5I5MA

Shewanella denitrificans nitrous oxide reductase, ca2+-reconstituted form
Total Genus 193
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
193
sequence length
575
structure length
575
Chain Sequence
SAVVHPGELDEYYGFWSGGHSGEVRILGIPSMRELMRIPVFNIDSATGWGITNESKRIKGDSAHLMTGDSHHPHMSMTDGSYNGKYVFINDKANSRVARIRCDVMKTDKMITIPNVQAIHGLRVQKVPYTKYVICNGEFEIPMNNDGKASLEDVSTYRSLFNVIDAEKMEVAFQVMVDGNLDNTDADYDGKYFFSTCYNSEMGMNLGEMITAERDHVVVFSLERCLAALKAGKFTNYNGNKVPVLDGRKGSDLTRYIPVPKSPHGINTAPDGKYFVANGKLSPTVSVVEIARLDDVFSGKIQPRDAIVAEPELGLGPLHTAFDNKGNAFTTLFLDSQIAKWNIQDAIKAYNGEKVNYLRQKLDVHYQPGHNHTSQGETRDTDGKWLVVLCKFSKDRFLPVGPLRPENDQLIDISGDEMKLVHDGPTFAEPHDCMIVHRSKVKPQKLWTRDDPMFADTVAMAKQDGVTLEMDNKVIRDGNKVRVYMTSIAPNFGMNEFKVKLGDEVTVVVTNLDQVEDVTHGFCMTNHGVQMEVAPQATASVTFIANKPGVQWYYCNWFCHALHMEMRGRMLVEAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nitrous-oxide reductase
publication title Role of Calcium in Secondary Structure Stabilization during Maturation of Nitrous Oxide Reductase.
pubmed doi rcsb
source organism Shewanella denitrificans (strain os217 / atcc baa-1090 / dsm 15013)
molecule tags Oxidoreductase
total genus 193
structure length 575
sequence length 575
chains with identical sequence B
ec nomenclature ec 1.7.2.4: Nitrous-oxide reductase.
pdb deposition date 2016-02-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18764 nos_propeller Nitrous oxide reductase propeller repeat
A PF18793 nos_propeller_2 Nitrous oxide reductase propeller repeat 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 5i5mA02
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5i5mA01
4G72B 1E5ZA 2PPCA 2UXTA 1WA0X 3I8CA 4HDJA 3SFZA 4A09B 3FQ2A 1GYCA 3DM0A 2HX8A 5B7MA 4PSWB 4UI9R 3AG4B 4GMBA 3ZX1A 1OMWB 1XHMA 4GM8A 1AS7A 5CYKB 1VLXA 3GFCA 5EMMB 3MMYA 5FC9A 1ASQA 3CVCA 2HRGA 3PSCB 3S3CB 3AZUA 3OMIB 2CO0C 1SDDA 1AANA 1WAEA 3GYRA 3JZNA 4GM3A 2NRDA 5TDHB 5I6OA 2MTAA 1ADWA 1GS7A 3V9FA 3PXSD 4CI8A 1N68A 2ZWNA 5PCYA 3OD3A 3IIWA 3J80g 4OWRA 3FYIB 3SCYA 4L1QD 1FFTB 4GXFA 3IN2A 1GXRA 1ASPA 2IAAC 1GY2A 1SFHA 5A7EA 2BZCA 3EI3A 2MTAH 2H3XA 4CY1A 3PVUB 4FA1D 1PNDA 1X9RA 4X4KA 4YSRA 3UACA 1L0QA 2AGZA 2B5MA 3MBWB 5H14A 4A09A 4D6VA 2DYSB 2XV2A 8PAZA 3P4FA 4QRJA 3NP4A 4KOBA 3FM0A 1XMEB 3FU7A 3H56A 1E30A 4HCFA 4E9WA 4J73A 5IJ7E 5B7EA 3SLED 5CYKA 1AG0A 5B1AB 4HCIA 5B3SB 4E9YA 2HX9A 1EZLA 2P80D 4AZUA 2UXGA 3PLYA 2FT6A 2YXWA 3I2NA 3KRWB 3CZUB 5HE0B 4PNKB 1A4BA 1J9RA 1ET8A 3BWSA 5K1CC 3X1NA 4G7SB 3WG7B 3WKQA 1GY1A 2GC4A 2O9KA 3OTTA 2DYRB 4GQBB 3SVWD 1L9SA 1URIA 4A2FA 3JAMg 4TXVB 4BWTA 3WI9A 4KO6A 4HHGA 3OKWA 1MZZA 4K3JB 2BO0A 3FQ1A 3PAVA 4NAJA 4JSVC 2OK4A 3JB9L 2XYBA 3ABLB 3UKUC 3EF4A 3DIVA 3UVNA 4JSNC 4CY5A 1HAUA 4GM9A 1OV8A 4JD2C 5A2Qg 4CI1A 2CN3A 1GW0A 2H6QA 2TRCB 3NVQA 4WKXA 2Y1AA 4YSPA 2P9UC 1CYXA 3PVWB 4G56B 3D12B 5I28A 5IJ8E 5ANHA 1KGYE 3ORVD 3FSWA 1ZDSA 4IMMA 2IWFA 4NERA 5HE1B 4JHUA 2BBKH 1N6EA 3ASNB 4DPBX 1W6LA 2I7SA 2H6NA 4AKOA 2PP8A 4A2MA 5TK4A 5AMSA 1RZQA 3SQRA 5TEEA 3BQVA 3QJUB 4J86A 4K3ID 1A65A 4ZOVA 5H1MA 3N2JA 1JXFA 4K9JA 1I53A 3ZDWA 4L9OA 3G5WA 6PCYA 1PEVA 3RLMD 1W6WA 2YXVA 3I7NA 1BXVA 3NJKA 1A3ZA 4G7RB 1OLZA 2H3XC 3DXKC 1E5YA 1YFQA 2H6KA 2H14A 4G71B 5B4WA 3WNIA 4YSCA 2W18A 1SHXA 3T6VA 4PAZA 3ASOB 2BP8B 1U2VC 2GB2A 1P22A 3C75A 1SQJA 3X1GA 3S3BB 3UR4A 1PBYB 5AKRA 3NSDA 3UVLA 4E5ZA 2AGWA 2LLNA 4YL4A 1CUOA 5EAPA 5FQDA 2FT8A 4CZVA 3TASA 3DWLC 2JXMA 2N0MA 4DPCX 1AAJA 2AGLA 3C75H 3OM3B 1BYOA 1RCYA 1NIFA 4CSZA 1N6DA 1JJUB 1KYAA 1V54B 3IKOA 3L4MD 5EAMA 1SHWA 2IAAA 3GREA 4MK0B 2DY2A 2UXVA 3SJLD 1W8EA 2PLTA 1JVOA 1PLBA 3TBBA 5K19A 1XKSA 3EHBB 4E9QA 2IDFA 3IJCA 3CDZA 3UVMA 2QDVA 2P9SC 4J77A 2HYEA 1XB3A 3OKYB 4KNSA 5FXYA 2H9LA 1MG3C 2YAMA 4L0PB 3FGBA 4BXSV 5D4IA 2DWSA 5IGOA 2P9KC 4E9TA 3QJTB 4N14A 5GMKn 1AZRA 1TEFA 2WO3B 2YB8B 4A7JA 3AL8B 1OCRB 4F7KA 3N0EA 3NJIA 3I7LA 4GGDA 4U7AA 7PCYA 1BYPA 1KBVA 1AOZA 3VGZA 3VH0A 2YAPA 1GR7A 3NSFA 1NWPA 2J57A 3FU8A 2H9NA 2GI0A 1KDJA 5EHFA 3SN6B 5B1BB 3ABGA 3EMHA 2G99A 1L9RA 1WS8A 1PZAA 2PM7B 2FWLB 5IC7A 1JZHA 1WA2X 3QPKA 3X1EA 5AFAA 2H68A 4H5JA 4NSXA 4Y5RD 4GQ1A 3U4YA 1MG2C 1PAZA 2CBPA 4FAAB 3OKYA 1KCBA 4CC9A 1SF3A 4QKTA 3RMZD 1PLAA 5FKQA 3NVNA 2R7EA 4ZOZA 1JZIA 4UF7C 1JXDA 4DP1X 2OK6A 4PCYA 3X1BA 4E54A 3FYEB 3TU6A 3RN1D 2EIMB 3NP3A 3X1FA 4PC0A 3AL8A 1ID2A 2OCCB 5HE3B 4FB1D 3NJGA 1M9WA 5FKRA 1OE2A 1PZCA 3CVDA 2VW7A 2FTAA 3H4HA 1ZIBA 1ASOA 2AQ5A 1NTDA 2AFNA 1A4CA 4X63B 4GP5B 5CXBB 2UX6A 4P5SA 5AFU3 3QJSB 1T5KA 3I7KA 1GS6X 4DP9X 1SQ9A 5B7FA 3FSAA 1VYHC 3JZGA 4CZYA 4YSDA 4BWWA 3AY2A 4O9DA 1AG6A 4HHWA 4E9RA 2I3SA 2XX0A 2P9NC 5TF2A 2W8CA 1BXUA 4O1QD 3JRPA 2OJ1A 1K32A 4ERQA 1ILSA 1QLEB 4LG9A 3QJQB 4P5RA 3NVXA 2XU9A 3RSEC 2PBIB 2FQFA 2VM3A 2YAHA 2IUPA 5GXHA 3DSMA 1NDTA 2XLLA 1OCOB 4A0AB 3ERXA 1AS8A 2QPEB 1NEXB 3WIAA 4JHVA 1M57B 2EILB 3N0DA 4IA9A 4CZXA 2CJ3A 1CC3A 4AX3A 1AZCA 3AH8B 3I7OA 1JOIA 1MDAA 2IWEA 3RN0D 2J56A 5LDUA 1WA1X 3MZKA 3SMRA 4FA4D 4ZOYA 5EMLB 3SBPA 4D0KA 1IKOP 2IWKA 3NJFA 4BWUA 3PPSA 2CNXA 1JOFA 2XYIA 1MG3A 2G9AA 5EARA 5I6MA 2FQEA 4A11B 4HAKA 4GQ2P 4DPAX 3NSCA 5FKSA 5IGQA 3T6WA 4Q8BA 4AEZA 4W1TA 5B1JC 4F2EA 1FWXA 1MDAH 1JZFA 2PM9B 2J56H 3EI2B 3I8EA 3QQXA 1J5CA 