5I5MA

Shewanella denitrificans nitrous oxide reductase, ca2+-reconstituted form
Total Genus 193
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
193
sequence length
575
structure length
575
Chain Sequence
SAVVHPGELDEYYGFWSGGHSGEVRILGIPSMRELMRIPVFNIDSATGWGITNESKRIKGDSAHLMTGDSHHPHMSMTDGSYNGKYVFINDKANSRVARIRCDVMKTDKMITIPNVQAIHGLRVQKVPYTKYVICNGEFEIPMNNDGKASLEDVSTYRSLFNVIDAEKMEVAFQVMVDGNLDNTDADYDGKYFFSTCYNSEMGMNLGEMITAERDHVVVFSLERCLAALKAGKFTNYNGNKVPVLDGRKGSDLTRYIPVPKSPHGINTAPDGKYFVANGKLSPTVSVVEIARLDDVFSGKIQPRDAIVAEPELGLGPLHTAFDNKGNAFTTLFLDSQIAKWNIQDAIKAYNGEKVNYLRQKLDVHYQPGHNHTSQGETRDTDGKWLVVLCKFSKDRFLPVGPLRPENDQLIDISGDEMKLVHDGPTFAEPHDCMIVHRSKVKPQKLWTRDDPMFADTVAMAKQDGVTLEMDNKVIRDGNKVRVYMTSIAPNFGMNEFKVKLGDEVTVVVTNLDQVEDVTHGFCMTNHGVQMEVAPQATASVTFIANKPGVQWYYCNWFCHALHMEMRGRMLVEAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords Nitrous-oxide reductase
publication title Role of Calcium in Secondary Structure Stabilization during Maturation of Nitrous Oxide Reductase.
pubmed doi rcsb
source organism Shewanella denitrificans (strain os217 / atcc baa-1090 / dsm 15013)
total genus 193
structure length 575
sequence length 575
chains with identical sequence B
ec nomenclature ec 1.7.2.4: Nitrous-oxide reductase.
pdb deposition date 2016-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18764 nos_propeller Nitrous oxide reductase propeller repeat
A PF18793 nos_propeller_2 Nitrous oxide reductase propeller repeat 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5i5mA02
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5i5mA01
3CDZA 1FWXA 2OJ1A 1KDIA 2TSAA 4G71B 1BXUA 1SQ9A 2OVPB 3K27A 4PXWA 5HQGA 5EM2B 4E9QA 4J0WA 1AZUA 4A08A 2YBAA 5I6NA 2AH0A 2PM6B 5FA5B 2FT6A 3EH5B 1ILSA 1SHXA 1M9WA 1NZRA 2Y69B 2FQEA 2ZOOA 3GYRA 4A09A 3CG8A 3QJQB 2I7SA 1KCWA 2BP8B 2J56H 2P9NC 4JSNC 1A4CA 4YSUA 4J0XA 2XXGA 2YAQA 1GY1A 7PAZA 5IGQA 5I6LA 2CCWA 6PCYA 4D6VA 4CY3A 4GQ1A 2P80D 3QJRB 3GXUB 1TEGA 1PZCA 1ASQA 1NPJA 4CSZA 3I89A 5HE2B 4LGNA 1KYAA 3DXMC 3EWEA 2XL3A 2IWEA 1MG3A 2HXCA 1AACA 1M57B 4YSEA 2XV3A 3PXTD 2AVFA 3NJNA 4FA4D 1DZ0A 4N4YB 2W88A 3N55A 5B1KA 2Q7QA 3UVLA 1P22A 3EI4A 4PBYA 1NINA 4FA1D 4Q8BA 1HAUA 3EHBB 4GP4B 4EF3A 4O3UB 5FC9A 5I6OA 3C75H 4A2DA 1XMEB 3AG3B 4E54A 4KOBA 3IKOA 4G7QB 2H9MA 2GC4C 3NSDA 1V10A 3OKYA 1RI6A 1SFHA 1JZJA 3UACA 4E9YA 5CXCA 3PSCB 1GR7A 3WNJA 1JXGA 1M56B 3EI1B 3U25A 3PXWD 2FJSA 3WNIA 4G7RB 1L9QA 1JOFA 4A0BA 1JVOA 1J9TA 3TU6A 3WKQA 5EMKB 1ADWA 1NTDA 1MG2A 3IBOA 3AL8A 3I7PA 3KRWB 3RLMD 3SJLD 4H5IA 3GREA 1OMWB 4KNTA 1IC0A 1FA4A 3FGBA 4Y5RD 3VH0A 5K19A 2AZAA 4QRJA 5EAMA 4O3TB 2YNOA 2HXAA 5TK4A 3KW8A 4YL4A 9PCYA 2XU7A 3AG2B 2PM9A 3OL2B 3EI2A 3HFQA 3X1BA 3OM3B 4JHUA 4CI1A 4UANA 2PBIB 3E0CA 3L45A 3FQ1A 1PGUA 1AOZA 3FPXA 2H3XC 2Y1AA 3PVUB 5IJ7E 3ZBMA 4PC0A 4Z8LA 2QPDB 3JRPA 1SF5A 3ULEC 4EWRA 3G5WA 2YARA 1BEXA 4TXVB 3QJVB 4AKOA 4K3ID 4GM3A 1AS8A 2B08A 1ET5A 1UATA 4IMMA 5C2VB 1MDAA 2UX6A 3I7NA 4NSXA 2VM3A 5FXYA 3UVNA 3FSZA 3CIKB 4ZOVA 2BW4A 4HDJA 2XU9A 3NJIA 1B9XA 1R5MA 5CXBA 3N2JA 3SBRA 2P9KC 5K1CC 1SNRA 5FKSA 4CI2A 4G7SB 4AKPA 2UX7A 2XV2A 1PMYA 2XXFA 3PPSA 5F7AA 1JZGA 4FAAB 2OK4A 3DWLC 3IE9A 3NVXA 3PE7A 5EMMB 2W8CA 2GC7A 4J79A 1JZEA 5EMLB 1OCOB 5H1MA 4M3HA 1PNCA 3S8GB 3L4OD 1E5YA 2IDSA 4U7AA 3PVWB 1EZLA 4XYIA 4ES0A 3SMRA 3I7HA 1E5ZA 3EG6A 4G72B 4MFHA 3FU7B 4U1EI 1PLCA 3I8EA 1NIDA 3SWSD 2XYIA 1PZBA 3ZDWA 4J8BA 1OE1A 4CZYA 1NIEA 4JD2C 2QDWA 3EH4B 5B1AB 4ERQA 2H9LA 3SLED 2MTAH 4L1QD 2VMJA 4KO9A 4DP0X 1JXFA 2XV0A 4A66A 6PAZA 4PAZA 4GGAA 1XHMA 3JROA 3SN6B 4YVDA 3TBBA 4J78A 1OCRB 2YXWA 2H5UA 2BZ7A 2HRGA 2GBAA 2PPCA 2XVBA 1L0QA 2AH1A 2EBSA 1MG3C 4HZ1A 3A0FA 5TF2A 3ABMB 1XKSA 3NT0A 1BXVA 3MKSB 2IDTA 5D4JA 1SJMA 2GSMB 2B5LA 3ZWLB 1PNDA 4QT8A 4CSPA 2HZHA 4HCFA 2FQDA 1NWOA 3IJCA 2H47A 4L3HD 4GP5B 2DYRB 3KW7A 1X9RA 4P5SA 4YSOA 4BH6A 4JSVC 3CVDA 5C2WB 1A65A 4DP7X 3NSYA 1DYZA 4BDVB 2XL2A 5FKTA 4YSPA 1J9SA 1OCCB 2AGLA 3NJLA 1TEFA 2IURA 1PCSA 1HFUA 1GP2B 3NYKA 3OMNB 4A7JA 4DPCX 2CALA 2P9IC 3IJ1A 3N0EA 4E5ZB 4E9WA 3S8FB 1IBZA 4NERA 3OMIB 4YSAA 1NWPA 2HX7A 5SXMA 3SXTD 3AW5A 1MG2C 2PM7B 1U4CA 4X4KA 2BHFA 3NJHA 3X1EA 1XB8A 2XX1A 1A0RB 3RN1D 3UAAA 4JHVA 2H6KA 5JWZA 1BQKA 3BVDB 5I28A 4GMBA 1OE3A 2I85A 5IJ8E 4O1QD 1GSKA 1NIFA 1L9RA 3C5MA 2IDQA 2X88A 1KBVA 1ASOA 2CBPA 4PNKB 4L0PB 4A11A 2HESX 4CZXA 2PPDA 2B4EA 2HJ4A 1A8ZA 3FYIB 3AH8B 3V5WB 5B4WA 4UAHA 5D4IA 3IN0A 2YAFA 3NJGA 2J55A 4J73A 2OK6A 4G70B 4E9XA 2MTAA 1JZIA 2PP7A 5I26A 2OVRB 4A09B 1HAWA 5EALA 1SHWA 1JMZB 3BG0A 3RRMC 1JZHA 2MRYA 1J9RA 5GXIA 4JT5C 3OD3A 2YB8B 4J8GA 3UVKA 3S3CB 3ABKB 3AZUA 2I3TA 3FSVA 2P9PC 4LG9A 1QLEB 2HJBA 2VW7A 1EHKB 4I79A 3IIWA 4YSTA 2WO3B 5IT9g 1RCYA 5AMSA 2FT7A 1YFQA 4PCYA 2WO2B 4DP2X 1L9TA 2DV6A 5B7FA 3QJUB 4J81A 1WA0X 1N68A 2UXFA 4HALA 3SQRA 3MZLA 2GNQA 2IH8A 3FPYA 2GC7C 2HLEB 4YVUA 1IBYA 5B7MA 2YNPA 3PXSD 4GGDA 1RZPA 1ZIBA 5FLXg 4A0AA 5I5IA 4J87A 4FB1D 2IUPA 2A3TA 4BWTA 4O9DA 4E54B 1RZQA 1TBGA 1AZBA 2DWTA 1IUZA 1BYOA 1BXAA 3ERXA 4DP4X 3EH3B 2G99A 2N0MA 2I0TA 1BYPA 2OJYA 4JSPC 1KGYE 4X60B 5CXCB 2CAKA 2J56A 2FT8A 2PP9A 2IDFA 2UXTA 3GDCA 4GY4A 4FA9D 5H14A 4CI3A 4JSXC 1N6EA 3X2QB 3I2NA 7PCYA 1E67A 