5I5MA

Shewanella denitrificans nitrous oxide reductase, ca2+-reconstituted form
Total Genus 193
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
193
sequence length
575
structure length
575
Chain Sequence
SAVVHPGELDEYYGFWSGGHSGEVRILGIPSMRELMRIPVFNIDSATGWGITNESKRIKGDSAHLMTGDSHHPHMSMTDGSYNGKYVFINDKANSRVARIRCDVMKTDKMITIPNVQAIHGLRVQKVPYTKYVICNGEFEIPMNNDGKASLEDVSTYRSLFNVIDAEKMEVAFQVMVDGNLDNTDADYDGKYFFSTCYNSEMGMNLGEMITAERDHVVVFSLERCLAALKAGKFTNYNGNKVPVLDGRKGSDLTRYIPVPKSPHGINTAPDGKYFVANGKLSPTVSVVEIARLDDVFSGKIQPRDAIVAEPELGLGPLHTAFDNKGNAFTTLFLDSQIAKWNIQDAIKAYNGEKVNYLRQKLDVHYQPGHNHTSQGETRDTDGKWLVVLCKFSKDRFLPVGPLRPENDQLIDISGDEMKLVHDGPTFAEPHDCMIVHRSKVKPQKLWTRDDPMFADTVAMAKQDGVTLEMDNKVIRDGNKVRVYMTSIAPNFGMNEFKVKLGDEVTVVVTNLDQVEDVTHGFCMTNHGVQMEVAPQATASVTFIANKPGVQWYYCNWFCHALHMEMRGRMLVEAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nitrous-oxide reductase
publication title Role of Calcium in Secondary Structure Stabilization during Maturation of Nitrous Oxide Reductase.
pubmed doi rcsb
source organism Shewanella denitrificans (strain os217 / atcc baa-1090 / dsm 15013)
molecule tags Oxidoreductase
total genus 193
structure length 575
sequence length 575
chains with identical sequence B
ec nomenclature ec 1.7.2.4: Nitrous-oxide reductase.
pdb deposition date 2016-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18764 nos_propeller Nitrous oxide reductase propeller repeat
A PF18793 nos_propeller_2 Nitrous oxide reductase propeller repeat 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5i5mA02
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5i5mA01
4KNUA 8PAZA 3TU6A 3ZIYA 1W6LA 5CXBB 1QLEB 2GI0A 3DSMA 3AG4B 1J5CA 1NIDA 2BP0B 2EINB 2YARA 3U25A 3EI3A 2UXFA 2OJ1A 3CDZA 3PAUA 4YSUA 4GP5B 2H6NA 5JWZA 3FGBA 4JT6C 1FFTB 5EMMB 2B5NA 3QJRB 1SF5A 4LG8A 5HE2B 1YFQA 1L9RA 2HKRA 3K26A 3UKUC 1MG2C 1U4CA 4UI9R 5I6NA 1MG3A 1ETJA 1L9PA 2I0SA 1ZIBA 3TASA 3X2QB 1KBVA 5FKQA 3FU7A 3ULEC 5HE3B 1HAUA 2OK4A 1OE1A 5D4HA 2BZ7A 5CXCB 4BXVA 4GM3A 1BXAA 4D0KA 1BYOA 4JXMA 3NJIA 4FA4D 1J9RA 1XIPA 2YXWA 1XKSA 1SFDA 2E86A 1RKRA 3FYEB 3SBPA 3AL8B 4Y5RD 4CY2A 1E30A 2JKWA 4A68A 3I7KA 4DP7X 2CBPA 4PSWB 2AZAA 5GMKn 1J9TA 4E9YA 1JOFA 4RH4A 2TSBA 2J57A 1NEXB 2I7OA 3PLYA 1KV7A 1OF0A 2CUAA 1W8EA 2TSAA 3MX0B 3I8CA 2BZCA 3I7PA 4GGCA 4U7AA 4A66A 4KFMB 1FWXA 1V54B 2PCFA 2IUVA 1NIEA 4Q8BA 2P9LC 5FKRA 2OVRB 3OW8A 3QJTB 4E54B 1XB3A 1IUZA 3UKRC 3T6WA 3NVXA 5HQGA 1KGYE 3AG1B 5I6MA 1ZV2A 2O9KA 3MBWB 4AZUA 3UACA 2BW5A 2B5LA 4A08B 1HAWA 3OD3A 1CUOA 4PC0A 3NYKA 3PAVA 4AKQA 4Y7RA 9PCYA 2Y69B 2XL2A 1EZLA 2FNWA 2BWIA 1SHWA 3GFCA 1PNDA 4YSCA 3MKSB 4L3HD 4D6VA 1L9QA 2B08A 4A2EA 2AGXA 5FA5B 1ET7A 4A0AA 4YSRA 2CE8A 3CFVA 5KDOB 3S8GB 2WO2B 2FQGA 1OCZB 2AZUA 2YAHA 4JHUA 2YB8B 4OWRA 1A4CA 1JXGA 1NZRA 2RACA 3FU8A 3C75H 4GM9A 3FPXA 4FAVD 3I8EA 4A7JA 4AX3A 4FAAB 2B3IA 4E9TA 2XX0A 5D4IA 2OCCB 1PLCA 1NDTA 4I79A 3VH0A 1U2VC 5H14A 2FQDA 7PCYA 2P9NC 1WAEA 4QT8A 2GHZA 4YSPA 1M56B 1MG3C 4JKNA 4FB1D 4G72B 5TF2A 1SF3A 3JZNA 3X1NA 5EHFA 1TEFA 4KO6A 1HFUA 3GYRA 3T6ZA 5IT9g 3ODTA 3MMYA 2IH9A 1X9RA 5PCYA 3EI1B 2FJSA 1TKWA 3CVBA 2H47A 5IGOA 5I6LA 1NWOA 4CZXA 4DP2X 4KOCA 5I28A 4CY5A 2PPCA 1OCCB 2VM3A 4G7QB 1WS7A 4YVDA 5SXMA 2HYEA 3I7LA 4BDVB 1OCRB 2YNNA 1SFHA 1PLBA 2PPFA 3D12B 2PM7B 4J79A 4CI8A 4FHLA 1JJUB 3RYMA 1NIBA 3RN0D 2HZHA 3DIVA 4DP1X 2IDQA 1ERJA 3AL9A 2G99A 1MDAH 4J0XA 5FXYA 1KBWA 3OKTA 2IH8A 4HCGA 4JSNC 2IWFA 3SJLD 2ZWNA 3WIAA 4GY4A 4GGAA 4BWTA 1BEXA 1SJMA 1PBYB 2EBSA 1PZBA 2HX8A 3T71A 3WNJA 4ZOYA 4P5RA 4LGNA 3GXUB 3KRXB 3V9FA 5GXHA 3NJHA 1CYWA 4KNTA 4E5ZA 1E67A 2QT6A 3FSAA 4G7RB 3W15A 5IJ8E 4J0WA 3SWSD 1NPJA 3QJQB 1OE2A 3FSWA 2DYSB 2PP7A 3N55A 3TBCA 3JRPA 3KRWB 5HYNB 3T9WA 1GS6X 2YAEA 2AH1A 2J57G 5CYKB 1PY0A 1GOTB 2WO3B 2BWDA 4N4YB 4ERYA 5IGQA 4A0BA 2ZONA 1OLZA 2H3XA 3RLMD 3AY2A 3FSVA 2HXAA 2EIKB 3OKYA 1PMYA 3H4HA 1PNCA 2PM6B 1ASOA 2JFCA 4BUJC 3JT2A 5B1JA 4J78A 2P80A 3QJVB 2PM9B 3OQRA 2FWLB 3NSYA 4ZOXA 3VA6A 3AH8B 3HFQA 5B1BB 1AZNA 2BP0A 1JZGA 2H9NA 4FAND 5EMKB 2IUPA 4X63B 1XB6A 4KO5A 4BWUA 5F7AA 3BG1A 4AOWA 2MRYA 3BQVA 4ENZA 5I5JA 3P4FA 2YAOA 3SBQA 2VSMB 2P9PC 1AAJA 3C75A 3ZDWA 4EF3A 4BH6A 4CI2A 3N0EA 3DWLC 3SMRA 5EMLB 1AZCA 3VGZA 2H47C 3I7HA 2VW7A 3J80g 4E9RA 1RI6A 5EM2A 4HZ1A 4JT5C 4DP4X 4EWRA 2BP8B 2XYIA 2IDFA 3MZKA 1NR0A 3N2JA 4GYBA 1A4AA 1GW0A 1ILUA 2R7EA 4W1TA 3CVDA 3X1EA 1AR1B 1JXFA 2CNXA 3EI3B 2VN3A 3IIYA 5FQDA 3ASNB 1NINA 1PGUA 4J81A 2PP9A 1BQRA 2PP8A 3UVMA 3AL8A 1PEVA 5EARA 3RRMC 1ASQA 3OKWA 1QNIA 4CY3A 1WA1X 2PPAA 4P5SA 2HX9A 4M4RB 3AW5A 1VLXA 2GNQA 4H5JA 2OVPB 1E5ZA 2Q5BA 1JMZB 4G71B 2W18A 3UVNA 4A2LA 3NT0A 2QDWA 1XB8A 1JZEA 3IJCA 3PXSD 4AEZA 3IEAA 4J84A 1NWPA 2PBIB 1E5YA 1V55B 4FA5D 3H4FA 5C9ZB 3V5WB 1VYHC 3I89A 5HE0B 4O45A 2AANA 2I85A 4E9XA 3ORVD 3WNIA 4E54A 2VW4A 2PLTA 3PVUB 4M3HA 3FSZA 5I6OA 2AVFA 4GP8B 3ERXA 1MDAA 2A3TA 3V7DB 3EI4B 3NJMA 3H56A 2OV0A 4DPBX 2IDUA 2I7SA 3UAAA 1CURA 4NERA 2I3SA 3EI2B 2GC7A 1A0RB 1I53A 2B5MA 4GM8A 1AG0A 3T6XA 3NSCA 1N6FA 2H3XC 1P22A 4A2MA 5B7MA 2MTAH 3DXKC 4Z8LA 2J55H 4DP5X 5B1JC 3I2NA 1L9OA 3IIWA 3SN6B 2XV0A 5C2WB 1FA4A 4E9SA 4CY1A 3PSLA 4ZOVA 3BVDB 1L9SA 3V9CA 1J9SA 5LDUA 3SVWD 