2PP7A 3KW7A 4E9VA 2XXGA 4A08B 3GDCA 4A2DA 3EU7A 2BZ7A 2YAFA 3PXLA 3I89A 2BP0B 2EIJB 1R5MA 5HYNB 4BH6A 2HLEB 2WSDA 1AQ8A 4A0AA 2XWZA 3FPYA 2YMUA 5C2VB 4EF3A 4A2LA 2I7OA 3HB3B 3AG3B 1PCSA 2B08A 4Z8LA 2X87A 1SHYB 2H13A 3IJ1A 4J0XA 1S4UX 5EMKB 4A2GA 3PE7A 4GZ8A 2Z2PA 4QT8A 3OMAB 2QC5A 2YNNA 1B9YA 2HKRA 3IEAA 3W15A 1PZBA 4JSXC 1NIAA 1MG2A 2XL3A 4H5IA 3A0FA 1NWOA 5F7AA 2J57G 2IDTA 3BVDB 5HE2B 4A0BB 3ODTA 2HXCA 2YNOA 5GXIA 4KO5A 2PM9A 3EI2A 2PPDA 1CURA 3CIKB 4FA7B 5F7BA 2GIMA 4CI2A 4HIPA 1PF3A 5JWZA 2GNQA 1J5DA 3V9EA 3RRMC 3KW8A 4BDVB 2I0TA 4JKNA 3E0CA 1YLBB 2EBSA 3FRXA 3V5WB 3KRXB 4AI7A 2WO2B 3TBCA 4J82A 4BK5C 3ABKB 2I0SA 2FJSA 2PCFA 3UGEA 4E9SA 1EHKB 1RZPA 4JT6C 3SHFA 1ZDQA 4DP4X 3S8FB 3RFGA 2IDUA 1OOWA 1AS6A 1NZRA 3B7FA 1SJMA 3MX0B 3QJVB 4YSTA 1NINA 3FT0A 2OVQB 4KO9A 2TSAA 1AZBA 2Y69B 3CFVA 3L4OD 3OL2B 3PXTD 3UKRC 3EI1B 2IH8A 1IBZA 5I6KA 2BP8A 1N6FA 2QXVA 1FA4A 3IBOA 1JZJA 2B3IA 1PGUA 4AKQA 4A0BA 3SBRA 1HFUA 3ABMB 1CYWA 2VM4A 4G70B 3SBQA 2GBAA 3RYMA 1ILUA 4L3HD 1SNRA 4ERYA 1NR0A 3EWEA 4AOWA 2AGYA 4BUJC 5I5JA 4X3EA 5C9ZB 4J8BA 3BG1A 4QLWA 1JXGA 2A3TA 4N8UA 4Y7RA 3N55A 1ETJA 1ET5A 1JERA 3F3FA 9PCYA 3U25A 4FA9D 2B5LA 4YVDA 2CE9A 1RI6A 4O3UB 3UVKA 4QQEA 4W9ZA 2AVFA 4FA5D 1XB6A 4F2FA 3NSYA 1TBGA 1NIDA 4I79A 2VMJA 4AKPA 2HXAA 2RACA 2H47C 3I7HA 3FU9A 4KNTA 1E67A 3UAAA 4PBYA 2BW4A 3H4FA 3TA4D 2CE8A 2UZYB 3CFSB 3SXTD 2CAKA 5B1JA 1X9UA 2YNPA 2GC7C 2UXFA 2FQGA 3EI1A 3OL2A 1AZNA 1J9TA 4NB7A 4YVUA 7PAZA 1ET7A 2HKMA 1KBWA 2HRHA 4LGNA 3I7PA 2FQDA 2IURA 4DP7X 1J9QA 3J81g 3SWSD 4ZK8A 3C99A 2DWTA 3NT0A 3FPXA 1JMZB 4YSUA 1HAWA 2PCYA 3NJJA 1GG2B 2CN2A 5TEFA 5EM2B 4A2EA 5KDOB 2DV6A 1OCCB 1AZUA 2BW5A 2XVBA 3FS9A 3WKPA 3FU7B 4FWWA 4FAND 3DTUB 2BWIA 3CG8A 5TK2A 1UATA 4U1EI 1BEXA 3ZWLB 2IUVA 4R7AB 4CY3A 1AACA 1QHQA 2JFCA 2I3TA 4XEIC 4BXVA 5I6LA 4HCGA 4GY4A 2YAOA 4X61B 4BL0A 1K8KC 2XX1A 1NIBA 3BG0A 2W88A 2FT7A 2HZHA 3FSVA 2X88A 3X2QB 4GGAA 4J81A 4JT5C 5CXCB 2CALA 3JTBA 2PPEA 5PAZA 3JROA 4CY2A 4J0WA 2OVPB 2XU7A 1DZ0A 2H9MA 2AH1A 3V7DB 4TZ4A 1PY0A 2XUWA 1E65A 1OE3A 2PPFA 4DP8X 1PMYA 1WS7A 4WTQA 2ZONA 3IIYA 4XYIA 1IBYA 1BQRA 4LG8A 5I6NA 2OIZA 2VW4A 3NJMA 3EH3B 3FQYA 4OZUA 1A4AA 5EM2A 4PXWA 2B5NA 4M4RB 3UADA 2UZXB 5CXBA 1TKWA 3F3PA 4A68A 2MRYA 1DYZA 4FAVD 3GXUB 4YSSA 1V55B 1ERJA 2OVRB 5GSAA 2AZUA 4J78A 2J5WA 4L3GD 2I85A 4ESGA 2HJ4A 1PI6A 3DKHA 3AG2B 3UVOA 2HJBA 2YQBA 1L9PA 2PP9A 4MFHA 3S3DB 1GS8A 1N70A 4JSPC 3FSZA 2YAEA 4KNUA 1PLCA 1V10A 2JKWA 3IN0A 4Q89A 2AH0A 3JZHA 3MKSB 3MZLA 1ZIAA 3OKTA 4XYHA 5CXCA 2H5UA 5D4HA 4KOCA 3S8GB 2CCWA 2H9PA 4JXMA 4J87A 4UAHA 2YAQA 2PPAA 4RH4A 3T6XA 4CSPA 2PM6B 1L9QA 4ZN4A 3AFCA 5C2WB 2TSBA 2P9IC 2YARA 3DXMC 1AR1B 3JT2A 2EIKB 1Q47A 2YBAA 2AGXA 1OE1A 3NYKA 3MXXA 3L45A 4UANA 2VSKB 1TEGA 2IDQA 2B4EA 2Q5BA 3RFHA 4A67A 4N4YB 4J79A 4EWRA 4E5ZB 1L9OA 4YSOA 2H47A 1ZPUA 4O45A 4FHLA 1J9SA 2IH9A 1KV7A 3QJRB 2P80A 4DP2X 2ZOOA 2OJYA 2GC7A 4ZOXA 4A11A 3NJNA 2IUQA 4HZ1A 5EALA 5FA5B 2Z2OA 1IUZA 2GHZA 2VSMB 5EMJB 1RKRA 3CVBA 3NJHA 2CUAA 3IJ0A 3HFQA 3UAEA 2EINB 1NICA 2FNWA 1ZV2A 3K26A 4A08A 1JVLA 3V9CA 2I0RA 3T9WA 1JZGA 1NPNA 3CDZB 4KFMB 2BP0A 3K27A 5FLXg 2XL2A 3PXWD 3NJLA 1TYQC 4J84A 3HEIB 4GP8B 3T6ZA 3EI4B 2BHFA 3EG6A 1AIZA 1XIPA 1JZEA 2XXFA 3OQRA 2VN3A 5H17A 1OCZB 4ERZA 4GP4B 3IE9A 1BQ5A 1F56A 1NIEA 2HX7A 5B1KA 4M3HA 2P9LC 1KCWA 2CO0A 1TU2A 4X60B 1SF5A 2E86A 3F3GA 2QT6A 5E9NA 3PSLA 1KDIA 3PAZA 1A0RB 5THAA 4DP5X 5I6PA 2J55A 4KO7A 2BCJB 2GC4C 1NPJA 2Q9OA 3ULEC 2BWDA 5AZUA 2P9PC 4HALA 3MKQA 1U4CA 1BAWA 1A8ZA 1B3IA 3PCYA 5SXMA 5FKTA 4YSAA 5HQGA 2XV3A 4DP6X 4O3TB 4PSXB 1QNIA 2ZXWB 1PNCA 4CI3A 3WNJA 1OF0A 3VA6A 3PAUA 4A66A 2J55H 5IT9g 2XV0A 2IDSA 3AG1B 2OV0A 3OMNB 2AANA 4GYBA 4YVNA 4BDVA 1B9XA 3AL9A 2QPDB 4ES0A 1GSKA 2GSMB 2Q7QA 3C9CA 3EI4A 1M56B 4E9XA 5D4JA 1GOTB 3OW8A 2HESX 3AW5A 1SDDB 2R7EB 4YSEA 5I5IA 3ZBMA 1GP2B 4QL1A 4E54B 2QDWA 1XB8A 1R1CA 4PBZA 5AJAA 5I26A 2AZAA 4ENZA 1IC0A 3EH5B 3T71A 4J8GA 1BXAA 1L9TA 1SFDA 3EH4B 6PAZA 3C5MA 4DP0X 5I5MA 4YSQA 3UABA 3ZIYA 5IY5B 1JMXB 2Z2NA 2UX7A 2VW6A 3EI3B 1BQKA 4A2HA 4GGCA 1MZYA 4G7QB 3JPXA
chains in the Genus database with same CATH superfamily
5T1KB 1QSFE 3I8CA 3V6OE 4X8XA 2KT6A 2GSIB 3ZX1A 4C59B 1ADQA 2LABA 4QXUH 4XWGL 4GBXB 3BPNC 2X6MA 4GUPA 3RGBA 3UTTE 5K33A 4M1CD 2AITA 5L2KA 4HCRL 2X44D 5I82A 2HJKB 3L9RB 5EU3B 5C0BA 3ZXAC 1VF5C 4NO3B 3U83A 1UENA 4MSWA 1E4JA 4AQ1B 4OCRH 4Q0XH 3NQKA 3NCXA 2XZAL 4TNVF 1QFSA 3EGXA 3QUGA 1QSEB 5AOKA 2W91A 4ALAL 4J3OG 1GXRA 5EUOE 4Y16A 2JJUA 5JMRA 1W91A 3EFDL 2KS0A 5MEQB 1WWCA 4CDHA 3V7AG 2EIEA 6CGTA 4FA1D 2B5MA 3TBVB 1KOAA 2MHAB 4M7LT 4NLHA 2WVTA 1JP5A 3H56A 3VE0A 2FX9L 5B7EA 1NCDL 3QWOA 4OFYD 2VLJE 4AEFA 4LHJB 3CSFA 4APXB 1D9KC 1LHZA 2V9UA 2EDXA 3UO1L 3IRCA 1SJHA 3GNML 1YVLA 1MW2A 2GABA 4FTVD 2CK2A 1HQRA 3NZHL 1FZJA 1FDLL 2X4TA 4ZTEA 2WXOA 4ZMAT 1LP9E 5L8JB 4LNRB 3SO3C 2HG5B 3H85A 4JD2C 2C4FT 3G5VB 25C8L 2AEPH 4BHUI 3HS8A 3SJVD 1DLFL 1CG9B 1XX9C 1S46A 4CSTA 3QCUH 3P0YH 1INQB 2FO8A 2WXQA 1P9MA 5I1KH 4G6FB 3HUJF 1FUNA 1KTLA 4XPFL 1JZ7A 1NGYA 4PJHE 1XCQA 3AGVA 2VIRA 4JUTA 2WBJB 2X7LB 3GPSA 4OCXH 5AOLA 4TVSa 5AMSA 1FYHB 2PXYD 4LHQB 1WBYA 3RVUD 3SYQA 2V2TB 3MJWA 1I31A 4LVOB 3QZWG 2ICWB 3AJ7A 4O2EB 1ZLWH 4XPAH 