2HXCA

Crystal structure of the benzylamine complex of aromatic amine dehydrogenase in n-semiquinone form
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
359
structure length
359
Chain Sequence
EVLTGGHSVSAPQENRIYVMDSVFMHLTESRVHVYDYTNGKFLGMVPTAFNGHVQVSNDGKKIYTMTTYHERITRGKRSDVVEVWDADKLTFEKEISLPPKRVQGLNYDGLFRQTTDGKFIVLQNASPATSIGIVDVAKGDYVEDVTAAAGCWSVIPQPNRPRSFMTICGDGGLLTINLGEDGKVASQSRSKQMFSVADDPIFIAPALDKDKAHFVSYYGNVYSADFSGDEVKVDGPWSLLNDEDKAKNWVPGGYNLVGLHRASGRMYVFMHPDGKEGTHKFPAAEIWVMDTKTKQRVARIPGRDALSMTIDQQRNLMLTLDGGNVNVYDISQPEPKLLRTIEGAAEASLQVQFHPVGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aromatic amine dehydrogenase
publication title Atomic level insight into the oxidative half-reaction of aromatic amine dehydrogenase.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 97
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2006-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2hxcA01
1PGUA 2W18A 2UZXB 4PNKB 4U1EI 4GGDA 3I8EA 3SXTD 2HKRA 5EALA 3RRMC 5FKRA 2QXVA 3UVMA 2P9PC 5TEEA 4FAVD 4O1QD 2HESX 1ERJA 1PBYB 5FKSA 3RN1D 4PC0A 1K32A 3KRWB 4J8GA 2H6QA 1JOFA 3SCYA 2CE9A 5IJ7E 3UVLA 1JMXB 2Z2PA 4X61B 4XYHA 2B5MA 4YVDA 3EI4B 3JPXA 5HE2B 4BH6A 2Z2NA 2P9SC 2EBSA 4FA4D 4CZXA 5CYKB 3EI2A 4H5JA 2GNQA 4PSXB 5SXMA 4GGCA 3E0CA 2B5NA 4IMMA 5AJAA 5H17A 3DXKC 2AH0A 5AMSA 4O9DA 3V5WB 2HJBA 3ULEC 4A11B 3ZWLB 4IA9A 4U7AA 4FA5D 3OL2B 5IGQA 5HE1B 4X60B 5TDHB 3IIWA 4J87A 4CI8A 4K3JB 3AFCA 2HXCA 4O3TB 5IC7A 4R7AB 5HE3B 4N14A 4E5ZB 1YFQA 3CFVA 1U4CA 5C2WB 2H13A 3I2NA 3U4YA 3UR4A 1SQJA 1GP2B 3ODTA 4J8BA 1JMZB 1RI6A 4L9OA 3I7PA 3DWLC 1OLZA 4Y7RA 4D0KA 2H9LA 3EI1B 3UVKA 3CFSB 2P9LC 2I0SA 3A0FA 2I0RA 2GC4A 4ZOXA 5FQDA 5GXIA 2B4EA 2TRCB 4BL0A 3V9FA 1GG2B 3SMRA 2BCJB 2AGZA 4KFMB 3UVNA 3C5MA 4J84A 4CC9A 2HYEA 4J0WA 4E5ZA 4A09B 4L3GD 4J78A 3SWSD 2J56H 3P4FA 1MG3A 4CZYA 2XL3A 4GMBA 4QT8A 1VYHC 2IWFA 5HQGA 1GXRA 3FGBA 3IJ1A 5THAA 4CI2A 4PXWA 1XKSA 2OVRB 3SBRA 2YNOA 3MKSB 4A0AA 2G99A 4CI1A 3B7FA 2PM9A 2J57G 3EI1A 3L4MD 4GQ1A 2G9AA 4GGAA 3L4OD 1U2VC 2OVPB 3OKYB 3F3GA 4OWRA 5KDOB 3C9CA 2IUPA 1SQ9A 4UI9R 4LG8A 4XYIA 5EM2A 2AGXA 4FHLA 5IGOA 3W15A 5AFU3 2YNNA 3V7DB 1XIPA 5IJ8E 4HDJA 5EMKB 2IUQA 3GREA 1NR0A 2O9KA 3NVQA 2YNPA 3CIKB 1JJUB 4A0BB 3UKRC 3AL8B 4FA9D 4PSWB 3N0DA 2HKMA 3EI3B 4FB1D 4QRJA 4TZ4A 2YB8B 2I0TA 4JT5C 5IT9g 2H6NA 2IAAA 3I7NA 2OK4A 2OVQB 4ZOYA 4K3ID 4J79A 2J55H 4PBZA 1B9XA 3SN6B 3MZLA 4ERQA 1TBGA 5GXHA 4GM8A 1PI6A 2AGLA 4CY1A 4CZVA 4A2MA 3EI4A 4JSPC 3PVUB 3MKQA 4FA1D 3BWSA 3EG6A 5I5JA 4A0BA 3MXXA 5HYNB 3JZHA 3SBPA 3AL8A 2QC5A 5CYKA 2H9PA 1N6DA 5TF2A 4H5IA 3RFHA 3C75H 2CN3A 4E54B 1B9YA 3PXWD 4J82A 1OMWB 3DXMC 4O3UB 4JT6C 2IWKA 4BUJC 3GFCA 2P9UC 1MG2A 3SFZA 4ESGA 4A11A 3FM0A 4L1QD 4CY2A 1FWXA 3JRPA 3IJCA 2H47A 3SLED 3F3FA 3OL2A 4O45A 4AOWA 3PSCB 2PBIB 4GM3A 2PM7B 1MDAH 2CNXA 3IIYA 5A2Qg 2YMUA 4XEIC 5FXYA 5I5IA 4LG9A 5K1CC 4J81A 3OKTA 3BG0A 4A2LA 2HJ4A 2XL2A 3EMHA 5EMMB 3SHFA 4L3HD 2H14A 1NEXB 2P9IC 3ORVD 1A0RB 1K8KC 1N6FA 3RMZD 5FA5B 4J0XA 5FKQA 1L0QA 1PEVA 4JSVC 4GQ2P 3F3PA 5C2VB 5FKTA 2B5LA 3K26A 2YBAA 3BG1A 3JB9L 4ES0A 4GZ8A 1P22A 3I7OA 3EI2B 5CXCB 3JAMg 3VH0A 3JROA 5GSAA 4OZUA 4PBYA 3I7LA 5GMKn 3EWEA 1Q47A 3PSLA 4A09A 5C9ZB 3DSMA 3DM0A 5CXBB 3N0EA 5H1MA 2P9NC 3VA6A 1S4UX 5H14A 5JWZA 3OW8A 2BBKH 4GQBB 4JSNC 3NVNA 2IURA 2I3SA 3EU7A 3I8CA 5TEFA 4CY3A 5B4WA 5K19A 4EWRA 1R5MA 4J73A 3RFGA 4FAND 3OTTA 3OKYA 5HE0B 2AGYA 4ZOZA 