2HXCA

Crystal structure of the benzylamine complex of aromatic amine dehydrogenase in n-semiquinone form
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
359
structure length
359
Chain Sequence
EVLTGGHSVSAPQENRIYVMDSVFMHLTESRVHVYDYTNGKFLGMVPTAFNGHVQVSNDGKKIYTMTTYHERITRGKRSDVVEVWDADKLTFEKEISLPPKRVQGLNYDGLFRQTTDGKFIVLQNASPATSIGIVDVAKGDYVEDVTAAAGCWSVIPQPNRPRSFMTICGDGGLLTINLGEDGKVASQSRSKQMFSVADDPIFIAPALDKDKAHFVSYYGNVYSADFSGDEVKVDGPWSLLNDEDKAKNWVPGGYNLVGLHRASGRMYVFMHPDGKEGTHKFPAAEIWVMDTKTKQRVARIPGRDALSMTIDQQRNLMLTLDGGNVNVYDISQPEPKLLRTIEGAAEASLQVQFHPVGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aromatic amine dehydrogenase
publication title Atomic level insight into the oxidative half-reaction of aromatic amine dehydrogenase.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 97
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2006-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2hxcA01
3MMYA 2EBSA 4J0XA 2XYIA 3PVWB 4ES0A 5THAA 2GNQA 1JOFA 3PXWD 2P9SC 4O9DA 3SFZA 5C9ZB 3PSLA 4ERZA 3JZNA 4CZVA 4FAND 3VA6A 4HDJA 1PI6A 4I79A 3RLMD 3I7NA 4XEIC 4ZN4A 3FGBA 3FRXA 4A0BB 2AH1A 4BH6A 3NVNA 4EWRA 3MXXA 4E5ZB 5EMLB 4O1QD 4A7JA 1MG2A 4GGCA 2UZXB 3W15A 4J81A 1JJUB 2B5MA 4H5IA 4QT8A 3ULEC 2HYEA 4CY1A 3C9CA 2YB8B 5FKQA 5SXMA 2AGWA 2YMUA 4GGDA 4A09B 3IJ1A 1TYQC 3SN6B 4PC0A 4J78A 3B7FA 3UVKA 5C2VB 1OLZA 2Z2OA 2OJYA 3JRPA 3EI3B 3OTTA 4GQ2P 1PEVA 4J79A 3IIWA 2XL2A 4L3HD 1XHMA 5HYNB 5IJ7E 4YVDA 4JT6C 2IUQA 4A0BA 4E54B 1JMZB 4MK0B 2B5NA 4FB1D 2CN3A 4IMMA 4UI9R 4E5ZA 4X60B 2AGLA 3CFSB 2HESX 1OMWB 3J80g 3BG1A 4K3JB 2OVPB 5EMJB 2H9LA 3NVQA 4JSNC 3SBPA 4ERQA 2CO0A 1L0QA 4A09A 1PBYB 2Q7QA 4GQBB 2Z2PA 3EG6A 4X61B 2J57G 3NVXA 3UR4A 5KDOB 3L4MD 2H47A 3UVNA 4D6VA 5H14A 3MKQA 1MDAH 3EI3A 3RSEC 5AMSA 2P9UC 1PGUA 2H13A 2YNPA 3OKYB 3ZWLB 2YBAA 3BWSA 3KRXB 3BG0A 2H9PA 2I3TA 4Y5RD 4Z8LA 2H6NA 4J86A 1U4CA 4E54A 4FA9D 3EMHA 1A0RB 2XL3A 4J0WA 1N6EA 5GMKn 2OIZA 3I7KA 2CE8A 4FWWA 5FA5B 3L4OD 2CNXA 4O45A 5EALA 3SHFA 3MZKA 3CFVA 5IC7A 5HQGA 2BCJB 4U7AA 2MTAH 2H6KA 1B9XA 3AFCA 2I0RA 1QNIA 3KRWB 3F3FA 4GMBA 4FA1D 1MG3A 2OK4A 4FHLA 4ESGA 4PSXB 2OVQB 3I7LA 2IAAA 1B9YA 1GOTB 2YNOA 2IUPA 2PM7B 5JWZA 1VYHC 2AGZA 3EI2B 4GM3A 4A2MA 2AH0A 3OKYA 3ODTA 4FAVD 1Q47A 4JD2C 3MKSB 2UZYB 4JT5C 5K1CC 4KFMB 5CXBB 3GFCA 4J73A 3JZGA 4A0AB 3I7HA 3SBRA 2J56H 2O9KA 3JB9L 2IUVA 2IWKA 2PBIB 3OW8A 1K8KC 1SHYB 2PM9B 4BUJC 4QRJA 4ZOZA 3JZHA 5A2Qg 4PBYA 4R7AB 4U1EI 3EU7A 1S4UX 1GXRA 4O3TB 5EMKB 4GM8A 3ORVD 2AQ5A 4ERYA 2J55H 3DXMC 4J84A 5TEFA 3I8CA 3EI2A 3UVOA 3F3PA 2QC5A 2GC4A 5B4WA 2QXVA 2TRCB 3E0CA 5H17A 4K3ID 3V7DB 4QQEA 3RFHA 3RRMC 2HXCA 4GM9A 3I2NA 4J8BA 4A11B 4X63B 5CXBA 4XYHA 4CZXA 2HKMA 5I5JA 3JPXA 4JXMA 4A0AA 3CIKB 4PNKB 4XYIA 2I0TA 3SBQA 1XIPA 3RFGA 3EWEA 5TEEA 4A08B 3I7OA 4L9OA 5CXCA 2H6QA 2PM9A 3PSCB 5EAPA 2H14A 4IA9A 5TF2A 5AFU3 4PXWA 1NR0A 5HE1B 3I7PA 4TZ4A 4J87A 5FKTA 2OK6A 5AJAA 5FLXg 3AH8B 4FA5D 4FA4D 1XKSA 5IJ8E 1GG2B 3RN0D 2BBKH 3AL9A 4PSWB 4CI3A 5K19A 2CE9A 4JSPC 4LG8A 3AL8B 5IT9g 4A2LA 5I5MA 3PXTD 1FWXA 2HJ4A 1YFQA 3IJCA 4D0KA 3N0EA 5EAMA 3SJLD 1NEXB 5FXYA 5FKRA 3PE7A 3UVMA 4AOWA 4BL0A 4CY5A 2H68A 2Z2NA 1N6FA 3OKWA 4J77A 4A11A 5GXHA 3FM0A 4CI8A 4ZOYA 4QL1A 5HE2B 2P9NC 5CYKB 3SVWD 1U2VC 3PVUB 3SXTD 4A08A 5GXIA 4NSXA 3N0DA 3UKRC 1SQJA 5HE3B 1R5MA 1GP2B 2H9NA 3OL2B 3JAMg 2B4EA 2P9IC 3C99A 2XU7A 4L1QD 4J82A 3VGZA 3C5MA 2G99A 2H3XA 3I8EA 4OWRA 2HJBA 4CI1A 