2HXCA

Crystal structure of the benzylamine complex of aromatic amine dehydrogenase in n-semiquinone form
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
359
structure length
359
Chain Sequence
EVLTGGHSVSAPQENRIYVMDSVFMHLTESRVHVYDYTNGKFLGMVPTAFNGHVQVSNDGKKIYTMTTYHERITRGKRSDVVEVWDADKLTFEKEISLPPKRVQGLNYDGLFRQTTDGKFIVLQNASPATSIGIVDVAKGDYVEDVTAAAGCWSVIPQPNRPRSFMTICGDGGLLTINLGEDGKVASQSRSKQMFSVADDPIFIAPALDKDKAHFVSYYGNVYSADFSGDEVKVDGPWSLLNDEDKAKNWVPGGYNLVGLHRASGRMYVFMHPDGKEGTHKFPAAEIWVMDTKTKQRVARIPGRDALSMTIDQQRNLMLTLDGGNVNVYDISQPEPKLLRTIEGAAEASLQVQFHPVGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Aromatic amine dehydrogenase
publication title Atomic level insight into the oxidative half-reaction of aromatic amine dehydrogenase.
pubmed doi rcsb
total genus 97
structure length 359
sequence length 359
chains with identical sequence B
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2006-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2hxcA01
3K27A 5CXBB 2AGZA 5CXCA 3RLMD 5IGQA 5H14A 4A11B 4E54A 4LG8A 2W18A 1FWXA 3CFSB 5C2VB 3FGBA 4CY5A 2AH1A 1GOTB 2BCJB 3EI3A 3N0EA 2AGXA 4PNKB 3NVXA 2P9UC 4CZYA 4A08A 2P9NC 2YMUA 2CNXA 4GM8A 3UVKA 4QRJA 4UI9R 4J84A 3MMYA 3JZGA 4FHLA 1GP2B 1PGUA 1N6FA 2CE9A 4J87A 3C5MA 2QC5A 1QNIA 3SXTD 4CY3A 1L0QA 3HFQA 3MKQA 4I79A 3PXTD 2H13A 3JROA 3P4FA 3K26A 2GNQA 3MKSB 5EAPA 2OK4A 3OKTA 4X3EA 2B5LA 4OZUA 4ERZA 4ESGA 1MG3A 5TF2A 2HESX 2HJ4A 5C9ZB 3I8CA 1Q47A 1TYQC 4CC9A 4K3ID 5FA5B 3RN1D 2I3SA 4JSVC 3I89A 4QQEA 5IJ8E 5AMSA 4GGCA 2OIZA 2MTAH 3SWSD 3U4YA 3OKYB 4FA5D 2H68A 3VH0A 3I7NA 4N14A 5TDHB 5IJ7E 2CN2A 2AGYA 2CO0C 4LGNA 4A2MA 3OL2B 4AOWA 3MZLA 5HYNB 4ERYA 4GM3A 4J0XA 1PBYB 4LG9A 1MDAH 2CO0A 3JAMg 3OW8A 3RMZD 3I7KA 4R7AB 2H9PA 4A0AB 4J86A 2HKRA 5FKSA 5TEFA 2H3XA 4FWWA 3OTTA 5CXCB 4E54B 4CY2A 3GREA 3RRMC 2Z2NA 3VA6A 4CI1A 1NR0A 3AFCA 3B7FA 3EI3B 2EBSA 3RFHA 1B9XA 4JT5C 5EM2A 