2HXCA

Crystal structure of the benzylamine complex of aromatic amine dehydrogenase in n-semiquinone form
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
359
structure length
359
Chain Sequence
b'EVLTGGHSVSAPQENRIYVMDSVFMHLTESRVHVYDYTNGKFLGMVPTAFNGHVQVSNDGKKIYTMTTYHERITRGKRSDVVEVWDADKLTFEKEISLPPKRVQGLNYDGLFRQTTDGKFIVLQNASPATSIGIVDVAKGDYVEDVTAAAGCWSVIPQPNRPRSFMTICGDGGLLTINLGEDGKVASQSRSKQMFSVADDPIFIAPALDKDKAHFVSYYGNVYSADFSGDEVKVDGPWSLLNDEDKAKNWVPGGYNLVGLHRASGRMYVFMHPDGKEGTHKFPAAEIWVMDTKTKQRVARIPGRDALSMTIDQQRNLMLTLDGGNVNVYDISQPEPKLLRTIEGAAEASLQVQFHPVGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aromatic amine dehydrogenase
publication title Atomic level insight into the oxidative half-reaction of aromatic amine dehydrogenase.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 97
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2006-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2hxcA01
3JZNA 5K1CC 3AL8A 5FLXg 4FHLA 1SHYB 3OW8A 3C9CA 3JPXA 4O9DA 4A2MA 5HYNB 3GREA 4J8BA 3PVWB 2AGXA 3CFVA 5C2WB 3HFQA 5I5MA 1GP2B 4QL1A 5EM2A 4ZOZA 3GFCA 3V5WB 3NVQA 1N6EA 2BBKH 1Q47A 3DXMC 5H17A 3MMYA 1NR0A 4JT5C 2HESX 1YFQA 4ES0A 4CZYA 2YBAA 4JT6C 5FKRA 4J78A 4A08B 2GNQA 5IGQA 4GZ8A 3OKYA 2IUQA 5B4WA 5EMLB 1JJUB 5FKSA 3I7KA 5C9ZB 2BCJB 1L0QA 3MZLA 1SQJA 4KFMB 1R5MA 4N14A 2G99A 4A0BB 5IC7A 3SBRA 3PXSD 4GQ1A 2AGWA 2P9NC 4X60B 2XL3A 3I7OA 5AJAA 4TZ4A 2P9LC 5HE1B 4ERZA 3B7FA 1OLZA 3ULEC 3F3FA 4K3JB 3N0EA 5AMSA 3SJLD 2PM9B 2H9LA 2H47A 2IUPA 4ZOYA 3K26A 3AL9A 4ESGA 2H68A 3JROA 1VYHC 5CXCB 3MKQA 4FB1D 3IIYA 3PXTD 3EI1A 4A2LA 4X63B 5IJ7E 4E54A 2B5NA 2AQ5A 2H9NA 3EI4B 3PSCB 1NEXB 4A0AB 5TF2A 2YNOA 1B9YA 1MDAH 4QRJA 3BWSA 2G9AA 3C5MA 2IURA 2I3SA 3CFSB 5CXBB 4H5JA 5HE2B 4H5IA 4E5ZA 1TYQC 1JMZB 2OK6A 3I2NA 4X3EA 4PSXB 2B4EA 5SXMA 2CNXA 3FM0A 2GC4A 3V9FA 4FAND 4JXMA 4AEZA 5EARA 3EG6A 1XIPA 4J0WA 4D0KA 4NSXA 4QQEA 2H9PA 1RI6A 3UVNA 3K27A 2I0TA 2UZYB 3JAMg 3OL2A 3PSLA 4JSPC 3JB9L 4FA4D 3SXTD 4OWRA 5I5IA 5TDHB 3VGZA 4FAVD 2EBSA 3UVLA 1SQ9A 3MZKA 5C2VB 4Y7RA 3SCYA 3RN1D 4A11A 3N0DA 4XYHA 3I7NA 2Q7QA 3BG1A 3OKWA 4CY1A 3A0FA 1N6DA 1PI6A 3VA6A 4X61B 4IA9A 1TBGA 4GQBB 1S4UX 3CIKB 4J86A 3IKOA 4O3TB 1P22A 4L3GD 4GQ2P 5FA5B 4O1QD 4CZVA 4BL0A 3SMRA 5GXHA 2AH1A 3DM0A 2I3TA 3IJ1A 5FKTA 2OVQB 3EI3B 5EAMA 2IUVA 2YB8B 4U1EI 3JZGA 4XYIA 2MTAH 5K19A 4A08A 3UKUC 4R7AB 4JD2C 2J56H 4J81A 1U2VC 4PBYA 2P9KC 4BH6A 5IGOA 5HE3B 3MKSB 3RSEC 2OIZA 2CE8A 4OZUA 4A0BA 4CZXA 5CYKB 3I7LA 5EALA 4A09B 2OVPB 1U4CA 2OJYA 3DSMA 1MG2A 4I79A 2J55H 1JMXB 3PE7A 2XL2A 2B5MA 3ORVD 3UVMA 4EWRA 3UVOA 2H6NA 4IMMA 3F3PA 4K3ID 4ZOVA 3AFCA 4FA5D 4ERYA 4GM9A 1QNIA 3EU7A 2P9UC 2O9KA 1ERJA 2HYEA 2PM9A 5THAA 3C99A 5I5JA 3DXKC 3JRPA 4ZOXA 2AH0A 1GXRA 2IWKA 3EI2B 4A7JA 5CXCA 4UI9R 1PGUA 4J87A 2PBIB 2YMUA 3VH0A 3P4FA 4FA1D 1PEVA 2PM7B 3EI4A 2AGZA 4O45A 3U4YA 4A0AA 1B9XA 2XU7A 1JOFA 4J0XA 3IIWA 4PSWB 4CC9A 5TEFA 3AH8B 2H6KA 5CXBA 4CI8A 5FQDA 3F3GA 4PNKB 4JSVC 4QT8A 3V7DB 3I8CA 2AGLA 5IJ8E 3ZWLB 4GGAA 5EM2B 1XKSA 5EMJB 3SFZA 3RRMC 3J80g 2P9PC 1K32A 2I0SA 5H1MA 2P9IC 3UKRC 2GC7A 3I7HA 4J79A 4LGNA 5A2Qg 2H3XA 4PBZA 1PBYB 2HXCA 4CI1A 3EWEA 3OKYB 3UR4A 2CN2A 1XHMA 3SBPA 2UZXB 3RN0D 4G56B 2HKRA 3W15A 2I0RA 4L1QD 2W18A 2CO0A 1K8KC 5GXIA 2QC5A 1A0RB 2CE9A 5EAPA 2YNNA 3FGBA 3RFGA 4L3HD 3MXXA 4AOWA 4CY3A 2OK4A 1MG3A 4CI3A 4XEIC 2P9SC 2AGYA 3C75H 2H9MA 4BUJC 4ZN4A 2YNPA 4Y5RD 2OVRB 1GG2B 4Z8LA 4FA9D 