3RN1D 2IURA 3J81g 5C2WB 3AL8A 3P4FA 5FKSA 3DM0A 4GQ1A 4G56B 5GSAA 3SWSD 3IKOA 2CO0C 2B5LA 2GC7A 3EI1B 5TDHB 5CXCB 5I5IA 4LG9A 4JSVC 4ZOVA 5IGOA 2G9AA 2IWFA 3UKUC 5EM2B 4H5JA 4O3UB 3SCYA 3V9FA 4N14A 3DXKC 2P9PC 3GREA 2P9LC 4Y7RA 4JSXC 3JROA 5CYKA 4X3EA 3EI4B 5EARA 3F3GA 4J8GA 4AEZA 2AGXA 5HE0B 5H1MA 4L3GD 4LGNA 4CI2A 1P22A 1RI6A 4OZUA 2CN2A 3OL2A 4CY3A 3HFQA 1ERJA 3SMRA 3MZLA 3K27A 1TBGA 2I3SA 4GZ8A 4CZYA 5IGQA 2H9MA 3C75H 1JMXB 3OKTA 3IJ0A 2PM6B 3I89A 5FQDA 3A0FA 3K26A 2YNNA 5EMMB 3EI1A 3UVLA 4GGAA 3DSMA 3SLED 1K32A 5EM2A 4CY2A 1SQ9A 2P9KC 4PBZA 4ZOXA 3U4YA 1N6DA 3RMZD 2W18A 3IIYA 3VH0A 2HKRA 2OVRB 4CC9A 3DWLC 3EI4A 2I0SA 3V5WB 3PXSD 2AGYA
chains in the Genus database with same CATH superfamily
5M5SA 3MMYA 5FFOA 2EBSA 4J0XA 2XYIA 3PVWB 4ES0A 5THAA 2GNQA 1JOFA 3PXWD 2P9SC 1E8MA 4O9DA 3SFZA 5C9ZB 4NBMA 3MUOA 3PSLA 4ERZA 3JZNA 4CZVA 4FAND 3VA6A 4HDJA 3K71A 1PI6A 4I79A 2HU8A 3RLMD 3I7NA 4XEIC 4ZN4A 3FGBA 3DDUA 4O02A 3FRXA 4A0BB 2AH1A 4BH6A 4G1MA 2JKXA 3NVNA 4EWRA 1VE6A 2VDQA 3MXXA 4E5ZB 5EMLB 4O1QD 4A7JA 1MG2A 4GGCA 2UZXB 3W15A 4J81A 1JJUB 2B5MA 4H5IA 4QT8A 3ULEC 4AX4A 2HYEA 4BP8A 1GOHA 4CY1A 3C9CA 2XDWA 2YB8B 5FKQA 3NIGA 5SXMA 2AGWA 2YMUA 4GGDA 4A09B 3IUNA 3IJ1A 3FCUA 2HU7A 1TYQC 4UM8A 1K3IA 4PC0A 4J78A 3SN6B 4BCBA 3B7FA 3UVKA 5C2VB 1OLZA 2Z2OA 3T3MA 4DNWA 2OJYA 3NIDA 3JRPA 3EI3B 3OTTA 4GQ2P 1PEVA 2EIEA 4J79A 2EICA 3IIWA 2XL2A 1H2XA 4L3HD 3OF7A 1XHMA 3ZE0A 5HYNB 5IJ7E 4YVDA 4JT6C 2VDRA 2IUQA 4A0BA 4QAMA 2EIBA 4E54B 1JMZB 4MMYA 4MK0B 2B5NA 4WK2A 4FB1D 3IVMA 2CN3A 4IMMA 4UI9R 4E5ZA 4X60B 2AGLA 3CFSB 3IUMA 2HESX 1OMWB 4WK4A 3J80g 3VI3A 3QHYB 3BG1A 4K3JB 2OVPB 2VC2A 2H9LA 5EMJB 3NVQA 1UOQA 4JSNC 3SBPA 4ERQA 1O6GA 2CO0A 2XE4A 1L0QA 1A12A 1QFSA 4A09A 2VDOA 1PBYB 3IJEA 2Q7QA 4GQBB 2Z2PA 3EG6A 4X61B 2J57G 5M5TA 3NVXA 3UR4A 5KDOB 3L4MD 1U8CA 2H47A 3UVNA 1C9IA 4D6VA 5H14A 4NAAA 3MKQA 4UM9A 1MDAH 3EI3A 3RSEC 5AMSA 5E6SA 3VI4A 2P9UC 1PGUA 2H13A 2YNPA 2QR5A 3OKYB 3ZWLB 2YBAA 3BWSA 3ZDZA 3KRXB 3BG0A 2H9PA 2I3TA 4AN0A 4Y5RD 4Z8LA 2H6NA 4J86A 1U4CA 3T3PA 4E54A 4FA9D 3EMHA 1A0RB 2XL3A 4J0WA 1N6EA 2VZ1A 5GMKn 2OIZA 1C9LA 1UOOA 3I7KA 2CE8A 4FWWA 5FA5B 3L4OD 3IUQA 2CNXA 1BPOA 3EQ9A 1UOPA 4O45A 5EALA 3O4IA 3SHFA 3MZKA 3KCIA 3CFVA 5IC7A 3O4GA 5HQGA 1VZ2A 2BCJB 3V4PA 4AN1A 4U7AA 2MTAH 2H6KA 1B9XA 3AFCA 2I0RA 1QNIA 3KRWB 3F3FA 2EIDA 3NIFA 4WJKA 4GMBA 4FA1D 2VDMA 1MG3A 2OK4A 4FHLA 4ESGA 3EQ7A 4PSXB 2OVQB 5M5VA 3I7LA 2IAAA 1B9YA 1GOTB 2YNOA 5E6UA 2IUPA 2PM7B 5JWZA 1VYHC 4JHPC 2AGZA 3V4VA 4GM3A 4A2MA 3EI2B 2AH0A 3OKYA 3ODTA 4FAVD 3EQ8A 1Q47A 2VZ3A 1T2XA 5M5RA 4JD2C 2VDPA 3MKSB 4IRZA 2UZYB 4JT5C 5K1CC 4KFMB 2WQ8A 1E8NA 5CXBB 3GFCA 4J73A 3JZGA 1VE7A 3ZDXA 5C92A 4A0AB 3I7HA 3SBRA 2J56H 2O9KA 3JB9L 2IUVA 2IWKA 2PBIB 3OW8A 1K8KC 1SHYB 5FFGA 2PM9B 4BUJC 4QRJA 1JV2A 3ZDYA 4ZOZA 3JZHA 5A2Qg 4PBYA 4R7AB 4U1EI 3EU7A 1S4UX 4NC4A 3K72A 4WK0A 1GXRA 4O3TB 5EMKB 4GM8A 3GC3B 3ORVD 5HDBA 2AQ5A 4ERYA 2J55H 3DXMC 4J84A 5TEFA 3I8CA 3EI2A 3UVOA 3F3PA 2QC5A 2GC4A 5B4WA 2QXVA 2TRCB 3E0CA 5H17A 4K3ID 3V7DB 4QQEA 3RFHA 3RRMC 3K6SA 2HXCA 4GM9A 3I2NA 4J8BA 4A11B 4X63B 5CXBA 4XYHA 4CZXA 2HKMA 5I5JA 3JPXA 4JXMA 4A0AA 2XZGA 3CIKB 4PNKB 4XYIA 2I0TA 4JHNA 3SBQA 1XIPA 3RFGA 3EWEA 4L1MA 5TEEA 4A08B 3I7OA 3O4JA 4L9OA 5CXCA 2H6QA 2PM9A 3PSCB 4NENA 5EAPA 2H14A 4IA9A 5TF2A 5AFU3 4PXWA 1NR0A 1GOGA 3QI0A 5HE1B 3I7PA 4TZ4A 4MMXA 4J87A 5FKTA 1VZ3A 2OK6A 5AJAA 5FLXg 3AH8B 4FA5D 4FA4D 1XKSA 