IQMA 1VENA 4HJJL 4KK9D 4HLEA 4B9ZA 1SXNA 4A7TA 4HGWA 2AXWA 1R24B 1IQDA 1YC8A 4U7MA 1MDAH 5CZRA 1AS8A 3KYMA 4O58L 3IAGC 4K3ID 3TBSB 3ZKXC 3R4RA 3PDOB 5F1NA 1GAFH 5CKAA 1YYLH 4HIIA 3OWEA 3ATFA 4M3HA 3WIHA 1EDYA 1FNGA 3L17A 3U30B 4LBAA 1QNIA 2QGEA 1XGPB 2AGJL 4JEGB 2CO4A 3JWDH 1FFRA 1L7IH 1PYWA 1B0RA 2N3JA 4O02L 3EYFA 5D7KD 4J6RH 2IDQA 5JXED 1H3UA 2XTJC 1FA4A 4KFMB 4FF9A 5TE4H 3RP1A 2XJLA 2P47B 2V8LA 1KTKE 2X9YA 3VG9C 2J7LA 2GJ6E 2X4TB 5F1IB 2XIDA 3FN0H 4A2HA 4WV1C 4EVNB 2AEOA 4N8VA 4MMZA 5EU5B 3OBAA 4BFKA 5E9AA 5F7DB 1KXVA 2RH0A 3FRUA 2PXYB 4WSJA 3DGCR 4HHAA 1C16A 2BDNH 4PV9B 4XMLL 3GK8L 5LJYH 4LRNH 1GYAA 1OAKL 1MF2L 3TVMD 2ZNWA 3BSZL 5EAMA 1RULH 1K6QH 3APNA 3NABH 1MEXL 2HCZX 4X8XA 2O5YL 3CVCA 3D51A 1QSFA 2AXHA 3LNHA 1T4KB 4OLWL 2D7OA 1CD8A 1JERA 1V7ML 2FBJH 4B95C 3ILQC 3K72B 1JHKH 4ODWB 2RTTA 4HJGA 4A67A 3CC5B 3FCTB 3DRTB 4E9XA 1MCIA 5J12C 2EUVA 3LXAA 3SE8L 1NIFA 3BUBA 3UTTE 3GTTA 2I27N 2OMWB 3HG4A 2H45A 3TT1L 1MCFA 5E6IC 1FL5B 4W9HC 2F7PA 4O9HH 5KVGH 1GVIA 5EUOE 1FPTL 1PJWA 5H8DA 4EDWL 4XPBH 1FCCA 4LSRL 1DFBH 2A83B 3Q5TA 4OZ4A 2FBRA 3AY4C 4JFQA 3QQ9D 3ZT7A 1S5IH 2ATKA 2Z6FA 4HJJH 5HPMB 4PRBB 5AENA 3G6JF 1EEZA 1IGCH 1U30A 2CIKA 1OVZA 4YHKL 2L8AA 5CHNB 1LGVA 1Z6JT 3BUDA 4QRRA 4JMXA 1XHHA 5I8KL 2ZXDA 1NUFA 2L0DA 2VLKA 1THAA 1J0IA 4C56A 3ES6A 2FEDC 2NTFB 1FN4B 4IIZA 5LBGA 5IBLD 2Q6WA 2NR6A 3OQ3B 5AW7B 1NFDE 4FULA 4ZXBD 3VWJA 3UPRA 1VGEH 3RFHA 3G04B 1HH6A 2YBGA 5AOIA 5B7MA 1TTRA 3DTDA 1Y6MR 2VL5B 4OQTH 1KGJA 1KB9K 4PQXA 4OZFA 4JPWL 1IGFH 2DMBA 1PG7X 4F15B 5D4JA 3LQAC 2P5WB 4FFVD 4K8RH 4Y2DD 5DURD 3UTTD 2LW3A 4HHWA 4WW2A 4GS7B 1QVOA 3S4SB 5KANI 4HBCH 4ZOZA 3L4WA 4JHPC 5ALCH 4TUOB 3DROA 1WUNT 3S3DB 3I8CA 3VWKD 1P1ZB 3DRTA 3F7RA 4L29A 3I7LA 1JAEA 2HRPH 4LG9A 5AVYB 1NGWB 2I85A 1QO3B 1K6QL 5AAWC 4XP5L 1F6LL 4HG4J 1EVUA 1WGOA 1JGUL 