3SVWD 4X3EA 4GM9A 2CO0A 3IJ0A 4ERZA 3SBQA 3VGZA 5CXCA 3PXSD 2AGWA 2XYIA 2OJYA 4NSXA 2OK6A 2AQ5A 3UKUC 3PXTD 5EMLB 4A7JA 1SHYB 3UVOA 3IKOA 5CXBA 4ZN4A 3I7KA 3RSEC 4J77A 3JZGA 3K27A 4I79A 3EI3A 4A08B 2H68A 2H6KA 5FLXg 4Z8LA 4LGNA 3AH8B 4CI3A 2XU7A 4QQEA 4JSXC 4QL1A 3RN0D 4J86A 2GC7A 2CO0C 2P9KC 2IUVA 2Z2OA 3OKWA 2Q7QA 3C99A 3HFQA 5EAPA 4MK0B 4A0AB 4FWWA 3AL9A 3FRXA 4CY5A 2PM9B 2H9NA 4ERYA 1QNIA 2CN2A 2PM6B 2UZYB 3I89A 4JXMA 3RLMD 3JZNA 4JD2C 4D6VA 5I5MA 4Y5RD 4G56B 5EM2B 3MZKA 2I3TA 3MMYA 1N6EA 1GOTB 2OIZA 4A08A 2CE8A 4E54A 3PE7A 3PVWB 2MTAH 3NVXA 4AEZA 3J80g 5EMJB 1TYQC 3SJLD 4ZOVA 1XHMA 5EARA 3I7HA 2H3XA 2H9MA 3J81g 3KRXB 5EAMA 4X63B 2AH1A
chains in the Genus database with same CATH superfamily
1PGUA 1O6GA 2W18A 2UZXB 4PNKB 4U1EI 4GGDA 3I8EA 3ZDZA 4UM9A 1H2XA 1T2XA 3SXTD 2HKRA 4WK4A 5EALA 3RRMC 5FKRA 3VI3A 3IVMA 2QXVA 3UVMA 2P9PC 5TEEA 4FAVD 4O1QD 2HESX 1ERJA 1PBYB 4DNWA 5FKSA 4DNUA 3RN1D 4PC0A 1K32A 3KRWB 2VZ3A 4J8GA 2H6QA 1JOFA 3SCYA 2CE9A 5IJ7E 3UVLA 1JMXB 1VE7A 2Z2PA 4X61B 4XYHA 2B5MA 4YVDA 3EI4B 3JPXA 5HE2B 4Z7OA 3ZDXA 4BH6A 2Z2NA 2P9SC 2XE4A 4UM8A 2EBSA 4FA4D 4CZXA 5CYKB 3EI2A 4H5JA 2GNQA 4PSXB 5SXMA 4GGCA 3E0CA 2B5NA 4NC4A 4IMMA 5AJAA 5H17A 3DXKC 2AH0A 5AMSA 3FCUA 4O9DA 3V5WB 2HJBA 3ULEC 4A11B 3ZWLB 1JV2A 4IA9A 4U7AA 4FA5D 3OL2B 5IGQA 5HE1B 3ZDYA 4X60B 4IRZA 5TDHB 3IIWA 4J87A 1H2WA 4CI8A 3NIDA 4K3JB 3AFCA 2HXCA 4JHPC 4O3TB 5IC7A 4R7AB 5HE3B 4BCCA 3K6SA 4QAMA 4N14A 3ZE0A 4E5ZB 1UOOA 1YFQA 3CFVA 1U4CA 3O4HA 5C2WB 2H13A 2VDRA 3I2NA 3U4YA 5E6UA 3UR4A 2VDOA 1A12A 3QHYB 1SQJA 1GP2B 4O2WA 1VZ3A 3ODTA 4J8BA 1JMZB 1RI6A 4L9OA 3ZE2A 1GOGA 3V4PA 3I7PA 3DWLC 1OLZA 4Y7RA 4BCBA 4D0KA 2H9LA 3EI1B 3UVKA 3CFSB 2P9LC 2I0SA 3V4VA 3A0FA 4MMXA 2I0RA 2GC4A 4ZOXA 5FQDA 5GXIA 2B4EA 2TRCB 4BL0A 3V9FA 1GG2B 3SMRA 3EQ8A 2BCJB 2AGZA 4KFMB 3UVNA 3C5MA 4J84A 1E8MA 1U8CA 4CC9A 2HYEA 4J0WA 4E5ZA 4A09B 4L3GD 4J78A 3SWSD 2J56H 3P4FA 1MG3A 4CZYA 2XL3A 4GMBA 4QT8A 1VYHC 2IWFA 5HQGA 1UOPA 1GXRA 3FGBA 3IJ1A 5THAA 1JTDB 4CI2A 4PXWA 1XKSA 2OVRB 3SBRA 2YNOA 3MKSB 4A0AA 2G99A 2EIDA 3B7FA 2PM9A 4CI1A 2J57G 1UTCA 3EI1A 3L4MD 4GQ1A 2G9AA 4GGAA 4D9SA 2JKXA 3IJEA 2VZ1A 3L4OD 1U2VC 2OVPB 3OKYB 3F3GA 3EQ7A 4OWRA 5KDOB 2QZPA 3C9CA 1C9IA 2IUPA 1SQ9A 4UI9R 4LG8A 4XYIA 1H2YA 5EM2A 2AGXA 4FHLA 5IGOA 3W15A 5AFU3 2YNNA 3V7DB 1XIPA 5IJ8E 4HDJA 5EMKB 2IUQA 3GREA 3IUMA 1NR0A 2O9KA 1K3IA 3NVQA 2YNPA 3CIKB 4AMYA 1JJUB 3O4GA 4A0BB 4BP9A 3UKRC 2HU8A 3AL8B 4FA9D 4PSWB 3N0DA 2HKMA 3EI3B 4FB1D 4QRJA 4TZ4A 2YB8B 2I0TA 4RE6A 4JT5C 3T3MA 5IT9g 2H6NA 3GD1I 2IAAA 4NAAA 1QFSA 3I7NA 2OK4A 3NIFA 2OVQB 3K71A 4ZOYA 4K3ID 4J79A 2J55H 4PBZA 1O6FA 1B9XA 3SN6B 3MZLA 4ERQA 1TBGA 5GXHA 4GM8A 1PI6A 2AGLA 2VDQA 3GC3B 4CY1A 3K72A 4CZVA 4A2MA 1VZ2A 2XZGA 3MVDK 3EI4A 4JSPC 3PVUB 3MKQA 4FA1D 3BWSA 3EG6A 5I5JA 4A0BA 3MXXA 5HYNB 3JZHA 4AN1A 5M5VA 3SBPA 1C9LA 3AL8A 2EICA 2QC5A 5CYKA 2H9PA 3IUQA 1N6DA 5TF2A 4H5IA 3RFHA 3C75H 2CN3A 4E54B 1B9YA 3PXWD 4J82A 1OMWB 3DXMC 4O3UB 4JT6C 2IWKA 4BUJC 4NBMA 5M5TA 1L5GA 2P9UC 3GFCA 5FFOA 5M61A 1MG2A 3SFZA 4ESGA 1BPOA 4A11A 3FM0A 4L1QD 4CY2A 3OF7A 4BP8A 1FWXA 3JRPA 3IJCA 2H47A 3SLED 3F3FA 3OL2A 1TYEA 4O45A 3PSCB 4RE5A 4WJKA 4AOWA 4O02A 2PBIB 4GM3A 2PM7B 1MDAH 2CNXA 3IIYA 5C86A 5A2Qg 2YMUA 4XEIC 5FXYA 5I5IA 4LG9A 1QFMA 5K1CC 4J81A 3OKTA 2HU7A 4G55A 3BG0A 4A2LA 2HJ4A 2XL2A 3EMHA 5EMMB 3QI0A 3FCSA 2VDMA 3SHFA 4L3HD 2H14A 1NEXB 2P9IC 3EQ9A 4DNVA 3T3PA 3ORVD 1A0RB 1K8KC 