1Q1PA 1VERA 5I16A 3Q9PA 1NCIA 3IDGA 1YNTB 3L13A 2WQSA 2M8XA 5F7EH 2HFGH 2KQNA 2WZ0A 1ZLSH 3HAEB 1CI5A 4MQXC 5E8DL 2WXNA 4XN8A 4X6DE 3F05A 3LVEA 5F9OL 5DHEA 2YMXL 1L6PA 3GSXA 4MGXA 3RDJA 3NA9H 3IUNA 1PAMA 1YN7B 1VPOH 2EJ1A 4YUEH 4AITA 3N3EA 5IHZB 1QUPA 4E5ZA 2LLNA 2CG9X 5GJTL 3D85B 3MN8A 1OY3B 3VI3F 3TASA 5CFAA 3SPGA 1E4KA 2MCMA 2NUPA 2WD0A 1MVYA 5LHDA 3DSFL 2QEJA 1OAZL 1I7ZA 1REIA 1AJ7L 3BO8A 1E8XA 3TBBA 1GGCL 4E9QA 1BQSA 1AQDB 3ARFC 2HKHH 1DSWA 1MIMH 3CFTA 1EPFA 1GGTA 3FONA 5EB9A 5LBSA 1AI1L 3ZDXA 4L5FH 3LNFA 4P23D 1C16B 4L8DB 1SM3L 1U42A 1NUFA 1MUJA 2OMUA 4L05A 4F92B 2R1XA 2YB8B 1NSNH 3QIBB 4PJDB 4NS0A 2IALB 3RTQB 3ZZSA 3B9KC 4IMLB 2OULB 2BVOA 4YLCA 1KGXA 3DPBB 4MZ3A 3F65A 4O02L 4U1NB 3RI5K 5CGBA 4M3JA 5DVNA 1T83A 1W8NA 4G9FB 2NY1B 1VFMA 2WQXA 4W81A 1T5XB 3BVVA 4M6MH 5DRZA 4PW3A 5IQMA 5IR1A 3UYPB 3VXME 3NK3A 4N0FA 4MDRA 1JWMA 3V0GA 4Z7QB 3FQRB 2CPUA 4GAAA 2YD8A 1YEGL 3A6BL 4OUOA 5SWSD 1JZIA 4XMLH 1G5GA 3TIDA 5DRNB 5BS0A 4L37A 2BVTA 1J8KA 5I9QB 1PZDA 4JBSA 3NCJL 4G6ML 4LRIC 4QF1B 5C09E 4UZGA 4KK8D 4D8PA 2VR7A 4R7XA 4X6EA 3HFML 3QEQE 5C0IA 3ARGA 4PGDA 3QPXL 5AFU3 2O5NA 2OMVB 1SQ9A 3F7VB 3JWDL 3N1FC 2DMCA 1UACH 2E6PA 2CO4A 1LNUB 4RZCA 3BVXA 3ZJAA 2QTEA 4YBQD 2VDML 1BXUA 5KVEE 1PGRB 2EAEA 4K7PY 4LEOA 4HPYL 2E9GA 1FNEA 5LGYA 5FEBA 3NVXA 1H9DA 2XICA 1HXMB 2XDHA 3U79A 5BJTB 1EZVY 3UZVA 5E8OB 3BE1L 4L1HA 3VH8G 4TVPE 2A6JB 3KPOA 1UM4L 1DZBA 3MV7A 1OM9A 2Y7LA 1F6FB 3CLEH 1B2YA 3FUJA 1AZCA 3PPEA 5C0JA 2YD9A 2ZX9A 3EYOB 3P69A 4J12A 4NDMB 1OSZB 1S3RA 1E8WA 1DVSA 1B2WL 3PPSA 2QSTA 5DK3A 4Y5VC 4ZBJA 1ED3B 3O0LA 5TJWK 1U8PB 1PU0A 3O2DL 4UTBL 1E9PB 3NSCA 2EVIA 4NQUA 2PM9B 2BVEA 5FW7A 2F8XC 5IROD 3NFSH 1OGSA 2FBJL 5AWNH 4PJAA 5HGDB 1R5WB 5LLIC 1ACZA 2BVQB 4QRUB 4L29B 3ZYIA 4JRXA 1NLDH 1CFMA 4NHUA 3RPKA 1SUJA 4JDZA 1HHHA 4Z95L 2WSDA 4Z7NF 1PTZA 3IFNL 4B95C 4A2LA 4FNSA 1QO3B 1XH2A 1ZVSB 2J5LC 4WO4D 1S4UX 3ZY7A 1MH5A 2A77L 3MJ7B 3IEAA 1AHWA 5IW6A 4BK8A 1BVKA 1F8TH 1CXEA 3QDJA 1PZBA 3V6ZB 32C2A 2ZYSA 5F7AA 1HHJA 2LT9A 2CRMA 4K3JH 3BVDB 2WXFA 2FJUB 4QRRA 3N0AA 1MCKA 1IGML 4RMSA 1XF2A 1OHZA 1CFSB 3CSGA 1BQLH 1DVQA 3HE6C 5E0FA 2EO7A 5EORL 5IF0B 3U7WH 3C5SA 5EOCJ 4Y9GA 3Q5YA 3V9EA 1ITCA 2XI9A 4JLRA 3B8SA 4G42B 4BK5C 1BFVL 2APVA 2RD0A 2M2DA 1CL7H 1CTNA 1A25A 3PXHA 3CVHH 4L4VE 5D1XB 2AGJH 1YHPA 5KBKA 3BFWA 3O11B 4OJEH 4CJ0A 2FX7L 3UG3A 3QUKA 4IBQA 3H9HB 4K5MA 4X2UA 4ZNEE 1E2WA 5CWSB 1RUMH 2AJXH 4IDJH 2CPCA 1T1XB 3HCVA 4I3GA 3OKDB 5IIEA 1P7KB 4JFZL 2XBZA 1FPTH 3D4GA 3JYCA 3KPRD 3REWA 2K6ZA 3KLAB 1XGTB 3FO1B 5CLTA 4Z1PA 3ZMRA 4ZQKB 2RBLA 2E8ZA 5JYMA 5AAWC 4YE4H 1M9SA 4FA5D 2VQ1B 3JV5A 5TH2A 1B6DA 3EGSB 1JPSH 4ZXBD 4QXVA 4Z3JA 4L8CB 4BZYA 4KX8A 2R39A 3G04B 2XN1A 3EYVB 4NB7A 4NZDA 4AJYV 3BJ91 4P46B 4F2MB 1KBWA 4O58L 2O5XH 3W1ZA 3I7PA 1BVZA 4JFFD 1I8IA 4QXGL 4GT0A 5IQ9A 5I0YA 3B2UC 1PKQB 3C99A 3SWSD 5AYUH 3L5XL 3FPXA 3O3DA 4PJ9A 4YDLB 3P4NB 5IOKA 1AZUA 1CD1A 1QFUH 3ML9A 5JOFB 4OV5B 3OJDB 2O5ZL 1J05B 3IJ7A 3IJEB 4FWWA 3F5WB 3QFJB 2ODHA 3VXQA 2NLJA 4D9QE 4OZIF 2JFCA 1KENH 1Z9LA 4MXWH 2HPTA 2I9TB 2QQNL 4X4MA 2PWEA 3PJLA 1W80A 3SDDC 4JHNA 1ZLUK 4FEIA 1N12A 2YD7A 3JTBA 4DZBA 1WZ1H 4LPVA 1TSHA 4LDOB 2LHAA 1DJWA 2Z1PA 1T3FB 1OE3A 2Z91B 4GKZB 3UTSD 4HS8H 5D5ME 1Z5YD 4QJ3B 4B53A 4E5XA 1I7UB 1IFRA 4ZTOL 1EJ8A 1AGFA 4FERA 4D0BB 5CLWA 1FZKB 3EOBA 4M5SA 4KKZA 1U41A 1KIUA 4GINA 2EYTA 3RZCC 5C7XH 4WI5A 3FT3B 2MRYA 2EIZA 3G6DL 3KPSE 1U8OA 1AKJD 3HLKA 2RB8A 1KUMA 5CUSL 3VRIB 4L3GD 1CDBA 2CHDA 3VTAA 1BXXA 1ZT4B 4I18C 5EN3A 5FECA 3SEPA 5I75B 5KVFH 5J3HD 4FXKC 5E8NA 2ZWYA 4TSAH 2XVKA 5L88L 1QRNB 3HG1B 2H9PA 4X5WB 4YEEA 2WV3A 1G9NC 2GK0A 2ZYHA 2WKLA 4AIEA 3GM0A 3T6XA 1SVBA 3DUSB 2J6WA 3R8QA 5L9DL 1AR1B 5I18H 1H2ZA 1NL0L 3FO0L 2ARJQ 3PQYD 3K5SA 3W9DB 3L9EA 3LZQA 1RZ8A 1JYNA 4JO8A 15C8L 4W6WB 1E2VA 4OLUL 2VLRD 4LSDA 4X5XA 4XH2A 5ITBL 3BAEL 1ERNA 4Q6YA 3RJQB 4LCUB 2H47A 2AJZA 1J9SA 3W38A 3IGFA 2Q8AH 1A3QA 4PJEA 2GC7A 4R4FH 2ZUQB 3ECBA 4X8JA 1J48A 4B97A 4B5EA 2Z2OA 2BOLA 1O9ZA 4LLWA 5F7UA 4H8WL 2IBBA 1LO3H 1QBML 3QUYB 4I3SL 4MASA 4Y16C 1J8RA 3EJPA 3LB6C 3WNPA 5C0GB 2F58L 1U8IB 2I0RA 4K2UL 2PWHA 1QZNA 2N3JA 3TA3D 4DEWA 2UUDK 2WSPA 1I7RB 3OC8A 1OGTB 4JN1L 1DEEA 3D5OF 5GGUA 3V52H 2NNCA 4PCSA 3IE9A 1BQ5A 1JK9B 3KGTA 3OLGA 1SF5A 2GG1A 2EDRA 1CIUA 1KDIA 3NFPB 3W0WA 5THAA 5AOZA 4PU2A 3QFDA 4WHTA 3RFZA 1FL6A 2GTZA 1HZHH 3OPUA 4J3OF 2BWDA 2CLVB 1ZRUA 3HZMB 2CSPA 3O45B 5DLMH 4ZFGL 2Y7QA 4BH8B 2XXMB 2FL5B 3HR6A 3UX9B 2F7IA 4CADB 2WTRB 3HI5H 4FFWD 5E6RB 1T89A 4PJIE 5JHDE 4R0LA 4ZMTA 2R0WH 1VZGA 3BUQA 4RAUB 4AZ8B 1YNKH 2EADA 1G4MA 3MV9B 1M56B 2KLSA 1VJSA 4G3YH 1QFWM 4R26H 3TEUA 3GS4A 1P9MC 4KV5E 1F0LA 1ZKAA 4E54B 3MI6A 6FABL 4Z77B 3SE9H 4LASL 3T71A 5H35B 4J8GA 1RIHH 1BXAA 2Y6SD 5DS1A 5D7LA 3EI3B 3EG9A 4XCNB 3MODH 2AJYH 2E46A 3B1UA 4NFBA 5DHVB 1GOGA 2A6KB 3BGFC 4HDJA 4Q9RL 4MA3B 2ICEB 3T0WA 3LNGA 4M7KL 3H9ZA 3IU3A 4XCYA 3AG4B 4FI6A 1ZAGA 3INOA 3VD4A 3T3PA 4KJPD 2CR6A 1VLXA 3GFCA 2BH0A 2F19H 1NMCB 2DM4A 4HWBA 1ASQA 4JM2D 5EMMB 4UUJB 3BSZA 5LWYL 4N2FA 4Y9EA 2D03L 2VAJA 5C9KA 5GZOD 3MO1A 1RHFA 2JTYA 3D39E 1N68A 5F9WB 4HKXA 3TBTB 1E4KC 1EVTC 4YQXH 4NJ9H 3NDZE 4X9YA 1FFTB 1SYSA 4U7KA 1ASPA 3TX4A 5EZIL 4NN6C 3HBZA 1OL0A 4FFZH 4OM1H 