2YNPA 4A08B 4X63B 5FXYA 3L4MD 1A0RB 1K8KC 2H6QA 3MZKA 3NVQA 3UVLA 4J8GA 3SBPA 4A09A 1MG2A 2H6NA 3CIKB 3UVMA 1XHMA 3MXXA 4XYHA 1VYHC 3EG6A 5HE1B 5IT9g 4EWRA 1GG2B 4D0KA 4GGDA 2AH0A 4CI3A 2P9IC 3RN0D 4FAND 5EMMB 5I5JA 2AGWA 4Z8LA 3EI4A 3I7LA 3SLED 3NVNA 2XU7A 4GGAA 5KDOB 4FAVD 2PM6B 4ZN4A 4L3GD 5K19A 3RSEC 4L3HD 3I7HA 2I0SA 3PSCB 4GM9A 4GQ1A 3CFVA 4MK0B 2YBAA 3L4OD 2UZYB 4ZOVA 2IUVA 3IIWA 2TRCB 3AH8B 2J55H 2Z2OA 1SQ9A 4BH6A 3SMRA 3SBQA 5EM2B 5C2WB 3PVUB 2PM7B 5GXIA 3I7PA 3SN6B 4BUJC 2XL2A 2YNOA 3UVOA 2OJYA 4O3UB 3JRPA 5AFU3 3FM0A 5EARA 2P9KC 5H17A 4PSWB 4A09B 3J81g 3SCYA 3C9CA 4YVDA 3KRWB 1GXRA 3FRXA 3UKRC 2H6KA 2UZXB 4IMMA 4FA4D 5AJAA 3IKOA 2IWKA 2YNNA 2GC7A 2GC4A 4L9OA 3ULEC 2HXCA 3AL9A 2I3TA 2PM9A 3EI1A 4PBYA 2IWFA 1RI6A 1OMWB 2I0TA 2H47A 4PC0A 3JZNA 2P9LC 3PXSD 4CI2A 2B5NA 3EI2A 1K32A 2H9NA 1SHYB 4FA1D 3EI4B 1XIPA 4JD2C 2CN3A 2I0RA 3PE7A 4CZXA 1PI6A 3BG1A 3JZHA 4H5JA 4J82A 3OKWA 5HE3B 2QXVA 3JB9L 3V5WB 2OVPB 3EMHA 3AL8A 3UR4A 4ERQA 5GSAA 3A0FA 2B4EA 5FKQA 3DXKC 3RFGA 4O9DA 4BL0A 5EMKB 2HYEA 1SQJA 3ODTA 1XKSA 4U7AA 4CZVA 3J80g 3PVWB 4J73A 4GMBA 2P9SC 3I8EA 3I7OA 4O3TB 4FA9D 3DM0A 3F3GA 4J78A 4A0BA 3DSMA 5EAMA 4A7JA 2J57G 3IJ0A 1JJUB 5FKRA 5FKTA 2J56H 5FLXg 5GXHA 4PSXB 4X61B 5HE2B 3PSLA 1TBGA 3ORVD 3EU7A 2P9PC 3SFZA 3V7DB 5IC7A 3W15A 3N0DA 3IJCA 4J79A 4GQ2P 4JT6C 5CYKA 5EMJB 2AGLA 2PM9B 3EI1B 5I5MA 4E5ZA 2XL3A 2B5MA 4D6VA 4J0WA 5FQDA 1OLZA 2XYIA 2YB8B 5I5IA 1JMZB 1ERJA 4GQBB 4XEIC 2H14A 4OWRA 3EI2B 2G99A 2IURA 1U4CA 3IIYA 3DXMC 4J8BA 4Y5RD 1JMXB 4NSXA 5SXMA 4H5IA 4CI8A 5K1CC 3SJLD 3DWLC 1N6DA 5HE0B 3F3PA 4ZOZA 5GMKn 4JSNC 1N6EA 1YFQA 5CXBA 3SVWD 4A11A 2HKMA 4A2LA 3AL8B 3BWSA 2OK6A 2G9AA 4TZ4A 2H9MA 3C75H 4JXMA 4Y7RA 5TEEA 3SHFA 5IGOA 5JWZA 4G56B 4JSXC 1U2VC 1NEXB 2IUPA 3IJ1A 4FB1D 5THAA 3E0CA 5HQGA 1P22A 3V9FA 2H9LA 3SBRA 1S4UX 4A0BB 2CE8A 3UVNA 4X60B 2HJBA 2OVRB 4ES0A 4K3JB 5B4WA 4PXWA 4U1EI 4KFMB 4AEZA 