1N6FA 3RMZD 5FA5B 2VDPA 5M5UA 4J0XA 5FKQA 1L0QA 1PEVA 4JSVC 4GQ2P 3F3PA 5C2VB 5FKTA 2B5LA 3K26A 2YBAA 3NIGA 3BG1A 3JB9L 4ES0A 2VDKA 4WK2A 2HU5A 2EIBA 4GZ8A 3MUNA 4AMZA 1P22A 3I7OA 3KCIA 3EI2B 5CXCB 3JAMg 3VH0A 3JROA 5GSAA 4OZUA 4PBYA 3I7LA 5GMKn 3EWEA 1Q47A 4BCDA 3IUNA 3PSLA 4A09A 5C9ZB 5FFGA 3DSMA 3DM0A 5CXBB 3N0EA 5H1MA 2P9NC 3VA6A 1S4UX 5H14A 5JWZA 3OW8A 2BBKH 4GQBB 4G1EA 3NVNA 4JSNC 5M5SA 2IURA 2EIEA 2I3SA 3EU7A 4L1MA 1UOQA 3I8CA 3O4JA 5TEFA 5B4WA 4CY3A 5K19A 4EWRA 1R5MA 1GOFA 4J73A 3RFGA 4FAND 4AN0A 3ZE1A 2BKLA 3MUOA 3OTTA 3OKYA 4WK0A 2AGYA 5HE0B 1VE6A 4ZOZA 3SVWD 4AX4A 4X3EA 4GM9A 3O4IA 2CO0A 3IJ0A 4ERZA 3SBQA 3VGZA 5CXCA 3PXSD 2AGWA 2XYIA 2OJYA 2VDLA 4NSXA 2OK6A 2AQ5A 3UKUC 3PXTD 1I2MB 3IUJA 5EMLB 4A7JA 1SHYB 3UVOA 1E5TA 5M5RA 3IKOA 2XDWA 5CXBA 4ZN4A 3I7KA 3RSEC 4J77A 3JZGA 3K27A 5HDBA 4I79A 3EI3A 4A08B 1GOHA 1H2ZA 2H68A 4JHNA 2H6KA 5FLXg 4Z8LA 2WQ8A 5E6RA 4LGNA 3AH8B 4CI3A 2XU7A 4QQEA 4JSXC 4QL1A 4NENA 3RN0D 4J86A 2QR5A 2VC2A 2GC7A 2CO0C 2P9KC 2IUVA 2Z2OA 3OKWA 2Q7QA 3C99A 3HFQA 5EAPA 4MK0B 4A0AB 4FWWA 3AL9A 3FRXA 4CY5A 2PM9B 2H9NA 4ERYA 1QNIA 2CN2A 3DDUA 3VI4A 2PM6B 1E8NA 2UZYB 3I89A 4JXMA 3RLMD 3JZNA 4JD2C 4D6VA 5I5MA 3IULA 4Y5RD 4G56B 5EM2B 3MZKA 3MMYA 2I3TA 1N6EA 1GOTB 2OIZA 4MMZA 2CE8A 4A08A 3IURA 4E54A 3PE7A 3PVWB 5C92A 4Z7QA 2MTAH 3NVXA 4G1MA 4AEZA 3J80g 1M1XA 5EMJB 5E6SA 1TYQC 2VDNA 3SJLD 4Z7NA 4MMYA 1YR2A 4ZOVA 1XHMA 5EARA 3I7HA 2H3XA 2H9MA 3J81g 3KRXB 5EAMA 4X63B 2AH1A
chains in the Genus database with same CATH topology
1PGUA 2W18A 2UZXB 4PNKB 4U1EI 4GGDA 3I8EA 3SXTD 2HKRA 5EALA 3RRMC 5FKRA 2QXVA 3UVMA 2P9PC 5TEEA 4FAVD 4O1QD 2HESX 1ERJA 1PBYB 5FKSA 3RN1D 4PC0A 1K32A 3KRWB 4J8GA 2H6QA 1JOFA 3SCYA 2CE9A 5IJ7E 3UVLA 1JMXB 2Z2PA 4X61B 4XYHA 2B5MA 4YVDA 3EI4B 3JPXA 5HE2B 4BH6A 2Z2NA 2P9SC 2EBSA 4FA4D 4CZXA 5CYKB 3EI2A 4H5JA 2GNQA 4PSXB 5SXMA 4GGCA 3E0CA 2B5NA 4IMMA 5AJAA 5H17A 3DXKC 2AH0A 5AMSA 4O9DA 3V5WB 2HJBA 3ULEC 4A11B 3ZWLB 4IA9A 4U7AA 4FA5D 3OL2B 5IGQA 5HE1B 4X60B 5TDHB 3IIWA 4J87A 4CI8A 4K3JB 3AFCA 2HXCA 4O3TB 5IC7A 4R7AB 5HE3B 4N14A 4E5ZB 1YFQA 3CFVA 1U4CA 5C2WB 2H13A 3I2NA 3U4YA 3UR4A 1SQJA 1GP2B 3ODTA 4J8BA 1JMZB 1RI6A 4L9OA 3I7PA 3DWLC 1OLZA 4Y7RA 4D0KA 2H9LA 3EI1B 3UVKA 3CFSB 2P9LC 2I0SA 3A0FA 2I0RA 2GC4A 4ZOXA 5FQDA 5GXIA 2B4EA 2TRCB 4BL0A 3V9FA 1GG2B 3SMRA 2BCJB 2AGZA 4KFMB 3UVNA 3C5MA 4J84A 4CC9A 2HYEA 4J0WA 4E5ZA 4A09B 4L3GD 4J78A 3SWSD 2J56H 3P4FA 1MG3A 4CZYA 2XL3A 4GMBA 4QT8A 1VYHC 2IWFA 5HQGA 1GXRA 3FGBA 3IJ1A 5THAA 4CI2A 4PXWA 1XKSA 2OVRB 3SBRA 2YNOA 3MKSB 4A0AA 2G99A 4CI1A 3B7FA 2PM9A 2J57G 3EI1A 3L4MD 4GQ1A 2G9AA 4GGAA 3L4OD 1U2VC 2OVPB 3OKYB 3F3GA 4OWRA 5KDOB 3C9CA 2IUPA 1SQ9A 4UI9R 4LG8A 4XYIA 5EM2A 2AGXA 4FHLA 5IGOA 3W15A 5AFU3 2YNNA 3V7DB 1XIPA 5IJ8E 4HDJA 5EMKB 2IUQA 3GREA 1NR0A 2O9KA 3NVQA 2YNPA 3CIKB 1JJUB 4A0BB 3UKRC 3AL8B 4FA9D 4PSWB 3N0DA 2HKMA 3EI3B 4FB1D 4QRJA 4TZ4A 2YB8B 2I0TA 4JT5C 5IT9g 2H6NA 2IAAA 3I7NA 2OK4A 2OVQB 4ZOYA 4K3ID 4J79A 2J55H 4PBZA 1B9XA 3SN6B 3MZLA 4ERQA 1TBGA 5GXHA 4GM8A 1PI6A 2AGLA 4CY1A 4CZVA 4A2MA 3EI4A 4JSPC 3PVUB 3MKQA 4FA1D 3BWSA 3EG6A 5I5JA 4A0BA 3MXXA 5HYNB 3JZHA 3SBPA 3AL8A 2QC5A 5CYKA 2H9PA 1N6DA 5TF2A 4H5IA 3RFHA 3C75H 2CN3A 4E54B 1B9YA 3PXWD 4J82A 1OMWB 3DXMC 4O3UB 4JT6C 2IWKA 4BUJC 3GFCA 2P9UC 1MG2A 3SFZA 4ESGA 4A11A 3FM0A 4L1QD 4CY2A 1FWXA 3JRPA 3IJCA 2H47A 3SLED 3F3FA 3OL2A 4O45A 4AOWA 3PSCB 2PBIB 4GM3A 2PM7B 1MDAH 2CNXA 3IIYA 5A2Qg 2YMUA 