2HX9A 3X1NA 5IGOA 5AKRA 5B3SB 3PAZA 2BCJB 1NR0A 2DYSB 2PPEA 1NDTA 4A0BB 4AKQA 2QPEB 3AG1B 1CYWA 2EINB 1OLZA 2FTAA 3F3GA 4A0AB 2XYBA 2DWSA 3ZIYA 3AL8B 3VGZA 4GM8A 2BP0A 1ASPA 4P5RA 1JVLA 4GXFA 3SBQA 3I7LA 4H5JA 4AZUA 2XLLA 1U2VC 1URIA 2B5NA 4O45A 2BW5A 4HHGA 4R7AB 3DM0A 2HKMA 3N0DA 5I6MA 3UKRC 2H47C 1XB3A 5TEEA 1ZIAA 4DP9X 1K32A 4LG8A 3C75A 1B3IA 2NRDA 4KO5A 4A68A 3C99A 3I7OA 3JZNA 2I7OA 4J84A 4YSDA 2JKWA 4K9JA 3RYMA 2YAEA 2IWFA 3ODTA 1KDJA 3CVBA 1J5DA 3FU9A 3DSMA 3IIYA 3MX0B 1AG0A 4FAVD 5I6PA 1GS6X 2AQ5A 2YAPA 4MK0B 2QXVA 4BK5C 1ZPUA 2G9AA 3BWSA 3EI3A 3QPKA 4UF7C 5PCYA 4GP8B 3MKQA 4F7KA 3VA6A 2XUWA 3ZX1A 1PAZA 4ERYA 3NJFA 3OKTA 2FNWA 1L9PA 2OCCB 2Q5BA 3ABLB 3FU7A 2YAHA 4QKTA 5B1JA 4HIPA 1CUOA 4E9RA 2QC5A 1SQJA 3FM0A 5A2Qg 1FFTB 3UR4A 3OKWA 3OTTA 4G56B 2ZXWB 4A2FA 3HB3B 1W8EA 4DP8X 1N6FA 4F2FA 1AR1B 3U4YA 4GM9A 2R7EB 5CYKB 3JTBA 4AOWA 3CFSB 5I5JA 3UKUC 4FHLA 3CFVA 3OQRA 1GYCA 2YMUA 1KBWA 1PBYB 2GI0A 3CVCA 2PCYA 3I7KA 2FWLB 5KDOB 3J80g 5AZUA 4A2LA 3PCYA 4N14A 4A2MA 1GY2A 1NICA 5EHFA 3T6XA 4DP6X 4DP5X 2P9SC 3UVOA 4OZUA 4WTQA 3IJ0A 3AG4B 2CO0A 4BWWA 4FAND 2IWKA 1WS8A 2ZONA 1CURA 1NEXB 1OF0A 2AFNA 1AZNA 1BQ5A 3X1GA 4A2HA 4YSCA 3DTUB 3QJTB 2J5WA 4A2GA 3WKPA 1ID2A 3H4FA 5EM2A 3DXKC 3V9FA 1X9UA 3OMAB 1ZDQA 2IH9A 3NP4A 4ZK8A 4J77A 2UZXB 3J81g 3B7FA 1WA2X 3F3PA 2VW6A 5HE3B 1PLBA 5LDUA 2XWZA 1F56A 1W6WA 2BP8A 3BQVA 3AFCA 4JT6C 4GQBB 2TSBA 4KNUA 1AS7A 1GXRA 3V7DB 2GHZA 3NJKA 4GZ8A 5A7EA 2EILB 1SDDB 2X87A 1MZZA 3SBPA 4J86A 1YLBB 2HYEA 3RMZD 2YNNA 3C9CA 1VYHC 3KRXB 2J57A 2B5MA 2CJ3A 3CDZB 2EIKB 2BO0A 4KNSA 4CZVA 3FQYA 2OV0A 3T6WA 4A08B 1AQ8A 2PP8A 2VN3A 4DPBX 2CUAA 3GFCA 3QQXA 3UVMA 2FQGA 1E30A 4BL0A 4CC9A 1PI6A 4ZN4A 2Z2PA 3RSEC 2ZWNA 4BXVA 2B3IA 4ERZA 1ZDSA 2EIMB 4YSQA 2IAAA 1KV7A 3D12B 4YVNA 4GQ2P 1TKWA 2Q9OA 2I0RA 5IY5B 4FA7B 4L3GD 1JZFA 4QLWA 3T6ZA 5B7EA 5D4HA 1BQRA 4E9TA 4K3JB 5GXHA 1CC3A 2Z2OA 4A11B 4NB7A 5EARA 4X3EA 3EI1A 1J9QA 2RACA 2WSDA 2QDVA 3DKHA 5I6KA 2P9LC 5IC7A 1J5CA 2IDUA 4AX3A 3PLYA 4YSRA 4IA9A 1ET8A 1K8KC 4L9OA 2JFCA 2VSMB 3FT0A 3MBWB 4BUJC 1MDAH 3H4HA 1W6LA 1SHYB 3NJJA 2I0SA 4M4RB 2UXVA 3JT2A 3EI4B 1GW0A 3T9WA 3NSFA 2AANA 3T6VA 1I53A 3JPXA 3PXLA 1PF3A 3QJSB 4DP1X 2GIMA 3NJMA 4ENZA 3OKYB 3RFGA 5C9ZB 1KCBA 3FS9A 3H56A 4A2EA 2AGXA 3OL2A 3SVWD 2DY2A 3UAEA 2H68A 2HX8A 3IEAA 1CYXA 2AZUA 5B1JC 1TYQC 2H6QA 3I8CA 4JXMA 3UGEA 5FKRA 4HCIA 3JB9L 1PZAA 1ZV2A 8PAZA 3HEIB 4GYBA 4CY1A 5TEFA 4ESGA 5GSAA 3ASOB 4HAKA 1OCZB 3NSCA 2UXGA 2AGWA 4XEIC 1A3ZA 1AZCA 3S3BB 1WS7A 3V9CA 2J57G 4KOCA 3BG1A 1SFDA 1GS8A 1OOWA 3WIAA 2JXMA 2AGYA 4KO7A 2P9UC 4UI9R 5FKQA 1AIZA 2VW4A 1ERJA 4GGCA 2VSKB 4PSXB 1MZYA 1TU2A 3IN2A 5AJAA 5EAPA 2GB2A 3NP3A 2YAMA 3FYEB 2E86A 3FU8A 1QNIA 4A67A 4F2EA 2PM9B 3SHFA 4CY5A 3EI2B 3RFHA 2H14A 5HYNB 4XYHA 2CO0C 2UZYB 5I5MA 2H9PA 4TZ4A 4Q89A 1WA1X 3MZKA 1NIBA 4BXSV 2AGZA 4Y7RA 1QHQA 2H6NA 2CE8A 3OW8A 1PLAA 1L9OA 3CZUB 2CE9A 1JERA 2BWDA 4ZOYA 1OE2A 2BP0B 1AS6A 3MXXA 3SCYA 4PSWB 5HE1B 3EF4A 2GC4A 2YQBA 2QT6A 1V54B 3UABA 1OV8A 5E9NA 3RN0D 1JXDA 1JMXB 4ZOXA 2OIZA 3AL9A 1PEVA 1AAJA 4OWRA 4PBZA 5CXBB 2I3SA 4D0KA 2LLNA 1JJUB 1XB6A 1WAEA 5AFU3 4KO6A 3TA4D 1VLXA 1A4BA 3JAMg 3NVNA 4E9VA 3DIVA 4RH4A 3PAVA 1AZRA 4YSSA 2YAOA 3NVQA 4X63B 5FQDA 4JKNA 2O9KA 1R1CA 2PPAA 2R7EA 3ASNB 5CYKA 3W15A 1Q47A 2BZCA 4AI7A 4E9SA 4FA5D 5B1BB 2PLTA 4HCGA 2OVQB 3EMHA 4HHWA 2BWIA 2YXVA 3S3DB 2FQFA 1GOTB 5ANHA 2Z2NA 1SF3A 3UADA 2P80A 3EI3B 3EU7A 3SFZA 1JOIA 2VM4A 3PAUA 1ETJA 1NPNA 2HKRA 1BAWA 1ET7A 3TASA 3P4FA 1AG6A 5F7BA 2IAAC 2H9NA 3WI9A 1E65A 2XX0A 1N70A 2CN3A 3F3FA 3MMYA 1PY0A 3ORVD 4ZOZA 4WKXA 2J55H 4AEZA 1IKOP 5HE0B 3V9EA 4CY2A 4BDVA 2H3XA 2CNXA 3JZGA 3PSLA 2IUQA 2CN2A 1ILUA 4W9ZA 2W18A 1L9SA 4FWWA 1V55B 5TK2A 2H13A 4QL1A 1T5KA 5THAA 4QQEA 4E5ZA 4KFMB 3JZHA 5TDHB 2HRHA 2TRCB 4N8UA 2IUVA 5PAZA 1GS7A 3FRXA 3L4MD 4CI8A 1NIAA 1A4AA 5AFAA 2PPFA 1XIPA 2BBKH 3WG7B 3ABGA 3AY2A 1B9YA 1N6DA 3T71A 3X1FA 3K26A 4J82A 5H17A 2EIJB 4W1TA 4BWUA 3TBCA 1S4UX 2PCFA 5EMJB 5GMKn 3FSWA 1AANA 1SDDA 4NAJA 4X61B 1RKRA 1GG2B 4DPAX 3FSAA 3FQ2A
chains in the Genus database with same CATH superfamily
5ITFB 4XHQA 1KJVA 3VXOA 3TO4B 3QH3B 4X9FA 3PGCB 3V0VB 4AIOA 1AHMA 1RIHH 4PXWA 3MLZL 3RTQB 2JK5B 5LO7A 3WDIA 1OQXA 4MD0B 5CGBA 1KGUA 3SGDI 2CGRH 1J8HE 1KB5H 1NDMB 3FB6A 3SDXB 3GRWH 4ZMLA 3ETSA 3VFRB 3CFIC 2AEPH 2FBRA 4WEMB 3WLBB 2XC8A 1A1OA 5CU9A 2MCAA 3TIDA 3MR9A 2P8LA 2OJEA 3HNSH 5D7IA 1DFBH 4H25B 4UI2A 5IMOA 2WKLA 4AVIA 1NPJA 4BFIB 1XCWA 1ONQA 5DVNA 1KPRB 2BVOA 1EV2E 1VZGA 2UYLB 2HXCA 3CBKB 3KYNB 1CDUA 1P4IL 1U0QA 4N4YB 3GMRA 5C08A 2OPCA 3ARFD 1P22A 3HNVH 3MRDB 1HAUA 4XWGL 4YLBA 1FVCA 4KZEL 3HNTH 2EO1A 4HBCH 2MPAL 4PLJC 1K6QH 2OMUA 1TF4A 2O6PA 4GO6B 1NL0L 4KRPB 2ZKMX 3PNWB 4PG2C 2AQTA 4X5LA 5LVEA 1KWGA 5HGHA 3PFUA 5EMKB 3TZVA 1JXJA 1I7TB 4H5IA 2FO4A 1A66A 4G8GE 4OFDA 2XWXA 4NIYE 5ID0B 3FGBA 3LPWA 1WT5A 3K4AA 2VMCA 5CGMA 1A7QL 5L2KA 2M2DA 1VSCA 2NLJA 4YBQD 3PPEA 1NH6A 3B5GA 4ATTA 2PM9A 1HK6A 4NC4A 4ECNA 3VSTA 2YGPA 3V4PH 4E5XG 4BGLA 2KERA 2R1WA 2VO8A 1U33A 4P07A 5EN2B 4FMFA 1Q94B 1IX2A 2WJ7A 3L4VA 2VDNH 5LNDA 3QUHA 1CFSA 5AAWC 2K3TA 4W6YB 4HG4K 4MNGA 5GZOC 3HE7B 3TYGH 3L3JB 2HFEB 3DHUA 3MRNA 1KCSL 2BS9A 4W68A 2ID5A 