5FXYA 2Z2NA 2B5LA 2Z2PA 3UVKA 4J8GA 3NVNA 3PVUB 4HDJA 3RFHA 2H14A 3FRXA 2PM6B 3JZHA 4GGCA 4CY5A 2QXVA 2CO0C 3BG0A 3EI3A 2IAAA 4L9OA 4O3UB 4CI2A 2HJBA 4GM8A 5TEEA 4FWWA 4PC0A 3SVWD 4JSNC 4GMBA 3SHFA 5KDOB 4J77A 3IJ0A 3EI1B 5H14A 4GGDA 4YVDA 2HJ4A 4E54B 3RMZD 3I89A 4LG9A 4LG8A 2Z2OA 3KRWB 5CYKA 4A09A 4E5ZB 5HE0B 2IWFA 4D6VA 4PXWA 2J57G 3SLED 3L4OD 4CY2A 5GMKn 4GM3A 5JWZA 4J84A 3I7PA 3SWSD 5EMKB 3DWLC 1OMWB 2CN3A 3RLMD 2HKMA 5GSAA 4U7AA 3SBQA 2H6QA 3OTTA 3NVXA 3ODTA 3AL8B 3PXWD 4MK0B 5EMMB 3OL2B 3J81g 4JSXC 5AFU3 5IT9g 4ERQA 3IJCA 1N6FA 4J82A 3OKTA 1FWXA 3SN6B 3EI2A 3KRXB 5FKQA 3I8EA 5HQGA 2TRCB 3EMHA 3L4MD 1GOTB 2H13A 3E0CA 4J73A 2XYIA 4A11B
chains in the Genus database with same CATH superfamily
3JZNA 5K1CC 4UM9A 3AL8A 5FLXg 5FFOA 2BKLA 4FHLA 5HDBA 1SHYB 4D9SA 3OW8A 1U8CA 3C9CA 4JHPC 3JPXA 2EICA 4O9DA 3ZE2A 4A2MA 5HYNB 3EQ9A 3GREA 4J8BA 3PVWB 2AGXA 3CFVA 5C2WB 3HFQA 5I5MA 1GP2B 3IVMA 4QL1A 5EM2A 4G1EA 4ZOZA 3GFCA 3V5WB 3NVQA 1N6EA 2BBKH 1Q47A 3DXMC 1E8NA 5H17A 3MMYA 1NR0A 4JT5C 2HU8A 3FCSA 4AX4A 1UOOA 2HESX 1YFQA 4ES0A 4CZYA 1E8MA 2YBAA 4JT6C 5FKRA 4JHNA 4J78A 4A08B 2QR5A 2GNQA 5IGQA 4GZ8A 3OKYA 2IUQA 5B4WA 5EMLB 5FFGA 1JJUB 3DDUA 5FKSA 3I7KA 5C9ZB 2BCJB 3MUOA 3ZE1A 1GOHA 1L0QA 1TYEA 3MZLA 1SQJA 4KFMB 1R5MA 4N14A 2G99A 4A0BB 4WJKA 5IC7A 3SBRA 3PXSD 4GQ1A 2AGWA 2P9NC 4RE6A 4X60B 2XL3A 2VDRA 3I7OA 5AJAA 4TZ4A 1YR2A 2P9LC 1UOQA 5HE1B 3O4JA 4ERZA 3B7FA 1OLZA 3ULEC 3F3FA 4K3JB 3N0EA 2XZGA 1O6FA 5AMSA 3SJLD 2PM9B 2QZPA 3EQ7A 2H9LA 2H47A 2IUPA 4ZOYA 5E6RA 2EIDA 5M5VA 3ZDYA 3K26A 3AL9A 4ESGA 2H68A 3JROA 1VYHC 5CXCB 3MKQA 4FB1D 3IIYA 3PXTD 3EI1A 4WK2A 4A2LA 4X63B 5IJ7E 4E54A 2B5NA 2AQ5A 2H9NA 3FCUA 3EI4B 4Z7QA 1NEXB 3PSCB 4AMYA 4A0AB 5TF2A 2YNOA 4G1MA 1B9YA 1C9IA 1MDAH 4QRJA 3BWSA 2G9AA 1GOGA 1UTCA 2VC2A 2IURA 2I3SA 3C5MA 3CFSB 4H5JA 5CXBB 4H5IA 5HE2B 1TYQC 4E5ZA 5M5TA 1JMZB 2OK6A 3I2NA 4X3EA 4PSXB 2B4EA 5SXMA 4L1MA 2CNXA 3FM0A 2GC4A 3V9FA 4FAND 4DNVA 4JXMA 4AEZA 5EARA 3EG6A 1XIPA 4J0WA 4BP9A 4D0KA 4NSXA 4QQEA 2H9PA 1RI6A 3UVNA 3K27A 2I0TA 2UZYB 2XDWA 3JAMg 3OL2A 3PSLA 4JSPC 3JB9L 4FA4D 4IRZA 3GD1I 3SXTD 4OWRA 5I5IA 4BCDA 1VE7A 5TDHB 3VGZA 4FAVD 2EBSA 3UVLA 1H2XA 1SQ9A 3MZKA 4A11B 5C2VB 4Y7RA 3SCYA 3RN1D 2JKXA 4A11A 3N0DA 4XYHA 3I7NA 3T3PA 2Q7QA 3BG1A 3OKWA 4CY1A 3A0FA 3K72A 4Z7OA 1N6DA 1PI6A 3VA6A 4X61B 1I2MB 1H2YA 3V4PA 4IA9A 1TBGA 4GQBB 4NC4A 1S4UX 3CIKB 1H2WA 3GC3B 3IULA 4J86A 3IKOA 4O3TB 1P22A 3NIFA 4L3GD 4AN1A 3O4GA 4GQ2P 5FA5B 4O1QD 4CZVA 4BL0A 3SMRA 1VZ2A 5GXHA 1VZ3A 2AH1A 3DM0A 2I3TA 3IJ1A 5FKTA 4NENA 1UOPA 2OVQB 3EI3B 5EAMA 2IUVA 2VDOA 2YB8B 4U1EI 3JZGA 4XYIA 1GOFA 2MTAH 5K19A 4A08A 3UKUC 3V4VA 3ZE0A 4R7AB 4JD2C 2J56H 3O4HA 4J81A 1U2VC 1H2ZA 4PBYA 2P9KC 3IJEA 4BH6A 1JTDB 5IGOA 1E5TA 5HE3B 3MKSB 3RSEC 2OIZA 2CE8A 3T3MA 4OZUA 4A0BA 4CZXA 5CYKB 3I7LA 5EALA 4A09B 2OVPB 1U4CA 2OJYA 3DSMA 2VZ1A 1MG2A 4I79A 2VDQA 4RE5A 2J55H 1JMXB 3PE7A 4UM8A 2XL2A 2B5MA 4O02A 3ORVD 3UVMA 4EWRA 1QFMA 3UVOA 4AMZA 3K6SA 2H6NA 4IMMA 3F3PA 4K3ID 4ZOVA 2WQ8A 3AFCA 4FA5D 4ERYA 4GM9A 1QNIA 3EU7A 2P9UC 2O9KA 1ERJA 2HYEA 2PM9A 5THAA 3C99A 1VE6A 5I5JA 3DXKC 3JRPA 4ZOXA 2AH0A 1GXRA 1M1XA 2IWKA 1BPOA 3EI2B 4A7JA 5CXCA 4UI9R 1PGUA 4J87A 2PBIB 2YMUA 3VH0A 3P4FA 4FA1D 4NAAA 1PEVA 1L5GA 2PM7B 3EI4A 2AGZA 4O45A 5M5UA 3U4YA 4A0AA 1B9XA 2XU7A 4QAMA 1JOFA 4J0XA 3IIWA 4PSWB 2VDLA 5TEFA 3AH8B 4CC9A 2H6KA 5CXBA 4CI8A 5E6SA 5FQDA 3F3GA 4PNKB 2VDKA 3IUQA 4JSVC 4QT8A 