4XEIC 5FXYA 5I5IA 4LG9A 5K1CC 4J81A 3OKTA 3BG0A 4A2LA 2HJ4A 2XL2A 3EMHA 5EMMB 3SHFA 4L3HD 2H14A 1NEXB 2P9IC 3ORVD 1A0RB 1K8KC 1N6FA 3RMZD 5FA5B 4J0XA 5FKQA 1L0QA 1PEVA 4JSVC 4GQ2P 3F3PA 5C2VB 5FKTA 2B5LA 3K26A 2YBAA 3BG1A 3JB9L 4ES0A 4GZ8A 1P22A 3I7OA 3EI2B 5CXCB 3JAMg 3VH0A 3JROA 5GSAA 4OZUA 4PBYA 3I7LA 5GMKn 3EWEA 1Q47A 3PSLA 4A09A 5C9ZB 3DSMA 3DM0A 5CXBB 3N0EA 5H1MA 2P9NC 3VA6A 1S4UX 5H14A 5JWZA 3OW8A 2BBKH 4GQBB 4JSNC 3NVNA 2IURA 2I3SA 3EU7A 3I8CA 5TEFA 4CY3A 5B4WA 5K19A 4EWRA 1R5MA 4J73A 3RFGA 4FAND 3OTTA 3OKYA 5HE0B 2AGYA 4ZOZA 3SVWD 4X3EA 4GM9A 2CO0A 3IJ0A 4ERZA 3SBQA 3VGZA 5CXCA 3PXSD 2AGWA 2XYIA 2OJYA 4NSXA 2OK6A 2AQ5A 3UKUC 3PXTD 5EMLB 4A7JA 1SHYB 3UVOA 3IKOA 5CXBA 4ZN4A 3I7KA 3RSEC 4J77A 3JZGA 3K27A 4I79A 3EI3A 4A08B 2H68A 2H6KA 5FLXg 4Z8LA 4LGNA 3AH8B 4CI3A 2XU7A 4QQEA 4JSXC 4QL1A 3RN0D 4J86A 2GC7A 2CO0C 2P9KC 2IUVA 2Z2OA 3OKWA 2Q7QA 3C99A 3HFQA 5EAPA 4MK0B 4A0AB 4FWWA 3AL9A 3FRXA 4CY5A 2PM9B 2H9NA 4ERYA 1QNIA 2CN2A 2PM6B 2UZYB 3I89A 4JXMA 3RLMD 3JZNA 4JD2C 4D6VA 5I5MA 4Y5RD 4G56B 5EM2B 3MZKA 2I3TA 3MMYA 1N6EA 1GOTB 2OIZA 4A08A 2CE8A 4E54A 3PE7A 3PVWB 2MTAH 3NVXA 4AEZA 3J80g 5EMJB 1TYQC 3SJLD 4ZOVA 1XHMA 5EARA 3I7HA 2H3XA 2H9MA 3J81g 3KRXB 5EAMA 4X63B 2AH1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PGU A;  2W18 A;  2UZX B;  4PNK B;  4U1E I;  4GGD A;  3I8E A;  3SXT D;  2HKR A;  5EAL A;  3RRM C;  5FKR A;  2QXV A;  3UVM A;  2P9P C;  5TEE A;  4FAV D;  4O1Q D;  2HES X;  1ERJ A;  1PBY B;  5FKS A;  3RN1 D;  4PC0 A;  1K32 A;  3KRW B;  4J8G A;  2H6Q A;  1JOF A;  3SCY A;  2CE9 A;  5IJ7 E;  3UVL A;  1JMX B;  2Z2P A;  4X61 B;  4XYH A;  2B5M A;  4YVD A;  3EI4 B;  3JPX A;  5HE2 B;  4BH6 A;  2Z2N A;  2P9S C;  2EBS A;  4FA4 D;  4CZX A;  5CYK B;  3EI2 A;  4H5J A;  2GNQ A;  4PSX B;  5SXM A;  4GGC A;  3E0C A;  2B5N A;  4IMM A;  5AJA A;  5H17 A;  3DXK C;  2AH0 A;  5AMS A;  4O9D A;  3V5W B;  2HJB A;  3ULE C;  4A11 B;  3ZWL B;  4IA9 A;  4U7A A;  4FA5 D;  3OL2 B;  5IGQ A;  5HE1 B;  4X60 B;  5TDH B;  3IIW A;  4J87 A;  4CI8 A;  4K3J B;  3AFC A;  2HXC A;  4O3T B;  5IC7 A;  4R7A B;  5HE3 B;  4N14 A;  4E5Z B;  1YFQ A;  3CFV A;  1U4C A;  5C2W B;  2H13 A;  3I2N A;  3U4Y A;  3UR4 A;  1SQJ A;  1GP2 B;  3ODT A;  4J8B A;  1JMZ B;  1RI6 A;  4L9O A;  3I7P A;  3DWL C;  1OLZ A;  4Y7R A;  4D0K A;  2H9L A;  3EI1 B;  3UVK A;  3CFS B;  2P9L C;  2I0S A;  3A0F A;  2I0R A;  2GC4 A;  4ZOX A;  5FQD A;  5GXI A;  2B4E A;  2TRC B;  4BL0 A;  3V9F A;  1GG2 B;  3SMR A;  2BCJ B;  2AGZ A;  4KFM B;  3UVN A;  3C5M A;  4J84 A;  4CC9 A;  2HYE A;  4J0W A;  4E5Z A;  4A09 B;  4L3G D;  4J78 A;  3SWS D;  2J56 H;  3P4F A;  1MG3 A;  4CZY A;  2XL3 A;  4GMB A;  4QT8 A;  1VYH C;  2IWF A;  5HQG A;  1GXR A;  3FGB A;  3IJ1 A;  5THA A;  4CI2 A;  4PXW A;  1XKS A;  2OVR B;  3SBR A;  2YNO A;  3MKS B;  4A0A A;  2G99 A;  4CI1 A;  3B7F A;  2PM9 A;  2J57 G;  3EI1 A;  3L4M D;  4GQ1 A;  2G9A A;  4GGA A;  3L4O D;  1U2V C;  2OVP B;  3OKY B;  3F3G A;  4OWR A;  5KDO B;  3C9C A;  2IUP A;  1SQ9 A;  4UI9 R;  4LG8 A;  4XYI A;  5EM2 A;  2AGX A;  4FHL A;  5IGO A;  3W15 A;  5AFU 3;  2YNN A;  3V7D B;  1XIP A;  5IJ8 E;  4HDJ A;  5EMK B;  2IUQ A;  3GRE A;  1NR0 A;  2O9K A;  3NVQ A;  2YNP A;  3CIK B;  1JJU B;  4A0B B;  3UKR C;  3AL8 B;  4FA9 D;  4PSW B;  3N0D A;  2HKM A;  3EI3 B;  4FB1 D;  4QRJ A;  4TZ4 A;  2YB8 B;  2I0T A;  4JT5 C;  5IT9 g;  2H6N A;  2IAA A;  3I7N A;  2OK4 A;  2OVQ B;  4ZOY