3RZCA 3ECWA 2A9ML 3G6DH 3L5IA 2IADB 3PWPE 3CIKB 2BW4A 4OCNC 4BZ2L 1N4XH 5DUML 2ED6A 4KZ0A 5I73B 5JQ6H 2AEQL 4XPBH 3SE3A 4OFQA 4YHIA 1YYLH 1SVCP 2K45A 1CE6B 1BBDH 1JZGA 3I6GA 3GSNH 3A22A 1D6EA 2OZ4L 3AQZA 3MXWH 3UYRL 2Z8RA 3ARGC 3MCKA 4YXLL 1CLVA 5CLYA 1N5AB 4S2SB 1DUZA 3V7AG 4IM8A 4TVPH 4I1PA 4HIHA 4WSJA 2AGJL 4G72B 1HEJC 3IJSA 4A6YH 4OZHF 2O61A 4QRQA 1AXSB 3HC4H 1Z3GH 2P45B 2GJPA 3Q06A 1EEYA 2O1AA 3HAEB 3EIFA 3FH7A 2Z31C 1JXFA 3SHSA 4GUPB 1E42A 3F5WA 4PAZA 5DJ8B 5IR1A 2HRGA 3MGTB 3WJJA 3K3QA 4BQBA 2AQPA 1R5IA 4APQB 4B9IA 4WEBH 2IAND 3QR0A 4ODTH 1J5OL 5DK2B 2ZAIA 4GUOA 5CGYD 1MOEA 2VR6A 4CJ1A 4JQVC 2Y5QA 3QPXH 1UD5A 1I1AA 1A7RL 5EBGA 3F7YA 3NSYA 4XBPB 3MLPA 5DFTA 1HE8A 1ZA6B 1EJ6A 2OXGB 2YPVH 4U6VH 3ZE0F 4RSYA 1YY9D 2YIHA 1HFUA 3ZDZF 2WCGA 1T1XA 4Z77A 2E27H 3FO1A 3ISYA 4M29A 3CBJB 3PWJB 3STZB 3ZW3A 2ZXQA 2EH8H 1E5AA 2QMKA 3NJHA 5AG9A 1A0RB 1JIBA 1ECYA 3CE1A 4JPVH 4OGAC 3QISA 1UA7A 3VCLA 2WC7A 1GSKA 4JB9L 3C5MA 3CSYA 2CBPA 4PWJA 4L0PB 1ZE3C 1MY7A 1TVHA 4HJJH 5EWIL 2HJ4A 5C09B 3IJHB 4UAHA 2XTSA 5D4IA 3LCYA 2K3HA 4OLUL 2MNWA 4Z7WA 5CN3A 1SVZA 1OAXH 4M7ZC 4OZGA 3UTQB 1QASA 3MRCA 4X0KA 2QFPA 4K23L 5I0DA 3ZTNH 3UVKA 4ZFOB 1TEYA 3V8OA 1MCOL 4TSAL 3CZKA 1OPGH 5K33A 3LKOB 2X4UA 1INEL 1MF2L 5E9DE 2JELL 2EVGA 1O6SB 4MNQA 4QRTB 3D39A 4JANB 4YXKL 2XNAA 1Z5HA 4AM0Q 4OZIE 4DQOL 2J8UA 4BFKA 1K4DA 3LKQA 3A4DA 2IH8A 5FOBB 1TTBA 3GI8H 1A5FH 5T1LA 4FNQA 2VXUH 4EI5C 3IVKA 2X4QB 4Z23A 2VABB 3KYKH 3QQ9C 2NY7H 1BXAA 1L0YA 5E2UH 25C8L 4APXA 4YXHH 1KPUA 5HHVL 3T6QC 1LE9A 2CAKA 1TJXA 3CC5A 4IKLA 3P4LA 2QKSA 4AQ1C 1W0WA 4ZO7A 4GPVA 2G5BB 2GITA 4ZO9A 1EVTC 1V7ML 1DDHA 2IANE 2X4RA 4MLSA 1HH6A 2KI6A 3S98A 4KK5D 2ZCHH 4Y5YC 5C0BD 3VW3L 1ASPA 1EUUA 1P9MA 1I1FB 3GEFA 1CR9H 3TIEB 1SXSA 4GW1B 2HKMA 2G3NA 5TGBB 1SMOA 3F7PC 4R5TA 1NFDF 4GKSA 1QFHA 3D34A 1VPOH 4NKOA 3RNQA 4BK8A 3BXNA 3C99A 3GF8A 3I7OA 1T22B 2UY6A 1I82A 3FTXA 1M6UA 3DPDA 4LGSB 4U1JB 5K9JH 5IK3B 4ESKA 1E9OB 3H7BB 3QUXB 1SOQA 4GI6A 5I6PA 4POYA 4GKLA 1P5UC 4MAYB 4BH7A 3QPKA 3ECUA 5HJBA 4Z8FH 1EJOL 2BX5A 2PYEB 4QD2E 4LVEA 1S7UB 3FTYA 3L1GA 3SJVD 1UXSA 3OKWA 2ED9A 4G56B 4KKAC 4GMSH 1U2HA 4DWHA 4ZSOB 3SKJL 2AQ3A 3ME0B 3VI3F 2VDKA 1INQB 1XGRB 5FV2A 3UKUC 4QCIB 2VDPH 2CO3A 1RJLA 2QVFB 1AGCA 3EJYC 4U2YA 3DTDA 3DARA 5KW9H 1M2VA 3KDMA 2WXFA 1YNKL 4XPGH 4PU2A 3T6XA 4U6XB 2OTUB 2WIIB 3S5LA 4BWWA 4OT1L 4ANXA 4DKFH 3RDJA 5EIIA 5EDXA 4GI8A 1E9PB 1ZK5A 1BLNA 4ODBD 3IS0X 5F1OB 1YPZF 3DPBB 5D6CB 4JKPH 5E6RB 2RB8A 1PGRB 1CE1H 2R29A 1E8XA 2FGWL 4MJ6B 3T3MA 4LHUD 5DRXA 5IQ7H 4WF7A 4AIXA 4GQBB 2JSFA 2VZ3A 4OD1H 3NIDA 3LXAA 3LZFL 4DN4L 2VUOA 1AVAA 2WTRA 4JHWH 2B5MA 1V3LA 4XMPH 4YK4C 5JPMA 3G5ZA 5E6YA 5C0BE 2LLLA 2EEDA 2C1OB 2YD2A 1BMGA 3LV3A 3BQUA 4G8IB 1UB6B 4TNFA 5GJTL 3WKMH 1NM9A 1DBBL 3HZVA 1XF3B 1LL1A 2H6UA 1A8JH 2A74B 4BKTC 2DYPA 5K69A 4MCZA 2YQ3A 2VC2B 2A6DA 2Q7AA 3PABB 3UO8B 2NQ3A 1X5XA 1JNLL 4NQXB 4GQZA 3KAAA 2F8VA 2Z2OA 4PV9A 2NTFB 1MFBL 5JHLL 3BH9B 1B88A 3WXWH 4OCMC 4JHAL 4AL8L 4HEPG 4M8UA 3RB7A 1WIPA 1R3IL 4FYSA 3UIYA 1FO0H 3P2BA 3P1VA 1RLWA 3BAYA 4IIQC 5FA3A 4RDBA 2ZSWA 3SJVE 3X3FH 2VSDA 2WYIA 1U9KA 4MMZB 3O6FA 3U0PB 5E6IB 3RFGA 1WZ1L 1KEMH 3LAFA 3A4EA 1NAKH 5IJVB 4KXDA 1DN0B 2V2WB 2NNXA 2IPKB 5EC2A 4NZJA 5E2TH 3HEIB 1USQA 4CMHB 1IAOA 3NSCA 4JFDE 4UWQB 5IGXL 1DBJH 5ERWA 2YGVA 3WIAA 3QJHA 5KSVB 4PJ8D 1DJGA 4ZFFB 2X7LA 3K0WA 1XSKA 4O2CA 4OLXL 1O6FA 5E5MA 4TS6A 3DSNA 1QNIA 4J23A 5FWQA 2XA8L 2MEJB 3UTZB 5L2JA 4OD2B 3TVMD 3MJGX 3PGFH 3LN9A 3IUJA 1RJYB 2WNKA 2X28A 5IROC 5DVPA 5DD1L 1UEMA 1XGYL 4AEEA 3VWJA 4BA8A 1TSRA 3D25B 2PABA 1CFBA 5TE6L 4WQOA 3FRUB 1JWUA 3IWUA 4HPHA 1P84J 3SE9H 1PKQE 2QADD 3L2MA 3H9YA 4KUCD 3VD4A 4LAQH 3ZMEA 4K73A 4PWFA 4OLEA 5TD4A 1E3ZA 5KZCD 1QFUH 2BY0A 1DQTA 3QG6B 3QORA 4BZYA 5IKCA 3L2LA 4H8QA 3WIHA 1A1NA 4ZAKC 4OI7A 3OLEA 2OZNA 3F6IA 4H13C 1XF4B 3VFUB 4FA5D 2Q2EB 3A5VA 3V52H 1ACZA 2VXVH 4LCCA 4JDTH 5E8DL 4LEBA 5I8OL 3FO2A 4WK4B 4F7TB 5D4QA 4B3VA 2HKRA 3NMEA 1BXXA 4O4YH 3P4FA 5E6UA 1BBJA 2Y7QA 2QSVA 3EHBC 4OF5A 1IAIL 1G6RL 2VZSA 2XX0A 2FEJA 1RULH 4OZIF 5EORH 1S9WB 1FORL 3FT9A 5CS7A 1RSYA 2X89A 3DOHA 5HHXH 2WP3O 2DKMA 1I9IL 5KTEL 4NZTL 5CNHA 3ZU8A 2VQ4A 4A38A 1IAIM 1UXLA 5IMMA 1YO4A 2P5WA 2ESVA 4EN2A 5TDHB 3P9LA 1JGIA 3C6LA 4GIPD 1KBPA 3WIIL 3MLRH 1M05B 1E6OL 4HT1H 2R0WL 4MJIB 5AOJA 3SCMA 3SYCA 3G6AB 4FA8A 4Z6AT 4MDJA 3VXSA 1SM3L 4P3DB 1N7ML 2EIJB 2YA0A 4JPKH 3P0VL 1NANI 1JSYA 4NAJA 1EMTH 3HG0A 5T3ZD 6FABL 4LPXA 1EK3A 1Z9LA 4FYRA 4XNYL 3L4YA 4DUXA 2ZOLA 5TFSH 3TBVB 4WGKA 3F7VA 4CGTA 1FWXA 4P48A 2D8KA 2IPTL 1GC1H 4HKJB 4NQCD 4ZRGA 3ALPA 4NEHB 5AW6B 3RG1C 5HQGA 1S7QB 1KY6A 4WNSA 3EH5B 4ZS7H 1AP2A 2ZOOA 5FKPA 3LX9A 4GUQA 1L9NA 2RH0A 4JSNC 3T2OA 2YBGA 4BK4A 4E5XA 4IOFD 3EYOA 4UT6H 4YHOL 2WYZA 1QUNA 4MD4A 4YHYC 3O4HA 4M3KB 5JA8B 1RFDH 2MHAB 3FUIA 5DR5H 4D6VA 1IGCH 1LEIA 3QJRB 2JJWA 2C5DC 5GS2D 4MJ2A 3IFPB 2FHFA 3ARDC 5KAQG 4K7FB 1XEUA 3QS2A 3C5XA 2K7QA 4NWTL 1DL7H 1EZVX 1LLAA 3FOLB 2XRAH 3NIFB 5E1HB 2H6PA 2EDYA 3GHPA 1I9JH 2W88A 5EU6D 2DWXA 3P9MB 4JDVB 3QIWB 4KAQH 4KOBA 5INCA 1A2YA 2AV1A 1SFHA 3MLSL 4LDCA 3UACA 4F9LA 5CSZA 4LLYA 5HDWA 3WEXA 3UBXG 4R90L 4D0DA 4KU1A 2A9AA 1H0DB 4NO0D 1KXTA 2H32A 3OKNA 2W9DH 1UOKA 2X9WA 4B6ZA 1JVOA 