4CZYA 1LLAA 3ARED 1CS6A 2EH7L 3MBWB 3O9WA 4NAQA 1MFEL 5CN3A 1IGTA 4WUUA 1PJ9A 1IRAY 1JUFB 2QGDA 4OCLC 2B16A 3D08A 3MTRA 4IJ3C 1KB9K 5JIKA 3L3IB 1FNGB 1R46A 1QBAA 2P80D 1YA5A 3BH4A 3DETC 3DURB 2D2OA 2XTJC 3EYQD 3P54A 4IKKA 4WK4B 3FHQA 3QJXA 1JZ6A 3DV4A 1KCRH 5I76B 4PWFA 4G7SB 3V0HA 2O9KA 1GY1A 4N8VB 1JNJA 4JZNA 4GQBB 5E00A 3DVNB 2EC9U 3HKFA 4KXDA 4XZUA 3ARWA 2QVIA 3LKSB 4GSRA 4OSUL 1T83C 4DUXA 2OX5A 3ABLB 3GBNL 2XNAB 1UOLA 1ECZA 2BHUA 3QIUD 4TTDD 5IKCA 1LL1A 2LVEA 5DVKA 1UADC 2Y1AA 3CZGA 4G56B 3UC0H 3U1QA 2OI9B 3ORVD 3FSWA 1S5IH 3QFGA 5JXEA 4AQ8A 3ASNB 1VZHA 4I1PA 3GHPA 3LXUX 1MJ8L 4DOHE 4IK6A 4FL4B 1TO5A 2J88L 3B34A 1JWUB 4H5SB 1XH3B 5TGBB 3B6SA 2H9GB 4DO4A 4ZOVA 3QNXB 1T0MB 2EDJA 1PEVA 1S9XB 5T5NG 4KZEH 2XKUA 2EE9A 3GJEA 3WS6A 5GGVL 1E50A 3ARGC 5A2BA 1LEKA 1H3GA 2HJFB 1QFHA 3ZE2B 4YMPA 1E9OA 3EJYD 1B88A 1D7DA 1F58H 2BP8B 4UZSA 5JPMB 1NPUA 2CHWA 2UY6B 4HKZB 4PRDB 5FM4A 3OGCA 2C3XA 4HIIA 5I1HH 3IXAA 1QFWL 1TIUA 2BC4B 2K7PA 3WFBL 3CZLA 4PWJA 2FT8A 3W5MA 4N1CA 4DPCX 4L2LA 3C75H 4AH2B 3OM3B 4ZQTA 1JF1B 3C6EA 3LRSB 1KYAA 1H3PL 1V54B 4ODHL 4XMUA 4WFED 5F0JB 1LO0L 3U6RB 2UZPA 3VFUB 3BGMA 4KKBC 5DVPA 3BYTA 1IIIA 1HILA 4JN2A 1XB3A 5HDBF 1AP2A 4EI5D 3ETTA 1KIPB 3I74A 2K45A 2WXPA 4JFPB 3GKWL 1D5ZB 3L4UA 3QUHA 4UB0L 1RK1B 4CW1B 3QQ4A 5I1EL 4F7KA 3CNKA 4WGWB 3HI6L 3S5YA 3L1GA 2MWCA 1UM5L 3FUNA 5IJBC 2X1OA 4JJ5B 3AWFA 4B0MM 2IXQA 3WTUA 4J7RA 2PM7B 3PWLA 1AHWC 5FHBH 2O4EA 1A0QH 3QUXD 1PAZA 5HGBA 3OKYA 1KCBA 4FXTA 4QKTA 2WLIB 5FKQA 1E9QA 3Q6FB 4ZMYA 1P7QB 3QUZD 4Y9FA 2NX5D 1QOKA 4XC3L 2Q7NA 2J4WH 4QRQB 3Q8EA 1AVAA 4N1HB 4FI7A 1H3XA 3RN1D 3GI9L 4PS3A 4FLRA 4PTUA 5HHOD 1M9WA 4NQQA 4Z8FH 3HJ0A 1MW1A 1OE2A 4Z3TA 1NEZA 1O6FA 1R5IB 2AQ5A 3DBXA 2Y5EA 1IBDA 1EDQA 2R23B 3QJSB 3MFFA 1B9ZA 1GS6X 3L7FA 1X5AA 2W80C 3MZGB 3HZKB 3R1GL 4BWWA 4XCEA 3TO4A 3VXTA 1SMOA 4PQXA 3WEMA 5I1LB 1AXTH 1J5OL 2ID5A 3D0VB 5JNYA 4J2XA 1YNLH 3SGEI 1O6SB 1FN4A 1KXQA 2DWEB 3H9SA 3ZYZA 2PTTA 2FWOB 4KXAA 5I8EA 1NDTA 4XHJC 4UDTA 4NQTA 2F54B 1Y6MR 1HJCA 1X7QA 2ENJA 1AS8A 3MHZA 4JFVA 1OGAA 4NM8H 4GIOA 3G9VA 3O2VH 2WXMA 3F12B 2CJ3A 3WFEH 4S1SH 3IFOA 1RUAH 1AHKA 5DRWB 1MQKL 4JHAH 4F7MA 3Q05A 1H6UA 4KK9C 5KVDH 4YBLC 1IKOP 4LSPH 3BEWB 5T3ZD 3H6JA 4LO9A 4A11B 2C7UA 1J1XL 4R8WH 4WI6A 4YDJB 5GPRA 1LO4H 1K5WA 4GUCA 1J86A 3EYSH 5B1CA 1VADA 1FVEB 3TFKD 1DUZA 4MYWB 2QMJA 1RXLA 4Y89A 4UU9A 2HLEB 3Q6GH 1NJ9A 4A04A 4AIZA 2X2YA 2P46B 2AQ3A 4Y4FC 2DDQH 5EMKB 1IGYB 1Q0YL 3RIFF 2AABH 2FWSA 2FLRT 2QSCH 3LD8B 5CJOH 3ZQWA 4BSJA 2YNNA 4NC2B 1FO0B 2NNAA 4RBPK 3CH1B 1QA9B 2XWTA 1DDHB 2JKNA 1VCBC 1HNFA 2E56A 3SKUD 1WBZA 3ZO9A 5C0FB 1HXYA 3NJVA 4MJ5B 3BAJA 5DYOA 1U8QA 2M1KA 3UJTH 4F93B 2PO6B 2NY7L 2IFFL 3T77B 1OAXH 2FSEA 2VSCA 4N0UA 4ZX6A 4MJJA 1QSFB 2NY6D 4KI5F 5FFLA 1E5CA 4E41B 3KPPB 4J3VA 5KYXA 4WY7H 5JUEH 3PIQB 1RZPA 3ZDYF 4N3UA 3PS6A 3RFGA 3UTTB 3MRJB 1WFIA 4Y5YC 3UTQB 1AS6A 3WYRA 5B3NA 2J6EA 2V3DA 5JIIA 1D7CA 1ICTA 2CK0H 1IQDB 3II2A 3MRNA 1I9JL 4PV8A 1CTOA 2X38A 3ZHKA 3LN9A 5EZLA 2QR5A 1FGVH 1RZFH 5DUPL 1EHLL 1KELH 1HEHC 1UT9A 4N0YH 5EUOB 1BOGB 4AOWA 1J8SA 1FJ1B 1RU9L 3QBTB 4HOMA 5I5JA 2I60L 1ZHNB 1BVLB 4RSYA 3IPBA 4OFDA 9PCYA 4QO1A 4G8GB 4YVDA 3SYPA 1PZ5B 1N5AB 1I7TA 4BFEA 3NQIA 3HRZA 4U1KA 2VLJB 1ZHKA 2BS8A 1UCBH 2H47C 1SY6A 1J1OL 1XVSA 4EIGB 3JV4B 2WB7A 3MRLA 2GC7C 5E1HB 4LSUH 1UOQA 2Z1KA 2BDNL 5EBMB 2HKMA 2HRHA 3DK0A 1LP9B 2YC1B 2ZD0A 2WINB 4K9EL 1HNGA 2LV4A 1RZJL 5C0AD 4IJTA 4MZIA 3DO7A 1HAWA 2PCYA 3NJJA 5E9DA 2VZ3A 4IKNA 2XG5B 2Q8BL 4X7EC 4WDIB 5C8JA 4IHBA 4KJWC 4LHUA 4RZKA 2NQ3A 3PREA 3VXUE 3L3HB 3VFOA 3PAYA 3NGBB 4HF5L 5IB5B 3SDYL 4TVUA 1ZSDB 4CC0A 4PJHB 4IBSA 3O6FD 4BQCA 5ADPL 4CN4A 3RL2A 1IKNA 4K94H 4J81A 5LUMA 4IBTA 1QHOA 1IC5L 4CY2A 1Z2KA 4XAKD 4B9IA 5I71B 3TYFB 4NSKA 4RGOH 4JPWH 2FYYA 4ZPVA 5BQ7A 3IIYA 1T89C 4R0LC 4R97B 3U2SA 5E4EB 4J6RH 5IBUB 4R2GD 3A23A 1G6VK 1AGCB 4JX0A 4X6DB 5JO5B 3F3PA 4D3CL 3TO2B 1JPFB 4MZ2A 2VDNH 1RJZA 3B2VL 5GSAA 5E7FA 5C0RH 2I85A 3HE7A 5MEPB 3VFTB 3DGGB 2Y06L 3UBXG 4OF8A 3WEAA 2AH0A 3TPUA 2G60L 5HYSG 4ZYKB 1BG9A 1IBFA 2WAQA 3IFPA 3ZDYA 1LO5A 1Q9KB 1R75A 4NNPL 5F9DC 1YEEH 1LWHA 4J3WA 5D1ZB 1JSYA 1QFMA 4JFEB 4QKXB 3VRJB 5K69A 3SDCB 2PM6B 3HB3D 4O02A 2BSRA 4U31A 2XWJA 2OSXA 1Q47A 4ZO8A 1KPUA 5T33H 4H2AA 1ZVHA 1G9EA 4M3KB 2FX8H 1AD0B 4KVCH 1GJUA 3FRUA 1HE8A 2MPAL 5FA3B 5EOQH 2D31A 3EDKA 4TNVK 5DJDA 3KCPA 3QWRA 2XWBA 1JGEB 3RU8H 3WKMH 1NUDA 2VERA 5LAPA 2OYLA 1FVDA 2OXHB 3RAJH 3LS5H 1SMAA 2VXVH 3MR9B 4FNQA 4GQ9L 5KG9B 5BO0D 5IJKA 2BY3A 4AW4A 3OHMB 3BUYB 3MNZB 4HUWA 4PJGA 2BP0A 4MHHG 5EBLB 5T5FL 4HU8A 3FAWA 1MJUL 3VXMB 3JTSB 4JFHD 3O9WC 1AIZA 3C9NB 4Y19B 5D7IA 2F53B 3OQRA 5EOTB 3L1FA 4R5XA 4QOKD 3LPOA 3V0AC 1NIEA 1CFQB 1PG7L 4GFXA 4QRPE 2WO4A 1BG1A 3F3GA 1BD2E 1BBJA 3EJZD 4GW1A 2Z8VC 1U95B 1RZ7H 3OJVC 4FNRA 4ZD3H 1UA6L 2BNRD 4HALA 3MV8D 3PCYA 1XBDA 4QHMB 3AS3A 4NHCH 5EDXA 4LBAA 4J3UA 1VZ3A 3S36L 5DSCB 1U8MA 2DYPA 5DUML 4ERSL 1OAQL 1Q9OA 5GRUL 4TL5A 5KSUA 4TSCH 1SEBB 3V0VB 3OW8A 3K6FA 2VR6A 1GSMA 1EFQA 1BPLB 1SJVA 4JCLA 5JXEC 4JFXB 1YPZE 3WN5A 4AQ8C 2HFEB 3O2DA 4LSQH 4UTBA 4OAWA 2P26A 4I4WA 1KN4H 3EDDA 4F8LA 2DQ6A 2W92A 4P5KA 5JPNA 1VFOA 2ZF8A 1WT5C 4EE2A 1N8ZB 1A6VH 3NDYE 3ZE1A 1GTFA 4H0HB 1JFHA 2EZ0C 