1WS8A 1T5KA 2DWTA 2ZOOA 4L0PB 5IY5B 3NSDA 3UVOA 2Z2NA 3EH5B 2Z2PA 4PBYA 4AI7A 1ZPUA 2I3TA 4J86A 2FTAA 1TEGA 1J5DA 2XYBA 3IN2A 2IAAA 1PAZA 4BXSV 3QQXA 3EU7A 3JROA 4L9OA 4K3JB 2LLNA 2X88A 3PVWB 2QDVA 2BBKH 5PAZA 4DP6X 2GBAA 4G70B 3JZGA 4A0AB 3OL2A 2UX6A 3MZLA 3FT0A 1S4UX 2QXVA 5FKTA 3NP3A 3AG3B 2EIJB 1K8KC 1PI6A 4GQBB 2CJ3A 2CALA 1ET5A 1SNRA 1ASPA 2TRCB 2XLLA 4YVNA 4ZOZA 1A4BA 1SDDB 4A2HA 7PAZA 3EI1A 1B9YA 5A2Qg 1B3IA 5H17A 3WG7B 2W8CA 4WKXA 3EWEA 2H9MA 4GXFA 2AGZA 1GP2B 5GXIA 2YNPA 3WKQA 1ZDQA 5B4WA 3F3GA 1TYQC 2YAMA 1L9TA 4N8UA 5E9NA 4BDVA 4XEIC 3HB3B 1PZCA 3ABKB 3NJKA 5TK4A 4K3ID 2CE9A 4DP8X 3UABA 4O3TB 4A09A 1R5MA 2XU7A 1AS8A 1AANA 2AQ5A 2QPDB 3X1FA 3T6VA 2WSDA 3SCYA 3OM3B 1KCBA 5EMJB 2PCYA 3ABGA 2CCWA 3S8FB 2W88A 3V9EA 1SQJA 3I7NA 3WKPA 4CI3A 2HRHA 2UXGA 1GXRA 3F3FA 2GB2A 3B7FA 2DY2A 1SHXA 4HAKA 4YSTA 4FA9D 3JTBA 4FA7B 2GC7C 2VW6A 2QC5A 1GR7A 4E9QA 3C5MA 2H5UA 4CSZA 1JOIA 1BQKA 1OCOB 2XVBA 5CXCA 3FPYA 4IMMA 4JSXC 3PE7A 1DZ0A 1AS6A 4GZ8A 3EH4B 3QJUB 2XUWA 4YL4A 2H6QA 4E9WA 2IURA 2OK6A 1RZPA 4UAHA 4W9ZA 4TZ4A 2XWZA 2AFNA 3DKHA 3BWSA 4GMBA 4ESGA 5K19A 3U4YA 4J77A 2Q7QA 3FU9A 5AMSA 2YAFA 3QJSB 5H1MA 5I6KA 4KOBA 3JAMg 4A11B 2HX7A 1XMEB 2I0RA 2XXGA 1N70A 2N0MA 4MFHA 3NJLA 5CXBA 2IAAC 3OMIB 6PCYA 2PM9A 4J8GA 4BL0A 1BYPA 2DWSA 4YVUA 4JSVC 4ERQA 1OV8A 5EAPA 2H68A 2AGWA 4UF7C 5EALA 1PZAA 2MTAA 2J55A 2IWEA 3UADA 3CZUB 4IA9A 3ABMB 4GQ2P 2BO0A 1Q47A 4JSPC 1GY1A 2XX1A 5EAMA 1ID2A 1YLBB 4QRJA 4KNSA 1KDIA 5IC7A 1B9XA 1MZZA 3OKYB 1ADWA 3PCYA 2PPEA 1XHMA 1ZIAA 1SQ9A 4DPCX 1RCYA 2VSKB 1JVOA 3IJ1A 4QKTA 3K27A 3RFGA 2DV6A 2P9SC 2BP8A 1NIAA 1KCWA 3ASOB 3TBBA 1CC3A 3CDZB 2CAKA 2UZYB 3C99A 3WI9A 2FT6A 1UATA 2GIMA 1OE3A 1BXVA 4UANA 4DP0X 3AG2B 4NSXA 2YQBA 2J56H 5TEEA 5FLXg 3DTUB 4A2GA 4CZVA 1V10A 4TXVB 1OOWA 4YSDA 2H13A 2P9UC 4XYIA 5HE1B 2OJYA 3FRXA 2I0TA 3FM0A 2P80D 1JXDA 4F2EA 3BG0A 3MKQA 1PF3A 2CO0A 5EM2B 4XYHA 3RMZD 4X3EA 3FU7B 5B1KA 4YSQA 3UVKA 3DM0A 3IJ0A 3EF4A 1GS8A 3S3CB 3ZBMA 3FQ2A 3AZUA 3FS9A 4BWWA 2R7EB 3HEIB 4NB7A 2GC4A 6PAZA 3EG6A 4YSAA 3JZHA 4HALA 3EH3B 3NJNA 3NJJA 2UX7A 2B4EA 2H9LA 1KDJA 1M9WA 4HCFA 4PBZA 1AQ8A 4G7SB 2YNOA 3SFZA 1IC0A 2UXVA 1DYZA 4A08A 2BCJB 1JERA 1PCSA 2UXTA 3EI4A 4WTQA 3PXWD 2FT7A 2AGLA 3L4MD 3EI2A 2UZXB 4J82A 3KW8A 1CYXA 4A67A 4X60B 3MXXA 3IE9A 4KO9A 4F2FA 2OVQB 3UR4A 3OTTA 1QHQA 4NAJA 2XXFA 1PLAA 2XV2A 2YAQA 1GG2B 3CIKB 1JZFA 3I7OA 4O9DA 3FYIB 4E9VA 2P9KC 2HJBA 4HDJA 2IDTA 3AFCA 4QLWA 2VM4A 4GQ1A 4FA1D 4AKPA 4JHVA 3SBRA 4A2DA 2IWKA 4KO7A 5AFAA 5I26A 1AIZA 2JXMA 1AOZA 3FQ1A 4G56B 5GSAA 1IKOP 4PCYA 4YSOA 1N6EA 1SHYB 1E65A 2Q9OA 5B1AB 2AH0A 2IUQA 4R7AB 3RN1D 3SXTD 4PNKB 1GS7A 1RZQA 4J73A 1EHKB 3IBOA 5B7EA 2HKMA 3TA4D 1GSKA 3S3BB 3UVLA 1GY2A 3FQYA 3OMAB 1KYAA 4A2FA 1N6DA 2Z2OA 1NTDA 2H14A 2DYRB 4ES0A 1JVLA 1BQ5A 4ZN4A 5IJ7E 3A0FA 5AJAA 1ILSA 1JZIA 4YSSA 5THAA 4QQEA 1WA2X 2HJ4A 2FQEA 3CVCA 3X1BA 1A65A 1F56A 1N68A 1WA0X 2NRDA 3NVQA 4CI1A 1SDDA 3JPXA 5ANHA 3L45A 3RSEC 1AG6A 5I6PA 1K32A 4JD2C 1OMWB 3CG8A 2HRGA 5B7FA 2GSMB 3X1GA 5F7BA 3ZWLB 4F7KA 4CZYA 2J5WA 2XL3A 4PSXB 4MK0B 5FKSA 3UGEA 3IN0A 3KW7A 1X9UA 3NSFA 1IBZA 3E0CA 3RFHA 1BAWA 4PAZA 1TBGA 5D4JA 3GREA 3NVNA 2CO0C 4CC9A 4X61B 5A7EA 3N0DA 3OL2B 5C2VB 2Y1AA 2XV3A 2PPDA 5B3SB 4GGDA 4ERZA 4H5IA 2YXVA 2HESX 2GC4C 3EHBB 2YBAA 2H9PA 2EILB 1A3ZA 3PXLA 1MG2A 2P9IC 4GP4B 2QPEB 1R1CA 3PSCB 3J81g 1ZDSA 2VMJA 4HHWA 3F3PA 4FWWA 1NIFA 2J56A 1J9QA 2ZXWB 1JZHA 4Q89A 1W6WA 2HLEB 4BK5C 4YSEA 4L1QD 3PAZA 4L3GD 1AZUA 4QL1A 4HCIA 3L4OD 4HHGA 5FC9A 2YAPA 1NICA 3ZX1A 2AGYA 4OZUA 2YMUA 1AS7A 5TDHB 3QPKA 5AFU3 4O3UB 4A09B 2BW4A 2EIMB 5I5MA 2BHFA 5CYKA 5K1CC 4ZK8A 3NJFA 1JZJA 1AZRA 2FT8A 4O1QD 4LG9A 3SLED 5AZUA 3IKOA 1L0QA 4A11A 1ET8A 3G5WA 4X4KA 2XU9A 1GYCA 3OMNB 5TK2A 3S3DB 2G9AA 3SHFA 5AKRA 4E5ZB 2CN2A 1MZYA 2FQFA 4AKOA 4DP9X 4N14A 3DXMC 4J8BA 5TEFA 3CFSB 1AZBA 2OIZA 3JB9L 2X87A 1JMXB 3NJGA 3PXTD 1URIA 4J87A 3UAEA 5I5IA 2CN3A 4DPAX 4HIPA 1IBYA 1TU2A 3C9CA 4A0BB 2IDSA 1NPNA 3ABLB 4U1EI 1BXUA 3SQRA 4CSPA 3EMHA 1A8ZA 1AACA 3NP4A 3PPSA 2HXCA 4PXWA 1M57B 4K9JA 2H6KA 3GDCA
chains in the Genus database with same CATH superfamily
2JB6A 5I1JH 1J87A 4K5OA 3V0WL 4AQ1B 1O7DC 3P1VA 4TLKA 3RNKA 4UT9A 2ZG1A 3Q9PA 3HR5A 2G3NA 3F58L 3VGFA 3FGBA 1OAYH 1TQBC 3W5NA 5DTFA 1TZ8A 1U95A 3MLWH 1HEZB 2ATAA 5JHDB 1FH5L 1CR9L 3RHWF 3LS4H 3UBXG 3CHSA 3N85L 4O5LL 4POZC 3OKMA 2FEDC 4UOW1 3FU7A 3QUMB 5JR1L 2OQJB 4KRPC 2OK4A 2BS9A 1ZHBB 2CLZB 3L1OL 3PWLA 1UXWB 5I1KH 2F74A 2D7NA 2C1PB 3AFLA 4HUUB 4NRZB 3KYNA 4Y5RD 3MLUL 3MBXL 4B96A 5E1AA 2ZYRA 1UUSA 4PSWB 1JD7A 1KJVB 1MWAB 3OKOB 3V7AE 5BPPA 3DPBB 1QAWA 3DXAD 5AZEL 1W8EA 2DQ6A 2GJ6A 1LO2H 5JNYA 1U8CB 2JVUA 3BUBA 3BT2H 1Q72L 2OTWA 4IRJB 3ZL4L 2BSTB 4URKA 2EZ0C 3APNA 3ZPDA 4PJ5B 4YE4H 1XB3A 2UV3A 1NAML 3MOBH 1B0IA 1U8LB 4B6ZA 2B5LA 4HXBL 2W9DH 3QI9A 5FKPB 3BJ91 4PJEE 4AKQA 3BXNA 3NFSH 3MU3A 3QHFL 4H8WC 4CN1A 3W3BA 1NKGA 4JUSA 1BBJA 4GAYB 4IOSA 4M7KL 2B9AA 5KSBB 2O5ZH 1U93A 2PXYD 1UCTA 3KBFA 1PFCA 4JFOB 1TVHA 4L29A 9CGTA 4X5LA 3R06A 4Q52A 5IM7A 2ERJB 1DJIA 1L0YA 5D4IA 1YYMH 4IGBB 1H2XA 1V7NH 3SCMC 5EO0A 4XH2A 1M56B 1WZKA 4XMPL 3ZKNC 4EDXA 1G4RA 3HKFA 4TNFA 1EEQA 4KO6A 4KQ3L 1IGML 1H6UA 1JPFB 2ZCKH 3WFHA 