A;  4K3I D;  4J79 A;  2J55 H;  4PBZ A;  1B9X A;  3SN6 B;  3MZL A;  4ERQ A;  1TBG A;  5GXH A;  4GM8 A;  1PI6 A;  2AGL A;  4CY1 A;  4CZV A;  4A2M A;  3EI4 A;  4JSP C;  3PVU B;  3MKQ A;  4FA1 D;  3BWS A;  3EG6 A;  5I5J A;  4A0B A;  3MXX A;  5HYN B;  3JZH A;  3SBP A;  3AL8 A;  2QC5 A;  5CYK A;  2H9P A;  1N6D A;  5TF2 A;  4H5I A;  3RFH A;  3C75 H;  2CN3 A;  4E54 B;  1B9Y A;  3PXW D;  4J82 A;  1OMW B;  3DXM C;  4O3U B;  4JT6 C;  2IWK A;  4BUJ C;  3GFC A;  2P9U C;  1MG2 A;  3SFZ A;  4ESG A;  4A11 A;  3FM0 A;  4L1Q D;  4CY2 A;  1FWX A;  3JRP A;  3IJC A;  2H47 A;  3SLE D;  3F3F A;  3OL2 A;  4O45 A;  4AOW A;  3PSC B;  2PBI B;  4GM3 A;  2PM7 B;  1MDA H;  2CNX A;  3IIY A;  5A2Q g;  2YMU A;  4XEI C;  5FXY A;  5I5I A;  4LG9 A;  5K1C C;  4J81 A;  3OKT A;  3BG0 A;  4A2L A;  2HJ4 A;  2XL2 A;  3EMH A;  5EMM B;  3SHF A;  4L3H D;  2H14 A;  1NEX B;  2P9I C;  3ORV D;  1A0R B;  1K8K C;  1N6F A;  3RMZ D;  5FA5 B;  4J0X A;  5FKQ A;  1L0Q A;  1PEV A;  4JSV C;  4GQ2 P;  3F3P A;  5C2V B;  5FKT A;  2B5L A;  3K26 A;  2YBA A;  3BG1 A;  3JB9 L;  4ES0 A;  4GZ8 A;  1P22 A;  3I7O A;  3EI2 B;  5CXC B;  3JAM g;  3VH0 A;  3JRO A;  5GSA A;  4OZU A;  4PBY A;  3I7L A;  5GMK n;  3EWE A;  1Q47 A;  3PSL A;  4A09 A;  5C9Z B;  3DSM A;  3DM0 A;  5CXB B;  3N0E A;  5H1M A;  2P9N C;  3VA6 A;  1S4U X;  5H14 A;  5JWZ A;  3OW8 A;  2BBK H;  4GQB B;  4JSN C;  3NVN A;  2IUR A;  2I3S A;  3EU7 A;  3I8C A;  5TEF A;  4CY3 A;  5B4W A;  5K19 A;  4EWR A;  1R5M A;  4J73 A;  3RFG A;  4FAN D;  3OTT A;  3OKY A;  5HE0 B;  2AGY A;  4ZOZ A;  3SVW D;  4X3E A;  4GM9 A;  2CO0 A;  3IJ0 A;  4ERZ A;  3SBQ A;  3VGZ A;  5CXC A;  3PXS D;  2AGW A;  2XYI A;  2OJY A;  4NSX A;  2OK6 A;  2AQ5 A;  3UKU C;  3PXT D;  5EML B;  4A7J A;  1SHY B;  3UVO A;  3IKO A;  5CXB A;  4ZN4 A;  3I7K A;  3RSE C;  4J77 A;  3JZG A;  3K27 A;  4I79 A;  3EI3 A;  4A08 B;  2H68 A;  2H6K A;  5FLX g;  4Z8L A;  4LGN A;  3AH8 B;  4CI3 A;  2XU7 A;  4QQE A;  4JSX C;  4QL1 A;  3RN0 D;  4J86 A;  2GC7 A;  2CO0 C;  2P9K C;  2IUV A;  2Z2O A;  3OKW A;  2Q7Q A;  3C99 A;  3HFQ A;  5EAP A;  4MK0 B;  4A0A B;  4FWW A;  3AL9 A;  3FRX A;  4CY5 A;  2PM9 B;  2H9N A;  4ERY A;  1QNI A;  2CN2 A;  2PM6 B;  2UZY B;  3I89 A;  4JXM A;  3RLM D;  3JZN A;  4JD2 C;  4D6V A;  5I5M A;  4Y5R D;  4G56 B;  5EM2 B;  3MZK A;  2I3T A;  3MMY A;  1N6E A;  1GOT B;  2OIZ A;  4A08 A;  2CE8 A;  4E54 A;  3PE7 A;  3PVW B;  2MTA H;  3NVX A;  4AEZ A;  3J80 g;  5EMJ B;  1TYQ C;  3SJL D;  4ZOV A;  1XHM A;  5EAR A;  3I7H A;  2H3X A;  2H9M A;  3J81 g;  3KRX B;  5EAM A;  4X63 B;  2AH1 A; 
#chains in the Genus database with same CATH topology
 1PGU A;  1O6G A;  2W18 A;  2UZX B;  4PNK B;  4U1E I;  4GGD A;  3I8E A;  3ZDZ A;  4UM9 A;  1H2X A;  1T2X A;  3SXT D;  2HKR A;  4WK4 A;  5EAL A;  3RRM C;  5FKR A;  3VI3 A;  3IVM A;  2QXV A;  3UVM A;  2P9P C;  5TEE A;  4FAV D;  4O1Q D;  2HES X;  1ERJ A;  1PBY B;  4DNW A;  5FKS A;  4DNU A;  3RN1 D;  4PC0 A;  1K32 A;  3KRW B;  2VZ3 A;  4J8G A;  2H6Q A;  1JOF A;  3SCY A;  2CE9 A;  5IJ7 E;  3UVL A;  1JMX B;  1VE7 A;  2Z2P A;  4X61 B;  4XYH A;  2B5M A;  4YVD A;  3EI4 B;  3JPX A;  5HE2 B;  4Z7O A;  3ZDX A;  4BH6 A;  2Z2N A;  2P9S C;  2XE4 A;  4UM8 A;  2EBS A;  4FA4 D;  4CZX A;  5CYK B;  3EI2 A;  4H5J A;  2GNQ A;  4PSX B;  5SXM A;  4GGC A;  3E0C A;  2B5N A;  4NC4 A;  4IMM A;  5AJA A;  5H17 A;  3DXK C;  2AH0 A;  5AMS A;  3FCU A;  4O9D A;  3V5W B;  2HJB A;  