3V7DB 3I8CA 4BCBA 3VI4A 4BP8A 2AGLA 5IJ8E 3ZWLB 4GGAA 5EM2B 1XKSA 5EMJB 3SFZA 3RRMC 3J80g 2P9PC 2VDMA 1K32A 2I0SA 5H1MA 3IUJA 2P9IC 3UKRC 2GC7A 3I7HA 4J79A 4LGNA 5A2Qg 1K3IA 4DNWA 2H3XA 4PBZA 1PBYB 2HXCA 3O4IA 3IURA 1JV2A 4CI1A 3EWEA 3OKYB 3UR4A 2CN2A 1XHMA 3SBPA 2UZXB 3RN0D 4G56B 2HKRA 3W15A 3NIDA 2I0RA 4L1QD 2W18A 2CO0A 4O2WA 1K8KC 5GXIA 2QC5A 1A0RB 5M5SA 2CE9A 3NIGA 2YNNA 3FGBA 5EAPA 3RFGA 4L3HD 3MXXA 2HU7A 4AOWA 4WK0A 4CY3A 2OK4A 1MG3A 4CI3A 4XEIC 2P9SC 2AGYA 5C86A 3C75H 2H9MA 4BUJC 4ZN4A 2YNPA 1C9LA 2OVRB 1GG2B 4Y5RD 4Z8LA 4FA9D 5FXYA 2Z2NA 2B5LA 2Z2PA 3UVKA 4J8GA 3NVNA 3PVUB 4HDJA 3RFHA 2H14A 1QFSA 4Z7NA 3FRXA 2PM6B 3JZHA 4GGCA 4CY5A 2QXVA 2CO0C 3BG0A 3EI3A 2IAAA 4L9OA 4O3UB 4CI2A 2HJBA 4GM8A 1T2XA 5TEEA 4FWWA 4PC0A 3SVWD 4JSNC 4GMBA 3VI3A 3SHFA 3EQ8A 5KDOB 3IUNA 4J77A 3IJ0A 3EI1B 3KCIA 3IUMA 5H14A 4GGDA 2HU5A 4YVDA 2HJ4A 4E54B 3RMZD 2VDNA 3I89A 4LG9A 3K71A 4LG8A 5M61A 2Z2OA 3KRWB 4AN0A 1A12A 5CYKA 3ZDXA 4A09A 3QI0A 4E5ZB 5HE0B 2IWFA 4D6VA 4PXWA 2EIBA 2J57G 4MMZA 3SLED 3L4OD 4CY2A 5GMKn 4MMYA 2EIEA 4NBMA 4GM3A 5JWZA 4J84A 3I7PA 4G55A 3SWSD 3ZDZA 5EMKB 3DWLC 1OMWB 2CN3A 2VDPA 3RLMD 2HKMA 4WK4A 5GSAA 4U7AA 3SBQA 2H6QA 3OTTA 3NVXA 3ODTA 3AL8B 3OF7A 3PXWD 4MK0B 3OL2B 5EMMB 3J81g 4JSXC 5AFU3 5IT9g 4BCCA 4ERQA 3IJCA 1O6GA 3QHYB 1N6FA 4J82A 3OKTA 3MVDK 2XE4A 1FWXA 5C92A 5E6UA 3SN6B 3EI2A 3KRXB 5FKQA 2VZ3A 4MMXA 5M5RA 3I8EA 5HQGA 4DNUA 2TRCB 3EMHA 3L4MD 1GOTB 2H13A 3E0CA 4J73A 2XYIA 3MUNA
chains in the Genus database with same CATH topology
3JZNA 5K1CC 3AL8A 5FLXg 4FHLA 1SHYB 3OW8A 3C9CA 3JPXA 4O9DA 4A2MA 5HYNB 3GREA 4J8BA 3PVWB 2AGXA 3CFVA 5C2WB 3HFQA 5I5MA 1GP2B 4QL1A 5EM2A 4ZOZA 3GFCA 3V5WB 3NVQA 1N6EA 2BBKH 1Q47A 3DXMC 5H17A 3MMYA 1NR0A 4JT5C 2HESX 1YFQA 4ES0A 4CZYA 2YBAA 4JT6C 5FKRA 4J78A 4A08B 2GNQA 5IGQA 4GZ8A 3OKYA 2IUQA 5B4WA 5EMLB 1JJUB 5FKSA 3I7KA 5C9ZB 2BCJB 1L0QA 3MZLA 1SQJA 4KFMB 1R5MA 4N14A 2G99A 4A0BB 5IC7A 3SBRA 3PXSD 4GQ1A 2AGWA 2P9NC 4X60B 2XL3A 3I7OA 5AJAA 4TZ4A 2P9LC 5HE1B 4ERZA 3B7FA 1OLZA 3ULEC 3F3FA 4K3JB 3N0EA 5AMSA 3SJLD 2PM9B 2H9LA 2H47A 2IUPA 4ZOYA 3K26A 3AL9A 4ESGA 2H68A 3JROA 1VYHC 5CXCB 3MKQA 4FB1D 3IIYA 3PXTD 3EI1A 4A2LA 4X63B 5IJ7E 4E54A 2B5NA 2AQ5A 2H9NA 3EI4B 3PSCB 1NEXB 4A0AB 5TF2A 2YNOA 1B9YA 1MDAH 4QRJA 3BWSA 2G9AA 3C5MA 2IURA 2I3SA 3CFSB 5CXBB 4H5JA 5HE2B 4H5IA 4E5ZA 1TYQC 1JMZB 2OK6A 3I2NA 4X3EA 4PSXB 2B4EA 5SXMA 2CNXA 3FM0A 2GC4A 3V9FA 4FAND 4JXMA 4AEZA 5EARA 3EG6A 1XIPA 4J0WA 4D0KA 4NSXA 4QQEA 2H9PA 1RI6A 3UVNA 3K27A 2I0TA 2UZYB 3JAMg 3OL2A 3PSLA 4JSPC 3JB9L 4FA4D 3SXTD 4OWRA 5I5IA 5TDHB 3VGZA 4FAVD 2EBSA 3UVLA 1SQ9A 3MZKA 5C2VB 4Y7RA 3SCYA 3RN1D 4A11A 3N0DA 4XYHA 3I7NA 2Q7QA 3BG1A 3OKWA 4CY1A 3A0FA 1N6DA 1PI6A 3VA6A 4X61B 4IA9A 1TBGA 4GQBB 1S4UX 3CIKB 4J86A 3IKOA 4O3TB 1P22A 4L3GD 4GQ2P 5FA5B 4O1QD 4CZVA 4BL0A 3SMRA 5GXHA 2AH1A 3DM0A 2I3TA 3IJ1A 5FKTA 2OVQB 3EI3B 5EAMA 2IUVA 2YB8B 4U1EI 3JZGA 4XYIA 2MTAH 5K19A 4A08A 3UKUC 4R7AB 4JD2C 2J56H 4J81A 1U2VC 4PBYA 2P9KC 4BH6A 5IGOA 5HE3B 3MKSB 3RSEC 2OIZA 2CE8A 4OZUA 4A0BA 4CZXA 5CYKB 3I7LA 5EALA 4A09B 2OVPB 1U4CA 2OJYA 3DSMA 1MG2A 4I79A 2J55H 1JMXB 3PE7A 2XL2A 2B5MA 3ORVD 3UVMA 4EWRA 3UVOA 2H6NA 4IMMA 3F3PA 4K3ID 4ZOVA 3AFCA 4FA5D 4ERYA 4GM9A 1QNIA 3EU7A 2P9UC 2O9KA 1ERJA 2HYEA 2PM9A 5THAA 3C99A 5I5JA 3DXKC 3JRPA 4ZOXA 2AH0A 1GXRA 2IWKA 3EI2B 4A7JA 5CXCA 4UI9R 1PGUA 4J87A 2PBIB 2YMUA 3VH0A 3P4FA 4FA1D 1PEVA 2PM7B 3EI4A 2AGZA 4O45A 3U4YA 