5IJ8E 1GG2B 3RN0D 4DNUA 2BBKH 3AL9A 4PSWB 4CI3A 5K19A 2CE9A 4JSPC 4LG8A 3AL8B 3MUNA 5IT9g 1JTDB 4RE5A 4A2LA 5I5MA 3PXTD 3ZE2A 1FWXA 2HJ4A 3GD1I 1YFQA 3IJCA 4D0KA 3N0EA 5EAMA 3SJLD 1NEXB 1H2YA 5FXYA 5FKRA 4BCDA 3PE7A 3UVMA 1L5GA 2HU5A 2VDNA 4AOWA 4AMYA 4BL0A 4CY5A 2H68A 2Z2NA 1N6FA 3OKWA 4J77A 4A11A 1O6FA 5GXHA 3FM0A 3IUJA 4CI8A 4ZOYA 4QL1A 5HE2B 2P9NC 5E6RA 5CYKB 3SVWD 1U2VC 3PVUB 3SXTD 4A08A 5GXIA 4NSXA 3N0DA 3UKRC 1SQJA 5HE3B 1R5MA 4BCCA 1GP2B 2H9NA 2BKLA 3OL2B 3JAMg 2B4EA 2P9IC 3C99A 1I2MB 2XU7A 4RE6A 4L1QD 4J82A 1M1XA 3C5MA 2G99A 3VGZA 2H3XA 3I8EA 4G1EA 4OWRA 2HJBA 4CI1A 3RN1D 2IURA 3J81g 5C2WB 3AL8A 3P4FA 5FKSA 3DM0A 4GQ1A 4G56B 5GSAA 3SWSD 3IKOA 4Z7OA 2CO0C 2B5LA 2GC7A 3EI1B 5TDHB 2QZPA 5CXCB 5I5IA 4LG9A 4JSVC 4ZOVA 5IGOA 2G9AA 2IWFA 3UKUC 5EM2B 4H5JA 4D9SA 4DNVA 4O3UB 3IURA 3SCYA 3V9FA 4N14A 3DXKC 2P9PC 1GOFA 3GREA 2P9LC 4Y7RA 4AMZA 4JSXC 3JROA 1E5TA 2VDLA 3MVDK 5CYKA 4BP9A 4X3EA 1TYEA 3EI4B 5EARA 3F3GA 4J8GA 4AEZA 2AGXA 5HE0B 5H1MA 4L3GD 4LGNA 4CI2A 1P22A 4Z7QA 1RI6A 4OZUA 2CN2A 3OL2A 4CY3A 3HFQA 1ERJA 1UTCA 3SMRA 5M5UA 3MZLA 3K27A 1TBGA 2I3SA 4GZ8A 4CZYA 5IGQA 2H9MA 3C75H 1JMXB 3OKTA 5C86A 3IJ0A 2PM6B 3I89A 5FQDA 3A0FA 3K26A 2YNNA 5EMMB 3EI1A 3UVLA 4G55A 1H2WA 3IULA 4GGAA 4MMZA 3ZE1A 3DSMA 3SLED 1K32A 5EM2A 2VDKA 4CY2A 1YR2A 3FCSA 1H2ZA 1SQ9A 2P9KC 4PBZA 4ZOXA 3U4YA 1N6DA 1QFMA 3RMZD 2W18A 3O4HA 4O2WA 3IIYA 3VH0A 2HKRA 2OVRB 4CC9A 3DWLC 3EI4A 2I0SA 4Z7NA 3V5WB 5M61A 3PXSD 2AGYA
chains in the Genus database with same CATH topology
3MMYA 2EBSA 4J0XA 2XYIA 3PVWB 4ES0A 5THAA 2GNQA 1JOFA 3PXWD 2P9SC 4O9DA 3SFZA 5C9ZB 3PSLA 4ERZA 3JZNA 4CZVA 4FAND 3VA6A 4HDJA 1PI6A 4I79A 3RLMD 3I7NA 4XEIC 4ZN4A 3FGBA 3FRXA 4A0BB 2AH1A 4BH6A 3NVNA 4EWRA 3MXXA 4E5ZB 5EMLB 4O1QD 4A7JA 1MG2A 4GGCA 2UZXB 3W15A 4J81A 1JJUB 2B5MA 4H5IA 4QT8A 3ULEC 2HYEA 4CY1A 3C9CA 2YB8B 5FKQA 5SXMA 2AGWA 2YMUA 4GGDA 4A09B 3IJ1A 1TYQC 3SN6B 4PC0A 4J78A 3B7FA 3UVKA 5C2VB 1OLZA 2Z2OA 2OJYA 3JRPA 3EI3B 3OTTA 4GQ2P 1PEVA 4J79A 3IIWA 2XL2A 4L3HD 1XHMA 5HYNB 5IJ7E 4YVDA 4JT6C 2IUQA 4A0BA 4E54B 1JMZB 4MK0B 2B5NA 4FB1D 2CN3A 4IMMA 4UI9R 4E5ZA 4X60B 2AGLA 3CFSB 2HESX 1OMWB 3J80g 3BG1A 4K3JB 2OVPB 5EMJB 2H9LA 3NVQA 4JSNC 3SBPA 4ERQA 2CO0A 1L0QA 4A09A 1PBYB 2Q7QA 4GQBB 2Z2PA 3EG6A 4X61B 2J57G 3NVXA 3UR4A 5KDOB 3L4MD 2H47A 3UVNA 4D6VA 5H14A 3MKQA 1MDAH 3EI3A 3RSEC 5AMSA 2P9UC 1PGUA 2H13A 2YNPA 3OKYB 3ZWLB 2YBAA 3BWSA 3KRXB 3BG0A 2H9PA 2I3TA 4Y5RD 4Z8LA 2H6NA 4J86A 1U4CA 4E54A 4FA9D 3EMHA 1A0RB 2XL3A 4J0WA 1N6EA 5GMKn 2OIZA 3I7KA 2CE8A 4FWWA 5FA5B 3L4OD 2CNXA 4O45A 5EALA 3SHFA 3MZKA 3CFVA 5IC7A 5HQGA 2BCJB 4U7AA 2MTAH 2H6KA 1B9XA 3AFCA 2I0RA 1QNIA 3KRWB 3F3FA 4GMBA 4FA1D 1MG3A 2OK4A 4FHLA 4ESGA 4PSXB 2OVQB 3I7LA 2IAAA 1B9YA 1GOTB 2YNOA 2IUPA 2PM7B 5JWZA 1VYHC 2AGZA 3EI2B 4GM3A 4A2MA 2AH0A 3OKYA 3ODTA 4FAVD 1Q47A 4JD2C 3MKSB 2UZYB 4JT5C 5K1CC 4KFMB 5CXBB 3GFCA 4J73A 3JZGA 4A0AB 3I7HA 3SBRA 2J56H 2O9KA 3JB9L 2IUVA 2IWKA 2PBIB 3OW8A 1K8KC 1SHYB 2PM9B 4BUJC 4QRJA 4ZOZA 3JZHA 5A2Qg 4PBYA 4R7AB 4U1EI 3EU7A 1S4UX 1GXRA 4O3TB 5EMKB 4GM8A 3ORVD 2AQ5A 4ERYA 2J55H 3DXMC 4J84A 5TEFA 3I8CA 3EI2A 3UVOA 3F3PA 2QC5A 2GC4A 5B4WA 2QXVA 2TRCB 3E0CA 5H17A 4K3ID 3V7DB 4QQEA 3RFHA 3RRMC 2HXCA 4GM9A 3I2NA 4J8BA 4A11B 4X63B 5CXBA 4XYHA 4CZXA 2HKMA 5I5JA 3JPXA 4JXMA 4A0AA 3CIKB 4PNKB 4XYIA 2I0TA 3SBQA 1XIPA 3RFGA 3EWEA 5TEEA 4A08B 3I7OA 4L9OA 5CXCA 2H6QA 2PM9A 3PSCB 5EAPA 2H14A 4IA9A 5TF2A 5AFU3 