3ULE C;  4A11 B;  3ZWL B;  1JV2 A;  4IA9 A;  4U7A A;  4FA5 D;  3OL2 B;  5IGQ A;  5HE1 B;  3ZDY A;  4X60 B;  4IRZ A;  5TDH B;  3IIW A;  4J87 A;  1H2W A;  4CI8 A;  3NID A;  4K3J B;  3AFC A;  2HXC A;  4JHP C;  4O3T B;  5IC7 A;  4R7A B;  5HE3 B;  4BCC A;  3K6S A;  4QAM A;  4N14 A;  3ZE0 A;  4E5Z B;  1UOO A;  1YFQ A;  3CFV A;  1U4C A;  3O4H A;  5C2W B;  2H13 A;  2VDR A;  3I2N A;  3U4Y A;  5E6U A;  3UR4 A;  2VDO A;  1A12 A;  3QHY B;  1SQJ A;  1GP2 B;  4O2W A;  1VZ3 A;  3ODT A;  4J8B A;  1JMZ B;  1RI6 A;  4L9O A;  3ZE2 A;  1GOG A;  3V4P A;  3I7P A;  3DWL C;  1OLZ A;  4Y7R A;  4BCB A;  4D0K A;  2H9L A;  3EI1 B;  3UVK A;  3CFS B;  2P9L C;  2I0S A;  3V4V A;  3A0F A;  4MMX A;  2I0R A;  2GC4 A;  4ZOX A;  5FQD A;  5GXI A;  2B4E A;  2TRC B;  4BL0 A;  3V9F A;  1GG2 B;  3SMR A;  3EQ8 A;  2BCJ B;  2AGZ A;  4KFM B;  3UVN A;  3C5M A;  4J84 A;  1E8M A;  1U8C A;  4CC9 A;  2HYE A;  4J0W A;  4E5Z A;  4A09 B;  4L3G D;  4J78 A;  3SWS D;  2J56 H;  3P4F A;  1MG3 A;  4CZY A;  2XL3 A;  4GMB A;  4QT8 A;  1VYH C;  2IWF A;  5HQG A;  1UOP A;  1GXR A;  3FGB A;  3IJ1 A;  5THA A;  1JTD B;  4CI2 A;  4PXW A;  1XKS A;  2OVR B;  3SBR A;  2YNO A;  3MKS B;  4A0A A;  2G99 A;  2EID A;  3B7F A;  2PM9 A;  4CI1 A;  2J57 G;  1UTC A;  3EI1 A;  3L4M D;  4GQ1 A;  2G9A A;  4GGA A;  4D9S A;  2JKX A;  3IJE A;  2VZ1 A;  3L4O D;  1U2V C;  2OVP B;  3OKY B;  3F3G A;  3EQ7 A;  4OWR A;  5KDO B;  2QZP A;  3C9C A;  1C9I A;  2IUP A;  1SQ9 A;  4UI9 R;  4LG8 A;  4XYI A;  1H2Y A;  5EM2 A;  2AGX A;  4FHL A;  5IGO A;  3W15 A;  5AFU 3;  2YNN A;  3V7D B;  1XIP A;  5IJ8 E;  4HDJ A;  5EMK B;  2IUQ A;  3GRE A;  3IUM A;  1NR0 A;  2O9K A;  1K3I A;  3NVQ A;  2YNP A;  3CIK B;  4AMY A;  1JJU B;  3O4G A;  4A0B B;  4BP9 A;  3UKR C;  2HU8 A;  3AL8 B;  4FA9 D;  4PSW B;  3N0D A;  2HKM A;  3EI3 B;  4FB1 D;  4QRJ A;  4TZ4 A;  2YB8 B;  2I0T A;  4RE6 A;  4JT5 C;  3T3M A;  5IT9 g;  2H6N A;  3GD1 I;  2IAA A;  4NAA A;  1QFS A;  3I7N A;  2OK4 A;  3NIF A;  2OVQ B;  3K71 A;  4ZOY A;  4K3I D;  4J79 A;  2J55 H;  4PBZ A;  1O6F A;  1B9X A;  3SN6 B;  3MZL A;  4ERQ A;  1TBG A;  5GXH A;  4GM8 A;  1PI6 A;  2AGL A;  2VDQ A;  3GC3 B;  4CY1 A;  3K72 A;  4CZV A;  4A2M A;  1VZ2 A;  2XZG A;  3MVD K;  3EI4 A;  4JSP C;  3PVU B;  3MKQ A;  4FA1 D;  3BWS A;  3EG6 A;  5I5J A;  4A0B A;  3MXX A;  5HYN B;  3JZH A;  4AN1 A;  5M5V A;  3SBP A;  1C9L A;  3AL8 A;  2EIC A;  2QC5 A;  5CYK A;  2H9P A;  3IUQ A;  1N6D A;  5TF2 A;  4H5I A;  3RFH A;  3C75 H;  2CN3 A;  4E54 B;  1B9Y A;  3PXW D;  4J82 A;  1OMW B;  3DXM C;  4O3U B;  4JT6 C;  2IWK A;  4BUJ C;  4NBM A;  5M5T A;  1L5G A;  2P9U C;  3GFC A;  5FFO A;  5M61 A;  1MG2 A;  3SFZ A;  4ESG A;  1BPO A;  4A11 A;  3FM0 A;  4L1Q D;  4CY2 A;  3OF7 A;  4BP8 A;  1FWX A;  3JRP A;  3IJC A;  2H47 A;  3SLE D;  3F3F A;  3OL2 A;  1TYE A;  4O45 A;  3PSC B;  4RE5 A;  4WJK A;  4AOW A;  4O02 A;  2PBI B;  4GM3 A;  2PM7 B;  1MDA H;  2CNX A;  3IIY A;  5C86 A;  5A2Q g;  2YMU A;  4XEI C;  5FXY A;  5I5I A;  4LG9 A;  1QFM A;  5K1C C;  4J81 A;  3OKT A;  2HU7 A;  4G55 A;  3BG0 A;  4A2L A;  2HJ4 A;  2XL2 A;  3EMH A;  5EMM B;  3QI0 A;  3FCS A;  2VDM A;  3SHF A;  4L3H D;  2H14 A;  1NEX B;  2P9I C;  3EQ9 A;  4DNV A;  3T3P A;  3ORV D;  1A0R B;  1K8K C;  1N6F A;  3RMZ D;  5FA5 B;  2VDP A;  5M5U A;  4J0X A;  5FKQ A;  1L0Q A;  1PEV A;  4JSV C;  4GQ2 P;  3F3P A;  5C2V B;  5FKT A;  2B5L A;  3K26 A;  2YBA A;  3NIG A;  3BG1 A;  