1UKQA 4EXKA 1ADWA 1NTDA 3NSXA 4WI0A 3S0PA 4Z7IA 3KXFA 3GREA 4KNTA 3RFZB 1VFBA 2F9BT 2FSEA 1YEJL 4QOKA 3OAUH 4QYOB 5IBLD 4WSKA 4O3TB 3X13B 1YMMD 1IBDA 4OCRL 4X4XA 1N26A 1EO8L 1UCBH 4LPWA 4QHKJ 1OVZA 4PRPB 1PGUA 1ESOA 1F58H 3GXTA 3D2TA 1IIIA 3Q5OA 4N25A 3TN0A 4PC0A 4JM4H 3QDMD 3WN6A 2Z3FA 3HHSB 3UG3A 4K3ID 3W57A 5C0NC 4PS8A 2X1XR 3EYUH 4X4MA 2VXQL 4IRZA 5DCCA 1GSMA 2P42B 4U6TA 2J5LB 3PL6A 3L3IB 4A04A 1B9XA 5HHMD 3WE6B 3Q0HA 2A1WL 2A5UA 5DWUH 1PX3A 1Q72H 3KLHC 4LIQL 4NQCE 3GRGA 1ZTXH 4G55A 3O2WH 4I48B 5EMMB 4WWKA 5KYYA 4NZRL 2CCVA 3I75A 4PRHB 3RPBA 5CHNB 3SKMB 1QEWB 1UWFA 3M88A 5KVGL 1OGAE 2VLRA 4FERA 3RWFA 4UIMA 3V0AC 4S1SH 4ZNCD 2J1XA 2BSCA 4DP0X 3H9HA 2XICA 1NMAL 2XV0A 2YMOA 1UM6L 4AEHL 4PSPA 3WUWG 4J78A 2J88H 1OT4A 4XTRD 3WJMA 2EBSA 2WOYA 4ZMAT 4X6BB 3RHWF 3VXMD 2ZUSA 1RHFA 2GSMB 5BV7H 2B5LA 2P4AB 3TYFB 2C4FU 4CSPA 2A9NL 3BN9D 5E7FA 3NTCH 3OR6B 4HUKB 4L3HD 4JQIH 4RGOH 5B4MD 3VMPA 4O51B 1X5YA 5B21A 5FKTA 4IHOA 2Q8AH 4XPTL 3OGCB 3VTTA 5HGBB 2IURA 2GT9A 3BLKA 3BESR 3BPOC 4R4BA 1BJ8A 3GGWA 5HJGA 5A2FA 4G6JH 4DPCX 1TTUA 4E5ZB 4MHHG 3UTSA 4KKRA 1T6VN 3TFBA 1K2DA 1Q9LB 4S0SD 5SWQA 1YMME 3NFNA 1SHMA 2EVJA 4M5TA 5DUPL 1QFWI 1FFOA 2XX1A 3C60D 1ZT1A 4AZ8A 3BVDB 3BIKA 2AV7A 2VT0A 4O1QD 4YHNB 4B5ZA 3VFMB 4HXAH 1ASOA 1G0YR 2PCPB 5AW5B 1ZA3B 2BJML 4PJBB 3JWDH 3QGVA 3ARGB 5KYWA 2J8OA 1DQJB 5D5MA 5FS5A 1S8DB 4ZPTB 3TC9A 4AK2A 1CDJA 3VNYA 2NY0D 4LQFH 4X99A 3A6OA 4P9HL 4QF1A 4B9GA 1L3NA 3CPLA 1EAQA 1TZHA 3OAYH 4ACPA 4NZDA 3GJFB 4OF6A 4DZ8B 1EZVY 2CK0H 5H2BB 3QFJA 3OD3A 4K3HA 5HHME 4EMZA 1OZTG 3U2IA 1N5YL 4L9LB 4Z7QA 5T1DL 4TMPA 2Z31B 2TRHA 5C3IA 4FXKA 2WLLB 3FFCA 3ARWA 3H9ZA 4NT6B 1LYQA 2BSSB 2B0SL 3NOIA 1S78D 3Q8BA 1NA8A 1BQSA 2UUDK 2XTJB 2OXHA 1PS3A 1OM3L 2DM2A 4N2DA 2DL9A 3C5SB 4IOIA 3BW9B 3AAZA 1TENA 1MCSA 2HPOA 2ZWYA 1JNJA 3P4MA 3DHJA 1A21A 4PJ5B 4O9DA 4E54B 2DWTA 3AREA 4PJIB 2BCKB 3LZOA 2N0MA 2DF3A 3QPQD 3GDCA 4HJTA 1DQMH 4OD3H 4FQJH 3BEVA 4NJAL 1E67A 1F2QA 1KULA 5DO2C 3D3VD 3LHPH 3GI9L 1NL0H 1A7NH 1SLUA 1OLLA 1WUZA 3VXME 1CYWA 4GRLC 3K46A 4FFVD 3H3PH 2DWSA 4FXGC 3ZIYA 2XWJA 4ZX3A 1NGXA 4XGZB 5I30L 5TE4L 1G7IA 2XIIA 4UTAL 1URIA 5HVGB 4N0RA 2F53A 3Q8AA 2WANA 1KGCD 3UJIH 5H8DA 1A7QH 2X9XA 1KJ2L 3JUZA 1FSKC 1U3HB 4U49A 3VGFA 4WU7A 3QUMA 3JZNA 1RUPL 2DWDA 2KPWA 3UJJL 4QGTA 3D85D 4AJ0A 4E41B 5C6WH 5I1LA 1DCEA 2O6DA 3CUPA 4K71C 1O5DT 3KR3L 4L4VE 2IO5A 5E5RB 4BK5C 2HT3C 4W9EC 2X6MA 4P5MA 2XUWA 3MRHA 4F7KA 4QDGA 3BZEB 1A12A 1IGJB 5D2NC 3UZEA 4Z3HA 2PUQT 1ND0B 3DV4B 2J4WH 1MFEH 5L7XL 3NACH 5C6PB 4TUJB 4KUCF 3W82A 4M6MH 4DP8X 2J12B 1E2WA 4TLSA 3MU3A 5EO9B 2WB7A 2AEQH 2RJMA 2R7EB 3O6KL 4S0TD 1JN6A 4TUOB 4JRYB 4OLZH 1CJYA 5E2VL 3DXAD 1D2PA 4WDIB 4GW5A 5AOLA 3MREB 4LO9A 2ZXCA 5TPWL 4G9DB 1G4RA 3MOAH 1Z5LA 5KYUA 2ZQKA 5J06A 4A2MA 1YG9A 2P9SC 2AGJH 3K6NA 4QXVA 5SWZE 1VEPA 3ARPA 4HEPA 2N1KA 3QQ4A 1KTJA 3V5HB 1AZZC 1DVYA 1PG7H 4A2HA 1WAAE 3UX9B 3SSGA 3ZKXC 5IHBA 4Y5YB 3GMQB 5GSRA 3FC8A 1QA9A 1BVLA 1AKJD 3F7RA 3K8LA 4HZAA 1C9SA 3QXUA 4CN6A 3FFDA 2FJFB 5E5UB 4JT6C 4MDRA 4HIEA 1ADQL 1LEKB 3MROB 3D0VB 3D3VE 4NQDA 4GOSA 1SDDB 3NABL 5C0DA 3D2UB 3L81A 2ICWI 1KSRA 3KPQA 3OBAA 4HUXB 3SDCB 3TBYA 1A7RH 4S0HA 3ULUC 3L3DA 5JHDA 4JFXA 4WK2A 2OW6A 2VSCA 5IHUH 4H8UA 1RZKC 4LVNC 3BVUA 1P5UB 1EA9C 4DPBX 4EN3C 3OKOB 4HK0B 5ICZB 4FADA 1DQQB 4Y7OC 1KGCE 1I8KA 3O6ML 2AP2A 2IAAA 1TCRA 3D12B 1QLRA 4LLMA 4UOJA 3VGGA 4CKVX 4N0CC 5LLIC 4LGRB 1HILB 2AJYL 1ZEAL 2VISB 3EBHA 1OTTC 1YZZA 2E56A 3I02B 1HCFX 5BZDB 4X3EA 3SEPA 2WQVA 4LCUA 4LSTL 2R4RH 4NKDA 4P3CL 4LCWD 3UMNA 4W9CC 1BQHA 4CC0A 4KQ0A 1KNOA 3TA3D 4M4PA 2NXZC 3KPRA 2D7TH 2ZKXA 3D4YA 1M7UA 1KTCA 4NXKA 4P2QB 2EDDA 1FI8C 5C70A 5J8OA 1I53A 1ACCA 3QJSB 5EC1B 1M1SA 3UFIA 2VXTH 2O72A 4G80B 2DWEB 2ZOKA 1TR7A 2MIZA 4K9EC 4FQPA 3DXAE 3FJTA 2NSMA 4JL2A 3GSUB 1INEH 5DRZA 2OA9A 1NAML 1IB5A 1MHHB 3ZDZA 1GCYA 4YXKH 3TEZA 2EABA 1MUJA 3MBXL 2JIXB 3ML8A 1DJIA 3HG1D 3I6LD 2DQUL 5K9OB 3DIFA 2ADFL 3BHBA 4LLVA 2GB2A 3H2WA 3CDGA 4F2EA 1ZGLP 5DQ9B 5E08L 2WMPB 3PIQA 5JTWA 4YK4B 4CMMA 3FO9B 5HHVH 1OGTB 4NAMA 3BZDA 5EOTB 2DJMA 5DJ6B 5KVEE 1PW3A 4A55A 4M00A 5BO0D 1VZ3A 1JERA 2BWDA 1O6TA 3WTWA 1V7MH 1BEYH 1AS6A 1HL5A 3VXUD 2DQMA 1Q0YL 1KXHA 2GC4A 4ES9A 1OV8A 1P2CB 3W0WB 4AIZB 3VW3H 1A14H 2F7RA 4XCYA 1MHEB 2Z6FA 2OS7A 1UOOA 1NCAH 1AE6H 1OZUA 3GPEA 4F7MA 2DTMH 3MLYL 3PAVA 1BAFL 4FC3E 2F54B 2P47B 4X4YA 2AXFA 2QTVA 3UGUA 2D0GA 2ZX8A 4JVWA 3HMXL 1F3RB 2XIBA 4GXVL 4Y5VB 3BPNC 4FA6A 3DMMC 1HNFA 2YXVA 4I2XB 4C56B 5CP3H 4R2GD 1MVYA 5AUMA 4P2RA 5GRWA 1JOIA 3RI5F 5D70L 2APTA 3SDAD 1RQ5A 1ZXKA 4LL9A 4XOBA 2B7DT 3B9KD 3TNNA 1NOAA 2OMYB 2ODIA 3F3FA 3MRFB 2OJZL 2AMGA 3NUKA 3K71B 2CNXA 1J1OL 2WN3A 3C9NA 4OZ4A 1H3UA 1DBML 1X5KA 3A67L 1QLFB 3QUYC 1FE8L 1J1PL 4FG4A 4MVBD 4X5RA 2X4PA 2DLFL 2WLJA 3MRLB 4LHUG 2HRHA 4HIIA 4PJCE 2QQKH 3GLZA 4HKXA 1A4AA 1U8CA 2HT4C 1WF5A 1KBBA 4IQHA 4L5FL 4M6NL 4FFZH 1XCTA 1FNSL 4BWUA 5D1XD 4JHZA 3HPLA 3CV5A 4OLYH 1UOWA 1NFDA 3CIQA 5IJBC 2FJGA 1I1RA 2LE9A 5CGTA 1PPIA 1TQTA 4YNYA 4F7PA 5IVXE 4AYFB 3R7QA 1QNZL 2QKIA 4P2OA 3LKPA 1TMQA 5KYXB 3HG1E 3I6LE 4QKXB 3DUSA 3TX4A 5AYQA 1AR1D 4FTVA 5ALCH 2OR7A 2FGWH 4WW1A 4L3FA 2B3RA 1MN4A 4N5EC 4AYBA 2YN5A 1E6JL 1FYTD 1C5DA 3L5XL 5DZLA 