5ADOH 2N0KA 2ICEC 4HIPA 5FUZH 3RQ3A 3JZGA 2J4WH 5TDPA 1V7NL 2CIIA 1U8HB 3A4FA 1ZS2A 3HKFA 1ZHLA 4LLYA 3V5KA 3LKPA 3SCMC 3T4AA 5ISZE 5AAWA 4J81A 3AWEA 1A3LL 3EUUA 3IU4H 3ZIYA 4HISA 3ZUNC 3GMMB 3S3PA 3ZTEA 2FH8A 4QKTA 1QUNA 1TMQA 2BOCB 3BEWB 3BT2H 3CH1B 4W4NA 2EVIA 4Y7OC 3GJFB 3HBPA 4OLUL 4PV8A 3F62A 1CFSB 2AAAA 4WTWA 5IMLB 5CFAA 3ATEA 3MLRL 4O3UB 2UZXA 1OCWH 1QNZL 2XXMB 5E6SB 3G6AA 5FYJE 3HPJB 4L4TD 2E6JA 1JTDB 2CPUA 4H20L 1HHJA 4HP5A 4F8QA 2OMXB 3C8DA 1NKGA 2XJKA 4WSGA 3KYKH 5DDHB 3H2QA 3QR2A 3NOIA 5CJQH 1G7QA 4XBPA 1RMFH 4P2QA 2I3TA 3CHXA 3GSOA 4DAGL 2ZF9A 4FMFA 1GZQB 4PJXE 4EI5A 5C2VB 4OF7A 2DWDA 2PWEA 4W1TA 4GAGL 4NIYE 4JM4L 3S7GA 3WKMH 4HWEL 2FJGB 3PG2A 5JWZA 3SJVB 2DIBA 4F7TB 2LLGA 4D0DA 3UTSD 1MVUB 1TQSA 4NENA 4HJSA 1MF2H 4LEEA 1GXRA 1FLTX 4XVUC 1A0QL 1Z0MA 2J5LB 5AWNL 1Q1JL 4N0YL 5GGSA 5HTSA 5M95B 1D5IH 3RVTD 4KV5F 1IGIL 2YGQA 1M7DA 2GNQA 4PJGB 3VU2A 1V7MH 3RIFK 4H0HB 4J79A 2CR0A 5H35B 1BLIA 3MOQA 4TL5A 2OM5A 1P5UB 5M61A 4XMPL 1CGTA 3KLAA 3LPGA 5BPPA 5IIEA 4G42B 4JG1L 4HGWB 4MD4A 2KT6A 4BQCA 4M7KH 5FYKE 1ZA6B 2PCXA 1DBAH 4CA4A 4J8BA 2D03L 3QZBA 2QZPA 3VI3E 3WFDH 2F54D 1AVAA 3BP6B 4QRAA 3SGJC 3QS2A 2X2UA 2YPVL 1SJXA 1B9ZA 4IOFD 1TJMA 2WZPD 3O11B 4BH7B 4M93B 5DSCB 1PBYB 1JGEB 3PSLA 4GP8B 3P3SA 2Z64C 3ZU8A 2CR3A 3AM8A 3BT0A 2IGLA 2E8YA 2VLME 4HUNB 5B4WA 2WLLB 1OGTB 2IURA 4OAWB 3D50A 2P9UC 1NDMB 2EKSB 1BVLA 1S7WB 4YO0A 4ZFOA 3COOA 3K4AA 4IMKA 2HWZH 4OVUA 1MAMH 3S97C 2CDFA 4OZGB 5FA4A 25C8H 3TPUB 3ABGA 4U6TA 5F0LB 5LGJB 4O02B 2DQUH 5I8KH 2XN9B 3GM8A 2X6VA 2AJSL 3VE0B 2BP0A 3QPKA 3SN6B 4CGUB 4Z3EA 2R0KH 3OMNB 1CZ8L 1NMBH 2JE8A 1A65A 2FJGA 4Y9CA 1YECL 5AG9A 4ZJ9A 4MD0B 4TSAL 5CZXD 4ZW7A 5JHBA 1BG9A 3D52A 3FQ2A 2WXFA 2P5EB 5CJ8A 1HCZA 3Q13A 3TCLA 2EYTA 4NAAA 4UB0L 1HZHH 1OGAB 1CLZH 4HCRA 5KYNA 2Z92A 1FQ9C 5A40E 4ES0A 1JTPA 