4PXWA 1NR0A 5HE1B 3I7PA 4TZ4A 4J87A 5FKTA 2OK6A 5AJAA 5FLXg 3AH8B 4FA5D 4FA4D 1XKSA 5IJ8E 1GG2B 3RN0D 2BBKH 3AL9A 4PSWB 4CI3A 5K19A 2CE9A 4JSPC 4LG8A 3AL8B 5IT9g 4A2LA 5I5MA 3PXTD 1FWXA 2HJ4A 1YFQA 3IJCA 4D0KA 3N0EA 5EAMA 3SJLD 1NEXB 5FXYA 5FKRA 3PE7A 3UVMA 4AOWA 4BL0A 4CY5A 2H68A 2Z2NA 1N6FA 3OKWA 4J77A 4A11A 5GXHA 3FM0A 4CI8A 4ZOYA 4QL1A 5HE2B 2P9NC 5CYKB 3SVWD 1U2VC 3PVUB 3SXTD 4A08A 5GXIA 4NSXA 3N0DA 3UKRC 1SQJA 5HE3B 1R5MA 1GP2B 2H9NA 3OL2B 3JAMg 2B4EA 2P9IC 3C99A 2XU7A 4L1QD 4J82A 3VGZA 3C5MA 2G99A 2H3XA 3I8EA 4OWRA 2HJBA 4CI1A 3RN1D 2IURA 3J81g 5C2WB 3AL8A 3P4FA 5FKSA 3DM0A 4GQ1A 4G56B 5GSAA 3SWSD 3IKOA 2CO0C 2B5LA 2GC7A 3EI1B 5TDHB 5CXCB 5I5IA 4LG9A 4JSVC 4ZOVA 5IGOA 2G9AA 2IWFA 3UKUC 5EM2B 4H5JA 4O3UB 3SCYA 3V9FA 4N14A 3DXKC 2P9PC 3GREA 2P9LC 4Y7RA 4JSXC 3JROA 5CYKA 4X3EA 3EI4B 5EARA 3F3GA 4J8GA 4AEZA 2AGXA 5HE0B 5H1MA 4L3GD 4LGNA 4CI2A 1P22A 1RI6A 4OZUA 2CN2A 3OL2A 4CY3A 3HFQA 1ERJA 3SMRA 3MZLA 3K27A 1TBGA 2I3SA 4GZ8A 4CZYA 5IGQA 2H9MA 3C75H 1JMXB 3OKTA 3IJ0A 2PM6B 3I89A 5FQDA 3A0FA 3K26A 2YNNA 5EMMB 3EI1A 3UVLA 4GGAA 3DSMA 3SLED 1K32A 5EM2A 4CY2A 1SQ9A 2P9KC 4PBZA 4ZOXA 3U4YA 1N6DA 3RMZD 2W18A 3IIYA 3VH0A 2HKRA 2OVRB 4CC9A 3DWLC 3EI4A 2I0SA 3V5WB 3PXSD 2AGYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MMY A;  2EBS A;  4J0X A;  2XYI A;  3PVW B;  4ES0 A;  5THA A;  2GNQ A;  1JOF A;  3PXW D;  2P9S C;  4O9D A;  3SFZ A;  5C9Z B;  3PSL A;  4ERZ A;  3JZN A;  4CZV A;  4FAN D;  3VA6 A;  4HDJ A;  1PI6 A;  4I79 A;  3RLM D;  3I7N A;  4XEI C;  4ZN4 A;  3FGB A;  3FRX A;  4A0B B;  2AH1 A;  4BH6 A;  3NVN A;  4EWR A;  3MXX A;  4E5Z B;  5EML B;  4O1Q D;  4A7J A;  1MG2 A;  4GGC A;  2UZX B;  3W15 A;  4J81 A;  1JJU B;  2B5M A;  4H5I A;  4QT8 A;  3ULE C;  2HYE A;  4CY1 A;  3C9C A;  2YB8 B;  5FKQ A;  5SXM A;  2AGW A;  2YMU A;  4GGD A;  4A09 B;  3IJ1 A;  1TYQ C;  3SN6 B;  4PC0 A;  4J78 A;  3B7F A;  3UVK A;  5C2V B;  1OLZ A;  2Z2O A;  2OJY A;  3JRP A;  3EI3 B;  3OTT A;  4GQ2 P;  1PEV A;  4J79 A;  3IIW A;  2XL2 A;  4L3H D;  1XHM A;  5HYN B;  5IJ7 E;  4YVD A;  4JT6 C;  2IUQ A;  4A0B A;  4E54 B;  1JMZ B;  4MK0 B;  2B5N A;  4FB1 D;  2CN3 A;  4IMM A;  4UI9 R;  4E5Z A;  4X60 B;  2AGL A;  3CFS B;  2HES X;  1OMW B;  3J80 g;  3BG1 A;  4K3J B;  2OVP B;  5EMJ B;  2H9L A;  3NVQ A;  4JSN C;  3SBP A;  4ERQ A;  2CO0 A;  1L0Q A;  4A09 A;  1PBY B;  2Q7Q A;  4GQB B;  2Z2P A;  3EG6 A;  4X61 B;  2J57 G;  3NVX A;  3UR4 A;  5KDO B;  3L4M D;  2H47 A;  3UVN A;  4D6V A;  5H14 A;  3MKQ A;  1MDA H;  3EI3 A;  3RSE C;  5AMS A;  2P9U C;  1PGU A;  2H13 A;  2YNP A;  3OKY B;  3ZWL B;  2YBA A;  3BWS A;  3KRX B;  3BG0 A;  2H9P A;  2I3T A;  4Y5R D;  4Z8L A;  2H6N A;  4J86 A;  1U4C A;  4E54 A;  4FA9 D;  3EMH A;  1A0R B;  2XL3 A;  4J0W A;  1N6E A;  5GMK n;  2OIZ A;  3I7K A;  2CE8 A;  4FWW A;  5FA5 B;  3L4O D;  2CNX A;  4O45 A;  5EAL A;  3SHF A;  3MZK A;  3CFV A;  5IC7 A;  5HQG A;  2BCJ B;  4U7A A;  2MTA H;  2H6K A;  1B9X A;  3AFC A;  2I0R A;  1QNI A;  3KRW B;  3F3F A;  4GMB A;  4FA1 D;  1MG3 A;  2OK4 A;  4FHL A;  4ESG A;  4PSX B;  2OVQ B;  3I7L A;  2IAA A;  1B9Y A;  1GOT B;  2YNO A;  2IUP A;  2PM7 B;  5JWZ A;  1VYH C;  2AGZ A;  3EI2 B;  4GM3 A;  4A2M A;  2AH0 A;  3OKY A;  3ODT A;  4FAV D;  1Q47 A;  4JD2 C;  3MKS B;  2UZY B;  4JT5 C;  5K1C C;  4KFM B;  5CXB B;  3GFC A;  4J73 A;  3JZG A;  4A0A B;  3I7H A;  3SBR A;  2J56 H;  2O9K A;  3JB9 L;  2IUV A;  2IWK A;  2PBI