3S37H 3QEGH 3PF2A 3VI3A 3LZFH 2EYRB 4CSZA 3I89A 2ARJB 5IM7B 4HV8A 1NFIB 5CEYA 1OP9A 4MZRA 3DVGA 1C08B 4HCRH 2JE8A 3G9VA 2V8MA 3QEQD 4G8EA 3AGVA 1D7FA 4FA4D 4N9GA 1XGPB 1BZ9B 1FGVL 4O5LH 5HDBE 1NINA 3SODB 3EHBB 3OKLB 4EF3A 4JJHA 5GJTH 3HJ0A 4D9RD 5CCKH 4PUBH 2QVMA 2KYIA 5D7JA 1P7QD 1JHKH 5JIHA 4AUYA 3EI1B 3QNZB 2X44D 4WI2A 1JNLH 4JFFB 1KCUL 2XSKA 4HC1L 1JZ8A 1JOFA 2P52A 1K8DA 3MKGA 2WXKA 5GGQL 3OXRB 4J3OC 3GUTA 1TYEB 1I1CA 4NM4L 4KVPA 3H53A 3GJFK 1R3IH 2Q87A 4ZMNA 1KELL 4K3EH 1RZ7L 1UJ3C 3MUZ1 1QPKA 3S36H 3UP6A 2SEBB 1RIVL 2GUOB 3G9AB 4N6RB 1KB5A 4YL4A 5EO1B 2CR6A 3O4IA 4XN4A 1RUQH 3WUWA 4J3WA 4K5OA 2D3NA 3HFQA 4Q0XL 4JLRB 5IWLC 2F53E 4FQCL 2XFGB 3QNXA 4KMQA 3LKRB 1SPDA 4AGOA 3R8QA 2NDGA 3PP4L 3JT0A 1M2OA 4KY1L 1T7WA 2BFGA 3BLBA 3DURB 4GAJH 5GJSL 5HDQL 1SF5A 3HG5A 2E75C 4P2AA 4KZCA 3WUZA 1KGJA 3KEHA 1P4BL 4EO5A 2H4EA 4YHYB 4NHUB 1I8MA 5TDNA 4HWZB 1QWUA 4PJ9D 4U1SB 5I1JH 3QEHB 1ZT4B 4P4KC 3ARDB 5DJZB 3NN8A 3UPCA 1SNRA 4CVZB 4CI2A 2NY4B 4U31A 1G7MB 2XA8H 2YQ2A 4FAAB 3MCYA 1SEQL 5EV7A 3C12A 4FL4B 3T0DA 5DD1H 5ANMA 1D6VH 1XGYH 2R69A 4M8RA 3Q1EA 4QR7A 2DM4A 3I50L 5TE6H 4AUJA 3WO4C 2C3XA 1FZOA 4IK6A 1SJXA 5T1JA 1IJ9A 4GW4A 1Z32X 1ZSDA 3AUWB 5LN4A 4XMZA 1LWJA 4D9LL 4NSKB 4J8BA 5HI3D 4LXFA 4RISH 5F44A 3RKPA 4WY7H 4PCKA 4NNXB 5IESL 1V3KA 5KN5A 2FATH 4I3RL 4WNJA 3CFKB 1QRKA 4QJ3B 3R4RA 3CVHA 3M1BA 4WW2A 3BZFB 1BZ7A 4N0FA 4QRUA 5H4YA 3ZTEA 4D9RE 3WFZA 3QP3A 5KS9B 5E8DH 4B97A 3RVXD 4ELKB 5I8OH 4EVNA 1J0ZA 2MCPL 5DRWB 4XAKD 3WMQA 4BDVB 2VDOA 4O2FA 1IAIH 1G6RH 3DYOA 5FYLH 3D0AA 5T33L 2GY7B 3W56A 5JIKA 1YUHB 4NO2A 4HMCA 1LO0L 1NBZB 2ITDA 2QZ5A 4AUUA 1DLHB 1K85A 1CGSL 1I9IH 5B8CA 2FHCA 4Y8AA 1LMKA 5CKAA 3TZVC 5DZAA 1PCXA 4G82A 4Q2ZB 3GHBL 4PJGE 4LARL 2LR4A 3WIIH 5DMKB 1WT5C 2R0WH 4Y9GA 2J6WA 3R8BB 3N1QC 4UZGA 4KKZA 3AXLA 2NCMA 5MEOA 3BP5A 3P0VH 3V5WB 2KUTA 4GO9A 4L1HA 6FABH 2XKUA 1E28A 1UJTA 1X4XA 4XNYH 2YAFA 4PJDE 4J73A 1CXKA 2GAZA 1FP5A 1MI5D 2H0JA 4E9XA 5JXED 3BEWB 4XX1E 2Y6TE 2YBRB 4JPWH 3UPRB 3B8YA 4L8BA 5L88L 1SXAA 1MFAL 3KCPB 2V3EA 4XNAA 3RZCC 2DMHA 2IAMD 4WVRA 3NJXA 4DO5A 4FS0A 1GIGL 2D03L 4YHOH 1CD0A 3INUH 5FM4A 4XCFH 3B2UC 3MYJA 2CA4A 1B0RB 2EE2A 2FUTA 1RD6A 3SE3C 2CG9X 3EO9L 3RNKB 1WD8A 3ROLA 2EAEA 3IUMA 5ICXB 5CLXA 4GGDA 3B7RL 1L6PA 5FCUL 5ECJE 1QAWA 2E9BA 3OHXA 3WTTA 2R0ZL 1DHKA 5IQ9A 1RY7B 2CNYA 3UC2A 1CFTA 4ZUSA 1RL1A 3LQZA 3SDYL 3Q1SL 4HETA 3BPOB 5EEVA 1F18A 1NGYA 1JNHB 4FQXA 3ZO9A 3X1NA 4R90H 1AO7E 2QPEB 4P59L 2W0LA 4NQED 1EZUA 1RK0B 4G6FB 2ITFA 3CHPA 3WJJC 1TTCA 2H45A 2XY1A 3F04A 3MZGB 4EXPX 1S3KL 4XAKE 1FNFA 4M6AA 2LABA 2E6JA 5H35B 5IVXF 4YDJB 1DSFH 4R26L 2Y23A 4E9LA 1K32A 4OCRH 4YBHA 1I1AC 5JO5A 5DUBB 1S7VA 4EKXA 3B2DC 5DMGC 1U2CA 4DN3L 4B9CA 2AI0L 2BHYA 4P49A 2FWUA 4YHKH 3MX0B 1AG0A 1FCGA 5JDJA 4MK0B 3EI3A 4M9OA 4XB8A 5PCYA 1PQZA 4NYLB 1ZS8B 3OKTA 1RP8A 4QKTA 2QGDA 4HIPA 1CUOA 1SBBA 1F11B 3LB6D 3ZR5A 3ML9A 4OUOA 3FQWA 4DZBB 3VE0B 1W8EA 1MI5E 3FCTB 4EZLA 4NLAA 5C7XL 3EYVB 3T0EA 4LIQH 5HDBF 2JKXA 5IB2A 3GJFH 3I3BA 3TH4T 3DO3A 1HSBB 3B1TA 1B90A 4XCCH 1WWWX 1SBSL 1BVKB 3E7JA 4KK6C 4QJ4B 4OAWA 1TMCB 4NZRH 4U0RC 4XO3A 1EERB 3REVA 4NOBA 3DETC 1DLFL 1JDDA 3O3BB 2CO0A 4JR9L 1CDIA 3LZLA 2V6HA 4H0IA 4OGXL 3SKOB 4KJQC 2E6PA 3K4DA 2BNRB 2FWOA 3QJTB 4JFWA 4FXGB 4HUVA 2WINA 5LGHH 1HHKB 3QFDB 2GFBB 3IFLL 5FV1L 4OIFA 1UM6H 3N40F 1XZWA 2D9QB 4Y5XA 5CJOL 3ZQWA 3ULUL 3QZPA 4Q97A 1TJGL 1K4CB 1RZKL 3HBZA 4F8TA 5DJ0B 1ZHLB 4OI8A 2FD6L 3TEXA 1KYFA 2AXGA 4UNUA 5C8JA 1PD1A 2A9NH 1FSKB 5E2WH 1MJ7L 1ACYL 3F62A 3KRXB 4ZQTA 2ZSVA 5AZ2L 2AQ2A 4PP1D 4MCYA 3HAEG 4R8WH 1JV5B 3TV3L 3P77B 1CLCA 5ISZA 3QXWA 1ORQA 2YD4A 4YE0A 1ZE3H 3KE0A 5D2NB 4BCXA 1P1VA 2VDPA 1WGOA 5HVFB 4DKAA 4YSQA 1HCZA 1P9MC 4BBWA 4ODXA 1WFMA 4QY8B 5C86A 3VFGL 3LRHA 4MLIA 5KBNC 4JREC 4E9TA 1PKOA 3D1MC 1WIUA 4KX8A 2E59A 1S7SA 3DKHA 3KLLA 4FLHA 5MERB 4ZX6A 2WY3B 2P9LC 4WHTA 4L3CA 1OSYA 2YSSB 4R6UA 3EI4B 1MCWW 3B37A 2F5BL 4F80A 2J72A 2KC0A 3D18B 1NGQL 1JPEA 1EANA 3OL2A 4OJCA 2HKFH 5FIEA 3VRIA 1N5YH 2H6QA 3IEAA 2AZUA 1FFRA 5T1DH 4ELME 5C0AB 2OX5A 1J7VR 1ZV2A 2ZZUT 4ODSL 3STLB 2QSTA 2F0CA 3TBWB 2B0SH 2VNCA 1SMDA 3BIAX 2IALA 4TUUA 1HXMA 4TVPD 3B2PA 5JLZB 2XL2A 4FXLA 3I3DA 2IQAB 4HEMA 4Z1PA 3IGAB 2J8HA 3RVUD 3V6FA 3U4EB 3S48A 2C7FA 5G55A 1FL5A 2JB6A 2JJUA 2VIRA 3FYEB 4HD5A 1HSAB 3QZBA 2I26N 5FOJA 5EU5B 4WO4D 3NA9L 2BRRL 5DF0A 4LHUA 5FGRA 2H9PA 1WA1X 4AC4A 3KGUA 4QRPD 1GGCL 1NIBA 1KBKA 1TCMA 4OGYL 5G5DB 3SD2A 1QHQA 4EN3B 1CCZA 3QI0A 5DGQA 1KTDB 1LO4H 4PB0L 3GI9H 4PJGF 3GT6A 4QWWC 3A6BL 4RAVA 2CE9A 3DRTA 3O3EA 4JFUA 4XI5C 4C4BA 3SCYA 3N9GL 2HVBA 2QT6A 1JK8B 1HYSD 3BISA 1JMXB 2XFXA 1FRGL 3OKDA 3WEBA 5TE4H 4PBZA 4FQLH 2DL2A 4EJ1C 3RL2B 1SEBB 3VFOB 3ZPDA 1OGSA 3IXTA 3POCA 5DMIL 2F08A 3H9SD 1S46A 2EE0A 1KJ2H 1G6VK 3V0JA 1ROWA 2NXZB 1A4KA 3P30L 1E9QA 3U4BH 5JPMC 1RUPH 3RIFF 2OVQB 2Z2NA 5K19A 1EEUA 1SF3A 5ICYA 5A2KH 4F2ME 2DS4A 2ZOWA 2DMCA 5HYEA 3DTXA 3BQUC 2P43B 2LTQC 1NPNA 2C9PA 1IGYA 5K93A 1AG6A 3C8KA 1W2KT 4PD4J 3IXAB 2IMNA 3P73A 4JKKA 5A6IA 1QRNB 4QAMB 3FCUA 2H3XA 3GC3A 3VD5A 5HVHC 2CN2A 3V6OE 1ILUA 5F3HA 4N2BA 3VX0A 2FZ3B 2K8MA 4F3FA 5J56B 3A4AA 5HPMB 1AMYA 1MNUL 2O5XH 3IDMB 2IBBA 3JZHA 4EQ3A 2EXWD 1CG9A 2WQRA 4BZ1A 4OM1H 2ZWZA 