4CDGC 3Q9QA 2IALB 5JORB 1UJTA 1YEEL 5PCYA 3WSQL 1M53A 3EJQA 5DDHA 4ODVH 1SPDA 4PJDE 3K71A 4I77H 5AOIA 1CE1H 4L0YA 3IUJA 1CFTA 1S7RB 3NFPA 1D5XB 1OCRB 3K6SB 4KDTA 3IDNB 3S0PA 3CFMA 4FHLA 4PV9B 1SXCA 4DP1X 5CR1A 5KAQF 5D2LF 2D9QB 3T3PA 3PABB 5DVKA 1A5FH 4DAGH 3P0GB 4UT6L 3D39E 1BVLA 2WSPA 4NZ8A 3BUPA 4APXB 1RVFH 1FNGB 4H88H 4Z3JA 3DMMB 3R4RA 2D7PA 4M43H 4JREB 3C6SA 4E5ZA 1PD0A 3WE6B 1VZHA 1OP3H 1K3ZA 1R5VB 3ZMNA 3Q01A 4XXCC 3HG5A 4ZO7A 4J27A 3V52L 4CY1A 2PP7A 3LMJL 1Q9WB 4APQB 5CYKB 1M7DA 2PMZA 2QSQA 4A0BA 1OLZA 3B9KC 5FS5A 2EIKB 1N4XL 2YBRA 1OL0A 1GGYA 3ZT5A 1TG8A 1F90H 3EJTA 5FFOA 1UKQA 2VLJA 4GKSA 2FWLB 3L5XL 2VDPL 3GRWA 4KY1H 4PS8A 3ARBC 1PLGH 4PYGA 2HVJA 4HMEA 4LDOB 4XPAL 1U4EA 1KCUH 3F7YA 3FB8B 3NESA 5LGHH 4Y9GA 2XZAL 2VN7A 5DJ2A 5KSVB 4PRNA 3WFEH 1NBCA 3SBQA 5IVOA 1AAJA 1XBDA 5J1TC 3VGZA 4N2HA 2A73A 4Y5VA 1S8DA 3L1EA 4FYQA 4KH9A 4WZ9A 5AAMA 3N2JA 1ZGLP 1XIWB 1T66D 1JXFA 3MYJA 1NINA 1T89A 2DQMA 3KXFA 3MNMA 1MFVA 1CGXA 2PP9A 1UOQA 4Q56A 1CT8B 4N1HB 5ETUA 3UTSE 5KN5B 4HETA 3BSZL 4FLRA 4JPSA 1GGIL 4P5SA 3UYOD 2W0FA 2WINA 3R8QA 1W0WB 1A1MA 3NT0A 4WI3A 5D7KE 1H19A 3SKNA 1WAAE 2A6KA 4IBTA 1J8HB 3IXTB 5E6IB 1AHMA 2V9RA 5AVWB 4JFDB 3QI0A 4I18C 2A1WH 2YQGA 1Z5LB 3KYNB 4LIQL 4GG6A 3K0YA 2O5XL 1NPUA 2DBJA 3B56A 4PG2A 4UQ2A 4ZTOH 5BRPA 5JA9A 5I2IA 3FQ4A 5HDOA 3K6NA 1FGVL 1T1XB 3JUYA 1T2XA 1CURA 1N0LA 4CVUA 3LH2H 3FTVA 2WXFA 5I15L 5JNYB 3U6RA 2BOCA 4Z8LA 4PG9B 2VDNL 1L9OA 1AGEA 2XV0A 1K6QL 3QUZD 5DURB 4ZUWB 1K2DB 4YHMH 3BPCA 4BFFA 4PGEB 3HG0A 3Q3GA 1KCRL 2ZAIA 3DTDA 4ZAKC 4ZW7A 1AQDA 4BBWA 2UZIL 3IFLH 4Z77A 1NANH 4ISVA 1O6FA 4F80A 1ZPUA 2H26A 1EEYB 3O2VH 2GCYB 1L4IA 3HBPA 4F5CA 2DJMA 4JN1L 2VR7A 5C2BH 1ZHKB 3SE6A 1PJ9A 1RMFL 1SQ2N 3FT0A 3CMOH 3CH8A 3ZTDC 3EF7A 4BZYA 1E0OB 4GW1A 4CMMA 2EIJB 5D7IE 1RZJL 5ACZA 1TVHB 2P9RA 2PCPB 5D7EA 5IM7B 3TO2A 4B50A 1XR9A 1S5IL 4JR9H 3OKLB 4MXQC 3RX9A 3GUFA 4GKZA 3LTVA 3LNEA 4QR7A 4QCIA 4TN9A 5EO0B 4AIEA 4EDXB 1SM3H 3QFGA 1W9XA 3W82A 3ZOAA 4AVHA 3ABKB 5JPNC 2W60A 2HWZH 2YXMA 4EMZA 3DX6A 3CE1A 4C54A 1SY6A 4XTRC 2YD4A 1CICC 3KBPA 3ET9F 4M1GH 4AEHL 3GI8L 2W88A 5CSBA 2RR3A 3FULA 5FM4A 3KDMB 1QWHA 2FHFA 3DHPA 4G8FA 1YPZE 1QTPA 1SMDA 4CSZA 3QWOB 4WENB 4Y4KD 2CGYA 2F5AH 1KJMB 3B2UC 3MVDK 4DKFH 1AS6A 5EUOF 3T3PB 3H3KA 1RP8A 3RAJL 2X2YA 5DJXA 2F58H 3EAKA 5A6LA 4ESGA 2B0SH 4PFEA 2P8PB 4XCCL 3QJSB 15C8H 1RH8A 5EOCJ 4A11B 4IMLB 4P2QD 1XMEB 2I0RA 2UVFA 3MQIA 2QR0A 4BIKA 3IGAA 5CXBA 2IAAC 3K46A 2PR9A 4RDQG 4OKVB 2CBTA 2P5WD 2GY5A 4MCNA 1DBJH 2AABH 3AS3A 3LEXA 4F7CA 5EU4A 4AJVA 4CKVX 2L4OA 5IC7A 2VUOA 3QORA 2VLRA 5AAWC 1R24B 2B16A 2DKMA 4NP4L 3RFGA 4G11A 1U3HB 2VLJB 3KEDA 2BP8A 3Q8CA 4FXGA 2CJUH 2OXHA 2CAKA 1YYCA 2M1KA 3CLFH 2GJRA 2J2ZB 5EC1A 2VLKD 1BXVA 2IAMB 3KE0A 3MV9E 3B8YA 3F7YB 4LMQI 3X13A 1HX0A 2WQVA 5DJ2B 5E99H 4TXVB 1SGKA 4PRNB 2IJ0C 5HE1B 2AV1A 4TTGA 5I19H 3OBAA 2MOQA 3UTTE 3VG0H 3NH7L 4YBQD 2IGFH 4DQAA 1S8DB 2OSLA 1S5HA 3LIZL 1G6RH 1XL4A 3DGGB 5J6HB 3K8KA 3FS9A 3ULUH 2F68X 1JZ7A 3V5KB 4IEFA 3ZN6A 2X9YA 4G7SB 3SFZA 3VXMD 3QUXB 1TTCA 2UXTA 3ZDYE 2W0FB 2WINB 3L3DA 2GUYA 1LO4L 2ZCLL 3EG9B 3ELAT 1IAMA 3KPTA 3RFZC 3WS6A 4DVBB 4X60B 3TN0D 1HH9A 1OM3L 1ZHLB 1GGBL 4LPXA 2ORBH 5FYJL 4Z7VA 1OTUD 4ICXA 1BECA 4JZOA 2IO5A 5FAAA 1AXTL 2MHAA 5EDXA 3CZEA 3EGSB 3AFCA 2RFXA 3DNKA 4LCYA 2VR3A 4N28A 1NANI 5AUMA 4XBEH 2XKNA 1ZTXH 4QMEA 5D2LA 5FA3A 1IGYB 5CF3A 1BP3B 5GS1B 2ARJQ 2OSWA 3SXTD 3RUGE 1R3JA 4CJ1A 3G3LA 2ADGB 4LRNL 1JZ2A 2BOCB 1BYNA 1DDTA 4I9WE 3UVLA 2DL9A 2BSSB 2DYRB 4FQIH 1FYTE 1UYWL 4NJ9H 4UQCA 1A6AB 1X4ZA 1UCBL 3BPCB 1SOQA 3IU4L 5E8EB 5FWQA 2VDOL 3X1BA 5F1NA 3GWJA 1FYHB 4Z77B 1TOXA 4ISVB 1NCAH 4QOKD 4NM8H 1VE7A 2COVD 3ARGA 1LE9A 3OAUL 1ZT4A 3V4PA 4G8GD 5HYJB 4XOAA 5BS0E 1X9UA 3SEPA 5I66B 2C9PA 1VB9A 3NVNA 5MI0B 3W9DA 3ZRCC 3TBWA 2D7OA 4XCEB 4CMMB 4GW1B 4L3EB 3PF2A 1A3ZA 3HJ0A 3TO2B 1ZDSA 4S2SB 3QQ4B 5JHBA 5DZJA 3NEOA 1J9QA 4YHYC 3IJHA 4HGMA 3LN9A 5DXWA 2WJ7A 3G6JA 1AJ7L 5K9OB 4MNHB 1DP0A 1CGTA 3OZ9H 1Z5HA 2C9AA 2X4PB 3S5ZA 1UWGL 4X8JB 5HVGB 5AFU3 4LCIL 4CN4A 2F2HA 4P04A 5T33L 4ZFGL 3KMDA 2KS0A 4HC1H 3TYFA 4XMLH 3ARVA 4ORGB 4I2XB 5SWSA 5B4MD 4FFWD 1X7QB 1NGYA 4ZRGA 2VO5A 4OFIA 1DVXA 4LQ1A 1S7SB 4OGYL 1ZA6A 2BMKA 2F7OA 2XU9A 5TK2A 2G9AA 4BCBA 5DI8B 1G1YA 5HJGA 4LDEB 3SJVB 4PJ9B 5ADPH 4WUKL 1P6WA 4D0DA 4TRPL 5C07D 5D1QD 2OIZA 4N8CH 5I75C 3K8MA 1IBFA 1MJUH 4U1NA 5DJXB 3I84A 3IFPA 3DX3A 1QA9A 4WCYL 1KN2L 3ULVL 3GIVB 4O2WA 5F8RC 3SQRA 4Y5YB 1S7WB 2OW6A 2Y3NA 4JM2F 1T04A 3FH5A 3IGAB 4L4TA 4Z7WB 5CXBB 2AK4E 4Z7UA 1NIDA 4AW7A 4BQBA 1D5BA 5ID0B 4NLHA 5D5ME 3G6DH 1PYWB 1MIEL 3T0EA 2FD6H 4P46C 3TNNA 2M83A 4LB8A 1SF5A 5C0AA 2HN7A 1KJ2H 4ALAL 4PJIE 1U8HA 4XNZB 3I02A 3LEVH 2VLRB 3O8XA 4OZ4A 5EV7A 2XZQH 3DYMA 4NQCD 1HWHB 4BXVA 5CXCB 3MCYA 3NCBB 4GRMA 1RPKA 3MUGA 3H0TB 3X13B 4KJQD 4PJCB 4N2CA 1E30A 3RA7L 3W38A 1AO7A 5GHWH 2KQMA 3BP4A 3SOTA 3VACA 3P0YL 4P5TC 1CFVH 3D69A 1AGBA 3DBSA 3G5ZA 3NCJH 3CHQA 1G1KA 3UZEC 3G9AB 2IDCA 5CP3H 1KWGA 2OSLB 2VR5A 1MRDH 3PG2A 3WY2A 5DVPA 1WD8A 4HHAB 3NTCL 2VXVL 5HI5D 1OGAE 3FO2B 1MY7A 5KZCD 4F8NA 4AYID 5ANME 2XZGA 3MNWA 3PFQA 3S35H 4XNYH 4AYFA 2LABA 2J20A 3JV5A 3MLVH 2D3JA 4WTZA 2BRRL 1NMAH 4XI5C 5K33A 5I30L 2PTUA 3R4DA 3U30C 1B4JH 