3JB9 L;  4ES0 A;  2VDK A;  4WK2 A;  2HU5 A;  2EIB A;  4GZ8 A;  3MUN A;  4AMZ A;  1P22 A;  3I7O A;  3KCI A;  3EI2 B;  5CXC B;  3JAM g;  3VH0 A;  3JRO A;  5GSA A;  4OZU A;  4PBY A;  3I7L A;  5GMK n;  3EWE A;  1Q47 A;  4BCD A;  3IUN A;  3PSL A;  4A09 A;  5C9Z B;  5FFG A;  3DSM A;  3DM0 A;  5CXB B;  3N0E A;  5H1M A;  2P9N C;  3VA6 A;  1S4U X;  5H14 A;  5JWZ A;  3OW8 A;  2BBK H;  4GQB B;  4G1E A;  3NVN A;  4JSN C;  5M5S A;  2IUR A;  2EIE A;  2I3S A;  3EU7 A;  4L1M A;  1UOQ A;  3I8C A;  3O4J A;  5TEF A;  5B4W A;  4CY3 A;  5K19 A;  4EWR A;  1R5M A;  1GOF A;  4J73 A;  3RFG A;  4FAN D;  4AN0 A;  3ZE1 A;  2BKL A;  3MUO A;  3OTT A;  3OKY A;  4WK0 A;  2AGY A;  5HE0 B;  1VE6 A;  4ZOZ A;  3SVW D;  4AX4 A;  4X3E A;  4GM9 A;  3O4I A;  2CO0 A;  3IJ0 A;  4ERZ A;  3SBQ A;  3VGZ A;  5CXC A;  3PXS D;  2AGW A;  2XYI A;  2OJY A;  2VDL A;  4NSX A;  2OK6 A;  2AQ5 A;  3UKU C;  3PXT D;  1I2M B;  3IUJ A;  5EML B;  4A7J A;  1SHY B;  3UVO A;  1E5T A;  5M5R A;  3IKO A;  2XDW A;  5CXB A;  4ZN4 A;  3I7K A;  3RSE C;  4J77 A;  3JZG A;  3K27 A;  5HDB A;  4I79 A;  3EI3 A;  4A08 B;  1GOH A;  1H2Z A;  2H68 A;  4JHN A;  2H6K A;  5FLX g;  4Z8L A;  2WQ8 A;  5E6R A;  4LGN A;  3AH8 B;  4CI3 A;  2XU7 A;  4QQE A;  4JSX C;  4QL1 A;  4NEN A;  3RN0 D;  4J86 A;  2QR5 A;  2VC2 A;  2GC7 A;  2CO0 C;  2P9K C;  2IUV A;  2Z2O A;  3OKW A;  2Q7Q A;  3C99 A;  3HFQ A;  5EAP A;  4MK0 B;  4A0A B;  4FWW A;  3AL9 A;  3FRX A;  4CY5 A;  2PM9 B;  2H9N A;  4ERY A;  1QNI A;  2CN2 A;  3DDU A;  3VI4 A;  2PM6 B;  1E8N A;  2UZY B;  3I89 A;  4JXM A;  3RLM D;  3JZN A;  4JD2 C;  4D6V A;  5I5M A;  3IUL A;  4Y5R D;  4G56 B;  5EM2 B;  3MZK A;  3MMY A;  2I3T A;  1N6E A;  1GOT B;  2OIZ A;  4MMZ A;  2CE8 A;  4A08 A;  3IUR A;  4E54 A;  3PE7 A;  3PVW B;  5C92 A;  4Z7Q A;  2MTA H;  3NVX A;  4G1M A;  4AEZ A;  3J80 g;  1M1X A;  5EMJ B;  5E6S A;  1TYQ C;  2VDN A;  3SJL D;  4Z7N A;  4MMY A;  1YR2 A;  4ZOV A;  1XHM A;  5EAR A;  3I7H A;  2H3X A;  2H9M A;  3J81 g;  3KRX B;  5EAM A;  4X63 B;  2AH1 A; 
#chains in the Genus database with same CATH homology
 1PGU A;  2W18 A;  2UZX B;  4PNK B;  4U1E I;  4GGD A;  3I8E A;  3SXT D;  2HKR A;  5EAL A;  3RRM C;  5FKR A;  2QXV A;  3UVM A;  2P9P C;  5TEE A;  4FAV D;  4O1Q D;  2HES X;  1ERJ A;  1PBY B;  5FKS A;  3RN1 D;  4PC0 A;  1K32 A;  3KRW B;  4J8G A;  2H6Q A;  1JOF A;  3SCY A;  2CE9 A;  5IJ7 E;  3UVL A;  1JMX B;  2Z2P A;  4X61 B;  4XYH A;  2B5M A;  4YVD A;  3EI4 B;  3JPX A;  5HE2 B;  4BH6 A;  2Z2N A;  2P9S C;  2EBS A;  4FA4 D;  4CZX A;  5CYK B;  3EI2 A;  4H5J A;  2GNQ A;  4PSX B;  5SXM A;  4GGC A;  3E0C A;  2B5N A;  4IMM A;  5AJA A;  5H17 A;  3DXK C;  2AH0 A;  5AMS A;  4O9D A;  3V5W B;  2HJB A;  3ULE C;  4A11 B;  3ZWL B;  4IA9 A;  4U7A A;  4FA5 D;  3OL2 B;  5IGQ A;  5HE1 B;  4X60 B;  5TDH B;  3IIW A;  4J87 A;  4CI8 A;  4K3J B;  3AFC A;  2HXC A;  4O3T B;  5IC7 A;  4R7A B;  5HE3 B;  4N14 A;  4E5Z B;  1YFQ A;  3CFV A;  1U4C A;  5C2W B;  2H13 A;  3I2N A;  3U4Y A;  3UR4 A;  1SQJ A;  1GP2 B;  3ODT A;  4J8B A;  1JMZ B;  1RI6 A;  4L9O A;  3I7P A;  3DWL C;  1OLZ A;  4Y7R A;  4D0K A;  2H9L A;  3EI1 B;  3UVK A;  3CFS B;  2P9L C;  2I0S A;  3A0F A;  2I0R A;  2GC4 A;  4ZOX A;  5FQD A;  5GXI A;  2B4E A;  2TRC B;  4BL0 A;  3V9F A;  1GG2 B;  3SMR A;  2BCJ B;  2AGZ A;  4KFM B;  3UVN A;  3C5M A;  4J84 A;  4CC9 A;  2HYE A;  4J0W A;  4E5Z A;  4A09 B;  4L3G D;  4J78 A;  3SWS D;  2J56 H;  3P4F