3WLWD 2AJUH 3U7WH 4CC4A 4MD5B 3K6SB 3O6FC 4K94L 2PCFA 2P7TA 1CDHA 2HN7A 2WNXA 3FMGL 5B3NA 4KROC 1Q9OB 4DPAX 3ESMA 3WFEL 5D7LB 4G5ZL 4JO1H 3KPMB 4TVPE 5EM2B 2ZWKA 3ARYA 1AD9B 4QRRD 4ANWA 3N50A 3DX3A 4JO3H 5CKGA 1JMZA 4GAYB 3EYQD 3M45A 5DRNB 2J56H 1ED3B 5GGTH 3RDTA 1A4CA 1W72B 3KLSA 2XXGA 5A6MA 5GGVL 1RJZB 1HOEA 5IVNA 2BP3A 4QRPE 4OZFG 3T2LA 4Z7VE 2AQRA 2YC1B 2YMXH 4YDKH 4YHLL 3NABH 3BPNB 1I7RA 5FUCC 3DMMB 3DXMC 2YS4A 2JKJA 2WWKO 2DD8L 3GB7A 1IARB 3PXTD 3VWJC 2E8ZA 3W1ZA 3FN0H 1TQSA 1CTOA 2Z92A 5GGSY 4PCSA 1LP9E 2A4EA 1XH3A 3LRGA 1TKWB 2CO4A 1KOAA 3NSDA 5DO8A 1QR4A 4HWBL 1KTLA 1QBAA 3FRPB 4AXWA 5MENE 3FFOA 1UXWA 3WNJA 4X7DC 4R3SA 1NBVH 3QUYB 3QORC 2AJYH 1ZEAH 2DIEA 1T1YA 3AB0C 3HB3C 3P4NA 4HS3A 5IP4A 4JGNA 3TT3L 4Q52A 3S3JA 4EIBA 3V55A 2IMMA 3GMPA 4PS7A 1JV2B 1PLGL 5CZXC 2XN9B 4AQ8A 3ISWA 1KLGA 4ZMQA 3OC8A 5FB8A 1T0MB 1TTAA 4LNRA 3RWCB 1II4E 4MMYA 3L7FB 3LNEA 4Y2DA 1JTOA 3DVIA 4V1DD 3AG2B 1OM9A 2GSIA 1WITA 4FQ1H 2XPYA 3T77B 1QSFD 1L5GB 1EWHA 4I0PA 1U95B 3QZLA 5C0IA 5JW5B 4F7CA 1QBLL 2Y1AA 1E7UA 1JK9B 2GTZA 3JRPA 2W80C 3OC5A 4ZD3L 4TXVB 4AKOA 3N41F 2JXMB 5DHYB 5TDPB 1MJJB 5DEGA 5AYUL 3C6LC 3E8UL 1QZNA 3MBXH 1F3JB 4YDIH 4YDLC 3MNZA 2XU9A 2F15A 3N91A 1WFTA 4HX1B 5DVMA 2UWEE 4GLRH 3SCMC 3B2VL 1H8OA 3B7SA 3VMNA 2EE9A 3R1GH 5HGDB 2DIJA 1UD4A 3PHSA 1RP9A 4XXDB 4QRRE 2Y25A 3ZYIA 4KGLA 4MQTB 1IBFA 2WUBL 5DJAA 3ROOA 3V0DA 2IQ9H 5B22A 1I1YB 5E51A 5I1CL 1XTMA 2B2XH 4JCMA 3QUZB 4X9IA 3N85H 3SMRA 3B9EA 3CZNA 3X11A 5IBTL 1Q0YH 3B34A 5EF2A 3PY9A 4E68A 2HTKC 3VVVA 2EIZA 1DJYA 2G75B 3QHYB 2XVLA 2QDWA 4KVCL 4D9SA 2XWBA 3SLED 2VKXA 4NZUH 3ZDXB 4AYGA 1FL6B 4KRNA 3LRMA 4IRJD 1UB5B 1WK0A 4HK3N 1FG2B 3HUJB 5BS0D 2VN4A 1KLFB 2W65B 4WFHD 1E4XL 3WXVL 5CEXB 1FH5L 2G9KA 4ORGB 1AHWA 1S9XB 5DVOA 3X12A 4FFYA 4WWPA 4DAGH 1PJWA 3QJOA 2I9LB 2WXPA 2VDRB 3QI9A 2I5YL 5FUZL 3UYPA 3KZ8A 4NRZA 1XR9A 2APSA 3L5WB 5D70H 4MMXB 5LBSH 2DYRB 2Z4QB 3F7LA 3KW7A 4YSOA 1GJIA 4OTXH 1U8LA 4K8RC 1IBGH 4OFIA 1HIML 4F9LC 3IUNA 1FDLL 5IB5B 1T80A 3QH3A 4I77H 2YD9A 3NYKA 3FUMA 1J1OH 4OGZA 4KKCC 2JK5A 3APNA 5C0JB 2CALA 3A67H 3K6DA 4LHJB 3FONA 4OCYL 2YXMA 1FE8H 1Q38A 2DLFH 3SXTD 5IQNA 5I0XA 4LGPB 1X7QB 2CCLA 3JUYA 4ONFL 4P4KB 5EIVA 3QDMA 3QWOA 5I0VA 1DVFD 4L5FH 4M6NH 4RWYL 1GGBL 2NZ9D 2ZCLL 4HXBL 3BAEL 3I6KA 5F93C 4H25A 4CZXA 3TFKD 1KJVB 5CILH 1MQKL 3MLWL 2AITA 4CRPA 2NR6D 4DIXA 1MCKA 2J55A 4ZW8A 1HHJB 3WFBH 4R7LA 3WO4B 1BGXL 1JPFA 1BFVH 3KYNA 5E24E 1QNZH 4AOFA 3TN0C 4HIXL 1JG9A 1KGIA 3NG5A 2Q7NA 3OLDA 4UCFA 2NT0A 4NLHA 3AZUA 2I3TA 4Z3EA 1A1OB 2WB1A 2APFA 4KJPD 3TIDB 3MR9B 1BD2B 2P8LB 5EUOE 2DQTH 2OJEB 1T21B 3PL6C 5EPMA 3CLWA 1UA6L 3L3KB 4YHPA 3L5XH 1G5GA 4M93B 2WO2B 1ONQB 4DP2X 2ZPKH 4J81A 4HALA 4FEMA 5T5FL 4YVUA 3CFDB 1JZ2A 5IREA 3GMRB 4WWKC 5C08B 2VDMA 3BZ5A 5FLXg 3EADA 5T3XL 4Z0BL 2QGBA 4HKZA 5ID0A 1FVCB 1B0WA 2WVUA 3ZE1B 4TNVK 3MDJA 2OMUB 1KGYE 5F8RC 4X60B 2PP9A 4LPTA 5IB3A 5BS0E 3EG9B 5KOVC 1MCLA 2WKGA 4WFHE 3OJDA 4RFNC 3GKWL 3I2NA 5IGOA 4MRBA 3CQFA 5AKRA 1Q94A 1RUAL 2F68X 1NDTA 2DQEH 3GQFA 4TM9A 5HGHB 4A7TA 2YWYA 3TZVB 3W9EA 3DI3B 4HC1H 2FO4B 2IPUG 2NY3C 3D8MA 4N2FA 2WWMC 3HZKA 1OAYL 5L2KB 2NLJB 3QDJB 3Q8CA 1KELH 4LP8A 5F70A 1YNLL 4MXQD 4H7VA 4RQQA 1RIVH 3Q2LA 4H44C 3O4LB 1CE6A 4RX4D 5I8KL 3OKEA 3ILQD 3ZTJH 5M5UA 1TT6A 1Y18A 2YAEA 3C60A 4FQCH 4HWUA 2Y4SA 4OCSL 4B50A 3ODTA 4URKA 4MNGB 3JTTB 4N8CH 3PP4H 3BC9A 4XBEH 4AK1A 4G9FD 5HDQH 1N5AA 3MRNB 1A0QL 1ZPUA 5GJSH 3RZCB 1OGPA 3BKJL 1FIEA 1YN6B 1P4BH 4Z7VF 1AXSA 4ODHH 2WZ5A 5CD5D 4L3ED 1FFTB 4B96A 1IM3D 1ZY9A 4YHIB 3HAEA 1CXIA 2JJSA 5BRPA 2WSKA 3I6GB 4ZW3A 4GUPA 1D6EB 4HH8A 1OWRM 2YEVB 5DJ8A 1LP9F 3MCKB 1GYCA 3MGTA 4YZFE 2X6UA 1G9HA 1UH3A 3DX9A 1QSED 5C0RL 1RU9L 2M26A 4G6KL 2CRMA 3I50H 3B7YA 3LS5H 4FZEL 3EGDA 5DK2A 1BM3L 3AFLA 1U6AL 4QRQB 4AH2B 1NICA 4L4TA 4KK8C 5M5RA 1EEYB 1OWWA 3UG5A 2H7WA 2FGZA 4FAND 3HW7A 5L9DH 3LKNA 4G42B 2X05A 5L8LB 1ZA6A 3TXAA 2OXGA 4FXKC 4D9LH 3DJ9A 3TURA 3F5WB 3GMOB 2CJSA 2AK4D 4JGJA 5C0EA 4YO0B 4NWUH 4JFZL 2MOGA 3GWJA 1XIWB 4QTFA 4I3RH 4H20H 4FLRA 4XO8A 3STZA 3VI4E 3HPJA 2JKSA 2H9GB 5D1QD 5K1NA 3V4VL 3H42L 4DO6A 1JE6A 3AREC 3F7YB 2NYYC 5ESQA 1I7ZB 2YNNA 3PQYD 2PR4H 3RWJB 5DWPA 3SGEI 4KNSA 3K72B 4PJHF 3WS6A 5C09A 1T1XB 5A6LA 5AOKA 2OV0A 5FYJU 3P54A 5BCAA 2IXQA 2H0FA 2R2HA 4HAGA 5CJQL 1LO0H 3UYOD 3MBEB 1BG1A 4ZN4A 2ALWA 5FECB 1CGSH 3VXRD 1MCCA 1M1XB 1RVFH 5CINH 1UM4H 4ZFOA 1NEZG 3HRZA 3VCLB 4FA7B 4JQXA 4WFGD 4LPCA 3GHBH 4LARH 2QGCA 1YRKA 1KBGL 4NB7A 5EARA 3RY6A 1EAJA 1O6SA 4LEXH 1TVHB 5HHPB 3J8F7 3NA4A 5SX4I 2R56H 4G1MA 4G9FE 3KPNA 4Z7WB 3ARBB 4IGBB 4OCWH 4UTBL 1HOCA 3AU1A 3JT2A 4OZGB 3RJDA 3QC6X 3MRCB 4X0KB 3RTLA 4KHTH 4NQUA 3L4UA 3UP1A 2KDGA 4MQ7A 4L3EE 2EKJA 3TO4D 1M9SA 1UASA 3C2AH 2VABA 4PLKC 3RWIA 3KD4A 3RTQD 1UYWL 4NO5B 1M7DB 1QABA 2X4UB 3K7UA 4TUKL 3UZEC 1AGFB 2DY2A 3CMGA 3RUGE 4BCZA 4KTDH 4MNQB 4KNQA 3D39B 2DH3A 5E2JA 4HCIA 2XNAB 4RLDA 2J8UB 1QSEE 3LKQB 3T09A 1BZQK 3D50A 1E4WH 4JY4A 4F7EA 3EO9H 5T1LB 4U1MA 4KKNA 3IVKB 3IJYA 2NYKA 5EBMA 3QAQA 4PSXB 1N6UA 4GW1A 1N18A 4FG6D 4CY5A 5B38B 3HBQA 3EI2B 1V7NL 4ZMXA 1BZ8A 1XAUA 3CC5B 2AK4E 5ALBL 5MEQB 2R0ZH 5F6IC 4C58B 3ZE2E 1LMIA 2CM5A 3GO1H 4PGBA 1T22A 3VGDA 2HVJB 4X7CC 4POUB 4U1JA 5IK3A 