3ZWLB 3KRXB 2Z2PA 4J81A 5EALA 3PXWD 4XYIA 2BBKH 4O45A 4IA9A 2IUQA 5CYKB 4PBZA 4ZOYA 3UKUC 4CY1A 3F3FA 4QL1A 2O9KA 2Q7QA 4E5ZB 3C99A 4GZ8A 3JPXA 5A2Qg 3OKYA 3BG0A 3I2NA 3GFCA 4J77A 3VGZA 2PBIB 2OVQB 3EWEA 4O1QD 2IAAA 3OL2A 4QT8A 4HDJA 1JOFA 2AQ5A 1R5MA 1PEVA 5EMLB 5H1MA 1B9YA 4JSPC 4L1QD 4A0AA 4ZOXA
chains in the Genus database with same CATH superfamily
3K27A 5HDBA 5CXBB 2AGZA 5CXCA 3RLMD 5IGQA 5H14A 4A11B 4BP8A 4LG8A 4E54A 2W18A 1FWXA 1O6FA 3CFSB 2QR5A 3EQ9A 5C2VB 3FGBA 4CY5A 2AH1A 1GOTB 2BCJB 3O4GA 3EI3A 3N0EA 3IUJA 2AGXA 2VC2A 2VZ1A 4PNKB 5FFOA 3NVXA 2P9UC 4CZYA 4A08A 2P9NC 2YMUA 2CNXA 4GM8A 3UVKA 2XE4A 4QRJA 4UI9R 4J84A 3MMYA 3JZGA 4FHLA 1GP2B 1PGUA 1N6FA 2CE9A 4J87A 3C5MA 2QC5A 3MUNA 1H2WA 1QNIA 3SXTD 4CY3A 1L0QA 3HFQA 3MKQA 4I79A 3PXTD 2H13A 3JROA 3P4FA 3K26A 5C86A 2GNQA 1UOQA 3MKSB 5EAPA 2OK4A 3OKTA 4X3EA 2B5LA 2EIDA 4OZUA 4ERZA 4ESGA 1MG3A 5TF2A 2HESX 2HJ4A 3EQ7A 5C9ZB 4WK0A 3I8CA 1Q47A 1TYQC 4CC9A 4K3ID 4O02A 5FA5B 1H2XA 2VDQA 2I3SA 3NIDA 4JSVC 3RN1D 3I89A 4QQEA 5IJ8E 5AMSA 4GGCA 2OIZA 2MTAH 3SWSD 3U4YA 1GOFA 3OKYB 4FA5D 2H68A 3VH0A 3I7NA 4N14A 2VDPA 5TDHB 5IJ7E 2CN2A 2AGYA 2CO0C 4LGNA 4A2MA 3IUQA 3OL2B 4AOWA 3MZLA 5HYNB 4ERYA 4GM3A 3T3PA 1UTCA 4J0XA 1PBYB 4LG9A 1MDAH 2CO0A 3JAMg 1VE6A 1QFMA 3OW8A 3QI0A 3RMZD 3I7KA 3NIGA 2H9PA 4R7AB 4A0AB 4J86A 2HKRA 5FKSA 5TEFA 2H3XA 4FWWA 3OTTA 5CXCB 4E54B 4Z7OA 4CY2A 3GREA 3RRMC 2Z2NA 3VA6A 4CI1A 1NR0A 1UOPA 3AFCA 3B7FA 3EI3B 2EBSA 1O6GA 3RFHA 1B9XA 4JT5C 5EM2A 3ZDZA 2YNPA 4A08B 4X63B 5FXYA 1A12A 4AX4A 3L4MD 1A0RB 1K8KC 2H6QA 3MZKA 2EIBA 2XZGA 4DNVA 3NVQA 3UVLA 4J8GA 3SBPA 3GD1I 4A09A 1MG2A 2H6NA 3CIKB 3UVMA 1XHMA 1U8CA 3MXXA 1VYHC 4XYHA 2XDWA 1I2MB 1YR2A 3EG6A 5E6RA 5HE1B 4EWRA 5IT9g 1GG2B 4D0KA 4GGDA 2AH0A 4CI3A 4MMXA 2P9IC 2HU8A 3RN0D 4FAND 5EMMB 5I5JA 4DNWA 2AGWA 2HU5A 1JV2A 4Z8LA 2VZ3A 3EI4A 1H2YA 3I7LA 3SLED 3NVNA 2XU7A 4GGAA 5KDOB 3O4HA 4FAVD 2PM6B 4ZN4A 