4A0AA 1B9XA 2XU7A 1JOFA 4J0XA 3IIWA 4PSWB 4CC9A 5TEFA 3AH8B 2H6KA 5CXBA 4CI8A 5FQDA 3F3GA 4PNKB 4JSVC 4QT8A 3V7DB 3I8CA 2AGLA 5IJ8E 3ZWLB 4GGAA 5EM2B 1XKSA 5EMJB 3SFZA 3RRMC 3J80g 2P9PC 1K32A 2I0SA 5H1MA 2P9IC 3UKRC 2GC7A 3I7HA 4J79A 4LGNA 5A2Qg 2H3XA 4PBZA 1PBYB 2HXCA 4CI1A 3EWEA 3OKYB 3UR4A 2CN2A 1XHMA 3SBPA 2UZXB 3RN0D 4G56B 2HKRA 3W15A 2I0RA 4L1QD 2W18A 2CO0A 1K8KC 5GXIA 2QC5A 1A0RB 2CE9A 5EAPA 2YNNA 3FGBA 3RFGA 4L3HD 3MXXA 4AOWA 4CY3A 2OK4A 1MG3A 4CI3A 4XEIC 2P9SC 2AGYA 3C75H 2H9MA 4BUJC 4ZN4A 2YNPA 4Y5RD 2OVRB 1GG2B 4Z8LA 4FA9D 5FXYA 2Z2NA 2B5LA 2Z2PA 3UVKA 4J8GA 3NVNA 3PVUB 4HDJA 3RFHA 2H14A 3FRXA 2PM6B 3JZHA 4GGCA 4CY5A 2QXVA 2CO0C 3BG0A 3EI3A 2IAAA 4L9OA 4O3UB 4CI2A 2HJBA 4GM8A 5TEEA 4FWWA 4PC0A 3SVWD 4JSNC 4GMBA 3SHFA 5KDOB 4J77A 3IJ0A 3EI1B 5H14A 4GGDA 4YVDA 2HJ4A 4E54B 3RMZD 3I89A 4LG9A 4LG8A 2Z2OA 3KRWB 5CYKA 4A09A 4E5ZB 5HE0B 2IWFA 4D6VA 4PXWA 2J57G 3SLED 3L4OD 4CY2A 5GMKn 4GM3A 5JWZA 4J84A 3I7PA 3SWSD 5EMKB 3DWLC 1OMWB 2CN3A 3RLMD 2HKMA 5GSAA 4U7AA 3SBQA 2H6QA 3OTTA 3NVXA 3ODTA 3AL8B 3PXWD 4MK0B 5EMMB 3OL2B 3J81g 4JSXC 5AFU3 5IT9g 4ERQA 3IJCA 1N6FA 4J82A 3OKTA 1FWXA 3SN6B 3EI2A 3KRXB 5FKQA 3I8EA 5HQGA 2TRCB 3EMHA 3L4MD 1GOTB 2H13A 3E0CA 4J73A 2XYIA 4A11B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JZN A;  5K1C C;  3AL8 A;  5FLX g;  4FHL A;  1SHY B;  3OW8 A;  3C9C A;  3JPX A;  4O9D A;  4A2M A;  5HYN B;  3GRE A;  4J8B A;  3PVW B;  2AGX A;  3CFV A;  5C2W B;  3HFQ A;  5I5M A;  1GP2 B;  4QL1 A;  5EM2 A;  4ZOZ A;  3GFC A;  3V5W B;  3NVQ A;  1N6E A;  2BBK H;  1Q47 A;  3DXM C;  5H17 A;  3MMY A;  1NR0 A;  4JT5 C;  2HES X;  1YFQ A;  4ES0 A;  4CZY A;  2YBA A;  4JT6 C;  5FKR A;  4J78 A;  4A08 B;  2GNQ A;  5IGQ A;  4GZ8 A;  3OKY A;  2IUQ A;  5B4W A;  5EML B;  1JJU B;  5FKS A;  3I7K A;  5C9Z B;  2BCJ B;  1L0Q A;  3MZL A;  1SQJ A;  4KFM B;  1R5M A;  4N14 A;  2G99 A;  4A0B B;  5IC7 A;  3SBR A;  3PXS D;  4GQ1 A;  2AGW A;  2P9N C;  4X60 B;  2XL3 A;  3I7O A;  5AJA A;  4TZ4 A;  2P9L C;  5HE1 B;  4ERZ A;  3B7F A;  1OLZ A;  3ULE C;  3F3F A;  4K3J B;  3N0E A;  5AMS A;  3SJL D;  2PM9 B;  2H9L A;  2H47 A;  2IUP A;  4ZOY A;  3K26 A;  3AL9 A;  4ESG A;  2H68 A;  3JRO A;  1VYH C;  5CXC B;  3MKQ A;  4FB1 D;  3IIY A;  3PXT D;  3EI1 A;  4A2L A;  4X63 B;  5IJ7 E;  4E54 A;  2B5N A;  2AQ5 A;  2H9N A;  3EI4 B;  3PSC B;  1NEX B;  4A0A B;  5TF2 A;  2YNO A;  1B9Y A;  1MDA H;  4QRJ A;  3BWS A;  2G9A A;  3C5M A;  2IUR A;  2I3S A;  3CFS B;  5CXB B;  4H5J A;  5HE2 B;  4H5I A;  4E5Z A;  1TYQ C;  1JMZ B;  2OK6 A;  3I2N A;  4X3E A;  4PSX B;  2B4E A;  5SXM A;  2CNX A;  3FM0 A;  2GC4 A;  3V9F A;  4FAN D;  4JXM A;  4AEZ A;  5EAR A;  3EG6 A;  1XIP A;  4J0W A;  4D0K A;  4NSX A;  4QQE A;  2H9P A;  1RI6 A;  3UVN A;  3K27 A;  2I0T A;  2UZY B;  3JAM g;  3OL2 A;  3PSL A;  4JSP C;  3JB9 L;  4FA4 D;  3SXT D;  4OWR A;  5I5I A;  5TDH B;  3VGZ A;  4FAV D;  2EBS A;  3UVL A;  1SQ9 A;  3MZK A;  5C2V B;  4Y7R A;  3SCY A;  3RN1 D;  4A11 A;  3N0D A;  4XYH A;  3I7N A;  2Q7Q A;  3BG1 A;  3OKW A;  4CY1 A;  3A0F A;  1N6D A;  1PI6 A;  3VA6 A;  4X61 B;  4IA9 A;  1TBG A;  4GQB B;  1S4U X;  3CIK B;  4J86 A;  3IKO A;  4O3T B;  1P22 A;  4L3G D;  4GQ2 P;  5FA5 B;  4O1Q D;  4CZV A;  4BL0 A;  3SMR A;  5GXH A;  2AH1 A;  3DM0 A;  2I3T A;  3IJ1 A;  5FKT A;  2OVQ B;  3EI3 B;  5EAM A;  2IUV A;  2YB8 B;  4U1E I;  3JZG A;  4XYI A;  2MTA H;  5K19 A;  4A08 A;  3UKU C;  4R7A B;  4JD2 