B;  3OW8 A;  1K8K C;  1SHY B;  2PM9 B;  4BUJ C;  4QRJ A;  4ZOZ A;  3JZH A;  5A2Q g;  4PBY A;  4R7A B;  4U1E I;  3EU7 A;  1S4U X;  1GXR A;  4O3T B;  5EMK B;  4GM8 A;  3ORV D;  2AQ5 A;  4ERY A;  2J55 H;  3DXM C;  4J84 A;  5TEF A;  3I8C A;  3EI2 A;  3UVO A;  3F3P A;  2QC5 A;  2GC4 A;  5B4W A;  2QXV A;  2TRC B;  3E0C A;  5H17 A;  4K3I D;  3V7D B;  4QQE A;  3RFH A;  3RRM C;  2HXC A;  4GM9 A;  3I2N A;  4J8B A;  4A11 B;  4X63 B;  5CXB A;  4XYH A;  4CZX A;  2HKM A;  5I5J A;  3JPX A;  4JXM A;  4A0A A;  3CIK B;  4PNK B;  4XYI A;  2I0T A;  3SBQ A;  1XIP A;  3RFG A;  3EWE A;  5TEE A;  4A08 B;  3I7O A;  4L9O A;  5CXC A;  2H6Q A;  2PM9 A;  3PSC B;  5EAP A;  2H14 A;  4IA9 A;  5TF2 A;  5AFU 3;  4PXW A;  1NR0 A;  5HE1 B;  3I7P A;  4TZ4 A;  4J87 A;  5FKT A;  2OK6 A;  5AJA A;  5FLX g;  3AH8 B;  4FA5 D;  4FA4 D;  1XKS A;  5IJ8 E;  1GG2 B;  3RN0 D;  2BBK H;  3AL9 A;  4PSW B;  4CI3 A;  5K19 A;  2CE9 A;  4JSP C;  4LG8 A;  3AL8 B;  5IT9 g;  4A2L A;  5I5M A;  3PXT D;  1FWX A;  2HJ4 A;  1YFQ A;  3IJC A;  4D0K A;  3N0E A;  5EAM A;  3SJL D;  1NEX B;  5FXY A;  5FKR A;  3PE7 A;  3UVM A;  4AOW A;  4BL0 A;  4CY5 A;  2H68 A;  2Z2N A;  1N6F A;  3OKW A;  4J77 A;  4A11 A;  5GXH A;  3FM0 A;  4CI8 A;  4ZOY A;  4QL1 A;  5HE2 B;  2P9N C;  5CYK B;  3SVW D;  1U2V C;  3PVU B;  3SXT D;  4A08 A;  5GXI A;  4NSX A;  3N0D A;  3UKR C;  1SQJ A;  5HE3 B;  1R5M A;  1GP2 B;  2H9N A;  3OL2 B;  3JAM g;  2B4E A;  2P9I C;  3C99 A;  2XU7 A;  4L1Q D;  4J82 A;  3VGZ A;  3C5M A;  2G99 A;  2H3X A;  3I8E A;  4OWR A;  2HJB A;  4CI1 A;  3RN1 D;  2IUR A;  3J81 g;  5C2W B;  3AL8 A;  3P4F A;  5FKS A;  3DM0 A;  4GQ1 A;  4G56 B;  5GSA A;  3SWS D;  3IKO A;  2CO0 C;  2B5L A;  2GC7 A;  3EI1 B;  5TDH B;  5CXC B;  5I5I A;  4LG9 A;  4JSV C;  4ZOV A;  5IGO A;  2G9A A;  2IWF A;  3UKU C;  5EM2 B;  4H5J A;  4O3U B;  3SCY A;  3V9F A;  4N14 A;  3DXK C;  2P9P C;  3GRE A;  2P9L C;  4Y7R A;  4JSX C;  3JRO A;  5CYK A;  4X3E A;  3EI4 B;  5EAR A;  3F3G A;  4J8G A;  4AEZ A;  2AGX A;  5HE0 B;  5H1M A;  4L3G D;  4LGN A;  4CI2 A;  1P22 A;  1RI6 A;  4OZU A;  2CN2 A;  3OL2 A;  4CY3 A;  3HFQ A;  1ERJ A;  3SMR A;  3MZL A;  3K27 A;  1TBG A;  2I3S A;  4GZ8 A;  4CZY A;  5IGQ A;  2H9M A;  3C75 H;  1JMX B;  3OKT A;  3IJ0 A;  2PM6 B;  3I89 A;  5FQD A;  3A0F A;  3K26 A;  2YNN A;  5EMM B;  3EI1 A;  3UVL A;  4GGA A;  3DSM A;  3SLE D;  1K32 A;  5EM2 A;  4CY2 A;  1SQ9 A;  2P9K C;  4PBZ A;  4ZOX A;  3U4Y A;  1N6D A;  3RMZ D;  2W18 A;  3IIY A;  3VH0 A;  2HKR A;  2OVR B;  4CC9 A;  3DWL C;  3EI4 A;  2I0S A;  3V5W B;  3PXS D;  2AGY A; 
#chains in the Genus database with same CATH topology
 5M5S A;  3MMY A;  5FFO A;  2EBS A;  4J0X A;  2XYI A;  3PVW B;  4ES0 A;  5THA A;  2GNQ A;  1JOF A;  3PXW D;  2P9S C;  1E8M A;  4O9D A;  3SFZ A;  5C9Z B;  4NBM A;  3MUO A;  3PSL A;  4ERZ A;  3JZN A;  4CZV A;  4FAN D;  3VA6 A;  4HDJ A;  3K71 A;  1PI6 A;  4I79 A;  2HU8 A;  3RLM D;  3I7N A;  4XEI C;  4ZN4 A;  3FGB A;  3DDU A;  4O02 A;  3FRX A;  4A0B B;  2AH1 A;  4BH6 A;  4G1M A;  2JKX A;  3NVN A;  4EWR A;  1VE6 A;  2VDQ A;  3MXX A;  4E5Z B;  5EML B;  4O1Q D;  4A7J A;  1MG2 A;  4GGC A;  2UZX B;  3W15 A;  4J81 A;  1JJU B;  2B5M A;  4H5I A;  4QT8 A;  3ULE C;  4AX4 A;  2HYE A;  4BP8 A;  1GOH A;  4CY1 A;  3C9C A;  2XDW A;  2YB8 B;  5FKQ A;  3NIG A;  5SXM A;  2AGW A;  2YMU A;  4GGD A;  4A09 B;  3IUN A;  3IJ1 A;  3FCU A;  2HU7 A;  1TYQ C;  4UM8 A;  1K3I A;  