4L3GD 3K71A 5K19A 3RSEC 3FCUA 4L3HD 3I7HA 1VZ3A 2I0SA 3PSCB 4GM9A 4GQ1A 3CFVA 3ZE0A 4MK0B 4RE6A 2YBAA 3L4OD 2UZYB 4ZOVA 2IUVA 2WQ8A 3IIWA 2TRCB 3AH8B 4G1MA 3K72A 2J55H 2Z2OA 3MVDK 1SQ9A 4BH6A 4JHNA 1GOGA 3SMRA 3SBQA 5EM2B 5C2WB 3PVUB 1C9IA 2PM7B 5GXIA 3I7PA 3SN6B 4BUJC 2XL2A 2YNOA 4D9SA 4BP9A 3UVOA 2QZPA 2OJYA 4O3UB 3ZDXA 3O4IA 3JRPA 5AFU3 3FM0A 5EARA 2P9KC 4MMYA 5H17A 4PSWB 4A09B 4WK4A 1UOOA 3SCYA 3J81g 3C9CA 4YVDA 3KRWB 4AN1A 4L1MA 1GXRA 3O4JA 3FRXA 3UKRC 2H6KA 2UZXB 5M5UA 4IMMA 4FA4D 5AJAA 1H2ZA 3IKOA 2IWKA 2YNNA 2GC7A 2GC4A 4L9OA 3ULEC 2HXCA 3AL9A 4QAMA 2I3TA 2PM9A 3EI1A 4JHPC 4PBYA 2IWFA 1RI6A 1OMWB 2I0TA 2H47A 4PC0A 3JZNA 2P9LC 1E8NA 3PXSD 4CI2A 2B5NA 3EI2A 1K32A 2H9NA 1VE7A 4BCDA 1SHYB 4FA1D 3EI4B 1XIPA 5M5SA 4JD2C 3V4VA 2CN3A 2I0RA 3PE7A 4CZXA 1PI6A 3BG1A 3JZHA 4H5JA 3ZE1A 4J82A 3OKWA 5HE3B 2QXVA 5E6SA 3JB9L 2VDRA 3V5WB 2OVPB 3EMHA 3AL8A 3UR4A 4ERQA 5GSAA 3A0FA 2B4EA 5FKQA 3DXKC 5E6UA 4O9DA 3RFGA 4BL0A 5EMKB 3IUMA 2HYEA 1SQJA 3ODTA 1XKSA 3IVMA 1K3IA 4U7AA 3OF7A 4CZVA 3J80g 3IULA 3PVWB 4J73A 4BCCA 4GMBA 2P9SC 3I8EA 3I7OA 4O3TB 4FA9D 3IJEA 3DM0A 3F3GA 4J78A 4WK2A 4NBMA 4A0BA 1M1XA 3DSMA 4G1EA 3T3MA 5EAMA 5FFGA 5M5TA 4A7JA 2J57G 3IJ0A 1JJUB 5FKRA 5FKTA 2J56H 5FLXg 5GXHA 4PSXB 4X61B 4MMZA 5HE2B 3PSLA 4NENA 1TBGA 4Z7QA 3ZDYA 3ORVD 3EU7A 2P9PC 3VI4A 3SFZA 5M5RA 2JKXA 3V7DB 5IC7A 3W15A 3N0DA 4UM9A 3IJCA 4J79A 1E5TA 4GQ2P 4JT6C 3KCIA 5CYKA 5EMJB 2AGLA 2PM9B 5M61A 3EI1B 4IRZA 5I5MA 4E5ZA 2XL3A 2B5MA 4D6VA 4J0WA 2EIEA 5FQDA 1OLZA 2XYIA 4DNUA 2YB8B 1C9LA 5I5IA 1JMZB 1ERJA 4GQBB 4XEIC 2H14A 4OWRA 3EI2B 2G99A 2IURA 3VI3A 4RE5A 4AN0A 1U4CA 2HU7A 3IIYA 3DXMC 4J8BA 4Y5RD 1JMXB 4NSXA 2BKLA 5SXMA 4UM8A 4H5IA 4CI8A 5K1CC 3SJLD 3DWLC 4NAAA 1N6DA 5HE0B 3F3PA 4ZOZA 5GMKn 4JSNC 1N6EA 1YFQA 5CXBA 3SVWD 1BPOA 4A11A 1JTDB 2HKMA 3AL8B 3BWSA 4A2LA 2OK6A 2G9AA 2VDLA 4TZ4A 2VDOA 2H9MA 3C75H 4WJKA 4JXMA 4Y7RA 5TEEA 1GOHA 3SHFA 