C;  2J56 H;  4J81 A;  1U2V C;  4PBY A;  2P9K C;  4BH6 A;  5IGO A;  5HE3 B;  3MKS B;  3RSE C;  2OIZ A;  2CE8 A;  4OZU A;  4A0B A;  4CZX A;  5CYK B;  3I7L A;  5EAL A;  4A09 B;  2OVP B;  1U4C A;  2OJY A;  3DSM A;  1MG2 A;  4I79 A;  2J55 H;  1JMX B;  3PE7 A;  2XL2 A;  2B5M A;  3ORV D;  3UVM A;  4EWR A;  3UVO A;  2H6N A;  4IMM A;  3F3P A;  4K3I D;  4ZOV A;  3AFC A;  4FA5 D;  4ERY A;  4GM9 A;  1QNI A;  3EU7 A;  2P9U C;  2O9K A;  1ERJ A;  2HYE A;  2PM9 A;  5THA A;  3C99 A;  5I5J A;  3DXK C;  3JRP A;  4ZOX A;  2AH0 A;  1GXR A;  2IWK A;  3EI2 B;  4A7J A;  5CXC A;  4UI9 R;  1PGU A;  4J87 A;  2PBI B;  2YMU A;  3VH0 A;  3P4F A;  4FA1 D;  1PEV A;  2PM7 B;  3EI4 A;  2AGZ A;  4O45 A;  3U4Y A;  4A0A A;  1B9X A;  2XU7 A;  1JOF A;  4J0X A;  3IIW A;  4PSW B;  4CC9 A;  5TEF A;  3AH8 B;  2H6K A;  5CXB A;  4CI8 A;  5FQD A;  3F3G A;  4PNK B;  4JSV C;  4QT8 A;  3V7D B;  3I8C A;  2AGL A;  5IJ8 E;  3ZWL B;  4GGA A;  5EM2 B;  1XKS A;  5EMJ B;  3SFZ A;  3RRM C;  3J80 g;  2P9P C;  1K32 A;  2I0S A;  5H1M A;  2P9I C;  3UKR C;  2GC7 A;  3I7H A;  4J79 A;  4LGN A;  5A2Q g;  2H3X A;  4PBZ A;  1PBY B;  2HXC A;  4CI1 A;  3EWE A;  3OKY B;  3UR4 A;  2CN2 A;  1XHM A;  3SBP A;  2UZX B;  3RN0 D;  4G56 B;  2HKR A;  3W15 A;  2I0R A;  4L1Q D;  2W18 A;  2CO0 A;  1K8K C;  5GXI A;  2QC5 A;  1A0R B;  2CE9 A;  5EAP A;  2YNN A;  3FGB A;  3RFG A;  4L3H D;  3MXX A;  4AOW A;  4CY3 A;  2OK4 A;  1MG3 A;  4CI3 A;  4XEI C;  2P9S C;  2AGY A;  3C75 H;  2H9M A;  4BUJ C;  4ZN4 A;  2YNP A;  4Y5R D;  2OVR B;  1GG2 B;  4Z8L A;  4FA9 D;  5FXY A;  2Z2N A;  2B5L A;  2Z2P A;  3UVK A;  4J8G A;  3NVN A;  3PVU B;  4HDJ A;  3RFH A;  2H14 A;  3FRX A;  2PM6 B;  3JZH A;  4GGC A;  4CY5 A;  2QXV A;  2CO0 C;  3BG0 A;  3EI3 A;  2IAA A;  4L9O A;  4O3U B;  4CI2 A;  2HJB A;  4GM8 A;  5TEE A;  4FWW A;  4PC0 A;  3SVW D;  4JSN C;  4GMB A;  3SHF A;  5KDO B;  4J77 A;  3IJ0 A;  3EI1 B;  5H14 A;  4GGD A;  4YVD A;  2HJ4 A;  4E54 B;  3RMZ D;  3I89 A;  4LG9 A;  4LG8 A;  2Z2O A;  3KRW B;  5CYK A;  4A09 A;  4E5Z B;  5HE0 B;  2IWF A;  4D6V A;  4PXW A;  2J57 G;  3SLE D;  3L4O D;  4CY2 A;  5GMK n;  4GM3 A;  5JWZ A;  4J84 A;  3I7P A;  3SWS D;  5EMK B;  3DWL C;  1OMW B;  2CN3 A;  3RLM D;  2HKM A;  5GSA A;  4U7A A;  3SBQ A;  2H6Q A;  3OTT A;  3NVX A;  3ODT A;  3AL8 B;  3PXW D;  4MK0 B;  5EMM B;  3OL2 B;  3J81 g;  4JSX C;  5AFU 3;  5IT9 g;  4ERQ A;  3IJC A;  1N6F A;  4J82 A;  3OKT A;  1FWX A;  3SN6 B;  3EI2 A;  3KRX B;  5FKQ A;  3I8E A;  5HQG A;  2TRC B;  3EMH A;  3L4M D;  1GOT B;  2H13 A;  3E0C A;  4J73 A;  2XYI A;  4A11 B; 
#chains in the Genus database with same CATH topology
 3JZN A;  5K1C C;  4UM9 A;  3AL8 A;  5FLX g;  5FFO A;  2BKL A;  4FHL A;  5HDB A;  1SHY B;  4D9S A;  3OW8 A;  1U8C A;  3C9C A;  4JHP C;  3JPX A;  2EIC A;  4O9D A;  3ZE2 A;  4A2M A;  5HYN B;  3EQ9 A;  3GRE A;  4J8B A;  3PVW B;  2AGX A;  3CFV A;  5C2W B;  3HFQ A;  5I5M A;  1GP2 B;  3IVM A;  4QL1 A;  5EM2 A;  4G1E A;  4ZOZ A;  3GFC A;  3V5W B;  3NVQ A;  1N6E A;  2BBK H;  1Q47 A;  3DXM C;  1E8N A;  5H17 A;  3MMY A;  1NR0 A;  4JT5 C;  2HU8 A;  3FCS A;  4AX4 A;  1UOO A;  2HES X;  1YFQ A;  4ES0 A;  4CZY A;  1E8M A;  2YBA A;  4JT6 C;  5FKR A;  4JHN A;  4J78 A;  4A08 B;  2QR5 A;  2GNQ A;  5IGQ A;  4GZ8 A;  3OKY A;  2IUQ A;  5B4W A;  5EML B;  5FFG A;  1JJU B;  3DDU A;  5FKS A;  3I7K A;  5C9Z B;  2BCJ B;  3MUO A;  3ZE1 A;  1GOH A;  1L0Q A;  1TYE A;  3MZL A;  