4J8RA 5IHLB 5HSFA 3WS6C 2YN3A 2PPCA 4KPHH 1WA0X 4XNMB 5J06A 5CP3H 1TTUA 5F7LB 4XMPH 3I75B 4N2HA 5AENA 2Y3NA 1W72H 2RR3A 3MKGA 3O6LH 2X53A 4FQHB 5AZEH 5F7MC 2FH6A 4HOZA 4RAVA 5J6SA 4LF3A 4QRBA 2WYZA 2B9AA 4M9PA 4FNTA 1A7RL 1CICB 2JTDA 2YFNA 3PJSB 2QQKL 2AXJA 1BCIA 1WTLA 3QHFL 3PXSD 5SWZD 1HCZA 3JZ7A 3OD3A 1E4WH 2WKGA 2HSIA 3AQXA 4JRYD 4YHPB 3EZ8A 3AFLA 2B59B 3FYIB 1MCFA 2CNYA 4NM4H 3IN2A 4ZW3A 5HYJD 2XN9D 1BA9A 4I9WD 5F7DA 4NO2B 2AMUA 5A7EA 4L8SA 4D0DA 3IVKA 1RURH 2FD6H 2VMEA 3X11A 4QHNB 4X4KA 5EC1A 1LK3H 2O30A 2OS7A 2XV2A 4KOBA 3S5ZA 3ALWA 3PHOA 4E9WA 3O4GA 2BXYA 3VMPA 1CF8L 1ZY9A 5IG7A 5KS9F 2EDHA 5F9JB 5F7WC 4AZUA 5AVZB 4C56B 2XE4A 2Y4SA 2ATKA 3FN0L 4ZOEA 2VC2L 4KK6C 3IDJB 4PJ5B 4WK2A 2A9AA 3BWSA 4F5CE 1A8JH 3H3PL 4TNGA 3WI9A 5CEZE 1K9TA 3RVTC 3TBYA 2HU5A 3ILPB 2EVJA 5H4YA 5EF3A 4NAJA 2W65A 1HC1A 4U4BA 3V4LA 5DJYB 3P3UA 5HDWA 4JO2H 4Y1AA 3D05A 1T6WA 1E8YA 2P9UC 5AW1B 3FAXA 2W0LA 1OARH 5DF0A 3CIQA 1Q0XH 4V1DE 4G7YL 1SBSH 3FULA 3G7TA 4NKMA 4ZDHB 2CE6A 3ULUF 1XGQB 5K5YA 4GG6F 5TK4A 2BINA 4W9GC 5DJ2A 2BSSA 2VH5L 4DGUA 3V0WL 4XOCA 4XNBA 1CBVH 5TEEA 1H8SA 1OT4A 4QNPE 4L9OA 1TR7A 3KNBB 3R7RA 2YXVA 1HN1A 5I0ZA 2DQCH 4ZW5A 2A6IA 3RKPA 1E5YA 4AV4A 4HK0B 3WN6A 1IJNA 5IFAL 5D55A 3TO4C 5KVEL 2V2WB 3Q1EA 3R06B 4ZO7A 3OV6A 2H45A 2EXSA 4FABH 4YHZL 4YHLL 1U2VC 2ZAIA 4OJFL 5ESVA 5F8RC 3RDTD 3HZVB 2NDGA 4APQD 4OF5A 5JDSB 3EDEA 4X6CA 4WFFD 5D96C 2W9EL 3FFDA 4DQAA 5EAPA 3OSKA 5FQDA 3GO1H 1KB5A 2B2XL 2NXYC 4TVPL 3MPCA 2YPLE 2DJSA 1IC7L 1JNNL 1TQBB 4MTMA 5T3ZH 2J25A 2H0PA 2JCCE 2ZKHL 1T04B 4O4YL 4F8PA 2W9LA 4OLYH 1XKSA 2BRQA 5IQLA 3U30B 4L3EE 3DV6A 4L0PB 2KQMA 4M5YL 2B4CC 3RWHA 1ML0A 2FAUA 4DPRA 3FCUB 5D7JC 5HHME 3HPJA 4N14A 5K39A 1SN2A 1TZHB 4PS8A 3AL8B 1BX2A 4AQAB 5GRJL 4U7AA 4X6BA 3V5DA 3RGVD 1YEFH 5ILTH 4LOFA 5CSBA 4L1MA 1QLFA 3L3GA 4JHPC 2W9DH 1B4JH 3NZ8B 4PGEB 5C86A 4AYFB 4LLVB 4N8CL 3GLZA 4OM0H 3SDXA 3EZJB 1QTYT 2IWGA 3Q3GB 3VQMA 4PJ7E 2BPBA 4L9DA 5DI8A 4AJVA 1IQWL 1QI3A 1OM3L 4BQBA 5CD3B 2A74B 3MLPA 3GPEA 3T0EB 3OKKB 4HETA 3HMWH 1BPVA 3WJLA 5AUMA 5DURB 3B5GA 2R0KH 4CRPA 1ZGLB 5I73C 2PTVA 3FQUA 2TRHA 2R7EA 2SEBB 2JMRA 4UF7C 5DMGC 1E27B 1LGVA 2WHVA 3AXIA 3MRHB 4LSRH 4LMQI 3QW9A 2VDQB 4YO0A 2OZ4L 3M45A 4LFHD 5GS3A 1ID2A 4FB1D 1I3RA 3GMPB 5FKRA 5EG6C 4R7DA 2XPGA 4ENEC 4ALAC 1BQHB 2AFNA 1W0WB 3CN2A 2X4NB 4FKKA 2O6EA 4RDQG 5GGSY 1Z7JA 2UX6A 1HZKA 1NCCH 2X3AA 1QNZH 3D2UA 4OH2A 5E99L 1S7QA 3POHA 4M8VA 3LV3B 4OLXH 3U0WH 3MOBH 3NN8A 4GG6A 4RE6A 2YD0A 4PYHA 2YA1A 2AK4E 3FZUD 5AKVA 4PYGA 4AMWA 5DMJB 1MCOL 2UZIL 1FYTB 5KSAD 1ACCA 2N7AA 2NZIA 3C60A 1TT6A 1AHMA 3LN5B 4TQ8A 5DZOA 1A7PL 2QPEB 1DN0B 2G0LA 1N6QL 1OF2B 2YPVH 4PBWD 4Q14A 3FCTB 1HU8A 3TJEL 1T4KB 4A6YH 4NPYB 5DO2D 4HUMB 3V4VL 2HVBA 4FG6D 1KLUB 1I8KB 4LLQA 4HS6B 2J56A 2QR0A 1WA1X 2A9MH 1CT8B 1WC7B 4JQXA 3HRZC 1MG3A 1TPXB 2FBOJ 3ILQC 2FQEA 2VT0A 5C07A 3MC0A 2AK1H 4KKLC 4LOVA 4ELMA 5KYUA 4G6FD 5HYQA 5LCVH 3IE4A 3FT4A 4P59L 5F6IC 4F58H 3EU7A 3MRBB 2X9ZA 2CXGA 1MRCL 1YMME 3KS0H 1D6EB 5DTFB 3ZKMC 4RESB 4Z7VB 5DC0A 4PJIB 1VSCA 2XWZA 1MRDH 2XZCH 4JEGB 1UOVA 4KKCC 1YAZA 2I7OA 1V5JA 5DJZA 4BRJA 5C7ZA 3H7BA 4Z8LA 4JGUA 3QGVA 3IYLW 3IJ1A 2C9PA 1OAKL 4GAFB 1UD8A 1L7IL 1Y7VA 2IAMD 1OTUC 1W15A 2WQRA 2X28A 3VACA 3SPJA 4PHXA 2J57G 2XT1B 4A0BB 3QZOA 3KYOB 1MI5E 4OD2A 3REVA 3K6NA 4GSXA 5GXIA 2HLAA 5KBPA 4Q58C 3D85D 1CURA 1QEWA 5M5SA 1PF3A 2B0SL 3ESVF 4BDVB 1GAFH 3FT9A 4CILA 1NBQA 1EH9A 3FRXA 2DKMA 2G5BA 1LEGB 2KDGA 1JV2B 1YCSA 3MYJA 4FRWA 3VDAA 2X4RA 1UFGA 3UGEA 4E9SA 2PR4L 3KVDD 3VXPA 4YGVB 2EEAA 3OG6B 3GXTA 1SJMA 1X4ZA 4Y4KA 4I3RH 3HE7C 4MX7A 1IBZA 4P5TB 3F04A 1QTSA 2VDRB 4KI5C 4O9HH 5KN5A 5I1IL 2VDQL 2WYIA 3QIBD 2VTFA 1KEGL 1FZMB 3IDYC 4X7FC 5E1AB 3OR6B 4Q6KA 1NCBL 3QDGE 2P5WE 1P69B 4HWEL 5C0CE 5BRZE 5BVPL 1U3HD 3BSHA 5F1NB 3QORB 2IEPA 4NLAA 1SLWA 4WJKB 3UTZB 5CILL 1IBBA 1JERA 1GGIL 1XGPB 2CMRL 4O3UB 2A2QT 3L95B 3P0VH 4JAMA 3BESR 2NY3C 4QAMA 2RACA 3AU1A 5HE3B 1E67A 5GHWH 5IQNA 5F97E 1IM9B 2EC9T 5IVNA 4JHBA 2M26A 3PWUB 2Z4QB 1S7XB 1A64A 5IJKC 3J81g 3AS2A 3CHRA 4D9SA 1UWGH 2VUYA 3B3BA 3HR5B 2XBTA 3PNRB 4LRNH 1EUTA 1DQVA 4BKTC 3MRPA 3MRKB 2OMTA 5CBAB 1PFOA 1E40A 1NLBL 4NUPA 3KPQA 1SJEA 3ZR5A 5EU6E 1NAML 1M7DA 3UPCA 3VYOA 5GGQH 3TZVA 1YDPB 1IGCL 3MSPA 5I1JH 3WY2A 4P2RE 3GRBA 3PDOB 1OP3K 1H3UA 5F7YC 1M2OA 4HGWA 1EDHA 4DGYL 3GSNB 3GZQA 4XP5H 4J0WA 5C0ND 2ADFH 3O3EA 3KMDA 2VDPA 3CLFL 1N0XL 3VWKB 3BZ4A 3QPQC 4LSSL 3QHZH 1PMYA 1EXUA 1MEXL 3I84A 3L3DB 1F45A 3KYNB 3NFNA 1TJXA 2EDNA 1JPST 4GW4B 4P2QD 3CSPA 1CLVA 5MP6H 4CVXB 4JFSA 3VI3B 1KJ2L 1QLRB 5JR1L 5CXBA 1KPRB 4BSVA 5ISZD 4MS8D 3OKOB 2JK5A 3WN5C 2FGWH 3QIWA 5HYFA 1G9ML 3QXAA 2VDLL 3AS1A 3BHBB 3ISYA 3N1QC 5DS8A 3AG2B 3FRPB 3ZT5A 4NUJB 2P48B 5I1DA 2X1WL 2YAEA 4M93C 1V10A 4HJJH 4YS4A 5JPNC 1ZA3A 3GTNA 3VU1A 3P3YA 4R5TA 3H55A 4NZUH 4AG4H 1WWAX 3ZE0A 1IT9H 5JHLL 4CSPA 1BECA 3DROB 5INCB 4OLWH 2UYLB 2A0LD 3QXDA 3RWDB 4DH2A 3W11D 4JW3A 4WKZA 5FYKE 4H20H 3WDJA 1AIFA 2Z31B 5IK3A 3D0AA 1IM3A 3BAYA 3RFHA 2W1NA 1N26A 2R0LH 4YSOA 4X9IA 3Q0HA 4MMYB 2WGNB 3AACA 3KR3L 4EZJA 4TNWK 5BOZG 3KYMA 3AAZA 1AO7A 3C5ZD 3PV7A 1RKRA 1PD0A 1TFPA 1K5NA 3PL6A 2RMNA 3HFQA 1NC4B 4A08A 3ZU8A 5LXGL 4R7NB 4OR1A 4L8SC 4XWGH 1MVUB 5FF6B 