4AMYA 4AMZA 5IGOA 5JWZA 4G56B 4JSXC 1U2VC 1NEXB 2IUPA 4NC4A 3IJ1A 4FB1D 5THAA 3E0CA 3IURA 5HQGA 1P22A 3V9FA 2H9LA 3SBRA 1S4UX 4A0BB 2VDNA 2VDKA 2CE8A 3UVNA 4X60B 2HJBA 4Z7NA 3EQ8A 3FCSA 2OVRB 4ES0A 4K3JB 5B4WA 3DDUA 3K6SA 4PXWA 4U1EI 4KFMB 4AEZA 3IUNA 1T2XA 3ZE2A 3ZWLB 3KRXB 2Z2PA 3QHYB 4J81A 5EALA 3NIFA 3PXWD 4XYIA 2BBKH 4BCBA 4O45A 3MUOA 1QFSA 4IA9A 2IUQA 5CYKB 4PBZA 1TYEA 4ZOYA 3UKUC 4CY1A 3F3FA 4QL1A 2O9KA 2Q7QA 2EICA 4E5ZB 3C99A 4GZ8A 1E8MA 3JPXA 5A2Qg 5C92A 3OKYA 3BG0A 3I2NA 3GFCA 4J77A 1VZ2A 3VGZA 2PBIB 2OVQB 3EWEA 4O1QD 1L5GA 2IAAA 3V4PA 3OL2A 4QT8A 4HDJA 1JOFA 4O2WA 2AQ5A 1R5MA 1PEVA 5EMLB 3GC3B 5H1MA 4G55A 5M5VA 2VDMA 1B9YA 4JSPC 4L1QD 4A0AA 4ZOXA
chains in the Genus database with same CATH topology
3K27A 5CXBB 2AGZA 5CXCA 3RLMD 5IGQA 5H14A 4A11B 4E54A 4LG8A 2W18A 1FWXA 3CFSB 5C2VB 3FGBA 4CY5A 2AH1A 1GOTB 2BCJB 3EI3A 3N0EA 2AGXA 4PNKB 3NVXA 2P9UC 4CZYA 4A08A 2P9NC 2YMUA 2CNXA 4GM8A 3UVKA 4QRJA 4UI9R 4J84A 3MMYA 3JZGA 4FHLA 1GP2B 1PGUA 1N6FA 2CE9A 4J87A 3C5MA 2QC5A 1QNIA 3SXTD 4CY3A 1L0QA 3HFQA 3MKQA 4I79A 3PXTD 2H13A 3JROA 3P4FA 3K26A 2GNQA 3MKSB 5EAPA 2OK4A 3OKTA 4X3EA 2B5LA 4OZUA 4ERZA 4ESGA 1MG3A 5TF2A 2HESX 2HJ4A 5C9ZB 3I8CA 1Q47A 1TYQC 4CC9A 4K3ID 5FA5B 3RN1D 2I3SA 4JSVC 3I89A 4QQEA 5IJ8E 5AMSA 4GGCA 2OIZA 2MTAH 3SWSD 3U4YA 3OKYB 4FA5D 2H68A 3VH0A 3I7NA 4N14A 5TDHB 5IJ7E 2CN2A 2AGYA 2CO0C 4LGNA 4A2MA 3OL2B 4AOWA 3MZLA 5HYNB 4ERYA 4GM3A 4J0XA 1PBYB 4LG9A 1MDAH 2CO0A 3JAMg 3OW8A 3RMZD 3I7KA 4R7AB 2H9PA 4A0AB 4J86A 2HKRA 5FKSA 5TEFA 2H3XA 4FWWA 3OTTA 5CXCB 4E54B 4CY2A 3GREA 3RRMC 2Z2NA 3VA6A 4CI1A 1NR0A 3AFCA 3B7FA 3EI3B 2EBSA 3RFHA 1B9XA 4JT5C 5EM2A 2YNPA 4A08B 4X63B 5FXYA 3L4MD 1A0RB 1K8KC 2H6QA 3MZKA 3NVQA 3UVLA 4J8GA 3SBPA 4A09A 1MG2A 2H6NA 3CIKB 3UVMA 1XHMA 3MXXA 4XYHA 1VYHC 3EG6A 5HE1B 5IT9g 4EWRA 1GG2B 4D0KA 4GGDA 2AH0A 4CI3A 2P9IC 3RN0D 4FAND 5EMMB 5I5JA 2AGWA 4Z8LA 3EI4A 3I7LA 3SLED 3NVNA 