4PC0 A;  4J78 A;  3SN6 B;  4BCB A;  3B7F A;  3UVK A;  5C2V B;  1OLZ A;  2Z2O A;  3T3M A;  4DNW A;  2OJY A;  3NID A;  3JRP A;  3EI3 B;  3OTT A;  4GQ2 P;  1PEV A;  2EIE A;  4J79 A;  2EIC A;  3IIW A;  2XL2 A;  1H2X A;  4L3H D;  3OF7 A;  1XHM A;  3ZE0 A;  5HYN B;  5IJ7 E;  4YVD A;  4JT6 C;  2VDR A;  2IUQ A;  4A0B A;  4QAM A;  2EIB A;  4E54 B;  1JMZ B;  4MMY A;  4MK0 B;  2B5N A;  4WK2 A;  4FB1 D;  3IVM A;  2CN3 A;  4IMM A;  4UI9 R;  4E5Z A;  4X60 B;  2AGL A;  3CFS B;  3IUM A;  2HES X;  1OMW B;  4WK4 A;  3J80 g;  3VI3 A;  3QHY B;  3BG1 A;  4K3J B;  2OVP B;  2VC2 A;  2H9L A;  5EMJ B;  3NVQ A;  1UOQ A;  4JSN C;  3SBP A;  4ERQ A;  1O6G A;  2CO0 A;  2XE4 A;  1L0Q A;  1A12 A;  1QFS A;  4A09 A;  2VDO A;  1PBY B;  3IJE A;  2Q7Q A;  4GQB B;  2Z2P A;  3EG6 A;  4X61 B;  2J57 G;  5M5T A;  3NVX A;  3UR4 A;  5KDO B;  3L4M D;  1U8C A;  2H47 A;  3UVN A;  1C9I A;  4D6V A;  5H14 A;  4NAA A;  3MKQ A;  4UM9 A;  1MDA H;  3EI3 A;  3RSE C;  5AMS A;  5E6S A;  3VI4 A;  2P9U C;  1PGU A;  2H13 A;  2YNP A;  2QR5 A;  3OKY B;  3ZWL B;  2YBA A;  3BWS A;  3ZDZ A;  3KRX B;  3BG0 A;  2H9P A;  2I3T A;  4AN0 A;  4Y5R D;  4Z8L A;  2H6N A;  4J86 A;  1U4C A;  3T3P A;  4E54 A;  4FA9 D;  3EMH A;  1A0R B;  2XL3 A;  4J0W A;  1N6E A;  2VZ1 A;  5GMK n;  2OIZ A;  1C9L A;  1UOO A;  3I7K A;  2CE8 A;  4FWW A;  5FA5 B;  3L4O D;  3IUQ A;  2CNX A;  1BPO A;  3EQ9 A;  1UOP A;  4O45 A;  5EAL A;  3O4I A;  3SHF A;  3MZK A;  3KCI A;  3CFV A;  5IC7 A;  3O4G A;  5HQG A;  1VZ2 A;  2BCJ B;  3V4P A;  4AN1 A;  4U7A A;  2MTA H;  2H6K A;  1B9X A;  3AFC A;  2I0R A;  1QNI A;  3KRW B;  3F3F A;  2EID A;  3NIF A;  4WJK A;  4GMB A;  4FA1 D;  2VDM A;  1MG3 A;  2OK4 A;  4FHL A;  4ESG A;  3EQ7 A;  4PSX B;  2OVQ B;  5M5V A;  3I7L A;  2IAA A;  1B9Y A;  1GOT B;  2YNO A;  5E6U A;  2IUP A;  2PM7 B;  5JWZ A;  1VYH C;  4JHP C;  2AGZ A;  3V4V A;  4GM3 A;  4A2M A;  3EI2 B;  2AH0 A;  3OKY A;  3ODT A;  4FAV D;  3EQ8 A;  1Q47 A;  2VZ3 A;  1T2X A;  5M5R A;  4JD2 C;  2VDP A;  3MKS B;  4IRZ A;  2UZY B;  4JT5 C;  5K1C C;  4KFM B;  2WQ8 A;  1E8N A;  5CXB B;  3GFC A;  4J73 A;  3JZG A;  1VE7 A;  3ZDX A;  5C92 A;  4A0A B;  3I7H A;  3SBR A;  2J56 H;  2O9K A;  3JB9 L;  2IUV A;  2IWK A;  2PBI B;  3OW8 A;  1K8K C;  1SHY B;  5FFG A;  2PM9 B;  4BUJ C;  4QRJ A;  1JV2 A;  3ZDY A;  4ZOZ A;  3JZH A;  5A2Q g;  4PBY A;  4R7A B;  4U1E I;  3EU7 A;  1S4U X;  4NC4 A;  3K72 A;  4WK0 A;  1GXR A;  4O3T B;  5EMK B;  4GM8 A;  3GC3 B;  3ORV D;  5HDB A;  2AQ5 A;  4ERY A;  2J55 H;  3DXM C;  4J84 A;  5TEF A;  3I8C A;  3EI2 A;  3UVO A;  3F3P A;  2QC5 A;  2GC4 A;  5B4W A;  2QXV A;  2TRC B;  3E0C A;  5H17 A;  4K3I D;  3V7D B;  4QQE A;  3RFH A;  3RRM C;  3K6S A;  2HXC A;  4GM9 A;  3I2N A;  4J8B A;  4A11 B;  4X63 B;  5CXB A;  4XYH A;  4CZX A;  2HKM A;  5I5J A;  3JPX A;  4JXM A;  4A0A A;  2XZG A;  3CIK B;  4PNK B;  4XYI A;  2I0T A;  4JHN A;  3SBQ A;  1XIP A;  3RFG A;  3EWE A;  4L1M A;  5TEE A;  4A08 B;  3I7O A;  3O4J A;  4L9O A;  5CXC A;  2H6Q A;  2PM9 A;  3PSC B;  4NEN A;  5EAP A;  2H14 A;  4IA9 A;  5TF2 A;  5AFU 3;  4PXW A;  1NR0 A;  1GOG A;  3QI0 A;  5HE1 B;  3I7P A;  4TZ4 A;  4MMX A;  4J87 A;  5FKT A;  1VZ3 A;  2OK6 A;  5AJA A;  5FLX g;  3AH8 B;  4FA5 D;  4FA4 D;  1XKS A;  5IJ8 E;  1GG2 B;  3RN0 D;  4DNU A;  2BBK H;  3AL9 A;  4PSW B;  4CI3 A;  5K19 A;  2CE9 A;  4JSP C;  4LG8 A;  3AL8 B;  3MUN A;  5IT9 g;  1JTD B;  4RE5 A;  4A2L A;  5I5M A;  