4AIZB 1CIDA 4HVBA 1JGDB 1D5IH 4HIHA 4D6VA 4EN3D 4X6FB 2B08A 4A2EA 4P4KD 4WW1B 1L6PA 5FDYA 4JZOB 1WCBA 1HZHL 4NRYB 2MHAB 2OI9B 4IHOA 3QDJE 2RFXB 5L8KB 4BKLB 3TVMC 3S2CA 3SDYL 5AUMB 3M17A 4FZEL 1WAPA 5D2LB 5EUOA 4AX3A 5DMJB 2N7SA 3MN8A 5DRNB 4PRIE 2YPVL 2A9NH 3CH1B 2O30A 1CZ8L 4S1SH 5SX4H 1R3JB 4QAMA 2P9NC 2VAJA 2W91A 5TJWK 1LO5B 3VNYA 1KPRA 3INOA 3MACH 3T09A 5KJ4A 3JUZA 2PWEA 3NEXA 3WGUB 3ODTA 1BMGA 3FH7A 1XR8A 5KW9L 5GZOA 1YEIH 4MMZC 2EXYD 5KS9A 5G2NA 3ARGB 2AJUH 5HI4D 3V4PB 4CY5A 5ICXB 4P23D 2B15A 2FGWL 3KZ8A 3NJXA 5E1HB 4NN6C 3QULA 1P1VA 5LGJA 5SWZE 5HDWA 3W9DB 1C12B 1RZ7H 3BQUD 3AL9A 4LKCA 3L5WA 1Z0MA 3VWKA 3TBYA 3VXSD 3RVTD 2K8MA 2HJFA 3HAEB 1SMOA 3QQDB 5CGTA 2J3SA 3OKTA 3US1A 1E8WA 3S48A 4EXPX 2J1XA 2OJEA 4A7GA 1JGLH 3MA9L 4NQDA 4HMDA 4LDCA 3O45A 2HFEA 1P9MA 4PJAA 5GXHA 4RIRA 3TBTB 1Z7JA 3T8XA 5I71C 4JHZA 4IRZH 3FT2B 3L6FA 5JDSA 1OVZA 4U6XB 2HRPH 1QTSA 4GSXA 2EYSA 4HBCL 1DQJB 1ZRUA 4XHJC 1OD9A 4F8LA 1N59A 2ZQKA 3G6AA 4YWGH 5C0GA 2BMKB 2NPLX 4GBXA 4BUJC 4RFOH 3IMUA 5B1JA 3ATFA 1CDHA 3JTTA 1U8NB 2G5BA 3OQRA 2JV6A 2BP0A 2H6PB 3C5ZD 2YRPA 1DQIA 1LEGB 3FDWA 3GHEH 4LSVL 4PUBL 4R2GC 3Q13A 1CLOL 4U1NB 5F7AA 5C0BE 1R3KA 1DUYA 1TQCB 1I8UA 2QKIC 3BQVA 4GW5B 2JF1A 4PW4A 4UT7L 4GINA 5FYJD 3DUUA 3SIKA 1GMEA 1KFAH 2ESVD 5EBMB 4PRDB 1AZCA 5EMLB 2H47C 2WLHA 4I88A 5EM2A 2WB7A 4J6RH 4LU5L 3DXAB 1WBYB 4DP4X 3EOAA 2CIKA 4N20A 3C60A 4AQAA 5DMGD 3ASNB 3EDDA 3TNNB 3BKJH 4FYTA 4NNYA 5C0AB 2HN7B 2PN5A 4PJHE 4ZFFA 3EZJB 1EXUB 5DR5L 1E5ZA 3ABZA 3Q6GL 3Q5OA 2WXPA 4GEJA 5TQ2L 2BVOA 3CZFB 4WK0A 1N64H 4GRMB 4AJWA 3OC8A 4E54A 3UZQB 1JGVH 4GQ9H 2PXYB 3TV3L 3H2QA 1AO7B 3H3PL 3LRLA 4QRUB 1R34A 3UIZA 2OV0A 4MJ2A 4OIBA 3OC5A 4XXDB 4BK4A 4F15C 1N8OE 3IJYB 2OYMA 2YIHA 3QDMA 4FJZA 1F13A 5J11B 3BEWB 1N26A 3I2NA 5IT2L 3R18A 4PY8J 3TPUA 3U1SH 5BJTA 2JK5A 4ZOVA 4WFFE 2VCOA 2A6IA 1MIML 1GW6A 4XODA 1O7DE 3GRWL 1OP9A 1J8KA 3PWPE 3K80A 2ZT9C 3O2WH 4XVSH 3CCHB 3EJZC 2FTAA 3RVVC 1BV8A 3OPZH 2HVKB 5SX4I 2JLPA 4D0BA 1CLCA 3DOIA 1PAZA 2CG9X 4MX7A 1UM6H 3QZOA 5DWUL 4HISA 4XPBH 3X3GH 5KYYA 5F7NC 3HRZA 1H8OA 4XXWA 1Q4NX 3OL2A 4KTEH 5AZ2L 3AG3B 1O0VA 3LXBA 3P30L 1PVHA 3FTGB 4R0LA 2BIQA 7PAZA 2EXWD 5F72S 3QIUA 1QACA 2X6MA 4LE8A 5GGTH 3S6CA 2NTSP 2AGZA 4J3UA 3SPCA 4HZAA 4R7NA 2AEPH 5B4WA 5I6XC 4BDVA 4JM2A 3ULVD 4Y19E 4RMSA 5J13B 4BFEA 1QZ1A 4LVNC 4ZOAA 3BFWA 1L7TH 1P6FA 3BVVA 5C0CA 3LDBB 2P24B 2VC2H 3IRZA 2ZOWA 4WW2A 5CJXC 1QHPA 2BIMA 1UA7A 5CLTA 4M8UA 3EQ8A 4DGUA 5CIPA 4O2CA 4GAGL 3S34L 4K23H 1I31A 2WWMD 3WIIH 1IM3A 1RU9L 2ICEC 4AC4A 2UZPA 3LN5A 1JOIA 3RWEA 4PJDA 4F7TB 4KXDA 3KYOA 3R19A 4AL8C 4JKPL 2HJFB 5TQ0H 1UD3A 2MQ3A 2Y7LA 1H3VA 3GMQB 2XWZA 4HT1H 3MCKA 5K19A 2OJEB 1GC1H 3F7RA 5JPMA 3RVUC 4KOBA 4R5TA 3FT9A 3OWEA 1R5WA 1NGQL 2A4CA 3CBRA 3VXTB 4IMKA 1E5AA 2HFEB 1I8LC 2VLMD 3D39A 1RUPH 2BIPA 3OHXA 4RIRB 4YVUA 2H68A 2AGWA 1UD6A 3TTSA 1BF2A 4GQ2P 1ORSA 4RETB 1XF4A 2V17L 3UTOA 1XL6A 2QQNL 2X4OA 1N59B 3G6AB 2G4EA 1A7RH 2KLTA 4Q9BA 4ETYA 4GBXB 2PPEA 1JWSA 3GMPA 1ZWIB 2VSKB 4ODTH 5BV7L 1L7IL 4PJGE 4XPFL 1Y18B 5E70A 1MCIA 5DJCB 1CGSL 1ED3A 1Z6JT 3D07A 4GSDH 4JQIL 4WK2A 1GSMA 3ZL1A 1IFHL 1PSKH 1TZGH 2FSDA 2FX8H 4K71C 3L8QA 1ETZA 5HHNA 3QNYB 1J0HA 4QXGL 3FM0A 3B9AA 4J8QA 1GJIA 5E2VH 5EM2B 4F33A 1E3FA 3V4LA 3EOAB 2CIKB 4YZWA 1KIUB 1PZ3A 2EDFA 3EKCA 1VGKA 5ALCH 3TEUA 1OB0A 6PAZA 4YSAA 2X89D 1SOSA 2OW7A 1A7BA 1JZ6A 1W72B 4FNLL 3U7YL 3HMWL 4ZFFB 4OI8A 4LSPH 3KAAA 2Z4QA 4XP5H 2OSYA 1R3HA 2CRZA 3VW3H 1P1ZA 3L4MD 3NK3A 4IKLA 5F1SA 3CXDH 3S4SA 4F9PC 1EO8H 2H3NB 1TQWA 3UTSA 4PJ6A 3QWRD 3MXXA 3UEZA 1J0YA 3GXPA 3K81A 5FCUL 1GG2B 1C8QA 5KBKA 1QSVA 1H2WA 3FYIB 3H54A 3QIWA 2IF7A 2IDTA 3H9SE 4N2KA 5F9WC 2Y1YA 1M1SA 4BK8A 4JHAL 4YLBA 5AFAA 5KYUA 1W15A 3NIFE 5BQDA 4KKQA 2XTLA 5DLMH 4C56D 3NCYS 4XX5A 4I1PA 4WJ5B 5FUOH 4YHPB 2VE6A 1TJHL 3QDMB 3RWFA 5I8KH 3WTXA 5DHYB 5LLIC 4YH6A 3E6FB 3SO5A 4QLRA 1S7XA 5IROC 1OPGH 4DIXA 1N9PA 1F4XH 4AOFA 1HOCA 2V7NA 3NRQA 2A6IB 1Q9LA 4Q2ZB 5GSRA 1N68A 1KULA 8FABA 2EXTA 4WEBH 5GIRB 1K72A 1RJYA 4DVRL 4DZ8A 5FW7A 2BC4B 2Z31A 3BKCH 3BKMH 4PV8B 2F5BL 4U49A 5C0RL 1OP4A 4QRBA 5B21A 3WAJA 2B4CH 1OF2A 1U91A 1U0QA 2EICA 4HFUH 5EG6C 3MLSH 3OL2B 2X0VA 2J8UE 2E7CA 3EHBB 4YHNA 3HS0A 2ZSWA 2BVUA 3EJPA 4R0LB 1DLHA 3POHA 2Z65C 4ZW5A 1RURH 2OMUB 5D7IA 3ARDA 2A83B 4LKXA 3AQDA 3HMXA 4Q89A 3LX9A 4LPCA 4HXAH 2CH8A 3C87A 4JM2B 3VXQA 2GEEA 4FL4C 1G1OA 4QT5A 1Q38A 1YUKB 2F61A 2VDKA 2P5WB 2Y7NA 1A22B 5C0CB 2PWFA 4JFEE 4HS6B 3PFUA 3VFOA 3W39B 2WK2A 3IKKA 3X17A 1HL4A 4G6JL 3SE9L 5TD4A 5JWZA 4Z8FH 1G94A 1ET8A 4X4KA 5HGAB 4GQRA 4GXVH 1KXQA 1L0PA 2KLSA 1NCWH 3RVXD 3ETTA 3MLPA 4AKOA 3LN5B 5ID1A 3RWEB 3RZCC 5EBWA 3LZLA 4YGVA 3S36L 2B9BA 1BOGB 1I1AD 4TSAL 1YPZA 2GTZB 2VLKB 5G4NA 3MCKB 4HIPA 3FT4A 3FHQA 2CR0A 4G7YH 3U9WA 5LAXB 3WS3A 3HC2A 5JPMB 1NLDH 1A8ZA 4LLMA 4PXWA 1R5WB 4OZFG 4ODWB 3I9GH 3DPDA 3MV8A 5HPMA 5IBTH 2H6KA 3O4OC 5F89A 3ZDXE 2PO6A 5AVZB 1RPQA 4JKKA 1ZS8A 4Z7QF 5MEQA 1G9NH 1XT5A 1YN7B 2KHAA 3C8HA 1KG0B 5CGYD 3V4VH 4NAAA 5GRVL 1XF4B 3PP3H 3CBKB 1FLRH 1QNZL 4RGMB 1MCFA 1MI5A 3IDIB 1A7QL 3WO4C 1BFVH 1B90A 4W9FC 5JQ6H 4OBRA 1L9PA 1JWSB 1OTSD 3GMPB 4H26B 3AXLA 1OAYL 5IWLA 1CXKA 3D18B 1RJCA 1ED3B 4W9CC 5D4HA 3MLWL 1UQSA 4PLKC 1TFHA 