1NPNA 3FUEA 1UQSA 4OU3A 5LGJB 5K59F 3BP6B 3UBXA 3CFUA 4HCRH 5BOJA 3C6LB 4Q74A 3NIFA 4JHWL 3DHPA 4I8DA 2YGPA 3G5XB 4AQOA 2NTFB 5DC2A 5H17A 1FH5L 5CGTA 2X2HA 2QSVA 3H0TA 4JM4L 5B1KA 3X13A 1MCQA 1FQ9C 2XZAH 4UM9A 2IUQA 4YHNB 4GUOA 5HDLA 4NKOA 1NFKA 5G5DA 2FCBA 1P2CA 3RVXD 3MJ9L 3OAYH 5C08D 3I3BA 4HBCH 4FA8A 4QXWA 3WTXA 2VMFA 3B7TA 4HAGA 2HU7A 5ICXB 3P4LA 4MNGB 2ITDA 2CR3A 4U0QB 4EI6A 1YEJL 3E3QC 1F4YL 1NBCA 2ZXWB 2VWEC 1DJGA 1NCDH 3PAUA 1G1OA 2OV0A 4HFWA 4WV1B 4ES0A 1NGWB 2BWQA 3LKPA 4AENA 4OY9A 3WAJA 3DMMA 3UO1H 3GNMH 2CJTA 1XR8B 3NZHH 1FDLH 4Y1SA 5DEGA 4NWUL 2QDWA 4JO4L 3DBSA 1OVZA 1LYQA 4GJTB 2P8MB 3QQNA 2MCAA 1RPQA 1D7BA 2BSEA 4N86A 1IL1B 3VI4F 5D2NA 1MHEB 2C1OA 3BEVB 1DLFH 2GJ6A 1RLWA 1MZYA 1YYLL 4G1MB 1X5GA 4MMZB 1F4WH 3SLED 4XTRD 1FCCA 1HIML 1G7QB 3E2HC 5IUSA 2DQJL 4FNUA 2BVPA 4UI9R 1WAAF 2W0FB 3KM2A 4XPFH 1KBPA 2A1WL 3QFJD 4P04A 5J13B 5AVTB 5CYKB 4MJ6B 1EERB 2CO7A 1I9EA 1OEZW 5BMFH 4HUVB 1JGUH 1O6GA 1H8NA 1QFWI 3A3YB 3IDXH 2QMKA 3OMIB 2V2XB 2PW1B 1WIOA 4KAQL 4WO0A 1PQZA 4IRSA 4L8BB 4Q2ZB 4YDIL 1XF5B 1ZLWK 3MUNA 2IANE 4PY7A 2WK2A 2V9QA 3JTTB 4U33A 5I66B 2P28B 1FIEA 3FKUS 1ETZA 4L1QD 4PRIA 1A6TA 2LAGB 3ES6B 3FOMB 4ZMPA 2ESVE 1MWAH 2QLVB 2V6HA 1R3JB 2DQDL 4HP5A 4U7SA 1A21A 2AXFA 1M05A 1P84J 1SXZA 5IMKB 3E9TA 5FO9B 1EZLA 4ISVA 4PRBA 5IGXL 3DSFH 2XKSA 3PWJA 1OAZH 1T1WB 4U6XA 3FMGL 1AJ7H 1C12B 1IC4L 3VVWA 2DQIL 3BH8A 1A6PA 4OCWL 4A2FA 3JAMg 3HG1D 5FCSH 1JGDA 1CGXA 4B9GA 1AI1H 4JSVC 5GRVL 4W4OA 4LCIH 5EU7C 3BPLB 5ETUB 1SM3H 1AR1D 4TUUA 1O0VA 1BMZA 1FFNA 1AMXA 3T2PA 2Z93B 1SOKA 4R83A 1K4DB 3V79C 4RFOL 3WJLC 3QAQA 4URTB 4M4RA 1U8LB 1T21A 5LO7A 4ZFZA 2BOBA 2JKTM 5KYNA 4GSDH 1G94A 2AJSL 2I9LA 3WUWA 5DRXA 1LK2B 5GZND 3PWPD 4MKTA 3RZWA 1MFDL 3GZKA 3B7SA 4BCBA 3UIZA 2XQYG 5HVWA 4DETA 3RY6C 3QUYD 1LE9A 3G5WA 3RLMD 4Z76B 3DX7B 1R3HB 1WIPA 5E1QA 3NJKA 1YEGH 4K3HA 2OMYB 3A6BH 3S96B 3RVVD 1PD1A 3ULUC 4LVHC 2H14A 2IGFL 1UFUA 3KDMA 5CEYA 4EN2A 1H15A 1GZPA 3ZTDC 3V0DA 1J8HA 1F11A 4PAZA 2JB6B 3MMEA 1TJHL 5AKRA 3NSDA 2CIIB 2E3VA 3H53A 2VLKD 3C60C 3K2KA 4OQTA 4RMTA 4EIZC 3JUYA 3GMRA 4W9IC 2C7FA 4RDQF 5KBNC 4MNQE 1AAJA 3ESMA 3JWDH 3GXMA 4N8PA 1CDHA 4PJXB 4F9PA 2WLNA 5EIIA 5EAMA 1R3LB 1RZKL 2HJLA 2NUTB 4H25A 4JVUA 5FK9B 2VDMH 2Z4TA 2UWEA 2X9YA 4WQOA 1AQMA 1W8EA 3T4AA 3VXUB 3EHBB 4HPYH 2YMOA 2IDFA 5IW1B 3S7GA 2VUKA 3S2CA 3U36A 1OOAA 2HYEA 1FGNL 4JQXC 4V2BA 3TZVD 3UMTA 1MG3C 3GFUA 4FFYL 5IFJA 4N90D 1FORL 3BE1H 4OFQA 2PWDA 4PBVC 2K1MA 5SX5H 4YBQC 2WO3B 1RFDH 1UM4H 1ACXA 2R69A 1MY5A 1ANUA 2Z7YA 3D3VB 4PW9A 5D9SA 3T3MF 3D7PA 5FYLL 3VG9B 4IYKA 4MD4B 4X5QA 2PWGA 3HAEH 1WPCA 4OJAA 2QL1A 1AD9B 3KAAA 1B2WH 1NWPA 3N40F 4HPOH 5E4OA 3STLA 3K6IA 3HBQA 4Y2DA 3RFRA 4KRPD 2X40A 4MD0B 3IKCB 3MCKA 1MPAL 2LAAA 4FQJL 3TBSB 3FC8A 4A55A 5IC7A 2FBJH 2YQ3A 1S7WB 2XPZA 3IXTA 5BUPA 1JYXA 3O4IA 5M95B 3DSNA 4QHKI 2OSWA 5EC2B 4Z95H 5MEOB 3KJ4C 4LFHG 3RPIB 1TETH 1Y0LB 3VFWB 5JW3L 1K72A 4OZHA 4PRHD 3IFNH 4WW1A 3T8XA 3LH8A 2OK6A 3GIVA 2R4RL 5J1AB 3ARYA 5C97A 2P8LB 1YJDH 3CDGA 3A5VA 4RMUA 4B7IA 1IKFL 2Z3FA 3CVDA 3MNWB 5LAXB 4ELDA 2Y3AA 3O3UN 4Z0XA 3PDDA 4QEGA 1IGMH 1UTCA 5CBEA 3CZJA 4UIMB 5EORH 1AG6A 4K5PA 1N8OE 4MWFB 3VGDA 4XP9H 5L2KE 4Y4KC 4XNZB 1ZLEA 5C0BE 3L4ZA 1KTJA 3BVNA 3GSRA 3KWWB 1TJGL 2OSLB 4ONFH 3CQQA 4NQCA 4EDWL 4PG2A 4U0RC 1NEXB 5C3IA 2DQFA 2GFBB 4NN7C 1FAIL 3O0RL 1MLBB 2FH8A 4X4XB 4CZXA 1BZ7B 4LB8A 2G3MA 3VFMA 3GSVB 4LIQE 2FX7H 3AH8B 4FZ8H 3I7OA 3RN0D 4FA4D 2Y2YA 3BWUC 4UILH 3FH5A 2VZVA 1A14L 1N64L 2WWMC 4QRPB 3L81A 4OZ4B 3UZEA 4P57A 1BD2B 4P07A 4JFZH 4EN3A 1KIQA 1JZFA 3QQ9C 1OANA 4FD0A 1J5CA 4QXTB 1K3ZA 4WJ5B 1KTDB 1BQUA 1Y18A 3HG5A 4W70A 2BNQA 2OYPA 3WE6B 5MHSD 1R5MA 4GH7B 1S6NA 2QZQA 4U6HA 5FXCH 1G6RA 1F00I 2EABA 3HAEG 4EEEA 4EF3A 3PNWB 4O2FB 2OXGA 4JRLA 3RP1A 3ESOA 3O8XB 3TEXA 2E7BA 1ZS8B 3EADA 3MV11 1ZWIB 3KL0A 1EMTH 2NY5L 3QNFA 1QWNA 2WYHA 3PWVA 5BV7L 1YPZB 5I1GL 2EUZA 1DVZA 4N25A 2CKBB 4M03A 3L5XH 5JQ6H 1GVIA 4S10A 2X4UA 1TF4A 1C8QA 5I23A 1KTCA 1RI8A 2IPUG 1EHNA 1DLHB 4N6QA 4FQQB 4ZX4A 3SE8L 1I4FA 5MI0C 2WZ6A 1FFOB 1YLBB 4WEBH 5K1NA 3BVWA 3KRXB 2QQNH 3SE4A 4S11A 5CMAA 3PGDA 3FXIC 3SHFA 3TV3L 3S8FB 4CC4A 4UQ3B 3BXNA 4OGAC 4YSTA 3KXFA 4H0GA 3QIWC 4NUMA 2NTSP 3D50A 5E94B 4ZT1A 3V0FA 3UG4A 1A1NA 2QADC 3ZHDA 5CR1A 3C87A 2CLRB 4UDUA 1CD8A 5DHMC 5IM7A 3ARBA 1JZJA 2BM3A 4KMTL 4LPCA 4PRPA 3BWAA 3K8LA 3ABMB 4GO9A 1DQKA 5M5VA 2X4PB 4FKHA 3JWNH 4QCIA 1II4E 3V4PL 2IFGA 3G6DH 4N85A 1QW9A 4QI3A 1PD6A 1KWKA 4QT5A 4FJZA 1JXGA 3FB5B 3LCYA 1MCRA 4JFOA 5CUSH 1WCBB 5SX4I 4HG4J 4E68A 1ET5A 5H94A 3ROOB 3CUPB 4ZMWA 5IUCA 1NQBA 3UXFA 3D52A 4HZLB 1SLVA 3ZDXE 5I17B 3OAUL 2ZX5A 1KT2B 2XTJE 2F5BL 3FL7A 4KH2A 4AYID 1KPVA 3W39B 2JQAA 4DIXA 4WW2B 3EYFA 1H5BC 4MA1B 3D07A 4ZAKB 1NL0H 3FO0H 3VWJA 3PL6C 4DP7X 1JS4A 3OJMB 1QABA 2Z8SA 4WHCA 3QHYB 5E2UL 4OLUH 4U1LA 1GG2B 5ITBH 3NPSB 3FS9A 2XVBA 4HIJA 1C5BL 2VZOA 4HH9A 3WKPA 3VFNB 4QAWA 3IETA 1KLFA 4X6FA 3CG8A 1VFBA 5CZXC 2G5UA 4WENB 4XX1G 4QTHA 4P4KA 4RRPM 2Z92B 3EO1A 2B77A 4NN5B 4NZRL 3O4LA 2WUBH 3CHXA 3FNKA 4W9LC 3L48A 1G7HB 3BN9D 2F58H 2HZHA 5BS0E 3QRLA 4K2UH 2X09A 4YHIB 2O1AA 1Y1DA 2BFVH 2X10A 2YGVA 3KS0J 3L5WB 1NCUA 2KC0A 2F54D 3N43F 4AYBA 5CJBA 4DP8X 1U3NA 2PPFA 3C6SA 1WS7A 