2XU7A 4GGAA 5KDOB 4FAVD 2PM6B 4ZN4A 4L3GD 5K19A 3RSEC 4L3HD 3I7HA 2I0SA 3PSCB 4GM9A 4GQ1A 3CFVA 4MK0B 2YBAA 3L4OD 2UZYB 4ZOVA 2IUVA 3IIWA 2TRCB 3AH8B 2J55H 2Z2OA 1SQ9A 4BH6A 3SMRA 3SBQA 5EM2B 5C2WB 3PVUB 2PM7B 5GXIA 3I7PA 3SN6B 4BUJC 2XL2A 2YNOA 3UVOA 2OJYA 4O3UB 3JRPA 5AFU3 3FM0A 5EARA 2P9KC 5H17A 4PSWB 4A09B 3J81g 3SCYA 3C9CA 4YVDA 3KRWB 1GXRA 3FRXA 3UKRC 2H6KA 2UZXB 4IMMA 4FA4D 5AJAA 3IKOA 2IWKA 2YNNA 2GC7A 2GC4A 4L9OA 3ULEC 2HXCA 3AL9A 2I3TA 2PM9A 3EI1A 4PBYA 2IWFA 1RI6A 1OMWB 2I0TA 2H47A 4PC0A 3JZNA 2P9LC 3PXSD 4CI2A 2B5NA 3EI2A 1K32A 2H9NA 1SHYB 4FA1D 3EI4B 1XIPA 4JD2C 2CN3A 2I0RA 3PE7A 4CZXA 1PI6A 3BG1A 3JZHA 4H5JA 4J82A 3OKWA 5HE3B 2QXVA 3JB9L 3V5WB 2OVPB 3EMHA 3AL8A 3UR4A 4ERQA 5GSAA 3A0FA 2B4EA 5FKQA 3DXKC 3RFGA 4O9DA 4BL0A 5EMKB 2HYEA 1SQJA 3ODTA 1XKSA 4U7AA 4CZVA 3J80g 3PVWB 4J73A 4GMBA 2P9SC 3I8EA 3I7OA 4O3TB 4FA9D 3DM0A 3F3GA 4J78A 4A0BA 3DSMA 5EAMA 4A7JA 2J57G 3IJ0A 1JJUB 5FKRA 5FKTA 2J56H 5FLXg 5GXHA 4PSXB 4X61B 5HE2B 3PSLA 1TBGA 3ORVD 3EU7A 2P9PC 3SFZA 3V7DB 5IC7A 3W15A 3N0DA 3IJCA 4J79A 4GQ2P 4JT6C 5CYKA 5EMJB 2AGLA 2PM9B 3EI1B 5I5MA 4E5ZA 2XL3A 2B5MA 4D6VA 4J0WA 5FQDA 1OLZA 2XYIA 2YB8B 5I5IA 1JMZB 1ERJA 4GQBB 4XEIC 2H14A 4OWRA 3EI2B 2G99A 2IURA 1U4CA 3IIYA 3DXMC 4J8BA 4Y5RD 1JMXB 4NSXA 5SXMA 4H5IA 4CI8A 5K1CC 3SJLD 3DWLC 1N6DA 5HE0B 3F3PA 4ZOZA 5GMKn 4JSNC 1N6EA 1YFQA 5CXBA 3SVWD 4A11A 2HKMA 4A2LA 3AL8B 3BWSA 2OK6A 2G9AA 4TZ4A 2H9MA 3C75H 4JXMA 4Y7RA 5TEEA 3SHFA 5IGOA 5JWZA 4G56B 4JSXC 1U2VC 1NEXB 2IUPA 3IJ1A 4FB1D 5THAA 3E0CA 5HQGA 1P22A 3V9FA 2H9LA 3SBRA 1S4UX 4A0BB 2CE8A 3UVNA 4X60B 2HJBA 2OVRB 4ES0A 4K3JB 5B4WA 4PXWA 4U1EI 4KFMB 4AEZA 3ZWLB 3KRXB 2Z2PA 4J81A 5EALA 3PXWD 4XYIA 2BBKH 4O45A 4IA9A 2IUQA 5CYKB 4PBZA 4ZOYA 3UKUC 4CY1A 3F3FA 4QL1A 2O9KA 2Q7QA 4E5ZB 3C99A 4GZ8A 3JPXA 5A2Qg 3OKYA 3BG0A 3I2NA 3GFCA 4J77A 3VGZA 2PBIB 2OVQB 3EWEA 4O1QD 2IAAA 3OL2A 4QT8A 4HDJA 1JOFA 2AQ5A 1R5MA 