3LS4L 3VFTA 2Y25A 1NCIA 1ZT1A 1XSJA 2X28A 5J12C 1UD8A 3BCDA 1ETZB 3L3HA 1WWAX 2R15A 1ZJAA 2CBPA 4AVKA 3UG3A 1JOFA 2XY2A 3MV9A 4W4OC 2YQ2A 4Y4FA 1OF0A 1BQUA 4LPUA 1U8OB 5E7BA 5I1KL 1D5ZB 3I50H 5D1XD 5HHVH 2DWEA 4N8VA 2KI6A 5B3NA 1EERB 3ECQA 1VGKB 2HTLC 3QJTB 3FO0L 1EQWA 5HQGA 3AG1B 2K9FB 3BUQA 2Z6FA 5C71A 3MNDA 3TEWA 1J7VR 3BT2L 4AZUA 3DTXA 3VMNA 5EUKB 3OVUB 4UI2A 5GRXG 3HC0B 2ICCA 3ZIMA 4M5YL 4QOKB 1SLVA 5IJVB 4YE4L 2F54D 4JFPB 4AQZA 4U1SA 3DSNB 4OT1H 5CBAB 4G8GB 4U0RB 1RJLA 1P5VA 2K45A 3ZDYA 4N9GA 1IIKA 3B2MA 1OTTC 2FB4L 2JKSA 1E6OL 4K4KA 3NFSL 5MP6H 4OV5A 4TVPE 2EVIA 4KJWC 1KLFA 1II4E 4QGYA 4FAVD 4PGCA 1E2ZA 4P4RA 5H8DA 3I8EA 1ZVYA 5D7LA 1EZVX 2O5ZL 1A3RH 3TOPA 3BESR 3OF6D 3QUHA 3CLEL 3OSKA 4NCC1 3DJ9A 1HJCA 1QFMA 5DHVH 1TYJA 2M2DA 1IZJA 3R0MA 3RWFB 2BVTA 2YGOA 2Z8RA 4U6TA 3W11D 3UBHA 3RUGA 1IGIH 3MRBA 1T1ZA 1HFUA 2OZ4H 3D0LB 4L8DB 4ONGL 1GH7A 3AREA 1WWCA 1QFUH 1HOCB 3CJJA 5DD3H 4BRJA 1QKZH 1S9XB 3EFFB 4EN2A 1H15A 3B2DC 3HKZA 3LD8C 4J3VA 3T4AC 3KBHE 2FWOB 3TGXA 1ACZA 1AR2A 1C5BH 2V7HA 5IVXE 2Z31B 2OTPA 2VM3A 4JRYA 5MERB 1TYEA 4H0HB 3S5LA 1KGCE 4Y9FA 4Y1AD 2AXFB 3F62A 1OF2B 3NPSC 3A4EA 3V9FA 5TE6H 2FWUA 1J1OL 4G80B 4Y1SA 5C07B 1MDAH 4I77L 2VJ0A 5D1QB 1H8LA 3ME0A 4GKOA 3RDJA 3FFCE 4YHNB 2BS8A 1LK2B 3HS0B 1ZLSL 4AJYV 4BGDA 1P6AB 5KVMC 2BX5A 3QXDA 3J07A 3MLZH 2N0KA 3KDPB 4ZOYA 2WXQA 2W94A 4BP8A 2G60H 1VCBC 3BT0A 3IAGC 1C9LA 2A2QT 3LZQA 4OH2A 4G6KH 5GRJH 4DAGL 1F3JA 3T0XA 5GGVY 2E6QA 2K6ZA 4QT5B 2P45B 5IJ8E 1RVFL 3CFDA 3NDZE 4H88L 5AYTA 1GMIA 3SPJA 1BFTA 5HYNB 1SMAA 1DE4B 1P4UA 2DQDH 2JB5H 1Z9NA 4J1UA 4WIQA 4CNIA 4HSQA 3OKYA 2D3NA 1PMYA 2EDEA 4OFYA 2PM6B 2JFCA 2YOAA 2HT4C 4O4YH 2MIZA 3C09B 3QJVB 2B59A 3WXVH 1WFTA 3BC9A 2J5LC 4QXTA 5JXEC 3V0GA 4NQCB 4KX8A 3O4LD 1XGYH 1IARB 3ZE1F 3IURA 1E8XA 4LLWA 2MRYA 2BSRA 4HKBB 4L4JA 4F1SA 3WS3B 5B38A 1VADA 2UYLA 3WV0A 2CRIA 3N0PB 4LLMB 2NY3D 1BBDH 2Y2WA 1YMHA 4KY1L 1UVQB 1JHKH 1PLGL 3MV8B 1RI6A 1AD0A 3E3QC 4NQSA 5IG7A 1TMCB 5LGHL 1D6EB 1DQDH 1EV2E 5H35B 2D4FA 3WFEL 2DYPD 4PRHE 1ZS8B 5C8JA 1C7SA 5AW3B 1KT2B 1FVDB 1PGUA 2AK4A 5KZCB 2VM9A 4CY3A 3N1MC 4RISH 3GS0A 5D5MA 1MI5B 1UHVA 4WJKA 3PV6A 4GQPH 3M1OA 1JDAA 4JANA 4KVNH 4KDVA 3CZNA 4PJIA 3T4YB 3V5WB 2APFA 3A6OA 3MBEC 4LGPB 5E4IA 5KUMA 5HE0B 3ULUE 3ORVD 3WNIA 4HOMA 5EZLB 1QMUA 6CGTA 4X98A 1OHZA 1DBBH 4DPBX 3US9A 3UAAA 4ZO9A 3ALWA 3GUTB 3IVKB 1QLEH 2X1QA 2W9EH 4Z9KB 1FE8H 2CKBB 4G6MH 3U0PB 2A1WL 3FRPG 5L7XL 4ZTOL 3WE1A 5D1ZC 2R1YB 1JGIA 2HFGH 2GJPA 3MLYH 3PY9A 4K7FA 2RJMA 5D93C 3T2OA 3N43F 1UJ3C 1OGAA 3EH5B 3UERA 4O51B 3VJ6A 3VD4A 4L8SA 5ESVA 5ANMA 1S7UB 2C9UA 4HZLA 5I74B 2QEJA 4CVXA 4NEHB 3F8UB 4U1SB 4BFBD 3SGJA 3GB7A 1HH6A 2VKXA 4M3KB 1NDGA 5PAZA 3VXRA 3NP3A 4OV5B 3BQUB 5C97A 4GQBB 5DJZB 3RY4A 2TRCB 5D7LB 3FFOA 1UURA 4NQEE 4DW2H 1QUNA 3QDJA 3LQZA 2QGBA 5C9KA 1G7PB 4XCYA 3P0VL 3EBIA 5GXIA 1LVEA 2AI0H 3QS2A 4G8EA 2JTYA 4JO3H 4PRIA 2A74C 1TLMA 1EPFA 2Q2EB 3K5SA 1UD5A 3O6FA 4JO2H 2N01B 3KWVA 4JR9L 4NENB 4CW1B 4N68A 3AREB 5FDWA 3FB7A 2BDNL 1MCEA 4RNRB 4ZW8A 4JQXC 4LSQH 3X1FA 1J5OL 2Y7QB 4Z7QA 3D2UB 3RDTC 4HEPG 2NTFA 1UEMA 1E9QB 2FLMA 1A9BA 1KGJA 1SM3L 3LRHA 1TITA 1UD4A 1N8ZB 2X0WA 3EGXA 4WTXA 2YN3A 4WU5A 4WFHD 1GXRA 2VMEA 1FO0H 2DY2A 1TYEB 4JRYB 1WFUA 3D09A 1NFKA 2GC7C 4JY5L 2L0DA 1WWWX 3DIDA 5MHSD 3V6OC 3FZUC 3OGCB 5KWYC 1F6AA 3GJEA 2IXQA 2KUTA 3ARYA 3HUJB 2VDLB 4MNQD 3TFKC 2QGDA 43CAB 4U7SA 3P2BA 5E4EB 5D7JA 2WVTA 5DK0B 1EH9A 1V3KA 2HTKD 2F5AL 4N2FA 1IAKA 4DKFL 2Q86B 4XE0A 1CFQA 1RXLA 1HYSD 3DIFA 1T7YA 2F58L 3L3IA 2PM9A 2NY4C 5H37A 3MRJB 2NNCA 2B0SL 3WUWG 4R96B 3MAWA 15C8L 1MQ8A 3CFDB 4IA9A 1XH3B 3AC0A 5I1IL 2PW2A 1T7WA 1TU2B 4LPTA 1M7IA 2XWBB 5GRUH 1AY1H 2FO4A 1HYRC 3OKYB 3VQLA 4AV5A 2AABL 2ITDB 3CVHB 4DCQA 4K8RL 4OI9A 1ZANH 3HG1E 2E56A 4QXTB 3CFKA 4LL4A 3TO4C 4DP0X 2HLAB 4J3OH 5FLXg 5DFAA 2J56H 1FC1A 2VITA 4XYIA 1DJYA 1KPVA 1VADB 1KB9J 4HIEB 4L4TD 1QPXA 4OCSH 3SBWA 4PB0H 5C0BA 4R7DB 2CO0A 1AD0B 4NQSB 4XYHA 2P49B 2VQ1A 1IE4A 3HE6A 3QZLA 4TNWF 3EF4A 5E99L 4RVBA 4CJ0A 4N5UA 5C8JB 4MDRA 2CHNA 3GSVB 4W9HC 3SN6N 4E36A 4HCFA 1LXMA 1KLUB 4ZXBD 1BFSA 2IGFL 5FGBC 5TDOA 1B4TA 5C92A 4JFFB 2I24N 3O4IA 4J4PC 4NWTL 1BM3H 3OXSB 4WJKB 3JZ7A 1C16A 1ZS2A 4O02H 5JXAH 4H1LH 4ODSH 3U0TB 1KTLB 4H40A 4PJHA 4DO4A 2E7LA 2PCFB 2PYEE 2VNCA 2DD8H 5KOVC 2ZUYA 3CIKB 3ZE2B 3QFDB 4GUPA 4RAHA 2NYKA 2HCZX 3S8WA 1KIPA 4FQXD 4TUJB 1D5MA 4A2DA 1SRDA 3L81A 4HFWA 4HIXH 5KSAC 1AOZA 1E65A 4R7AB 3REWB 4WFGD 4HG4K 1I3VA 1KLGA 3N44F 2B1OA 4XBEL 1KYAA 1ZTXL 3UBXA 1NTDA 4NZUH 3RRQA 4Z76B 4N0YL 4XGZA 1UGNA 1YQVH 5EBLB 4DH2A 3KM1A 2VDQH 3FUDA 5DHEA 3QFJE 2Q6WA 4YSSA 1GYAA 2CPUA 3OJDA 3WYRA 4G1MB 2YUWA 4X4XB 4HK3J 4YPJA 2PR4L 1IBGH 2LU7A 1AFVH 4L8SB 3TBSB 4FQIL 3LV3B 4U2YA 2HRGA 3D34A 3DJRA 1JHTB 2WTRB 1CGWA 4HZLB 4L1HA 4UBDD 2YS4A 5F7BA 2XL3A 1A02N 3ZWLB 2D7TH 3KW7A 3PWPA 2D8KA 2X10A 4UQAA 4RDQF 1NCAL 3VXRB 5GXBB 4NKDA 1TQTA 4NM8L 4Z23A 1ZLUH 1OGTB 3QR1A 1KC5H 3CHXA 3UTPE 4YBHA 3ZZ1A 2DQJL 5IIEA 4YC2C 1IFRA 2QPEB 3NOIA 3TEXA 5AW0B 5FW6A 5C0IA 1NIFA 4AMYA 1QUNB 1C08B 4PYHA 1LDPH 2OMTA 1E2VA 5D7KD 1EHNA 3BIBX 3KEHA 3VFSA 3GKZA 3WBDA 4BK5C 2WGXA 2XVLA 5MENE 4KKBD 2KZ1B 2GSIA 4FG2A 4JFSA 4QWWD 1XSIA 1XZ0B 4JRLA 4WU7A 4F7EA 2WXLA 