1SQJ A;  4KFM B;  1R5M A;  4N14 A;  2G99 A;  4A0B B;  4WJK A;  5IC7 A;  3SBR A;  3PXS D;  4GQ1 A;  2AGW A;  2P9N C;  4RE6 A;  4X60 B;  2XL3 A;  2VDR A;  3I7O A;  5AJA A;  4TZ4 A;  1YR2 A;  2P9L C;  1UOQ A;  5HE1 B;  3O4J A;  4ERZ A;  3B7F A;  1OLZ A;  3ULE C;  3F3F A;  4K3J B;  3N0E A;  2XZG A;  1O6F A;  5AMS A;  3SJL D;  2PM9 B;  2QZP A;  3EQ7 A;  2H9L A;  2H47 A;  2IUP A;  4ZOY A;  5E6R A;  2EID A;  5M5V A;  3ZDY A;  3K26 A;  3AL9 A;  4ESG A;  2H68 A;  3JRO A;  1VYH C;  5CXC B;  3MKQ A;  4FB1 D;  3IIY A;  3PXT D;  3EI1 A;  4WK2 A;  4A2L A;  4X63 B;  5IJ7 E;  4E54 A;  2B5N A;  2AQ5 A;  2H9N A;  3FCU A;  3EI4 B;  4Z7Q A;  1NEX B;  3PSC B;  4AMY A;  4A0A B;  5TF2 A;  2YNO A;  4G1M A;  1B9Y A;  1C9I A;  1MDA H;  4QRJ A;  3BWS A;  2G9A A;  1GOG A;  1UTC A;  2VC2 A;  2IUR A;  2I3S A;  3C5M A;  3CFS B;  4H5J A;  5CXB B;  4H5I A;  5HE2 B;  1TYQ C;  4E5Z A;  5M5T A;  1JMZ B;  2OK6 A;  3I2N A;  4X3E A;  4PSX B;  2B4E A;  5SXM A;  4L1M A;  2CNX A;  3FM0 A;  2GC4 A;  3V9F A;  4FAN D;  4DNV A;  4JXM A;  4AEZ A;  5EAR A;  3EG6 A;  1XIP A;  4J0W A;  4BP9 A;  4D0K A;  4NSX A;  4QQE A;  2H9P A;  1RI6 A;  3UVN A;  3K27 A;  2I0T A;  2UZY B;  2XDW A;  3JAM g;  3OL2 A;  3PSL A;  4JSP C;  3JB9 L;  4FA4 D;  4IRZ A;  3GD1 I;  3SXT D;  4OWR A;  5I5I A;  4BCD A;  1VE7 A;  5TDH B;  3VGZ A;  4FAV D;  2EBS A;  3UVL A;  1H2X A;  1SQ9 A;  3MZK A;  4A11 B;  5C2V B;  4Y7R A;  3SCY A;  3RN1 D;  2JKX A;  4A11 A;  3N0D A;  4XYH A;  3I7N A;  3T3P A;  2Q7Q A;  3BG1 A;  3OKW A;  4CY1 A;  3A0F A;  3K72 A;  4Z7O A;  1N6D A;  1PI6 A;  3VA6 A;  4X61 B;  1I2M B;  1H2Y A;  3V4P A;  4IA9 A;  1TBG A;  4GQB B;  4NC4 A;  1S4U X;  3CIK B;  1H2W A;  3GC3 B;  3IUL A;  4J86 A;  3IKO A;  4O3T B;  1P22 A;  3NIF A;  4L3G D;  4AN1 A;  3O4G A;  4GQ2 P;  5FA5 B;  4O1Q D;  4CZV A;  4BL0 A;  3SMR A;  1VZ2 A;  5GXH A;  1VZ3 A;  2AH1 A;  3DM0 A;  2I3T A;  3IJ1 A;  5FKT A;  4NEN A;  1UOP A;  2OVQ B;  3EI3 B;  5EAM A;  2IUV A;  2VDO A;  2YB8 B;  4U1E I;  3JZG A;  4XYI A;  1GOF A;  2MTA H;  5K19 A;  4A08 A;  3UKU C;  3V4V A;  3ZE0 A;  4R7A B;  4JD2 C;  2J56 H;  3O4H A;  4J81 A;  1U2V C;  1H2Z A;  4PBY A;  2P9K C;  3IJE A;  4BH6 A;  1JTD B;  5IGO A;  1E5T A;  5HE3 B;  3MKS B;  3RSE C;  2OIZ A;  2CE8 A;  3T3M A;  4OZU A;  4A0B A;  4CZX A;  5CYK B;  3I7L A;  5EAL A;  4A09 B;  2OVP B;  1U4C A;  2OJY A;  3DSM A;  2VZ1 A;  1MG2 A;  4I79 A;  2VDQ A;  4RE5 A;  2J55 H;  1JMX B;  3PE7 A;  4UM8 A;  2XL2 A;  2B5M A;  4O02 A;  3ORV D;  3UVM A;  4EWR A;  1QFM A;  3UVO A;  4AMZ A;  3K6S A;  2H6N A;  4IMM A;  3F3P A;  4K3I D;  4ZOV A;  2WQ8 A;  3AFC A;  4FA5 D;  4ERY A;  4GM9 A;  1QNI A;  3EU7 A;  2P9U C;  2O9K A;  1ERJ A;  2HYE A;  2PM9 A;  5THA A;  3C99 A;  1VE6 A;  5I5J A;  3DXK C;  3JRP A;  4ZOX A;  2AH0 A;  1GXR A;  1M1X A;  2IWK A;  1BPO A;  3EI2 B;  4A7J A;  5CXC A;  4UI9 R;  1PGU A;  4J87 A;  2PBI B;  2YMU A;  3VH0 A;  3P4F A;  4FA1 D;  4NAA A;  1PEV A;  1L5G A;  2PM7 B;  3EI4 A;  2AGZ A;  4O45 A;  5M5U A;  3U4Y A;  4A0A A;  1B9X A;  2XU7 A;  4QAM A;  1JOF A;  4J0X A;  3IIW A;  4PSW B;  2VDL A;  5TEF A;  3AH8 B;  4CC9 A;  2H6K A;  5CXB A;  4CI8 A;  5E6S A;  5FQD A;  3F3G A;  4PNK B;  2VDK A;  3IUQ A;  4JSV C;  4QT8 A;  3V7D B;  3I8C A;  4BCB A;  3VI4 A;  4BP8 A;  2AGL A;  5IJ8 E;  3ZWL B;  4GGA A;  5EM2 B;  1XKS A;  5EMJ B;  3SFZ A;  3RRM C;  3J80 g;  2P9P C;  2VDM A;  1K32 A;  2I0S A;  