3WEXB 1AGBB 3QCTL 3VXQB 5FO8B 5KSAA 4PRDB 2XFXB 1U8KB 5EC2B 2LTQB 1P69B 3G5ZB 4P46B 4UT6A 1SXCA 5CJXC 5GS3A 4QJ4B 4R9HA 2V3EA 5DI8A 2K6YA 2F0CA 2WQ8A 5FKAA 1M9WA 2ZXQA 3KGTA 3PU7A 3IMRA 4FG4A 4X6DB 5DS8A 5IJCC 3VFGH 3FO9B 2PM9A 3M1OA 4PCYA 3AQXA 3US9A 3O4OC 4XX5A 2JKRM 1N4XH 3B3BA 3GXNA 2B59A 4DIXA 3NCEB 4RESB 5D72L 1GOHA 1XF1A 3QJUB 5C09D 1F41A 1T7XA 1XIWA 4JN2B 3CN4A 4X5WA 1X9QA 4WJKB 5C08A 2FD6L 4F2ME 3PS6A 3CCHA 5B1JC 2AJZB 3FUHA 5FA4B 5IQ7L 1INQA 3U7AA 3SE3A 3ABKB 4JVUA 2F9BT 4G5ZH 5GGQH 3CX2A 5I1EH 5D1ZB 1WFMA 4JSXC 1G0XA 2HLFD 4QXUH 4JCLA 2ZIDA 4ICWA 1RHHB 4UTBL 1KT2A 1BFSA 3ZT6A 5E7FA 3DIFB 4JRXB 3K6SA 4QTIL 4Y8DC 3UX9B 4UZGA 1J1OH 3VSQA 2XPYA 1B3JA 2ZCHH 2QDVA 3NH7H 2FH6A 2LHAA 2BSRA 2EZ0D 2P5WA 3ECBB 3SHSA 1C08B 3WFHA 1CGSH 1H8LA 2Z0BA 1YJDC 4MX7B 5T3XH 2JKLA 3EH3B 4PJAB 1CYWA 5HHMB 5C2BL 5JIPA 4M43L 1YDPB 4PWKA 3O6FC 4JM4H 1JK9B 2NX5A 5IFAL 3UR4A 2YPLB 4HX1A 5E6RB 4XBGA 5LG6A 3V4VH 2Q8AH 3L3HB 4FFWC 4PYHA 3HN3A 4UV7L 3QDJD 1XEUA 1CXHA 2V2WA 5AWNH 1NCCH 3NFNA 2CLRB 3MRCA 1ETJA 3LNGA 3GBML 4GMSL 4N1CA 4RH4A 4Z18A 2G5RA 3WFCH 4EZJA 4Q9QH 2HYEA 3MRQB 4M6OH 2TRYA 3QO1B 1U8LA 3K6DA 5DT1L 2JI2A 5LGJA 5K9KB 1PEZA 2HVKB 2BRRH 1MFNA 1KB5A 4I88A 4P05A 5ABAA 3O6KH 4F1ZA 3QAZB 4HUXA 4OZGE 4PIRF 4BFFA 1CQKA 5LDSA 2G9AA 4IRJC 1YA5A 2LQRA 3KPSE 4KROD 3PXWD 1DFXA 2B7DT 5EOQL 4A2DA 1U93A 1WGVA 2FBJL 3EYSH 5DRXA 4XR8C 4D9RD 4LLMB 5FWRA 2VLJE 2NT1A 4KKZA 2XN2A 4PRHB 3W0WE 3QEUB 2HKFL 1O0VA 4H40A 5TQ2L 1JV5A 2WQSA 3REWB 2NY1D 2XI9A 4L2YA 1Q0YH 3NZ8B 4J78A 3SE8H 3TVMA 2XTSA 1JL8A 3N0AA 5ESQB 1A7OH 1AQHA 4QT5B 3GXPA 4PRPA 1OV8A 1YEIH 3AJ7A 3V0EA 2GC4A 2R4RL 4OIIL 2NQDA 1RHHA 4A7UA 1CFQB 3E8UL 5FF6B 3LRLA 2G2RA 3LZFH 4KTEL 3MV7D 4KQ4L 1BX2B 2ITFA 2CDEB 2W9EL 4ZSOA 2EDFA 3FHEA 1BIIA 1J8RA 1GGBL 4PJFA 2NYZA 4OGAD 3TIEA 2DWDB 1P9MC 1XGTA 