1DDHB 1HH6B 3GIZL 2CSPA 3H7BA 4P59H 3UGXA 1CLOL 5CFAA 5DZ9A 2G5UA 4MAYA 4LSDA 4FJYA 4HWNA 3D4GA 4ZOXA 1S5IL 3T8XA 4JREB 4NGHL 3FTWA 3F05A 4OWRA 5CXBB 2I3SA 1UA3A 2Y6SC 3K2IA 1S7UA 4ZDHA 3PQYE 5IFAL 3UH8A 1S3KH 4PJFF 3RNQB 3Q05A 4PRBB 5A16A 3BXNB 4PS3A 3ATFA 2BSTA 3W11C 3ZDYE 1INQA 2UY6B 4FOMA 4JFHD 2FJHA 4I1RA 4MB4A 5DZNA 1QW8A 3UIZA 1VZ2A 3FTUA 3S3DB 1S7RA 1O0VA 1A1MA 1IGML 2PWFA 4BH7B 4J2QA 1O6GA 2A73A 4LCWA 4OZFA 4ZMWA 4PJXB 1T1ZA 2YRBA 2IAAC 1WO2A 1NQBA 4TTDD 4U6XA 1N70A 3MMYA 5D96C 3MA9H 2J20A 4FLOA 2Z4TA 5DQDL 3DNKA 1W8OA 4R83A 2VDKB 4DOHB 4OIBA 1E9PA 2W92A 2ATAA 3HC3L 4W9ZA 1DSYA 2BVQA 4I88A 3VD2A 1RJLB 5EMYA 3DPBA 1OKEA 3QDAA 5E6RA 3DUUB 2B5IB 1GJWA 4NC1C 1B2WL 3FXIC 2BY1A 2AJVH 4DK6A 4MJ6A 2ADIA 1SBSH 1M2VB 4FP8H 4N2HA 1R24A 2WNWA 1ZTXE 3KDMB 3US1A 3J7HA 4N0YL 2HKHL 2JH2A 4Q9CA 3SDXE 2JVUA 3WBDA 1GHFL 5AVSB 2HFGL 3LXUX 3S5LB 5F7UA 3GXIA 1NFKA 1DLFH 1RZJL 2ZAHA 4UAOC 5EIIB 1YNTF 1ZTMA 1BLNB 3CZFA 2HJLA 2Z8WC 3QIUB 1VJSA 5IW6B 3MGOB 4Z7UB 1PFCA 4E9QA 1UWYA 1XH2A 5DHVH 2C1OA 3ATBA 5FM5O 1L0XA 3GYRA 3R06A 1SHXA 3PYCA 3U1PA 3W9DB 4LSPH 1KCWA 3QJQB 1OARL 4FHBD 4YFLI 3ULUH 5DZVA 4Y1SA 1TJGH 1RZKH 1LQSR 1O7DE 3NIDB 4GUCA 4PW3A 3T1WA 2VC2A 1N8ZB 2ADGA 3RURA 5JMOC 4FQQB 4WHYH 3KH3A 2WTRB 3VXUA 4GBXD 5ABAA 2NTFA 3PJLA 1MJ7H 2DQIL 5JPMB 5KJRH 1T0PB 4XB7A 5EZIH 3TO2A 3FTZA 2QMJA 3A47A 5AZ2H 5D93C 4IK7A 2EH7H 5J11C 3LV3B 3HZVB 4PBYA 4ABVA 7FABH 2ICWA 2RCSL 3UZVA 4X9GA 5FC9A 5C07A 4DF9A 2NNCA 3HOGA 4MMZA 2DYPB 2GC4C 5C9JB 4MCZB 2O30A 1KB3A 1WRFA 2VJ8A 2A6DB 2V9TA 4I18B 5KSBE 2DQ6A 2O6FA 5HVHB 2D7PA 4JFHE 1SOKA 4UT9H 3WJLA 4ADJA 4PV9B 3I9GL 1MW2A 3RLSA 2PXYA 9CGTA 3U1SH 3MUGB 4ZUTA 3B9KA 1LEGA 2WXIA 1BV8A 3SGJA 1ZANH 5DSCA 3TGXA 5BOZG 3RLMD 3NRFA 4K9EH 4XBMA 2WBXA 2GVYA 2L8AA 2R0LH 2UZPA 3BSZA 4U05A 2NY1B 3IDNB 3O6FB 5KOMC 2A4ZA 3QWQB 2QHRL 1RUKL 5HY9B 4KROB 1YC8A 3KW8A 5TK4A 3MJWA 1WP6A 1NEUA 4YUEH 1C9IA 1SUJA 3UTZA 4OD2A 3BI9X 4FNUA 2KLTA 1HHHB 5EC2B 2DQGL 2A0LD 1R3HA 4X80L 4X50A 5FO2A 1DP0A 3VI4F 3QIBD 4Z8LA 2JB5L 4FFWD 4ODSH 5D1XA 1BWWA 1BEXA 4I87A 4MA1C 4JHNA 2R8SH 3VM5A 1SJEB 3QJHB 1AR2A 1H3PL 1GCFA 3FQ4A 1FPTH 4P06A 1E8ZA 1WFOA 2HTLC 4HP5A 5L2JB 5EH1A 2G2RA 4OKDA 3K1DA 4OQTA 5FM8A 4X5WA 4RGNC 3VWJB 4PJEF 5IBUB 3RY5A 1PEZA 3CHOA 4IBTA 3V95A 3VFUA 5JUEH 4X7FC 1W72H 1FYTA 1GGCH 1TQBB 2QKIC 4P2OC 2JLLA 3WHE0 1UZGA 4XYIA 3I7HA 1E5ZA 4H2CA 1C9LA 3SWSD 3QJXA 1HZKA 1LD9A 1IKFL 3AB0B 3GTNA 3GSVA 4BFOA 2VR7A 4R7XA 1Y07A 1CYGA 4GGAA 3UTTB 3JROA 4K8RL 1GYVA 3TM6A 4YEFA 1EZSA 3T04D 3V2AR 3TNMA 3LDBC 2V2TB 2XIDA 4YL9A 4B41A 3RGVB 4MJIA 4MCMA 3ZRFC 3U9UB 5K9QI 3G6AA 1BREA 4ZUVB 3IJCA 3U2SB 3F3HA 5IOPB 4P3DA 3WTSA 4GKOA 4R0LA 3R19A 3CVDA 3EJTA 4XCNB 1MFVA 3BVNA 4DP7X 3QUXD 4BH8B 4H1LG 5EG6C 2AS5M 3IDYB 1A6AA 4NPYB 3WTYA 3UJTL 3TBVA 5D7JC 3WFDL 2O4EA 1GP2B 4LPVA 3BWUF 2PYED 1S7QA 1DVXA 4PJ6A 5IMMB 5CZKA 2P5WB 4M03A 2ESVB 4BSJA 3P9LB 4DK3A 1ETZB 4PYGA 3C6LB 1MNUH 3BAIA 3I2CH 4OLWH 3D51A 3ILEA 2A6IA 2I07B 4DGIH 3SCMB 1HINH 4MDJB 3VXSB 3ZE2F 1H2YA 4L48A 5DS2A 4BV1A 2B9BA 4XN2A 1JBJA 3TF4A 2CQVA 1FUNA 3N43F 2ADJB 2ZOLB 2HESX 1ZJAA 2LW3A 3F7VB 4Z7OF 3FMGH 3IFPA 3TJEH 1S5HA 4O2EB 3G08B 5DYFA 4BFJA 4PJ9A 4J5VA 1E8YA 3QEUA 3FOLA 1PVHA 3SYAA 5CFHA 1HAWA 5FKPB 3T2PA 5JZ7D 4L18A 1ZLVK 5EF0A 3EQ7A 1Q9KA 1S4IA 4TYUA 4E5XB 4JT5C 2ZTBA 3D0LB 3EYOB 5D55A 3ABKB 3ZDYF 3NCJL 3UAJA 3HI1A 2GJ6D 3GM0A 4DEPC 2D2OA 4KI5E 4Z5RA 4HUMB 1G9EA 5I19H 2FT7A 3OAZH 4RAHA 1QR1A 2WOBA 2ICEA 2BK8A 1N68A 4YHLH 2GCYA 1DJWA 2H6PB 5B7MA 2WWOA 2NT1A 2DD8H 3G6JE 2DQDL 3FU5A 3KGRA 2XWDA 3RFZA 4NNPL 3OZ9H 4QYOA 1MWAL 1MFCL 5F96L 5INCB 2JKLA 3X13A 1A2YB 5IMKA 2AV1B 4LLDA 4Y4HD 5SX5K 4J3OH 5CSZB 1KJMA 2WWNA 3WEXB 3F7QA 4KXBA 1ZPLA 3NQKA 4HWBH 1KXTB 2H32B 4WZ9A 1UACL 3OKNB 1R19A 5DJCB 3EFFA 2Q7YA 5DXWA 3MAWA 4JDEB 4J3XA 4WI0B 3V10A 1FBIL 3HHSA 3KXFB 4XP4L 3TT3H 1A9VA 5HYJA 1VFBB 1CL7L 4J27A 4QOKB 4WW2C 3VG9C 4G8FB 2WKOF 4GAGH 4CBZA 4RVBA 4ENEC 4H5JA 1KB9J 4ZTPL 3BUQA 2L04A 4UUJA 2FECI 1J18A 3HCVA 4X4XB 5IF0B 3UBGA 5I6MA 2Y5TA 5L0QB 3W5NA 4PY7B 3BVTA 4J8QA 1A25A 2PYEE 4A68A 4AG4L 5GISL 4M7LL 3KYMB 1A9EB 4ZSOE 4V11A 2OW7A 2Z9TA 1QBLH 5CWSA 3I84A 4PRHA 1Y6KR 5BZWA 5B8CC 2YK1L 5CHNA 2AXHA 4WI6A 3ABLB 1O9VA 2ILLA 4XP5H 3EJZD 5D71H 5A2Qg 2N01B 5AENA 3FCGA 4MA8L 3S35L 4A2FA 2FO8A 4GSQA 5IQMA 1VFAA 2V0AA 2X2IA 5KVFH 5CYKB 4WWKB 5BRZB 1HZHL 4FHLA 5KYYB 3E6HA 1LJMA 2EVHA 2YMUA 4E36A 4JFPB 1NEZA 2FX7L 4TQHA 2KZWA 3ZMRA 5KSBF 3Q6FB 3ZRSA 2QHLA 4KH9A 4EUPG 4ABUA 3OR6A 4JCLA 3TWCH 5I1CH 1JP5A 4F57L 2VQ1B 3MRQA 5JQHC 2YKLL 3RWFB 2HU5A 4RFNB 5J3HD 4UIMB 4O51A 4LSSH 2YLHA 2HSIA 1IC7H 2KDYA 1CURA 2AFNA 3OGCA 3UAFA 2C9RA 2EKSB 3KLAA 3WJMB 3V9FA 2OMXA 3OMAB 2YD5A 1E4XH 4HS8L 1Q9LA 4LFHD 4IBWA 2JF1A 2BP8A 4X6CB 3OHXC 2I5YH 5FUZH 4BUQA 4PW4A 4NQEA 4NPJA 4YHNA 2X87A 3QCVL 1U3ZA 2PCPA 4RAUA 2V17L 4CU8A 4DSYA 2XN2A 4PJBA 2BO0A 1FNAA 3GGWB 3TONA 5BO1H 1HIMH 4FQXC 1FDLH 4O02L 1GA2A 2IGFH 4WTXA 1AQ8A 4GQ9L 3OLIA 3UTSB 1JF5A 4KKBD 4GRWH 1GVIA 4CC9A 1PI6A 5IHLB 5HD8D 3MJ9A 2EIMB 3M17B 1FFOB 3UCRA 3D6GA 4ES8A 3DDUA 4DNUA 4AZ8B 4L9LA 2AV7B 3OHMB 4L2YA 5F0MB 4JBSA 1UXMA 1AQKL 3TEYA 4NT6A 2BSSA 3D30A 1BFOB 1EDYA 1GGBH 4X5QA 2ZCLH 5KYWB 5D5MB 3B2XA 