5H1M A;  3IUJ A;  2P9I C;  3UKR C;  2GC7 A;  3I7H A;  4J79 A;  4LGN A;  5A2Q g;  1K3I A;  4DNW A;  2H3X A;  4PBZ A;  1PBY B;  2HXC A;  3O4I A;  3IUR A;  1JV2 A;  4CI1 A;  3EWE A;  3OKY B;  3UR4 A;  2CN2 A;  1XHM A;  3SBP A;  2UZX B;  3RN0 D;  4G56 B;  2HKR A;  3W15 A;  3NID A;  2I0R A;  4L1Q D;  2W18 A;  2CO0 A;  4O2W A;  1K8K C;  5GXI A;  2QC5 A;  1A0R B;  5M5S A;  2CE9 A;  3NIG A;  2YNN A;  3FGB A;  5EAP A;  3RFG A;  4L3H D;  3MXX A;  2HU7 A;  4AOW A;  4WK0 A;  4CY3 A;  2OK4 A;  1MG3 A;  4CI3 A;  4XEI C;  2P9S C;  2AGY A;  5C86 A;  3C75 H;  2H9M A;  4BUJ C;  4ZN4 A;  2YNP A;  1C9L A;  2OVR B;  1GG2 B;  4Y5R D;  4Z8L A;  4FA9 D;  5FXY A;  2Z2N A;  2B5L A;  2Z2P A;  3UVK A;  4J8G A;  3NVN A;  3PVU B;  4HDJ A;  3RFH A;  2H14 A;  1QFS A;  4Z7N A;  3FRX A;  2PM6 B;  3JZH A;  4GGC A;  4CY5 A;  2QXV A;  2CO0 C;  3BG0 A;  3EI3 A;  2IAA A;  4L9O A;  4O3U B;  4CI2 A;  2HJB A;  4GM8 A;  1T2X A;  5TEE A;  4FWW A;  4PC0 A;  3SVW D;  4JSN C;  4GMB A;  3VI3 A;  3SHF A;  3EQ8 A;  5KDO B;  3IUN A;  4J77 A;  3IJ0 A;  3EI1 B;  3KCI A;  3IUM A;  5H14 A;  4GGD A;  2HU5 A;  4YVD A;  2HJ4 A;  4E54 B;  3RMZ D;  2VDN A;  3I89 A;  4LG9 A;  3K71 A;  4LG8 A;  5M61 A;  2Z2O A;  3KRW B;  4AN0 A;  1A12 A;  5CYK A;  3ZDX A;  4A09 A;  3QI0 A;  4E5Z B;  5HE0 B;  2IWF A;  4D6V A;  4PXW A;  2EIB A;  2J57 G;  4MMZ A;  3SLE D;  3L4O D;  4CY2 A;  5GMK n;  4MMY A;  2EIE A;  4NBM A;  4GM3 A;  5JWZ A;  4J84 A;  3I7P A;  4G55 A;  3SWS D;  3ZDZ A;  5EMK B;  3DWL C;  1OMW B;  2CN3 A;  2VDP A;  3RLM D;  2HKM A;  4WK4 A;  5GSA A;  4U7A A;  3SBQ A;  2H6Q A;  3OTT A;  3NVX A;  3ODT A;  3AL8 B;  3OF7 A;  3PXW D;  4MK0 B;  3OL2 B;  5EMM B;  3J81 g;  4JSX C;  5AFU 3;  5IT9 g;  4BCC A;  4ERQ A;  3IJC A;  1O6G A;  3QHY B;  1N6F A;  4J82 A;  3OKT A;  3MVD K;  2XE4 A;  1FWX A;  5C92 A;  5E6U A;  3SN6 B;  3EI2 A;  3KRX B;  5FKQ A;  2VZ3 A;  4MMX A;  5M5R A;  3I8E A;  5HQG A;  4DNU A;  2TRC B;  3EMH A;  3L4M D;  1GOT B;  2H13 A;  3E0C A;  4J73 A;  2XYI A;  3MUN A; 
#chains in the Genus database with same CATH homology
 3JZN A;  5K1C C;  3AL8 A;  5FLX g;  4FHL A;  1SHY B;  3OW8 A;  3C9C A;  3JPX A;  4O9D A;  4A2M A;  5HYN B;  3GRE A;  4J8B A;  3PVW B;  2AGX A;  3CFV A;  5C2W B;  3HFQ A;  5I5M A;  1GP2 B;  4QL1 A;  5EM2 A;  4ZOZ A;  3GFC A;  3V5W B;  3NVQ A;  1N6E A;  2BBK H;  1Q47 A;  3DXM C;  5H17 A;  3MMY A;  1NR0 A;  4JT5 C;  2HES X;  1YFQ A;  4ES0 A;  4CZY A;  2YBA A;  4JT6 C;  5FKR A;  4J78 A;  4A08 B;  2GNQ A;  5IGQ A;  4GZ8 A;  3OKY A;  2IUQ A;  5B4W A;  5EML B;  1JJU B;  5FKS A;  3I7K A;  5C9Z B;  2BCJ B;  1L0Q A;  3MZL A;  1SQJ A;  4KFM B;  1R5M A;  4N14 A;  2G99 A;  4A0B B;  5IC7 A;  3SBR A;  3PXS D;  4GQ1 A;  2AGW A;  2P9N C;  4X60 B;  2XL3 A;  3I7O A;  5AJA A;  4TZ4 A;  2P9L C;  5HE1 B;  4ERZ A;  3B7F A;  1OLZ A;  3ULE C;  3F3F A;  4K3J B;  3N0E A;  5AMS A;  3SJL D;  2PM9 B;  2H9L A;  2H47 A;  2IUP A;  4ZOY A;  3K26 A;  3AL9 A;  4ESG A;  2H68 A;  3JRO A;  1VYH C;  5CXC B;  3MKQ A;  4FB1 D;  3IIY A;  3PXT D;  3EI1 A;  4A2L A;  4X63 B;  5IJ7 E;  4E54 A;  2B5N A;  2AQ5 A;  2H9N A;  3EI4 B;  3PSC B;  1NEX B;  4A0A B;  5TF2 A;  2YNO A;  1B9Y A;  1MDA H;  4QRJ A;  3BWS A;  2G9A A;  3C5M A;  2IUR A;  2I3S A;  3CFS B;  5CXB B;  4H5J A;  5HE2 B;  4H5I A;  4E5Z A;  1TYQ C;  1JMZ B;  2OK6 A;  3I2N A;  4X3E A;  4PSX B;  2B4E A;  5SXM A;  2CNX A;  3FM0 A;  2GC4 A;  3V9F A;  4FAN