1MHPL 4HKJB 2VL5B 3CZFB 5DGQA 3KLHD 1S7VB 2XKNA 1Q1JL 5HY9A 5E9AA 3DMMC 2XWDA 5DD0L 3NIGF 2OTWA 4ZFGH 1BMWA 3GXUB 3MRIB 3GQFA 2PYED 2AZUA 4UV7L 4J78A 3B8YA 2ZKXA 4ESGA 2VISA 3DKHA 5FB8B 3V5HB 5HDBB 4OGZA 3S3DB 5DFTA 1M71B 4FP8L 5DJAB 3C8HA 3QNYB 4BKLB 5KSVA 1KF9B 3OKTA 2G4EA 1XF3A 4U4IA 5D8JL 4OJDH 1AE6L 2VXQL 4YHOL 3MV7E 2Y72A 5K1VA 3IM1A 4LXFA 2Q1EA 3EJCA 1NC2B 6FABH 4YGAB 1RUKH 3JWNG 2HPOA 2L0DA 1HSBA 3GSWB 3JT2A 4Y9CA 4LASH 4C8XA 3SQOH 4FHKA 1DQJB 1T0OA 4L3EB 4PJCA 4IU3B 5HJ3A 2H41A 3P4OB 5L2JA 3MRQA 3HPLB 4A67A 2FHCA 3BP7B 4MJHA 4PJFB 4D0CA 1A7QH 2XZQL 3KYAA 4IRSC 1TJMA 2GI7A 1KV7A 1PFCA 4WWKB 2PN5A 4WI0B 4XXCA 1P4IL 1AQKL 4PJAE 1YMHA 4RLDA 5GGTL 1BJ1H 1WO2A 4HZ1A 4M7KH 4E42B 4S2SA 1OKEA 4JRXE 2F74A 4P05A 2JJSA 2MKWA 3UL4A 2HFFB 4R4BA 2OZ4A 3DUUA 5C71A 2DEXX 1QSFD 5AB0A 4PJ7B 2P24A 2YK1H 4G1EA 3J07A 4IRJB 2NYZA 1UG9A 3IGUA 4RSVA 3CVIL 3HEIB 3ZTNL 1JRHL 2D03H 2VITB 4JPKL 2ZSVB 4NENB 1JD7A 4JKWA 3RPBA 3QDJE 4X9FA 3UTTD 4FHBD 1F56A 2NY0C 4JY4A 4BM7A 2X1PA 4M3HA 2MIZA 2KZBA 3ZOAA 4Z23A 1T66C 3UTPE 1S7RB 2Q10A 4QRRE 3U9UA 5GQBA 1CDGA 5EZIH 3WTWA 2BSTB 2Q9OA 4RISL 5AZUA 3CDFA 4FLQA 3U0TB 5CEZL 3V8OA 1EHAA 1MFEH 2I26N 5SXMA 2CDGA 4JKPL 4OGXL 4QHPA 4IBUA 4NJAH 4W4OC 4A66A 2YN5A 4QWWD 3AG1B 2Q87A 3ILEA 4Q97A 4F80A 3V4VA 1MLCA 1XF1A 2X0VA 1J87A 5KANI 1CE6A 2AK4B 3DECA 3BUDA 2OL3B 4XNUH 4YPGB 1MVFA 2VLJD 4RA0C 4KC3B 4TULL 2VZTA 1B4TA 1XB8A 4P8QA 5DD3L 4AYDC 5CSZA 5M61A 2KERA 4QY8B 3QI9D 4OSUH 5HDQL 2WIIB 2KHAA 3CN0A 3D06A 3GBNH 4XMKL 3EH4B 4M8UA 3ZR6A 4ACPA 5TD4A 3UFIA 5ADOH 4LCWB 3DTXA 1T2QH 1CFNB 2DZEA 5CJXA 5JYLA 1S9VB 1E8NA 1MW3A 2E9IA 3LNEA 4FULA 4ZTPL 1A2YB 2CJSA 5D2LA 1JCKA 1QSVA 2J88H 4HV8B 4XXWC 4JREC 4AYEC 3J2PA 1A7OL 3ORJA 2CO0C 4RX4A 4AVHA 2OP4L 4G8FA 2NRDA 3LNHA 2AV1A 2ZCKL 4KUCD 5GGVH 4XVSL 5L4IA 4P2OA 2Q6WA 2D3NA 2DTSA 5E2WL 3IU4L 2C26A 4KQ4H 4F9PC 4H88L 3TTYA 5H4ZA 2GVYA 5B8CB 3MRFA 4C4BA 2DL9A 3T4AC 4HWNA 1X9RA 1T1ZA 4JDEB 1F97A 5TF0A 5HYEA 3WFBH 2MJWA 2VLLB 4IDLA 4Y2OA 1OTTD 4X4ME 3WD5L 1RY7B 3IDUA 4X7CC 4AIXA 1CXHA 1MI5B 1MCSA 3TOPA 3BP4B 5AOJA 4PNKB 1A12A 4FXGA 2E7HA 1GOHA 1URIA 2AAAA 3PUUA 4PJ8B 2H7WA 1Z32X 4KO6A 3L1EA 5JLZB 1VENA 4IIZA 4Y2DC 3T1FB 4K3JB 3GKWH 4JQIA 3Q5TA 1LXMA 3KWVA 3SDCD 4DK3A 3STZA 2AQNA 1AKPA 4UB0H 4GM9A 3B7YA 1IEAB 3NVQA 4MCYB 4A63A 1BEYH 3HJEA 3WEXB 5I1EH 3NCWA 4OVUA 2XIIA 5IJ8E 5L6YL 5HI4D 2AF2A 4WCYL 3RHWF 1KGYE 3O3BB 2IWFA 4LEEA 2YIHA 3P2TA 1UM5H 1BFOB 5A2CA 5EU5A 2DLEA 2X6VA 1ZE3H 2XRAL 4TLKA 4OD3H 1MXDA 4X99A 3CVHB 1S78C 3QDGB 5JW4M 3L3KB 4J86A 3DLQR 1H2YA 1ZT1A 3VXOA 5C0CB 5A16A 5BRZB 1UXSB 4LLMB 3I7NA 2EXWC 2YFOA 2A9NL 4NPJA 1LQSR 3SQBB 2X4OA 1UA3A 1A9VA 3VXMD 3B37A 4BINA 4Q9QL 2RJMA 1NEUA 4MA8L 1IGFH 4NO5B 4FLHA 5E6ZA 4YSCA 2W18A 1JV5B 3GI9H 5CP7A 2EKJA 4JFWA 1NAMA 5TF1L 2YSTA 4ZUSB 5B38G 3CMOH 5ESQA 3US9A 3BDXA 3J27A 4PJEE 2CDEA 2ICCA 2R2CA 4H26B 4LLYB 2F6AA 3DWLC 2JXMA 5C09D 4PG2C 5FYJU 4CGTA 3R1GH 3SO3B 1EHXA 3WIHL 3QEQD 2BOCA 2X89D 2ED6A 3DA0A 4YDZA 4ANKA 4TQIA 3EGDA 3UDWC 2W95A 3MCYA 3TESA 3G5YA 3RL1B 6TAAA 2ZICA 3KPLB 4LARL 1MF2H 4P2RB 4CVWA 4HJ1A 4EN3C 2P9KC 1C1EL 3W0WE 3OPZL 1TEFA 3EJUA 1DO5A 3D51A 3KVQA 1E8MA 3AU0A 3KGUA 4ZPTB 5E5MB 1G7IB 1G7JB 3U4EA 1EWHA 5T1MB 4NRXA 3KBEA 1MQKH 5GIRA 2C9SA 4TVPD 4PI2A 5B1BB 1J1XH 1LDPL 1RZGB 5DS2A 2FWLB 2H68A 2BHZA 3H3BC 4ODXB 4RVBA 3GI8H 3FCSB 3HHMA 1CICD 5DUBB 4ODBD 4NOBA 4PHZA 3S4SA 1YNTF 1ETB1 5AW7B 3UZQA 5A6MA 3D39A 4G9DB 5D7LE 4M1DL 4G6KH 5DFVD 1MCDA 4W9CC 2GTWA 5EFIB 3WENA 1XR9B 2ZKYA 3SE4C 1O7VA 3MCLL 1KYOJ 2R51A 3T3PE 5T1KA 3O4JA 1WE5A 2NY7H 3WTTA 2P9NC 4O1QD 1ZHLA 4XRCB 4AL8L 1XCTB 3D1MC 2HTLC 3SOTA 4GBXA 4BFBD 3NSXA 3ARBC 4LKCA 1DQIA 1MFAH 3FQTB 4HJ0C 4UNVA 1TOXA 1XSKA 2FUQA 5B4MD 4XI5D 1PX4A 4AQ1A 1ORQB 3G6JA 1I1CA 3HS9A 4M7LL 3UP1A 1QSEA 5ERWB 4POYA 2NY6C 3VD9A 1I9JH 2C3HA 2AXGB 3CFBB 4OV6F 4PJDF 4WUUE 5DMIL 3MZKA 5MEQA 5F7NC 4L4VD 5DUPH 1R34A 1EHLH 1DQQB 3BKYH 5HHQA 2EH8H 1JPTL 3CQFA 1RU9H 4GFTB 4C57C 3LX9A 4DPAX 3EI2B 3MBXH 4FTVB 2XXGA 5A7BA 3VWJC 3DO3A 4APXA 4LAJH 4PR5B 3T0XA 3QG7H 3DRQB 3A0OA 1P5UB 4QHLB 3FO2A 5DK0B 3FB8B 4H8VA 4Z7QF 5C2VB 3RB5A 5F6HJ 4AEIL 1VESA 3U0PA 1TCRA 1CGUA 4BCXA 5T3XE 3JWOL 3VX1A 1T20A 2HG5A 4P4KC 2JJVA 1X5FA 4U6VL 1UZ8B 4PH8A 4K9EH 3QI0A 1RZJH 2VAAB 2GBTA 3EFFA 3P2DA 4GRMA 1IMHC 1U0QA 3I9AA 12E8L 2RCSL 4ODUA 4EDXA 3MNVA 2PXYB 2Z35A 2QVTA 2D3VA 1SOXA 3CGTA 4LP5A 2EQDA 2Y5TB 5CSGA 1WFMA 2WBJA 3LQAC 1R6VA 5SV4A 4HF5H 1TTBA 3E8UL 4I88A 3U2IA 4G5ZH 4NC0B 5I6XB 2FJSA 5ADPH 3S88H 4FN0A 3OXSB 4D9QD 5IHWA 5HPMA 4ECNA 4KDVA 5IB4B 1IC5H 2IDUA 4X9GA 3GHEL 2DMKA 5AW0B 3DRTA 3QJVB 5AD0B 2Y69B 1YQVL 3MA9H 2Y0SA 4M00A 4TS6A 3S0PA 1YN7A 3MLWL 3MRGA 2XWXA 4WHDA 3SBRA 3ZL4L 1HFUA 3QUML 1GPOL 1XT5A 4G70B 1FO0H 4IBYA 4AE0A 3VFPB 4E0RB 1E7UA 3BRGC 1AFVL 1T1YB 2J5LB 1YY8B 4N8UA 4OFKA 1XQ4A 4GSUA 4V11A 2P8PB 2Y06H 3GTVA 1VFUA 4HD5A 2A4CA 4X7TA 3KPSD 4AVJA 4DO6A 3UVKA 43CAB 2D0FA 4F20A 2LOEA 5E8EB 4JGJA 4CL7A 4P23B 2VMJA 2ADIA 2DH2A 3VJ6B 5TQ2L 4XXCC 1JFQH 3HE6B 5EO1B 5EIVA 1C16A 1BBDL 4L8DA 5LNDA 3J8F7 1HYSC 4PRNA 2JJSC 1CFTB 4LPWA 1A4JA 5SX4H 3PP3H 4PPTA 4DKEL 2IALA 4AGPA 3RTQA 2D7TH 2MPAH 2BW5A 4N0CC 4U1NA 1P84K 4Z7WA 1EJ6A 3CHQA 2F9BT 4G9FA 3COOA 