A;  1MG3 A;  4CZY A;  2XL3 A;  4GMB A;  4QT8 A;  1VYH C;  2IWF A;  5HQG A;  1GXR A;  3FGB A;  3IJ1 A;  5THA A;  4CI2 A;  4PXW A;  1XKS A;  2OVR B;  3SBR A;  2YNO A;  3MKS B;  4A0A A;  2G99 A;  4CI1 A;  3B7F A;  2PM9 A;  2J57 G;  3EI1 A;  3L4M D;  4GQ1 A;  2G9A A;  4GGA A;  3L4O D;  1U2V C;  2OVP B;  3OKY B;  3F3G A;  4OWR A;  5KDO B;  3C9C A;  2IUP A;  1SQ9 A;  4UI9 R;  4LG8 A;  4XYI A;  5EM2 A;  2AGX A;  4FHL A;  5IGO A;  3W15 A;  5AFU 3;  2YNN A;  3V7D B;  1XIP A;  5IJ8 E;  4HDJ A;  5EMK B;  2IUQ A;  3GRE A;  1NR0 A;  2O9K A;  3NVQ A;  2YNP A;  3CIK B;  1JJU B;  4A0B B;  3UKR C;  3AL8 B;  4FA9 D;  4PSW B;  3N0D A;  2HKM A;  3EI3 B;  4FB1 D;  4QRJ A;  4TZ4 A;  2YB8 B;  2I0T A;  4JT5 C;  5IT9 g;  2H6N A;  2IAA A;  3I7N A;  2OK4 A;  2OVQ B;  4ZOY A;  4K3I D;  4J79 A;  2J55 H;  4PBZ A;  1B9X A;  3SN6 B;  3MZL A;  4ERQ A;  1TBG A;  5GXH A;  4GM8 A;  1PI6 A;  2AGL A;  4CY1 A;  4CZV A;  4A2M A;  3EI4 A;  4JSP C;  3PVU B;  3MKQ A;  4FA1 D;  3BWS A;  3EG6 A;  5I5J A;  4A0B A;  3MXX A;  5HYN B;  3JZH A;  3SBP A;  3AL8 A;  2QC5 A;  5CYK A;  2H9P A;  1N6D A;  5TF2 A;  4H5I A;  3RFH A;  3C75 H;  2CN3 A;  4E54 B;  1B9Y A;  3PXW D;  4J82 A;  1OMW B;  3DXM C;  4O3U B;  4JT6 C;  2IWK A;  4BUJ C;  3GFC A;  2P9U C;  1MG2 A;  3SFZ A;  4ESG A;  4A11 A;  3FM0 A;  4L1Q D;  4CY2 A;  1FWX A;  3JRP A;  3IJC A;  2H47 A;  3SLE D;  3F3F A;  3OL2 A;  4O45 A;  4AOW A;  3PSC B;  2PBI B;  4GM3 A;  2PM7 B;  1MDA H;  2CNX A;  3IIY A;  5A2Q g;  2YMU A;  4XEI C;  5FXY A;  5I5I A;  4LG9 A;  5K1C C;  4J81 A;  3OKT A;  3BG0 A;  4A2L A;  2HJ4 A;  2XL2 A;  3EMH A;  5EMM B;  3SHF A;  4L3H D;  2H14 A;  1NEX B;  2P9I C;  3ORV D;  1A0R B;  1K8K C;  1N6F A;  3RMZ D;  5FA5 B;  4J0X A;  5FKQ A;  1L0Q A;  1PEV A;  4JSV C;  4GQ2 P;  3F3P A;  5C2V B;  5FKT A;  2B5L A;  3K26 A;  2YBA A;  3BG1 A;  3JB9 L;  4ES0 A;  4GZ8 A;  1P22 A;  3I7O A;  3EI2 B;  5CXC B;  3JAM g;  3VH0 A;  3JRO A;  5GSA A;  4OZU A;  4PBY A;  3I7L A;  5GMK n;  3EWE A;  1Q47 A;  3PSL A;  4A09 A;  5C9Z B;  3DSM A;  3DM0 A;  5CXB B;  3N0E A;  5H1M A;  2P9N C;  3VA6 A;  1S4U X;  5H14 A;  5JWZ A;  3OW8 A;  2BBK H;  4GQB B;  4JSN C;  3NVN A;  2IUR A;  2I3S A;  3EU7 A;  3I8C A;  5TEF A;  4CY3 A;  5B4W A;  5K19 A;  4EWR A;  1R5M A;  4J73 A;  3RFG A;  4FAN D;  3OTT A;  3OKY A;  5HE0 B;  2AGY A;  4ZOZ A;  3SVW D;  4X3E A;  4GM9 A;  2CO0 A;  3IJ0 A;  4ERZ A;  3SBQ A;  3VGZ A;  5CXC A;  3PXS D;  2AGW A;  2XYI A;  2OJY A;  4NSX A;  2OK6 A;  2AQ5 A;  3UKU C;  3PXT D;  5EML B;  4A7J A;  1SHY B;  3UVO A;  3IKO A;  5CXB A;  4ZN4 A;  3I7K A;  3RSE C;  4J77 A;  3JZG A;  3K27 A;  4I79 A;  3EI3 A;  4A08 B;  2H68 A;  2H6K A;  5FLX g;  4Z8L A;  4LGN A;  3AH8 B;  4CI3 A;  2XU7 A;  4QQE A;  4JSX C;  4QL1 A;  3RN0 D;  4J86 A;  2GC7 A;  2CO0 C;  2P9K C;  2IUV A;  2Z2O A;  3OKW A;  2Q7Q A;  3C99 A;  3HFQ A;  5EAP A;  4MK0 B;  4A0A B;  4FWW A;  3AL9 A;  3FRX A;  4CY5 A;  2PM9 B;  2H9N A;  4ERY A;  1QNI A;  2CN2 A;  2PM6 B;  2UZY B;  3I89 A;  4JXM A;  3RLM D;  3JZN A;  4JD2 C;  4D6V A;  5I5M A;  4Y5R D;  4G56 B;  5EM2 B;  3MZK A;  2I3T A;  3MMY A;  1N6E A;  1GOT B;  2OIZ A;  4A08 A;  2CE8 A;  4E54 A;  3PE7 A;  3PVW B;  2MTA H;  3NVX A;  4AEZ A;  3J80 g;  5EMJ B;  1TYQ C;  3SJL D;  4ZOV A;  1XHM A;  5EAR A;  3I7H A;  2H3X A;  2H9M A;  3J81 g;  3KRX B;  5EAM A;  4X63 B;  2AH1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...