3DVGA 3GTVA 3HI6L 4XAKE 1ID5I 1MOEA 2W9LA 1UH2A 4Q0XH 3NQKA 5J56B 4ZQKA 5EWIH 1LWRA 2EC8A 4AENB 4HA1A 4Z7QB 5GS0H 3O9WC 3LH9A 3OWRA 4Y19A 3VMOA 3OZ9L 4PRPD 3I9IA 1A9BB 1SLWA 2H1XA 2ITEA 1RZIB 4XMTA 5I73B 3KCPA 2QADD 2ZXQA 4FQCL 4H0GA 4YS4A 1YZZA 4JGJA 4HC1L 1G4MA 1R5IA 3IJSA 3O6KH 3RL2B 5JOPD 3HZ3A 1O9VA 3D25A 3GJFB 4JO8A 4LHQB 4R97B 4A1RA 4AM0A 2IXQB 5C0FA 1NEZA 2CJSA 4PTUA 4NQDD 3PXHA 4HUCA 3HCVA 4UTAA 2X6VA 1ZLDA 2MNWA 2C5DC 2GSGA 4ODUA 5CKAA 2JJUA 2XQYK 2G9KA 3AB0C 3WNNA 3G08A 2BS71 3L3IB 4NHUA 5G4OA 2AMUA 1J5CA 1I82A 4WI4A 1BD2E 4XB8A 5CJQL 3LCYA 1C5CH 2WJ5A 4NT6A 2EDMA 2NXZB 4G43A 4JT6C 1FFTB 5I0ZA 1BJ1H 4WO4C 3SPGA 2H1LM 1M7IB 2JJTC 3FUHA 4MZRA 3SCMA 4G1EB 1M1XA 2YA1A 4PN6A 1FPTH 5E8OB 2AJYH 4Y1TA 1ND0B 3FAXA 5I8EA 1KBVA 4M5SA 1WP6A 3RL1A 2WN3A 3LS5H 2NYYD 4YGAB 2Y6TE 4PJ7E 2ZWLT 3KYMA 4IBZA 3WHXA 3WL9A 1OKEA 2ZOLB 4GAAA 2NT0A 3HNVH 3LEVL 4U4IA 1MCNA 3CX2A 4S11A 2ODIA 3CQFA 4MMXC 3I7KA 5E56A 1J05B 1OD7A 5GMKn 2XZQL 4Q58C 2GJJA 3DETD 5INCB 1NEXB 2NSQA 3PLYA 2NY6C 1KV7A 4NLAA 4C56B 3C60D 1OWRM 5IJCC 1X5LA 3CXFA 3N40F 4UMGA 1FNFA 3HE6B 4ADGA 5EZPA 4B9PA 2NY5C 1QZNA 3PIQB 3ZW3A 3G9VA 1CI5A 2OSXA 2WBJB 1HU8A 3NCJL 1KGYE 2X1OA 2O9KA 1S9YA 5TDOB 3U4KA 3CVIL 1T03H 3VXUD 5IB5B 3BFOA 2NR6C 2VXTL 1MRDL 1CUOA 2VDMA 1XD1A 1I85C 3VH8G 3DBXA 5BNXD 1S9WB 3ZTJH 4IBUA 2ZAGA 4AGMA 2A5UA 3MKSB 1OARL 3AU0A 3S35L 2DLIA 4XXCA 3CSGA 3LRSA 4OCNC 1UB5A 3GBNH 3LZFL 4D9LH 3GD1I 4A0AA 1XX9C 3WY4A 2NXYD 3HFML 1NMAL 2CXGA 3VWJD 1D5IL 2ZPKH 1KTDB 4P05A 1AR1C 1AC0A 2IANA 3B9KA 3CQPA 3PGDB 1UOKA 4PWJA 2EDYA 4KBPA 5C3LD 3H9SA 2LV4A 3V55A 2DLFL 4RBPH 1KGXA 5CZKA 1NC4D 3PDOA 1V7ML 3UBXB 3NIFA 3ARBA 5TF2A 3UOAB 3L2NA 4AN0A 5I82A 1Z9OA 2GPZA 4CBZA 2QZQA 2A9NL 3AQYA 3HZVB 4ZFZA 1SJEB 3MJ8B 4JDVA 4JL2A 1QLFB 1BW8A 2IH9A 3OJDB 3QH3A 2D0HA 1TKWA 3CVBA 3GMLA 5IGOA 2DH2A 2VB5A 1OOAA 3MACL 4C4UA 2TRHA 1CFMA 2PPCA 4G7QB 3VI3E 4IU3B 3BP7A 2EE3A 5EC2B 4B3VA 2YNNA 1YEIL 1X5JA 2CHZA 1U6AH 3TCLB 5MEPA 4GOSA 4UMSA 3RYMA 2YWZA 4NKDB 3WU1A 1W91A 1K8IA 5ENWA 4NC1C 4Y89A 5E6SA 2PW1B 4CBPA 3QIUD 1MFMA 3C6EA 4GAJH 3SJLD 1I1AB 1EBAA 3WIAA 3QJFA 3T77B 1BEXA 1CLVA 3ZE1B 3QA3B 4HJUA 3T71A 1RZ7L 2J8UA 5IW3A 2X4QA 3PQYE 3A6CH 3MODL 3V8CA 5E6UA 2DIAA 4E9LA 1GPOL 4I18A 1B3JA 1DQLH 4G8IA 5E95B 2CHXA 1GTNA 2L7QA 1JGLL 4Z0XA 2NZIA 4GUCA 5HD8C 1NPJA 4WKZA 3IDXL 4UZGA 3QSKB 3T9WA 1COBA 3GHPA 3VFVB 1YEJH 1BZQK 1KXVC 2C4FT 2WYZA 3W9EA 2X4RA 2NX5B 3KLLA 4IRZL 4JFEA 4FKEA 4WI2A 4XNQB 2E7BA 2HRPL 5M95B 3TJEL 2FO1A 1KTBA 1R5IB 3U48A 3TTYA 2N1TE 3C8KB 4ZAKA 3HFQA 2V0AA 4XZUA 3D25B 4X6EA 3QUGA 2VDRH 4KU1A 4QUOA 4AOWA 5T1DH 5F7MC 1A6UH 2AF2A 2ENPA 3BH8A 4H8VA 3KPPB 4S0HA 1YYLH 3BUDA 3KPNA 4HUXA 2FZ3A 3EQ7A 1KZYA 4NHUB 3IUMA 3MZKA 2UUDH 2R69A 5FF6A 3W0WD 2P42B 5FQDA 1KFAL 1K4DA 3WFBH 1YUHB 2VZUA 1FZOB 4HP5A 3BUYB 1XZWA 2Z7WA 1JWUA 1LYQA 3DYOA 4G43B 3ZDXA 1U8PA 1QNIA 3WCYA 2ZP0T 1G5GA 3ZTNH 1YEFH 3N43B 1M1XB 2Q5BA 4XOCA 2QDWA 5I8EB 1UM5L 1URLA 5JPNA 3MLTA 4MMYA 2GK2A 4W6YB 4FA5D 2EC9U 4I3GA 3DI3B 5T1LD 2FJUB 1CICA 5ICYA 1RLWA 4JX0A 5FHBH 4LQFH 4K5LA 1RUKL 5DJDA 4ESKA 5IBLD 4M7LH 4MJ5B 3V7DB 1S7TA 2RAMA 4ZNCD 3TF4A 4Y4HD 2HLFC 1AYOA 2Z91A 2YD3A 4GM8A 5C0ND 1JGVL 4NDMA 4K94H 4GQ9L 5F96H 3DHUA 3UAJD 2J55H 1CQKA 4DKDC 4RMQA 2H0EA 3MRLA 4LPYA 2OMYB 4KTYA 2BWQA 1Z9SB 4ZT1A 3SDXF 5HVFB 2APSA 4NOFA 2F53D 2L7EA 1WS8A 3M07A 1ONQA 3KWTA 3QDAA 2PUQT 2FIKB 4U6HA 1JF1B 1U30A 4PBYA 1IQDB 2IAAA 4K7PX 3U1SL 5F88A 2I60L 2R9HC 4NKOB 4UQEA 2X88A 4DNVA 2GBAA 4A0AB 2OR7A 4TQ8A 4XVSL 3O2WL 4UNTA 4S1QH 3OPZL 2DQUL 4IBWA 5CP7B 1VE6A 2X4TA 4JAMA 4XP4L 1ET5A 3I3EA 1ASPA 2IANB 3B9KB 3CPLB 3OB0H 1DBKH 3X3GL 1TZAA 5AAWA 4FABH 4KTEL 5CGBA 1C1EL 3CFBB 3DROB 3DX9B 4X6CE 4HJGB 1N0XH 1EANA 1L9TA 2QQQA 1QQDA 2EXSA 3QJXA 1T2QH 3ILQD 4JFYA 4IRJC 4NNXB 2JI1A 3EOTH 3B7TA 4CVWA 3QH3B 4WJG3 2V5YA 3P40A 2ADJB 4R5XA 2EIDA 3CN4A 3V9EA 3L16A 3QDGA 1KMGA 5K69A 2GB2A 2EJ1A 4HAKA 4QHPA 1L7TL 4DZBB 1YY9D 2VYRE 1C9SA 5DEGA 2AXHA 2VC2L 2PWGA 4NZFA 4FTVD 3KGUA 5IVXA 1SN0A 5DEZA 1K8IB 3OV6A 3GC3A 4GRWH 4JPQA 4K7PH 4C83A 1VKXA 1AHWB 1H6EA 3WIIL 4GG8A 3O4LB 4URTB 2J88H 2YUVA 1OAXH 3O2DA 2Q7QA 3WMQA 5F0LB 3RFZA 2YAFA 4OAWA 5D8JH 3RIFF 3IVMA 3BFQG 4K3JH 5GGSY 4GH7B 2X4QB 1A25A 3FFCA 4FNPA 2ERJC 5TQ0L 2NY3B 3NJLA 3KLSA 4BL0A 6PCYA 4I18B 4XCFH 1JNNH 4JSVC 4QHUB 3FCGA 4QHMB 3QAZC 4S1RH 4Z6AT 2WC7A 3GEFA 1MJ8L 3EADA 3K2MC 1L6XA 4JG1H 3VM5A 1RIHH 4PI0A 1RUPL 1TT6A 1Y6NR 3W9EB 2X4RB 1IU1A 4JFEB 2RCSH 3DO4A 1DQQB 4DPCX 1RCYA 3DLQR 3L3JA 5CINH 3L95B 3K27A 5FKAA 2XPZA 4P9MH 4BUQA 1KCWA 3S98A 4X9YA 3OLGA 4PIBA 5CGMA 1OSYA 3CNKA 5T5FA 1ZHNA 4X5PA 2A77H 1XV8A 1RIUH 3BP5A 2JMRA 1U8MA 3KM2A 4LEBA 2CR6A 4GSDL 4ZMOA 4Z7IA 5IFHH 1MF2H 3O4HA 3F7KA 2CO4A 1F58L 5MEOA 4G9FE 3UYPA 1PSKL 1TZGL 3NA4A 3RMZD 2FZ3B 4YSQA 2ENJA 2XVKA 3MRDA 3DMMC 3VE0B 1EZVY 1CVSC 1GS8A 4U1MA 5KOMC 4HJIA 3HEIB 4K9EL 5J4MA 2E4TA 5IHUH 3ZKQD 5A2CA 4I7ZC 4MA1B 1JV2A 1JWUB 4TQIA 1DJZA 1M3JA 1ZT7A 2OR8A 3CMGA 3QYMA 2UXVA 2VL5A 4PRHA 1JERA 1SLXA 4MNGB 1Y0LB 4N25A 3PXWD 1X5MA 4PJFF 4GI8A 5ALCL 2J71A 3NCCB 4GI9A 2BVQA 4ZQTA 1BZ7A 1M9SA 5JPNB 3MLTB 2I5YH 2OCJA 3QG6B 3ARPA 1PIGA 4LSPL 1OSEA 4XP5L 1CICB 3VW3L 5A40E 4DN4L 1MFCL 2V8LA 1IGFH 4IOFC 