7TAAA 3LH2L 4WFEE 3ZZ1A 3NJJA 1WZMA 3MLWH 1UG9A 4X99B 2RAMA 3C5SA 1EFXB 2BLFA 3BW9A 4GQQA 1BGXH 4N2AA 3GM8A 1XD0A 3S34L 1UWEH 1O75A 4HIXH 5D7SL 5T8IA 1PF3A 2VN6A 3IFNH 2BCKA 3TESA 3E3QC 4WEUD 3JB9L 4WI8A 1IAKA 5EOCL 3ZUNC 2F1BA 2VH5L 1LO3L 2D4FA 4GYBA 2C9VA 1T04A 2LU3A 5DMJB 3T0EC 2IWGA 2AGWA 3AAZB 4QRSB 3FZUC 2HMID 4JE0A 3P4MB 1SYSB 2JCCE 1AIZA 1GZPA 3SDDB 5T3XH 3SO3B 2X42A 2XKSA 3PHOA 2KMWA 3BEVB 2UZIH 2CO0C 1U3HA 3BP7A 5L8KB 4Y7RA 5DJ2A 4EDXB 3KLDA 4RBPK 2F58L 2Z7WA 3K8MA 4TVSa 1OW0A 2XWJB 4UINH 5I9QB 1FFQA 2P5PA 1L7IL 1OAQH 2D4DA 2OM5A 4Y5XC 3EF4A 3HZMA 1DEEA 4RMSA 1PEVA 3S4SG 1ND0A 4L37B 3DV4A 1UUSA 5JOPD 4XN7A 4DQAA 2IOMA 3BE1L 4Y19B 4KWUA 1PDKB 4WU7B 3QUMB 2DWDB 1SVBA 2R7EA 3CX5K 1R17A 4TUOA 4JRYA 5KUKA 4NKMB 2X2JA 5DDHB 2IDCA 1J86A 1MSPA 4WDIA 4OCSH 2FQFA 3Q43A 5SX5H 3CUPB 3Q6GL 5SWSA 3MREA 3W2DL 4JUSA 5C0CB 4PRPD 1NGPL 3CDYA 5GGRY 1MY5A 4PMEA 4OBSA 2W95A 5AKTA 3IPFA 4B7LA 5J12B 1U8KB 1F42A 3GJEB 2FEDC 1XGUA 3MMEA 4P0DA 4AQZA 3IKCA 1IGFL 1JN6B 3G6JF 3OQ3B 4YFLF 1NBCA 2Q8BH 4GW5B 2A7BA 2WBJB 4LCVA 3ZIMA 2G4EA 2APXA 2FEEI 4TSBH 1YEFL 1Z5LB 5EO0A 5KYUB 3MSPA 2FJFA 1ORSA 2BBKH 5I1IH 3T71A 1MCRA 1LEKA 5F6IB 5HYSG 2GIXA 1XX9C 2ZX6A 2D3LA 3D0VA 2CE6A 1SDDA 1UD2A 2ENQA 2VLJB 4HU2A 3D2UA 2B4CL 2GHWB 1EPFA 4P4RA 3SDCA 3P4OB 2QJDA 3ZKMC 5ETUA 3U6XA 5EF1A 1S9KC 2F61A 2TSAA 5EOCJ 4J0WA 4GH7B 1BVLB 1QI5A 5FA5B 3OKOA 5I18L 3IMUA 5J7CC 4J2XA 1WVZA 4HK0A 5ICZA 3CG8A 1DQQA 2I7SA 3FFDB 1J0YA 2DMBA 3CFBB 3NIFE 3BT2L 3O8XA 5TH2A 5I1GL 1KYUA 2ZJSH 5I76A 1IM9A 3O41A 3MUOA 4IKNA 5E4EC 1YCSA 3TJPA 5C0DB 2VISA 1OTSC 2ZP0T 3I02A 4WUUD 4GQ1A 1EAPA 3GXUB 3LY6A 5BZXA 4PWIA 3TBYB 3DO4A 4PR5A 1AYRA 3JWOC 3L3DB 4JFXB 4WK2B 4MX7A 5E94B 2XL3A 3CCHA 5F72S 4B27A 1AACA 4OBRA 2BIPA 1U93B 1KPVA 4GQRA 1BZOA 2I9TA 2VKWA 3LEXA 1I8KB 1QBMH 3H9SA 1JGLH 4P2QA 5JOPE 1TCRB 5GZOD 5FYLE 4OZHB 5D96B 1QLRB 2QR5A 4LLMB 4ODUA 5EC1A 4OM0L 5C6TH 2MKWA 1SJHB 1CF1A 4XX5A 5F1NA 2V8LA 3DX4A 1PAMA 4LCUB 3JSSA 4NKDB 3CN2A 4F5CA 1MHHA 1NMCC 4LMQI 1BQHB 3WKQA 1KNOB 4JL1A 4PRPE 4M5SA 1EEQA 3ZYOA 1RPQA 3KPRB 2MQ3A 2BIOA 2YQGA 3APDA 5FKAA 1UCTA 5DZJA 3F00A 3RX9A 2VDKH 2CHWA 3ARGD 5K9OA 1R9FA 4ZFZB 2YNOA 2ZXEB 4UAOB 2OL3A 4LCIL 2ZOKB 4U4IA 4HLEA 3FO9A 4ONGH 2P26A 5CJ8A 4UANA 3ZE0B 1OGTA 4JEGB 3E0CA 5TJWK 3FQ1A 5DRZB 4XP9H 5EOTA 3ZDZB 4PJHA 2H3XC 4DKDC 2WLHA 3GEWB 1T89A 3ECVA 5EN3A 3ULEC 2XQYG 2QVKA 2IH3A 2YARA 1MUJB 2Z31D 3BUDA 4HFWB 4B9YA 4H1LA 3DIFB 2MQCA 3W0WA 5LGJA 4LLVB 4DFIA 5FFGA 4YBLB 1HZLA 3EGSA 1HC1A 4OLVL 3PIQB 3ARQA 4CMMB 1TJIL 4CC4C 2KT6A 3FTGB 2R29H 4M02A 2X6BA 1KB9K 1PMYA 1VGEH 1XD1A 4N87A 1V7NH 5D93B 5ALBH 4PJ5D 1M71A 1QQDA 4XP1H 3VWKB 2KS0A 2BFVL 3L2NA 4Y5VA 3EJQA 2QQNL 2FDBP 3EYSL 3OX8A 3BZ4A 5HHOD 5M95B 3BMVA 3I9IA 1FC1A 1MPAL 3GIZH 4JX0A 4NKQB 2C9UA 5LGYA 3VX1A 2Y07H 2WVSA 1CLOH 1WISA 3FQUB 4MFHA 3A0OA 3RDTC 5JPNA 5ABZA 3RKDC 1S5IH 1DVSA 4NGHH 4PJ7F 4B9FA 2WUCH 2NSQA 4F7MB 1AXTH 4QUOA 5G4MA 3K71A 2QADC 4U6HA 4OGAD 2AXFB 1G7JB 1MFDL 2FX8H 1QLFA 2H5UA 1IBHA 4HUCA 1XR8A 4YHML 3LZNA 3ABMB 1OT2A 1CIDA 1JPSH 3QDHA 3P9WB 2SODB 4QHUA 5AUMB 3RE0A 2WNGA 2ZUQC 4FABL 3PWLB 3TJHC 5AKSA 4MGXA 2NUTA 3FN9A 5C2WB 3MLTB 4C54A 1YQVL 1OCCB 3C9NB 2V5SA 5DQDH 3HVDA 2CGRL 2D7QA 1KB5L 2JCCF 5IG7A 4V1DA 4JFED 1IBZA 2AEPL 1BF8A 3DROA 1QSFA 1TJMA 4HKXB 4YJZL 1U8CB 4AQ8C 5F7KC 4NS0A 4Z9KB 1NMBH 3IJEA 1D5BA 3HNSL 4IOSD 1HYRC 1CK0L 4GMBA 4LIQE 2Y2TA 4Q4EA 4WV1A 3D07A 1NFDB 4RESB 4Y2DC 2FJGB 4RGNB 4EI5D 4PJFA 4F7PB 1TYJA 3PREA 3QQ9D 2FR4B 2WQSA 1NFIA 3IK2A 2N0KA 3LKPB 1C08A 4LRNH 4BFBD 1ZGLA 3BKMH 3VG0H 4K7PL 3HNVL 3EO1A 3DUSB 4EAEA 5A3IC 1SN2A 1JZHA 3SPCA 1XGPA 3HNTL 4FTVB 4HBCL 1TYRA 5D2LE 4WW1B 1K6QL 4QNPF 3QDGD 4N0UB 1C5DB 3Q2CA 3T0XA 2ENJA 1OP3K 4PJ5E 3VFNB 4PV8A 3VI3B 4XNQA 4CVWA 4DKTA 4PJIE 4HV8B 5CEYB 2LT9A 2WSPA 3CH8A 3DVGB 3IBEA 3LDBB 4JFFA 5F0PB 4X8JA 5IV2B 3MYZA 4G8EB 2DQIH 3RJQB 1KCVH 1D7CA 1HH9B 2HLEB 2ITEA 5IFJB 1TYEA 1C8PA 1A6ZA 1G4MA 2I25N 2WZPD 2A3TA 3WIHH 2VLKB 5I17A 2ZWSA 4BRJA 2RCSH 2SEBA 2GUOA 3EH3B 4N6RA 4GY4A 1NCGA 2PKDA 2IC2A 3G04B 1YNTA 1HESA 2DH2A 3UC0H 1I2MB 3TYGL 4G8GB 1YPZB 3I9GH 1K8DB 1F90H 4KKAD 1OP5K 4EUPA 1Y6NR 4JZNA 3DBSA 3GSRA 3PDGA 4UYPA 1OEZW 3G6DL 3GUTB 2VDOL 4KDVA 1JVKA 1HEZA 1JI2A 2G3XA 1AHWC 3QR2A 4NHUA 4E41E 4XMLH 3THML 2B1HH 1JFHA 3QI9C 4XPBL 2FB4H 1YYLL 2E7HA 3EJYD 4U1SA 1BBDL 3LEVH 1RUKH 4LG8A 4CVZA 2LLGA 3CFCH 3HIZA 4JMNA 3MXWL 1G7MA 4RZKA 5AW9B 5JORA 3HJEA 1R6VA 1EEZB 4K9JA 3CVIH 4V2CB 5DJYB 3US9A 4PTUB 3FRPG 5IBLC 1WE5A 4IMKA 1RK7A 4MNHB 1KXQA 4YWGL 4A7GA 5KWYC 3HC4L 5A2LH 4QXTA 1YEHH 1R33A 3VA6A 4DEPB 5TDNB 2VRQA 1H3PH 4XH2A 1PIGA 5K1JA 2J2ZA 3NN8B 2QZPA 3QUGA 2P3YA 4N8PA 4FZ8L 2JIXD 1CFVL 3CIAA 1H6FA 3CFVA 5ANMB 3BO8B 3NK3A 1XH1A 4OF0A 4UDUA 1JS4A 3FUEA 1MREL 3FH8A 2FWLB 4OF3A 4BUGA 4F33A 3BZFA 1FAIH 2PF6A 1FZOB 3VRJA 3QDGE 1TO4A 2YEQA 1JHTA 2EIBA 2ZKHH 3GSWA 3QPXL 4HISA 4MS6A 5E0FA 3EXJA 1ZSDB 1GY2A 4FKHA 4DP6X 8CGTA 5FAAA 4U6VL 2YPVL 3IFOB 5FYKL 3DX2A 4KK9D 1NC4D 2AMUA 3P2DA 5ELIA 4BM7A 1KIQA 2EE3A 3DRQA 2WN2A 3TBTA 1OF0A 5SXMA 1DVZA 2EZ0C 3SPIA 2E27L 1YUHA 4BSVB 1XHHA 4KRPC 4KXZH 5KN5B 1NBZA 3F83A 3OGOE 2RD0A 1X5AA 3CVHB 1DLHA 2CRIA 3M1BB 1T6BX 1ZDQA 4CVXA 4F9PA 2EH8L 4K8RH