3PXT D;  3ZE2 A;  1FWX A;  2HJ4 A;  3GD1 I;  1YFQ A;  3IJC A;  4D0K A;  3N0E A;  5EAM A;  3SJL D;  1NEX B;  1H2Y A;  5FXY A;  5FKR A;  4BCD A;  3PE7 A;  3UVM A;  1L5G A;  2HU5 A;  2VDN A;  4AOW A;  4AMY A;  4BL0 A;  4CY5 A;  2H68 A;  2Z2N A;  1N6F A;  3OKW A;  4J77 A;  4A11 A;  1O6F A;  5GXH A;  3FM0 A;  3IUJ A;  4CI8 A;  4ZOY A;  4QL1 A;  5HE2 B;  2P9N C;  5E6R A;  5CYK B;  3SVW D;  1U2V C;  3PVU B;  3SXT D;  4A08 A;  5GXI A;  4NSX A;  3N0D A;  3UKR C;  1SQJ A;  5HE3 B;  1R5M A;  4BCC A;  1GP2 B;  2H9N A;  2BKL A;  3OL2 B;  3JAM g;  2B4E A;  2P9I C;  3C99 A;  1I2M B;  2XU7 A;  4RE6 A;  4L1Q D;  4J82 A;  1M1X A;  3C5M A;  2G99 A;  3VGZ A;  2H3X A;  3I8E A;  4G1E A;  4OWR A;  2HJB A;  4CI1 A;  3RN1 D;  2IUR A;  3J81 g;  5C2W B;  3AL8 A;  3P4F A;  5FKS A;  3DM0 A;  4GQ1 A;  4G56 B;  5GSA A;  3SWS D;  3IKO A;  4Z7O A;  2CO0 C;  2B5L A;  2GC7 A;  3EI1 B;  5TDH B;  2QZP A;  5CXC B;  5I5I A;  4LG9 A;  4JSV C;  4ZOV A;  5IGO A;  2G9A A;  2IWF A;  3UKU C;  5EM2 B;  4H5J A;  4D9S A;  4DNV A;  4O3U B;  3IUR A;  3SCY A;  3V9F A;  4N14 A;  3DXK C;  2P9P C;  1GOF A;  3GRE A;  2P9L C;  4Y7R A;  4AMZ A;  4JSX C;  3JRO A;  1E5T A;  2VDL A;  3MVD K;  5CYK A;  4BP9 A;  4X3E A;  1TYE A;  3EI4 B;  5EAR A;  3F3G A;  4J8G A;  4AEZ A;  2AGX A;  5HE0 B;  5H1M A;  4L3G D;  4LGN A;  4CI2 A;  1P22 A;  4Z7Q A;  1RI6 A;  4OZU A;  2CN2 A;  3OL2 A;  4CY3 A;  3HFQ A;  1ERJ A;  1UTC A;  3SMR A;  5M5U A;  3MZL A;  3K27 A;  1TBG A;  2I3S A;  4GZ8 A;  4CZY A;  5IGQ A;  2H9M A;  3C75 H;  1JMX B;  3OKT A;  5C86 A;  3IJ0 A;  2PM6 B;  3I89 A;  5FQD A;  3A0F A;  3K26 A;  2YNN A;  5EMM B;  3EI1 A;  3UVL A;  4G55 A;  1H2W A;  3IUL A;  4GGA A;  4MMZ A;  3ZE1 A;  3DSM A;  3SLE D;  1K32 A;  5EM2 A;  2VDK A;  4CY2 A;  1YR2 A;  3FCS A;  1H2Z A;  1SQ9 A;  2P9K C;  4PBZ A;  4ZOX A;  3U4Y A;  1N6D A;  1QFM A;  3RMZ D;  2W18 A;  3O4H A;  4O2W A;  3IIY A;  3VH0 A;  2HKR A;  2OVR B;  4CC9 A;  3DWL C;  3EI4 A;  2I0S A;  4Z7N A;  3V5W B;  5M61 A;  3PXS D;  2AGY A; 
#chains in the Genus database with same CATH homology
 3MMY A;  2EBS A;  4J0X A;  2XYI A;  3PVW B;  4ES0 A;  5THA A;  2GNQ A;  1JOF A;  3PXW D;  2P9S C;  4O9D A;  3SFZ A;  5C9Z B;  3PSL A;  4ERZ A;  3JZN A;  4CZV A;  4FAN D;  3VA6 A;  4HDJ A;  1PI6 A;  4I79 A;  3RLM D;  3I7N A;  4XEI C;  4ZN4 A;  3FGB A;  3FRX A;  4A0B B;  2AH1 A;  4BH6 A;  3NVN A;  4EWR A;  3MXX A;  4E5Z B;  5EML B;  4O1Q D;  4A7J A;  1MG2 A;  4GGC A;  2UZX B;  3W15 A;  4J81 A;  1JJU B;  2B5M A;  4H5I A;  4QT8 A;  3ULE C;  2HYE A;  4CY1 A;  3C9C A;  2YB8 B;  5FKQ A;  5SXM A;  2AGW A;  2YMU A;  4GGD A;  4A09 B;  3IJ1 A;  1TYQ C;  3SN6 B;  4PC0 A;  4J78 A;  3B7F A;  3UVK A;  5C2V B;  1OLZ A;  2Z2O A;  2OJY A;  3JRP A;  3EI3 B;  3OTT A;  4GQ2 P;  1PEV A;  4J79 A;  3IIW A;  2XL2 A;  4L3H D;  1XHM A;  5HYN B;  5IJ7 E;  4YVD A;  4JT6 C;  2IUQ A;  4A0B A;  4E54 B;  1JMZ B;  4MK0 B;  2B5N A;  4FB1 D;  2CN3 A;  4IMM A;  4UI9 R;  4E5Z A;  4X60 B;  2AGL A;  3CFS B;  2HES X;  1OMW B;  3J80 g;  3BG1 A;  4K3J B;  2OVP B;  5EMJ B;  2H9L A;  3NVQ A;  4JSN C;  3SBP A;  4ERQ A;  2CO0 A;  1L0Q A;  4A09 A;  1PBY B;  2Q7Q A;  4GQB B;  2Z2P A;  3EG6 A;  4X61 B;  2J57 G;  3NVX A;  3UR4 A;  5KDO B;  3L4M D;  2H47 A;  3UVN A;  4D6V A;  5H14 A;  3MKQ A;  1MDA H;  3EI3 A;  3RSE C;  5AMS A;  2P9U C;  1PGU A;  2H13 A;  2YNP A;  3OKY B;  3ZWL B;  2YBA A;  3BWS A;  3KRX B;  3BG0 