1PEVA 5EMLB 5H1MA 1B9YA 4JSPC 4L1QD 4A0AA 4ZOXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K27 A;  5CXB B;  2AGZ A;  5CXC A;  3RLM D;  5IGQ A;  5H14 A;  4A11 B;  4E54 A;  4LG8 A;  2W18 A;  1FWX A;  3CFS B;  5C2V B;  3FGB A;  4CY5 A;  2AH1 A;  1GOT B;  2BCJ B;  3EI3 A;  3N0E A;  2AGX A;  4PNK B;  3NVX A;  2P9U C;  4CZY A;  4A08 A;  2P9N C;  2YMU A;  2CNX A;  4GM8 A;  3UVK A;  4QRJ A;  4UI9 R;  4J84 A;  3MMY A;  3JZG A;  4FHL A;  1GP2 B;  1PGU A;  1N6F A;  2CE9 A;  4J87 A;  3C5M A;  2QC5 A;  1QNI A;  3SXT D;  4CY3 A;  1L0Q A;  3HFQ A;  3MKQ A;  4I79 A;  3PXT D;  2H13 A;  3JRO A;  3P4F A;  3K26 A;  2GNQ A;  3MKS B;  5EAP A;  2OK4 A;  3OKT A;  4X3E A;  2B5L A;  4OZU A;  4ERZ A;  4ESG A;  1MG3 A;  5TF2 A;  2HES X;  2HJ4 A;  5C9Z B;  3I8C A;  1Q47 A;  1TYQ C;  4CC9 A;  4K3I D;  5FA5 B;  3RN1 D;  2I3S A;  4JSV C;  3I89 A;  4QQE A;  5IJ8 E;  5AMS A;  4GGC A;  2OIZ A;  2MTA H;  3SWS D;  3U4Y A;  3OKY B;  4FA5 D;  2H68 A;  3VH0 A;  3I7N A;  4N14 A;  5TDH B;  5IJ7 E;  2CN2 A;  2AGY A;  2CO0 C;  4LGN A;  4A2M A;  3OL2 B;  4AOW A;  3MZL A;  5HYN B;  4ERY A;  4GM3 A;  4J0X A;  1PBY B;  4LG9 A;  1MDA H;  2CO0 A;  3JAM g;  3OW8 A;  3RMZ D;  3I7K A;  4R7A B;  2H9P A;  4A0A B;  4J86 A;  2HKR A;  5FKS A;  5TEF A;  2H3X A;  4FWW A;  3OTT A;  5CXC B;  4E54 B;  4CY2 A;  3GRE A;  3RRM C;  2Z2N A;  3VA6 A;  4CI1 A;  1NR0 A;  3AFC A;  3B7F A;  3EI3 B;  2EBS A;  3RFH A;  1B9X A;  4JT5 C;  5EM2 A;  2YNP A;  4A08 B;  4X63 B;  5FXY A;  3L4M D;  1A0R B;  1K8K C;  2H6Q A;  3MZK A;  3NVQ A;  3UVL A;  4J8G A;  3SBP A;  4A09 A;  1MG2 A;  2H6N A;  3CIK B;  3UVM A;  1XHM A;  3MXX A;  4XYH A;  1VYH C;  3EG6 A;  5HE1 B;  5IT9 g;  4EWR A;  1GG2 B;  4D0K A;  4GGD A;  2AH0 A;  4CI3 A;  2P9I C;  3RN0 D;  4FAN D;  5EMM B;  5I5J A;  2AGW A;  4Z8L A;  3EI4 A;  3I7L A;  3SLE D;  3NVN A;  2XU7 A;  4GGA A;  5KDO B;  4FAV D;  2PM6 B;  4ZN4 A;  4L3G