D;  4JXM A;  4AEZ A;  5EAR A;  3EG6 A;  1XIP A;  4J0W A;  4D0K A;  4NSX A;  4QQE A;  2H9P A;  1RI6 A;  3UVN A;  3K27 A;  2I0T A;  2UZY B;  3JAM g;  3OL2 A;  3PSL A;  4JSP C;  3JB9 L;  4FA4 D;  3SXT D;  4OWR A;  5I5I A;  5TDH B;  3VGZ A;  4FAV D;  2EBS A;  3UVL A;  1SQ9 A;  3MZK A;  5C2V B;  4Y7R A;  3SCY A;  3RN1 D;  4A11 A;  3N0D A;  4XYH A;  3I7N A;  2Q7Q A;  3BG1 A;  3OKW A;  4CY1 A;  3A0F A;  1N6D A;  1PI6 A;  3VA6 A;  4X61 B;  4IA9 A;  1TBG A;  4GQB B;  1S4U X;  3CIK B;  4J86 A;  3IKO A;  4O3T B;  1P22 A;  4L3G D;  4GQ2 P;  5FA5 B;  4O1Q D;  4CZV A;  4BL0 A;  3SMR A;  5GXH A;  2AH1 A;  3DM0 A;  2I3T A;  3IJ1 A;  5FKT A;  2OVQ B;  3EI3 B;  5EAM A;  2IUV A;  2YB8 B;  4U1E I;  3JZG A;  4XYI A;  2MTA H;  5K19 A;  4A08 A;  3UKU C;  4R7A B;  4JD2 C;  2J56 H;  4J81 A;  1U2V C;  4PBY A;  2P9K C;  4BH6 A;  5IGO A;  5HE3 B;  3MKS B;  3RSE C;  2OIZ A;  2CE8 A;  4OZU A;  4A0B A;  4CZX A;  5CYK B;  3I7L A;  5EAL A;  4A09 B;  2OVP B;  1U4C A;  2OJY A;  3DSM A;  1MG2 A;  4I79 A;  2J55 H;  1JMX B;  3PE7 A;  2XL2 A;  2B5M A;  3ORV D;  3UVM A;  4EWR A;  3UVO A;  2H6N A;  4IMM A;  3F3P A;  4K3I D;  4ZOV A;  3AFC A;  4FA5 D;  4ERY A;  4GM9 A;  1QNI A;  3EU7 A;  2P9U C;  2O9K A;  1ERJ A;  2HYE A;  2PM9 A;  5THA A;  3C99 A;  5I5J A;  3DXK C;  3JRP A;  4ZOX A;  2AH0 A;  1GXR A;  2IWK A;  3EI2 B;  4A7J A;  5CXC A;  4UI9 R;  1PGU A;  4J87 A;  2PBI B;  2YMU A;  3VH0 A;  3P4F A;  4FA1 D;  1PEV A;  2PM7 B;  3EI4 A;  2AGZ A;  4O45 A;  3U4Y A;  4A0A A;  1B9X A;  2XU7 A;  1JOF A;  4J0X A;  3IIW A;  4PSW B;  4CC9 A;  5TEF A;  3AH8 B;  2H6K A;  5CXB A;  4CI8 A;  5FQD A;  3F3G A;  4PNK B;  4JSV C;  4QT8 A;  3V7D B;  3I8C A;  2AGL A;  5IJ8 E;  3ZWL B;  4GGA A;  5EM2 B;  1XKS A;  5EMJ B;  3SFZ A;  3RRM C;  3J80 g;  2P9P C;  1K32 A;  2I0S A;  5H1M A;  2P9I C;  3UKR C;  2GC7 A;  3I7H A;  4J79 A;  4LGN A;  5A2Q g;  2H3X A;  4PBZ A;  1PBY B;  2HXC A;  4CI1 A;  3EWE A;  3OKY B;  3UR4 A;  2CN2 A;  1XHM A;  3SBP A;  2UZX B;  3RN0 D;  4G56 B;  2HKR A;  3W15 A;  2I0R A;  4L1Q D;  2W18 A;  2CO0 A;  1K8K C;  5GXI A;  2QC5 A;  1A0R B;  2CE9 A;  5EAP A;  2YNN A;  3FGB A;  3RFG A;  4L3H D;  3MXX A;  4AOW A;  4CY3 A;  2OK4 A;  1MG3 A;  4CI3 A;  4XEI C;  2P9S C;  2AGY A;  3C75 H;  2H9M A;  4BUJ C;  4ZN4 A;  2YNP A;  4Y5R D;  2OVR B;  1GG2 B;  4Z8L A;  4FA9 D;  5FXY A;  2Z2N A;  2B5L A;  2Z2P A;  3UVK A;  4J8G A;  3NVN A;  3PVU B;  4HDJ A;  3RFH A;  2H14 A;  3FRX A;  2PM6 B;  3JZH A;  4GGC A;  4CY5 A;  2QXV A;  2CO0 C;  3BG0 A;  3EI3 A;  2IAA A;  4L9O A;  4O3U B;  4CI2 A;  2HJB A;  4GM8 A;  5TEE A;  4FWW A;  4PC0 A;  3SVW D;  4JSN C;  4GMB A;  3SHF A;  5KDO B;  4J77 A;  3IJ0 A;  3EI1 B;  5H14 A;  4GGD A;  4YVD A;  2HJ4 A;  4E54 B;  3RMZ D;  3I89 A;  4LG9 A;  4LG8 A;  2Z2O A;  3KRW B;  5CYK A;  4A09 A;  4E5Z B;  5HE0 B;  2IWF A;  4D6V A;  4PXW A;  2J57 G;  3SLE D;  3L4O D;  4CY2 A;  5GMK n;  4GM3 A;  5JWZ A;  4J84 A;  3I7P A;  3SWS D;  5EMK B;  3DWL C;  1OMW B;  2CN3 A;  3RLM D;  2HKM A;  5GSA A;  4U7A A;  3SBQ A;  2H6Q A;  3OTT A;  3NVX A;  3ODT A;  3AL8 B;  3PXW D;  4MK0 B;  5EMM B;  3OL2 B;  3J81 g;  4JSX C;  5AFU 3;  5IT9 g;  4ERQ A;  3IJC A;  1N6F A;  4J82 A;  3OKT A;  1FWX A;  3SN6 B;  3EI2 A;  3KRX B;  5FKQ A;  3I8E A;  5HQG A;  2TRC B;  3EMH A;  3L4M D;  1GOT B;  2H13 A;  3E0C A;  4J73 A;  2XYI A;  4A11 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...