A;  2H9P A;  2I3T A;  4Y5R D;  4Z8L A;  2H6N A;  4J86 A;  1U4C A;  4E54 A;  4FA9 D;  3EMH A;  1A0R B;  2XL3 A;  4J0W A;  1N6E A;  5GMK n;  2OIZ A;  3I7K A;  2CE8 A;  4FWW A;  5FA5 B;  3L4O D;  2CNX A;  4O45 A;  5EAL A;  3SHF A;  3MZK A;  3CFV A;  5IC7 A;  5HQG A;  2BCJ B;  4U7A A;  2MTA H;  2H6K A;  1B9X A;  3AFC A;  2I0R A;  1QNI A;  3KRW B;  3F3F A;  4GMB A;  4FA1 D;  1MG3 A;  2OK4 A;  4FHL A;  4ESG A;  4PSX B;  2OVQ B;  3I7L A;  2IAA A;  1B9Y A;  1GOT B;  2YNO A;  2IUP A;  2PM7 B;  5JWZ A;  1VYH C;  2AGZ A;  3EI2 B;  4GM3 A;  4A2M A;  2AH0 A;  3OKY A;  3ODT A;  4FAV D;  1Q47 A;  4JD2 C;  3MKS B;  2UZY B;  4JT5 C;  5K1C C;  4KFM B;  5CXB B;  3GFC A;  4J73 A;  3JZG A;  4A0A B;  3I7H A;  3SBR A;  2J56 H;  2O9K A;  3JB9 L;  2IUV A;  2IWK A;  2PBI B;  3OW8 A;  1K8K C;  1SHY B;  2PM9 B;  4BUJ C;  4QRJ A;  4ZOZ A;  3JZH A;  5A2Q g;  4PBY A;  4R7A B;  4U1E I;  3EU7 A;  1S4U X;  1GXR A;  4O3T B;  5EMK B;  4GM8 A;  3ORV D;  2AQ5 A;  4ERY A;  2J55 H;  3DXM C;  4J84 A;  5TEF A;  3I8C A;  3EI2 A;  3UVO A;  3F3P A;  2QC5 A;  2GC4 A;  5B4W A;  2QXV A;  2TRC B;  3E0C A;  5H17 A;  4K3I D;  3V7D B;  4QQE A;  3RFH A;  3RRM C;  2HXC A;  4GM9 A;  3I2N A;  4J8B A;  4A11 B;  4X63 B;  5CXB A;  4XYH A;  4CZX A;  2HKM A;  5I5J A;  3JPX A;  4JXM A;  4A0A A;  3CIK B;  4PNK B;  4XYI A;  2I0T A;  3SBQ A;  1XIP A;  3RFG A;  3EWE A;  5TEE A;  4A08 B;  3I7O A;  4L9O A;  5CXC A;  2H6Q A;  2PM9 A;  3PSC B;  5EAP A;  2H14 A;  4IA9 A;  5TF2 A;  5AFU 3;  4PXW A;  1NR0 A;  5HE1 B;  3I7P A;  4TZ4 A;  4J87 A;  5FKT A;  2OK6 A;  5AJA A;  5FLX g;  3AH8 B;  4FA5 D;  4FA4 D;  1XKS A;  5IJ8 E;  1GG2 B;  3RN0 D;  2BBK H;  3AL9 A;  4PSW B;  4CI3 A;  5K19 A;  2CE9 A;  4JSP C;  4LG8 A;  3AL8 B;  5IT9 g;  4A2L A;  5I5M A;  3PXT D;  1FWX A;  2HJ4 A;  1YFQ A;  3IJC A;  4D0K A;  3N0E A;  5EAM A;  3SJL D;  1NEX B;  5FXY A;  5FKR A;  3PE7 A;  3UVM A;  4AOW A;  4BL0 A;  4CY5 A;  2H68 A;  2Z2N A;  1N6F A;  3OKW A;  4J77 A;  4A11 A;  5GXH A;  3FM0 A;  4CI8 A;  4ZOY A;  4QL1 A;  5HE2 B;  2P9N C;  5CYK B;  3SVW D;  1U2V C;  3PVU B;  3SXT D;  4A08 A;  5GXI A;  4NSX A;  3N0D A;  3UKR C;  1SQJ A;  5HE3 B;  1R5M A;  1GP2 B;  2H9N A;  3OL2 B;  3JAM g;  2B4E A;  2P9I C;  3C99 A;  2XU7 A;  4L1Q D;  4J82 A;  3VGZ A;  3C5M A;  2G99 A;  2H3X A;  3I8E A;  4OWR A;  2HJB A;  4CI1 A;  3RN1 D;  2IUR A;  3J81 g;  5C2W B;  3AL8 A;  3P4F A;  5FKS A;  3DM0 A;  4GQ1 A;  4G56 B;  5GSA A;  3SWS D;  3IKO A;  2CO0 C;  2B5L A;  2GC7 A;  3EI1 B;  5TDH B;  5CXC B;  5I5I A;  4LG9 A;  4JSV C;  4ZOV A;  5IGO A;  2G9A A;  2IWF A;  3UKU C;  5EM2 B;  4H5J A;  4O3U B;  3SCY A;  3V9F A;  4N14 A;  3DXK C;  2P9P C;  3GRE A;  2P9L C;  4Y7R A;  4JSX C;  3JRO A;  5CYK A;  4X3E A;  3EI4 B;  5EAR A;  3F3G A;  4J8G A;  4AEZ A;  2AGX A;  5HE0 B;  5H1M A;  4L3G D;  4LGN A;  4CI2 A;  1P22 A;  1RI6 A;  4OZU A;  2CN2 A;  3OL2 A;  4CY3 A;  3HFQ A;  1ERJ A;  3SMR A;  3MZL A;  3K27 A;  1TBG A;  2I3S A;  4GZ8 A;  4CZY A;  5IGQ A;  2H9M A;  3C75 H;  1JMX B;  3OKT A;  3IJ0 A;  2PM6 B;  3I89 A;  5FQD A;  3A0F A;  3K26 A;  2YNN A;  5EMM B;  3EI1 A;  3UVL A;  4GGA A;  3DSM A;  3SLE D;  1K32 A;  5EM2 A;  4CY2 A;  1SQ9 A;  2P9K C;  4PBZ A;  4ZOX A;  3U4Y A;  1N6D A;  3RMZ D;  2W18 A;  3IIY A;  3VH0 A;  2HKR A;  2OVR B;  4CC9 A;  3DWL C;  3EI4 A;  2I0S A;  3V5W B;  3PXS D;  2AGY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...