3IDMA 2R1YB 2WXJA 4FA8A 1AQKL 2ZX8A 4I9WE 3VFOB 4DUWA 2W18A 1N67A 2A74A 3KXFB 2AV7A 5ACMA 4N4YB 5T1LB 4M8QA 4OI9A 4TPRL 1X4YA 2B4CH 4JM0A 3NRQA 4ODHH 1BFTA 3FUEA 4I5BB 3MLTB 4YHML 2H6PA 2Y7NA 5J6HB 4PS8A 3GIVB 5INDB 1R5MA 3UABA 3HLKA 4YDZA 2OJEB 1F4AA 2H32B 2FLRT 1UM6H 2G9HA 3GWJA 2AMGA 4Z7VE 4GBXB 3T6VA 4KZDL 3BH9B 3QEQD 1TXKA 5AW3B 2HKHH 1TYEB 2P8LA 2BSED 4RSYA 3ILDA 2BMKA 1PL3A 2VO8A 2V7NA 4EKJA 3RZCD 1KSRA 4TSBH 2JMRA 1PZDA 1TCMA 2FB4L 5CEZL 3V4PB 4Y0GA 3FQ1A 1Z3GH 3GKWL 1T1ZA 2IGTA 3OXSA 3QJTB 4WWPA 1HJBC 5HE0B 2B1HL 4PGEB 3QIUA 4FFZL 2FZ3A 4UIKL 4HJEA 3RTQA 3N40F 4ERQA 3I85A 3KJ6L 2D2OA 2A9CA 4GMSH 4RRPG 1YYMH 1A6VL 3EOBA 4N22A 4H5SA 4GS7C 4PJCA 5CEYA 2GI7A 2VN4A 3EI4B 1A14H 5LQBL 3C5ZB 4PRPD 35C8L 1WCBA 1INEL 2QQKL 1MCWW 4GW1B 4P2QE 3ARXA 3UYPA 2BVEA 3MUGB 3TBVB 1NDMA 1UFGA 1UWEH 3WSQH 1UM5L 2ZUWA 5IB5A 2IH1B 3QZNA 3QWQB 4LESA 5MEPA 1RZKC 1B9KA 5GGUA 5FO9B 4Q9RL 2CHWA 4WENB 2J3SA 2CUHA 5LVEA 5ECJE 1P2CB 5HHME 4FC3E 4HIHB 2H1PH 5IQ7H 1N59A 5IROD 4A08A 1OARH 2IPTL 4N8UA 2JKTM 1NGXA 3WJLC 5DWPA 2CNYA 3NCWA 4GAJL 2MJWA 3L3GA 3FPYA 5EM2A 3LZPA 2R2BA 3PNWA 4NRXA 3TFKD 2AGZA 3CSYB 1NFIA 2ATKB 3O3DA 4KQ4H 1KUMA 3AMLA 1D9KC 2Q7QA 2F5BH 2E4FA 1BG1A 3OPZL 1BD2A 1Q4NX 1J1OL 1YY8A 2WVUA 5CBEA 4K3GA 5HYQA 2Y1VA 4GUOA 1N68A 4Y88A 1J0KA 2H68A 4IBSA 4NCDA 3FQ4A 2IO5A 4OUOA 5E6IB 3WKNA 3WFZA 1EK3A 5AD0B 2ZSVA 4LCCC 2NUTB 1G7HB 1U8PB 3LN5B 1JPTL 1ZDSA 4HS3B 1DJZA 4WK4B 2FX9H 2EDRA 3IS1X 4BZ2L 3PWPD 4JVPA 3MGAA 4FQJH 4KC3B 4XXWA 4YDKL 4AQ1A 2CLZB 3NIDB 2DWSA 1MHPL 4OCWH 2B5IB 3DX6A 4QYOB 2YUWA 5F1SA 2VRAA 4F7MA 4NZFA 3T0EC 2XKNB 1UZGA 2GABA 5A2JH 1YJDL 2A1WL 1F8TL 5JPNB 3EOYG 4TLUA 3C09C 3UZVA 4DUXA 1Q72H 2CALA 1IIIA 3T0VA 2CD0A 2HN7B 1G94A 3Q1EA 4NJAL 4YBLC 5C2UB 3T0EA 2A77H 1NINA 2XKSA 1M6OA 4FFZH 2Z31D 3H8NA 3HZMB 4B9PA 5HGDB 5D1XA</