5DJDB 4TOYL 1EO8L 4AKPA 3N91A 3DUSB 5I26A 4IS6B 2FYVA 3L3OB 1CF1A 4WNQA 2QTEA 2FX7H 2YPLE 5ABZA 3UTTD 2HKMA 5GGUA 4U1IA 1N6DA 4OZIF 3V2AR 1RIVL 3E3QE 4F8OA 4R3SA 5INDA 4FXKB 3BGMB 1NFDF 2GITA 1XIWC 5FUOL 3QC6X 2V8MA 2KYIA 1ZMYA 2X2HA 3GJFK 4AYBA 5I8KL 3JPXA 5I6PA 5HGDB 3QS3A 1OPGL 5F88B 2HT2D 4H7VA 1F4XL 4JPVH 1MCWM 2ID5A 1P7KA 4RQQB 5F21B 2G0LA 4R6UA 4PAZA 1P5UC 4YNYA 4ZZKA 3GREA 5KBPA 4JGNA 4P46A 4WEBL 5DF0A 4GGDA 1E3ZA 2DQEH 5E6IC 5JOEA 1QFWL 1SZNA 3BKCL 3ISYA 4XMZA 1EHAA 3BKML 5HGHA 3F3PA 3KLHC 2F8XC 2ZKMX 2B4CL 3GZOA 1FG2A 1QR1B 2HB0A 3MLSL 5IB1B 2CA4A 4YSEA 1UZ8B 4NQEA 4B9IA 4M6MH 4QHKI 1WFJA 3KPQB 4UTBH 3ZYOA 1S78D 4X6DE 1MAKA 4FFZH 4JFYB 3RKDC 5E0QA 3C08H 1FYTD 5J9PB 4AGOA 2XZCH 5BO0D 1XQ4A 1DEEA 4K2UH 2FBJL 4HXAL 4P5TA 4G42A 3UZEA 3X11B 3EO9H 2C3WA 3QDGB 3O3DB 2BNRE 3M7FB 3VYOA 4N0FB 2YPKB 4XPHH 3TZVC 5IQ7L 1MZYA 5E6RA 4OLVH 1MPAH 5CWSA 5BS0D 3RGVD 3O6MH 3PUUA 1RAMA 5TEFA 2C34A 4WUUD 5LG6A 1HHJB 4NO3A 2EDWA 4N2IA 1IT9H 5DYOB 1URIA 4A38A 4GSQA 4AUUA 5CZVL 4Z8FL 3GC3B 5D7SH 4GG8B 4GXVL 5I5IA 2CN3A 4XWOD 3AT8A 1NCWL 4ZFQA 3ABLB 3KGTA 4G9DA 4LCWE 2KPWA 4FQHB 4KK8D 1EMTH 1D7DA 2ZSVB 3PPSA 2HJKA 4HK0B 2XZZA 4AYGA 4DNWA 4M7JH 5JQHC 1YG9A 3R7QA 1K4CA 1JYVA 3Q5TA 4G7YL 3TVMA 2DJSA 2YARA 3NIGE 4WI7A 2PWHA 1NLDL 3CDZA 4YSUA 1N7MH 4XNUL 5IFAH 5IW6A 3KCWA 1LJMA 3I9GL 4FG4A 5DJ6A 5IBTL 1BZ9B 1QBLH 2R56H 5J06A 4ZUUA 3U0WH 2HUHA 1WITA 4ZXBB 4WSGA 3SDXA 5IOKA 4JDZA 3IF1B 1P84K 2J7LA 5LBSH 5IMLB 5AQ0A 1MLCA 2I07A 2NZ9D 3WN5B 2BZ7A 2C8NA 1FLRL 4QRPA 3U1QA 5CSZA 3MRCA 4WI0A 1QW9A 3GQFA 3NJIA 4MMZA 3T2QA 1D2OA 3EYFA 4OM0H 4B27A 2C26A 3D0AA 4MJIE 4DOHE 3HG1A 1ZHNB 3V6OE 2E9GA 2LE9A 1HHGB 4FQXB 4MD0B 5T3XE 2AQ1A 4IW4C 3TIDA 4PW9A 2Z92B 2ZUXA 3OR6B 3NSXA 5F97E 5LB1A 4GRLD 3B43A 4YLQT 3ZRFC 4TUUA 4A66A 2YMTA 5FGRA 2OVRB 3QQ9D 4JFXB 1JV2B 2FLBT 4KUCD 5HHVL 2P8MA 1DVFD 2VL5B 4YHYB 3LN4B 1CG9B 1D6VH 1F11A 1X5XA 3VFRA 2EACA 4YPGA 4UTAL 2X7LB 4DN3H 4X99B 1HHKA 5FA5B 4X50A 3FONB 5EU3B 3CFVA 2DIJA 1XGUA 4E41A 4X4YA 3WFDH 5B8CC 1U3HC 4BFJA 1A4CA 3DJTA 2PYEA 2B1HH 2WCGA 5FW8A 3WLBA 3QZMA 3CC1A 3BIKA 4I3RL 5DA4A 4YHOH 2VXQH 2W38A 2C1OA 2IAMC 1A14H 1U8IB 4WNQB 1HC1A 3IJEA 3SYQA 4ANKA 5MP6L 1XSKA 4ZMAT 1MJ7H 4XC1H 1J0IA 4OGAD 3ROOB 1DLFL 4G72B 4MAYA 2HMIC 2WYHA 3CN3A 3RWJA 2QKIA 1A3RL 2X2JA 1O7VA 1OGAD 5INDB 3DSFH 3QEQE 2GITB 3KR3L 3PHOB 3IYLW 3AMLA 3NN8A 4M5ZH 4B7LA 2H47A 4LVOB 2MCG1 1LP9E 1DJWA 4PRPB 4LASL 3QFJA 1HEJC 1IGIL 2HJLB 4GXUN 2OZ4L 1LQBC 3QUXC 5FECA 1XAUA 1QFUL 1ERNA 3VM7A 2PM7B 1ADQA 4MD5B 3GSRB 5CCKH 3U4BH 1E28B 2ICWA 2HZHA 3MNZB 1DBAL 1E42A 1W0YT 3V5HA 1R0AL 1ZTMA 1C5BL 5IOPA 4Q6YA 1KBWA 2XVGA 3JWDC 1W8OA 1WCQA 4HK3N 4M62H 4CMHC 2JCCE 1USZA 5F9JB 4FHJA 1T5WA 3QT2A 2EBSA 3WNJA 1TZHA 5TE6L 3U2SA 2P46B 1JN6B 1I8KA 1MW0A 2GY7B 3GXUB 4AVJA 1IRAY 3POCA 3O6FD 4FEIA 3CFUA 4UINH 1O6GA 5GS1C 1FAIH 4J2QA 4U3CA 2TAAA 4OLXH 2ODHA 3O41B 4G7RB 3SYOA 3WJMB 4AWJC 2XPYA 3MLZL 5IMMB 3AS1A 4TVSa 2HG0A 3KRWB 1OE2A 5MENA 1BX2B 3WY3A 1DEEB 1EZUA 4PP1D 3KNBA 1JXKA 4G42B 4G6KL 4V1DD 4AYSA 3RLMD 4KQ4H 4HU8A 2H32H 1VEMA 1XO8A 4JDEA 4P3DA 4K3DL 1S46A 4PJFA 3IU3B 1VGEH 4I4WA 1AD9B 5JHMA 3BAEH 3S37X 2E6JA 2QQLH 4Q14A 5SWZD 3BZEA 4KJYB 1WV7T 4O4YL 3NBNA 4JY4A 2FEJA 4PM1A 2H3KA 1ZEAH 2EVGA 1J11A 3KPOA 1RUQH 1R3LA 4B9CA 1J88A 1YAIA 1L9NA 2DI8A 2WNXA 4FS0A 1XGYL 4U05A 4OIAA 2HU5A 3V7MA 4DPRA 25C8H 2ED7A 2XKUA 1KNOB 1KY7A 1BBDL 3UTZA 1XH0A 5IW6B 4J81A 1JHKL 2EDXA 2HG5B 3EH1A 4OZIA 5F0PB 3SDXB 2HX9A 1DQDL 3W37A 3EJYC 4PCKA 5M94B 2GNQA 1IKNC 3VXUB 2OKMA 2K6WA 1JMZB 3N41F 3LQAH 3IJCA 1IM9D 1KOAA 2I07B 1ACYH 4AK2A 1FFNB 5E8PB 4L4VE 4QRPB 4MVBD 2AANA 3MRCB 1NCGA 4PJ9C 12E8L 2NXYB 2VW4A 1YNKH 4G3YH 5CJXA 3FNKA 1I3RA 3VWJB 1IBDA 5BZWB 2I7SA 2FWSA 4HIIB 3VRIA 1PIFA 2ICEA 3QARA 4NZJA 3S37H 1T21A 5DQ9B 1E8MA 3SY0A 1WBXB 1UXSA 4Y5YC 3IWVA 1NC4B 5DVOA 5DRWB 4U6VH 2WNGA 1GOGA 1QLEL 4X7TB 1INDH 2W9EL 1FE8L 4G6ML 1CD1B 5JIKA 3FCTA 4LVHB 3B7YA 2JXMB 4JE4B 3V6ZA 4X7EC 3T65A 4W9GC 5HYSB 1I8LA 4Z95H 1CU4H 3MLYL 4YPGB 3JROA 5I8OH 3PE9A 5IMKA 4XNZC 3KH4A 4R90H 5A16A 1XGUB 5A3IC 4NSKA 4E41B 4HKJA 1J9CT 5IJKC 4WI8A 3ETBF 4JKLA 2CALA 1SNRA 4B95C 1I8MB 1TYRA 3BIKB 1OP5K 4NYLA 4NZRH 1KBKA 5K1NA 1TZOA 1E7VA 4PJXF 2GBVA 2O6PA 4QYOB 4XBMA 3VTTA 5AB1A 2JI2A 2VAAA 4PJ8D 3RVWC 4PGDA 4MAYB 3VGHA 4R2GB 5LGYA 1J0ZA 3IULA 4DW2L 3PYCA 5F7DB 3RWJB 2CUHA 1AS8A 3H2PA 4ZPTB 2D7QA 4WFFD 2EKJA 2AI0L 3NN8B 4XVOA 4EKJA 4JO3L 1SQJA 3L2MA 2MFNA 4LLQA 3QFJB 2DLTA 4U0QB 4JO2L 1A1OA 3GSNH 2CK0H 4K55A 4YE0A 3CIQA 4LSQL 2H5UA 2AXGA 3B37A 2AJZB 5IESH 4OLUL 4CAGA 2ICWB 4IK6A 1G6RB 3VI3A 1USQA 3CSPA 3OJ2C 5IQ9A 3L4CA 3NK4A 4PWHA 1FO0L 3UEQA 5FOBB 1LD9A 2QVIA 3UGXA 4KRPD 4GMBA 4F9PA 2A9MH 1VIWA 5BMFH 3QQNA 1TZHB 4LGRB 2VRAA 2N0MA 1A6TA 2G3ZA 5FYKE 3CN0A 3VFPA 1F5WA 2OJZH 1Y6KR 3FK3A 3PQYA 2CGZA 2OL3H 3W0WB 3KPSD 5GJSH 1JPGB 4YDVA 4EQ3A 1ROWA 3KPRB 3QUYD 6TAAA 1ID2A 4JPWL 3V0WH 3OSVA 5LNEA 3QZWG 3QNXA 4N2AA 1OHQA 5IMOA 3SE3C 2EE9A 2VN4A 2FJGA 3PCYA 3IGKA 3F58H 2N56A 1NDMA 5IROA 4XCNA 3QO1A 4PJFB 3HPLB 1UWXK 1V5JA 4F7MA 3FT3A 1AY1L 5GRUL 5TDNB 1FH5H 3S96A 1H5BB 3W81A 5L2KA 2H8PA 3WI9A 1NL0L 4QRRE 3BZEB 4NSXA 1ACCA 3AG2B 2YQBA 4MBOA 1F86A 2EDBA 3U83A 4BV1A 1SXBA 