3SE3C 2IUVA 1T5XA 2HTKC 3DVGB 5F3FA 4X8GA 5SWSB 2XX1A 4QYAA 1I1FA 3LJ3A 5KAQG 3WFZA 4QGYA 5AAPA 4JT5C 1F3JA 3FQRA 3D0LB 5T5FH 1RK7A 2QPFA 3B9DA 2F68X 1NGZA 2FB4L 4ZMOA 1PY0A 4L4TA 1MCWW 5K9KB 1PG7H 1GCFA 4WI3A 4F15C 4Y2NA 5CAYB 1FG2B 1KY7A 5TQ0L 3LIZA 1RMFL 2WLJA 3ULVL 4YNYB 5I0DA 2LU5A 1UA6H 4JJHA 3O2WL 1THCA 2OMVA 3H2WA 1N18A 3LQZB 3BPCB 5D72L 4FFYA 4XMWA 4I13B 3S36H 3IUJA 1KXQE 3H9SE 4JSPC 5DUMH 4ERSH 4K7PL 1N70A 3EJZC 1OAQH 5AW5B 4MNQB 1N4XL 4HX1A 3BGAA 4LEXL 5IMMB 1OGAE 4HC1L 1HXMA 3K2IA 2Z7UA 2E7LC 1LWJA 5JHDD 4AXWB 5SV3A 3CZKA 5AVRB 1HWHB 2A6JA 3N9GL 1DVYA 1WEJL 1UA7A 2WXJA 3MXXA 1TEGA 2IDQA 4DJMA 4JFDA 3F64A 1JZ4A 1PLGL 3EYOA 4BCYA 4NDMA 1OSZA 5HP5A 1CE1H 1TDQA 3DC0A 3VMOA 1GGUA 3GINA 4OFVA 4DP2X 3D18A 4PWGA 4ZOXA 4P2OC 3BQUA 2YWYA 3MCG1 5E1GA 2VLME 3KD4A 2EDOA 1UB6B 1RIVL 2FNWA 4POZC 2A6DA 2DM7A 5HGDA 1KCUL 1R5WA 2ATAA 2BVQA 4QRUA 2E6QA 4M02A 1GC1H 1PY4A 4Y5XB 1OP4A 8FABB 1A7RH 3KVPA 3VCLB 4WO4B 2QQKH 3MA7B 4BZ2A 3EI4B 1YY9C 4CGUB 4CBZA 1OCZB 4Y8AA 1QO3A 1ZVSA 2J8OA 3WLBB 3HS0B 4OBRA 1TU2A 3MJ7A 2MNUA 3VFRA 2A9CA 2OJZH 4PGCB 4ZUVB 5J12C 2J8UA 5E5LA 4P5TD 5TDNB 4FXKB 3T0AA 5INDB 5KSBA 3D39D 4M43L 4YHYC 1NPJA 4BP9A 4FXGC 4XAWL 4XVTL 4TNFA 2R1YB 3CPLA 4GXUM 2ZXBA 4F7CB 5FKTA 4LSVL 4N0UE 4AQEB 4HEMA 1CMOA 1CF8H 1M53A 3B9AA 3HN3A 4KRMB 1Z5HA 4UT9A 4Y4HA 5M5TA 4GYBA 1E5AA 2MQ3A 2E6JA 2VC2H 3PYCA 2CDFB 4G42A 4HMCA 4LPUA 4OI7A 5D4JA 4MJ4A 3IRPX 3H3PH 2HESX 3DJ9A 4JL2A 4KNQA 4MBRA 1QPXA 2YJQA 3QO0A 4U2ZA 5C0BB 3S35L 4Z7OB 2AQQA 3BKML 3WHE1 1QLEL 5D1XA 4QHUA 1B0WA 4Z3GA 3O11A 4R96B 1WGOA 3VGAC 4L3AA 5H2BB 2DI8A 3FTWA 4TLUA 3GD1I 1ZD6A 4Y16B 3GGWA 4B50A 5CWSA 2JELL 3CFKA 2YRPA 4JK0D 1T1XA 3VTTA 2CM5A 1JVKA 1J0JA 2VJXA 3ECVA 3OKDA 1WF5A 4G7YH 3SFZA 2BY0A 4PSWB 4KDTA 4YC2B 2A7BA 2HUEA 1KJMB 3VE0B 2AC0A 1RJLB 1AS7A 1FFPA 4AYMC 1XGTA 3RWFB 5FDWA 3UJJH 4ZQKA 4IU2B 3V0WH 4NBYB 3P11L 5IVZA 4L2YA 4N6RB 1AANA 5FIEA 1S7SB 2VQ1A 3EGSA 4MQSB 1HQRB 4JHZA 1FZJB 5D1QA 1V7NL 4JFFB 1RSYA 3CMGA 5IFAH 3EYVA 4GXFA 4FJ6A 4P46A 5KVEH 5IBUG 4FXLA 4YHZH 1QASA 5E9DE 1TQUA 4LK4A 4OJFH 1KC5L 1XIWD 2ZUXA 4KY1L 4YR6A 3O4HA 2ZCHL 2W9EH 3FHEA 4MKMA 1RLBA 2A99A 3IJEA 4CMMA 3BT0A 4M1GL 5IEKA 2B2XH 4TVPH 1D6VH 1NGYB 3CXHJ 3HN5A 4LP4A 4OCSL 1IC7H 4POUB 2Y7NA 4E9YA 1BJ1J 4YFLF 2VRQA 2ZKHH 1WBYB 3KRWB 5HE0B 4RCAA 4O4YH 4MAYD 1DP0A 1FNSL 4WLCA 1W16A 5DJCA 2FEDC 2OR9L 5BVJA 4XO3A 5T1LD 4QRSA 5I16B 5KJRH 4F7TA 3IDGB 2CCVA 1H3WM 2OK4A 4XVUD 3V4PA 3OR7B 1T3FA 4DFHA 2X9WA 2NYYC 1I7UA 5A3ID 2E9BA 3DXAA 1MDTA 4N26A 2V5RA 2WYTA 2Z31D 1FZKA 2ARJA 2V37A 5HE1B 3MRMA 2G9HB 4JG1L 4PLJD 4KI5E 1HI6A 1Q9LA 2LTQC 4O2CA 3UGUA 1IQWH 2NUPB 1ZT4A 3MLZL 4Z18A 5EZJB 1EEQA 3RVWD 3ZDYE 5J11B 1VZ2A 2NY4C 3SYOA 4K9JA 1I53A 1Z3RA 3WV0A 5F1KC 4NN6B 3QCTL 4NXSA 1XHHA 5HYSB 1M3JA 2E47A 1QRNA 3QR2A 5I8KL 3PQYB 4H1LA 3RI5F 2NCMA 4DVRL 3DUSA 5DWPA 2H8PA 3K8MA 3ZDXB 4FDWA 2VLRB 1MUJB 2XTJB 2OMUB 3V6BR 5AW8B 2CO3A 3X1GA 3FU0A 2J1XA 4GBXC 5C0DA 5CCKL 4XBEL 5GS1A 2CNZA 4LCUA 2NZ9C 5C2BL 2DQUL 5E99H 1CZ8L 1BYOA 1NIFA 1A6UL 3GSQA 4PJGE 4AQ1C 3VSTA 3RNQA 4DN3L 4HG4K 5CZVL 1SHWA 2DJ4A 1HNYA 4LIQL 4X7SL 5DRZB 3GREA 4BP8A 5ES4B 2W94A 3TA3B 5IR1B 2WXHA 4MK0B 3SJLD 5D7IE 1JVOA 4U2YA 3FSOA 4PSPA 4N0FB 3IJCA 1U8IA 4PLKD 1JWMB 4Z9KB 2UZIH 2Y1ZA 4AOFA 2A5UA 2HH0L 1U91B 4K8RD 3LTVA 1I7RA 5I8OL 2XETA 1A7PH 1KIRA 1V05A 3TIDB 3V7MA 5BS0B 5IGOA 4L37B 1N6QH 1IILE 1JK9A 2QFRA 1WTGT 3I7LA 3NFPA 5CXPA 1KGWA 2BERA 1L3WA 4KFZC 1JXJA 3NSFA 4QYOA 2P7TA 1DANU 2ZCZA 2VXUL 3N0PB 2KBGA 3O45A 1OHQA 4IIQA 5GSRB 5C0IB 4AC2A 4BH8A 5IOPB 4UNUA 1GKOA 2VXQA 3M88A 1ZK5A 2ZZUT 4XB7A 4Q6IB 4CADA 4DAGL 4RZCB 5E6RA 3IKKA 4WEMB 4P59H 1GZHA 5AFAA 3X1EA 1U6AH 3LXCA 4FG6C 5A2AA 3F62A 2VMDA 3U4YA 4LEOB 3ATAA 3WTSA 1T2XA 4AX4A 3MV9A 3CX5J 4PG9A 2EDQA 3FQXB 1DDTA 2R8SL 5B39G 3KH3A 2UY7A 2Y23A 4E54A 5E6IA 3TU6A 3K72B 2C34A 3L3OA 4BGLA 3NP3A 4IGBA 2BCKA 2VDNB 2WBJC 1MHCB 3MLRL 3KPOB 3NJGA 3SGKA 3ZE1E 5H35A 2VO5A 5KW9L 3MV7B 4NO0D 5E56A 4OBSA 4IMKA 4LVOC 1A4CA 2R4SL 4OLZH 5E2TL 4HBQA 5DHVA 5C6PB 2YSSA 1PW3A 1HSAA 4XPGL 2Z6FA 4G6AC 2ICEA 4JFDD 4MA3A 1PYWB 1TVDA 3ZDZB 4JM2B 2B0SH 3JRPA 4AGMA 3BOVA 4PJAB 4ICWA 3LXAA 2B5IB 4JRXB 4J1UA 4NHUB 3RSEC 4JDZB 2WWOA 2IGLA 3NK4A 4GO8A 4GAJH 2PR4H 4NNXB 2WKOF 5CJ8A 5DDHA 5F3BB 3JYBA 5E4IA 3BYYA 3RY4A 5EA0L 3TBTA 3ARDA 4UMSA 2GAZA 1CC3A 5CCHE 4AX3A 1MH5B 3AREB 4LSTL 3WHXA 1AHWB 5I1IH 1UT1A 2E59A 1XSJA 2VDQH 1EO8L 1KEGH 4N5EC 1HHJB 3MBWA 4XB8A 4HWEH 2XTLA 4QRRB 5DYFA 5E2VL 4W1TA 1NDMA 3M17B 4FQPA 4XMZA 5BRQA 5BVPH 1MDAH 5IHHA 3L3IA 3QQXA 3C5SB 3DURA 5DD5L 2PP7A 4RRPA 5CILH 5I1AB 1DQDH 4AT6A 4ZMVA 1R3KB 1GGIH 4HULB 1CTMA 4RGNC 3OLDA 3QIBC 1U93A 2E8YA 4S0HA 3RTQC 3E3QE 2NT0A 1EBAA 3RX7A 2V9TA 2VWEE 4JKMA 4N8VA 3TVMD 4PI0A 1ZTMA 4BE5A 3JZYA 4Y1AE 4GW5B 3W56A 5EPMA 2HMID 1NDGB 3LKSA 3M46A 2ZXAA 4I77L 2NY1C 5A2IH 5J6HA 1JYWA 4XNQA 1KCVL 3G5ZA 2QVKA 4HISA 3WGVB 2IDTA 2CIKB 5K9JL 3OSVA 3DVIA 3HCVB 2HXCA 1VEOA 2ZUVA 3FCGA 5IIEB 4XVOA 1NLBH 2MOQA 3I6GB 1U9KA 4KY2A 2D7OA 4RFNB 5I9QC 4XMTA 1DFBH 2VDKL 3NIDA 1XH3A 2H9GA 1IGCH 1CK0H 2WO2B 3AXLB 3QNXA 1DVFD 3A67L 4UNIA 5T1DL 1QYGH 3VXUD 1QEXA 5DCCA 3BIKA 2MCPL 4JL1A 5CJ5A 2JNZA 5KAQF 1XGUA 5EBWA 1CXFA 3BD3A 3MX0B <