3RG1C 1X5IA 2CLRA 4NC1E 1R3LB 3EJSA 1P4BH 4F2EA 4DGYH 1JF5A 4Y4HB 5DJ0B 2DJUA 5DVMA 2ZE0A 2WQSA 2R2HA 3S3CB 2Z8SA 3VGGA 3EH3B 4OCSL 4X42A 5GRVK 1KDJA 3W5MA 4MASA 2ARJA 3H3BC 5E1QA 1N5YH 4OZIB 3ZL4H 3AABA 1DYZA 3ZKND 2E6PA 2F53B 4G82A 1NFDB 1VCAA 4LSRH 5I6XB 3MMEA 1X4YA 2EE0A 1EEZB 5ISZA 1NAMH 1CYXA 2I32A 3O2DL 2C9XA 1G7IA 3UR4A 3CDYA 2FHBA 4MDJB 4LVNB 4OZFA 1BPOA 3AWFA 1IIIA 3HAEG 4YR6A 3CZSA 2HJBA 3IT8D 3OKKA 3PUCA 4O02L 5JXAL 3MGTA 4KO7A 1NGWA 4M7KH 5DJ8B 2ICWJ 1HXYA 2DD8L 3G5YB 1KYDA 2ICEB 1TQCC 1T21B 2E7MA 4XPTH 2E3VA 3I6KA 3RZCA 3SY0B 5DGQA 1UXSB 3TA4D 1FGNH 3OMAB 4OLEA 1E9PA 5E5UB 2W65A 5C09E 1IC5H 3A0OA 3CUPA 4OJDH 3D9AH 1FZMB 2JI3A 1IL1B 4QQEA 2CHWA 3CVCA 1WA0X 2BCKA 4XMPH 3V6ZB 1ITBB 4NZUL 1IGMH 1FNLA 4XC3H 1FORH 2WMPA 3X1GA 3OX8B 4MCMA 4AGNA 5FKSA 1Y6MR 5I8CA 5IMKB 3UP1A 4AQEB 5BZXA 1IBGL 1YEDB 3EFOA 4GFXA 1S9VB 1N18A 4FTVB 4HKJB 5IV2A 2HESX 1M4KA 2OYLA 2D7TL 3VFMB 3C6LB 3TWCH 1LLAA 2C9VA 4NYLB 2PXYC 3UH8A 4LPWA 3FUFA 4FZ8H 4QPEA 5J5EA 2WNKA 1KJ2B 4FJYA 1KC5L 2VAAB 3IS1X 3GMRA 4FLSA 4L3GD 2R0WH 4K71B 4Y5XB 4X6CA 1T0NA 3EJJX 1LDPL 5CILH 5TDHB 4O3UB 5J11C 2E0PA 4EBQH 1FZKB 1A7PH 2GIXA 4W4OA 4LEOB 2ATPB 1JZJA 4LG9A 4LLQB 2EDRA 1WF5A 5I23A 1GYCA 4AEEA 4H8UA 4E42A 3ULUL 4J12A 5EWIL 3CZLA 3FH8A 4KC3B 4NZTL 2CN2A 5GS0L 1FL6A 3UG4A 2AXGB 4A37A 2J1ZA 1DANU 4JO4L 1N4XH 1S6NA 2X87A 5JHDE 2AKRA 1I1CA 1JG9A 1I1FB 5I0WA 4H25A 3H53A 3L5XH 3O6KL 5E03A 3LAFA 1MHCA 2VDPH 5IEKB 3EMHA 4WWKD 3NP4A 4XPAH 1E5UI 4OF6A 5TF0A 2CDGB 2XZAH 1S4IA 2IQ9H 3DSMA 5H2BA 5F9WB 1JWMA 3HBQA 4HJEA 2O6EA 4IKKA 3FCUA 1JK9A 1LO3H 3CFNA 3WNMA 1FN4A 4AMKH 1IC4H 5J13C 3ZHFA 4NO0D 1KFGA 2FVNA 5DQDL 3WTUA 1BVNT 4YDNA 1OP3K 4CDHA 4M8QA 5JLZB 2IOOA 1SOKA 4AYEC 4BYHA 4OTXL 3MA7A 1WRFA 4PJ5E 1PZ5B 3QO1B 3ULEC 1TO5A 3BSZH 3MR9A 5DUPH 1OAUH 1QEWB 2TRYA 3FUEA 4N26A 4Q6IC 1A7NL 1BYOA 4R9HA 5L2KB 1A1NA 1J9RA 1FPTL 2AJYL 1WTLA 4PWGA 3T4AA 1A66A 3MHZA 2CO2A 2X1PA 5E2WH 1ZE3C 3LS5L 5AKVA 5EORL 3SD2A 2FLRT 4HUKB 4YDJA 5DMIH 5EU7C 7FABL 5KSBE 1EO7A 3ML8A 3HNVL 2ZX6A 1OSZA 4PJXA 3OR7A 1FGVH 3P77A 3L9RA 5HHXL 2XXMB 4UB0H 4G9FA 3RWGA 4HSAC 5IF0A 2UY7B 3D4CA 3UX9B 4AMZA 2ARJB 4PIRF 3ECWA 2R2EA 2BW5A 2VDNH 1T66C 3O11B 4MDIB 1K6QH 3PAVA 3O4JA 1WBZB 2RHEA 3WIHA 5ISZB 1RZKC 1PNDA 2IBZX 3H7BB 1W80A 2AGXA 2ZUVA 4Z3IA 1MH5A 4FNRA 4KAQH 2FQGA 4ZFOL 1WO2A 2AZUA 4JHUA 3OKKB 1KB3A 2YD1A 4L23A 1NZRA 5KYNA 1NGWB 5B3JF 3MV11 3GBNL 3IDUA 4D9LL 5K39A 1MFUA 3GMOA 1BSIA 3VH0A 2R4SH 3VYPA 2WSKA 3ECBA 1WAEA 3EYSH 3GLZA 2GHZA 1T1WA 5JXEA 1YJDC 1PCXA 1S5IH 4HW6A 2JKIS 4JPIA 2YPLA 3N0AA 3NZ8A 4X5XB 2ALAA 1FVEA 2FEEL 1MELA 3KJ4B 2C7UB 2AQ3A 4FQ1H 4GLRH 4C4BA 2WZAA 4DKEH 1N67A 4FX5A 3APCA 3QUZC 2NYZA 4PR5A 1DUZB 1FNHA 2YK1L 1I7UA 5E94A 1NWOA 2WLZA 1V8HA 1P2CA 4O9HL 2Y24A 3I7LA 2CLVA 4HEME 1B88A 3LPFA 2XHNA 2AK1L 4YDKH 3FRPA 5F7UA 1ZVNA 3DIVA 3FUIA 1ERJA 1NGZA 2R1WA 4WUUB 5DZPA 4D3CH 3C2SA 1VHPA 2QELA 3G5XA 5EZIH 5J1AB 1I3GL 1KYUA 3OLEA 4P5RA 4DUXA 2X4NA 3MBEA 1MRFL 3KRXB 1WFMA 1E67A 2DEYX 5J12B 3GHBH 3SWSD 2LOEA 2WZ0A 4QD2E 4J3OD 1GS6X 2YAEA 3LB6D 1AIFA 1U8JA 3RTLA 2ZONA 1BWMA 3AY2A 1DQLL 2HXAA 5KVGE 2J4WH 2X4UA 2HPOA 2NW2B 3MO1A 2RIKA 2GT9B 4FQJH 4HS3A 5D1ZA 2WXGA 3TEZA 4ZOXA 2A6JA 3N41B 1KGCD 3HI1A 5BW7C 2BNRA 2B39A 3EDFA 1UJ3A 3FTXA 4NP4H 2P7TA 1XXDC 3JWNH 4N5EC 3GBDA 3TURA 1CVRA 2G3MA 2XWEA 1DSWA 3FFCD 4Y4KC 4PBWD 1FL5A 3EHBC 3NIDF 1J8HE 3BWAB 2W0PA 4Y2DD 3N0EA 4JFDE 4PBDA 2EIEA 1M42A 4LCWA 4S0TD 1A6UL 3BOVA 2C3XA 4FG6D 3FCUB 1YYLL 3BHBA 3MROB 3IIYA 5ERWA 3NH7H 3I74A 1BQRA 3UVMA 3NZHH 4U1JA 3X14A 3RRMC 3D48R 3VFUA 5JZ7D 3CC5B 1DVFB 2K0RA 1VFBA 3IDMB 4NQTA 4WGKA 2NDFA 3WFBL 2V3DA 1XB8A 1G43A 1JXJA 2A74A 2FR4A 4J84A 2XFXB 3LVEA 4U1HB 1NWPA 4KVCH 5EPMA 3GRGA 1SN5A 3I75A 4KFMA 1ZLVH 4EDWL 1WD9A 3AUWB 5ALBH 3FB5B 5EFIA 1PTZA 4JQXA 1YEFL 4U6YB 3RIFK 4BHUI 3RDTA 5E0FA 3LD8B 3WUWA 4M3HA 2AVFA 1GGBH 4GIOA 1FP5A 4ACTA 3EI4B 3E0CA 1AXTH 1PU0A 2VC2B 4Z78A 2GC7A 4FP8L 4ETQB 2Y0SA 4MJIA 5FHBL 4LQFL 3V6OA 5GSVB 5AG8A 3PU7A 1CDCA 5E2TH 1YQ2A 4PJXB 1E5CA 1YC8A 5DUBB 3DRQA 3K1KC 2IADA 4YBQC 2FAUA 4GS7B 2QJDA 3P9MA 4K94L 4BINA 4L0PB 1QSZA 4W9EC 5JA8B 1HCVA 1RHHB 1IMHC 2Z2NA 2CBOA 1UYWH 4XRCB 1EAJA 1EVTC 1X7TA 2XYBA 1HL5A 1UCBH 4KROD 2ZX7A 5GGVL 3UBGA 3JTSA 2OMWA 4RGMC 4L9OA 4LEXH 5FYKU 2XJLA 4B5EA 1QWUA 2CM6A 3AS0A 4F27A 4TVUA 4R5VA 1SVZA 4QGTA 1O9WA 2FL5B 4GLRI 3TN0C 1LNUB 1GHFH 3ULUD 2AC0A 1MWAH 1THAA 5GS0D 1OTUC 4BCYA 4KK6D 4LAQH 1ZOXA 2QSTA 2ZXDA 1NM4A 1SEBA 2WXMA 3GSOB 3FQTA 4UQ3A 5BVJB 2YAMA 5DRXB 2KZWA 2CR3A 3TO4A 1FIEA 1DBKL 3IXAA 1EFXA 5KSUA 4ZDHA 4FABL 2X1XR 5TK4A 4K3ID 3N9GH 4JPIB 3G5VA 3A5VA 4L3CA 4A7VA 1U58B 4QJ4B 1AJ7H 4OD3L 3DO7B 3KVDD 1M6OA 1N0XL 1L9MA 3ES6B 5F1IB 3F7VB 4NPJA 4AUJA 5EMJB 5ADOH 4LCUA 2G4GA 5HHPA 3PHQB 1T2QL 4V1DB 3WXWH 3QEQA 1MFAH 2NY0D 3VD7A 3BEVB 1RFDL 2RQEA 3EOTL 2VW6A 2QC5A 1T0PB 1VFUA 4E9QA 2CLVB 2VWEC 4NUGL 3FRPB 5FM5M 4U0RC 5FGBA 4OGYH 4XOBA 3PE7A 3AAZA 4POUB 3BDXA 4J4PA 4RESB 3JWOC 1UKSA 1QBMH 2YXFA 3PWVA 3DGDA 5AB9A 5I1AB 5AMSA 4HX1B 1MREH 2EYTB 1A3LH 2RH0A 1FQ9C 5TDPB 3JXAA 2BFVL 1T2JA 3CFEA 2JCCA 5EZJA 5F9DC 1KN2H 3JZYA 1FV1A 2J88L 3COOA 3FO1A 3UTQA 5EAPA 1CXHA 2MTAA 3KHQA 5D8JL 4J28A 4K3JL 1XGTA 2XQYG 1R17A <