D;  5K19 A;  3RSE C;  4L3H D;  3I7H A;  2I0S A;  3PSC B;  4GM9 A;  4GQ1 A;  3CFV A;  4MK0 B;  2YBA A;  3L4O D;  2UZY B;  4ZOV A;  2IUV A;  3IIW A;  2TRC B;  3AH8 B;  2J55 H;  2Z2O A;  1SQ9 A;  4BH6 A;  3SMR A;  3SBQ A;  5EM2 B;  5C2W B;  3PVU B;  2PM7 B;  5GXI A;  3I7P A;  3SN6 B;  4BUJ C;  2XL2 A;  2YNO A;  3UVO A;  2OJY A;  4O3U B;  3JRP A;  5AFU 3;  3FM0 A;  5EAR A;  2P9K C;  5H17 A;  4PSW B;  4A09 B;  3J81 g;  3SCY A;  3C9C A;  4YVD A;  3KRW B;  1GXR A;  3FRX A;  3UKR C;  2H6K A;  2UZX B;  4IMM A;  4FA4 D;  5AJA A;  3IKO A;  2IWK A;  2YNN A;  2GC7 A;  2GC4 A;  4L9O A;  3ULE C;  2HXC A;  3AL9 A;  2I3T A;  2PM9 A;  3EI1 A;  4PBY A;  2IWF A;  1RI6 A;  1OMW B;  2I0T A;  2H47 A;  4PC0 A;  3JZN A;  2P9L C;  3PXS D;  4CI2 A;  2B5N A;  3EI2 A;  1K32 A;  2H9N A;  1SHY B;  4FA1 D;  3EI4 B;  1XIP A;  4JD2 C;  2CN3 A;  2I0R A;  3PE7 A;  4CZX A;  1PI6 A;  3BG1 A;  3JZH A;  4H5J A;  4J82 A;  3OKW A;  5HE3 B;  2QXV A;  3JB9 L;  3V5W B;  2OVP B;  3EMH A;  3AL8 A;  3UR4 A;  4ERQ A;  5GSA A;  3A0F A;  2B4E A;  5FKQ A;  3DXK C;  3RFG A;  4O9D A;  4BL0 A;  5EMK B;  2HYE A;  1SQJ A;  3ODT A;  1XKS A;  4U7A A;  4CZV A;  3J80 g;  3PVW B;  4J73 A;  4GMB A;  2P9S C;  3I8E A;  3I7O A;  4O3T B;  4FA9 D;  3DM0 A;  3F3G A;  4J78 A;  4A0B A;  3DSM A;  5EAM A;  4A7J A;  2J57 G;  3IJ0 A;  1JJU B;  5FKR A;  5FKT A;  2J56 H;  5FLX g;  5GXH A;  4PSX B;  4X61 B;  5HE2 B;  3PSL A;  1TBG A;  3ORV D;  3EU7 A;  2P9P C;  3SFZ A;  3V7D B;  5IC7 A;  3W15 A;  3N0D A;  3IJC A;  4J79 A;  4GQ2 P;  4JT6 C;  5CYK A;  5EMJ B;  2AGL A;  2PM9 B;  3EI1 B;  5I5M A;  4E5Z A;  2XL3 A;  2B5M A;  4D6V A;  4J0W A;  5FQD A;  1OLZ A;  2XYI A;  2YB8 B;  5I5I A;  1JMZ B;  1ERJ A;  4GQB B;  4XEI C;  2H14 A;  4OWR A;  3EI2 B;  2G99 A;  2IUR A;  1U4C A;  3IIY A;  3DXM C;  4J8B A;  4Y5R D;  1JMX B;  4NSX A;  5SXM A;  4H5I A;  4CI8 A;  5K1C C;  3SJL D;  3DWL C;  1N6D A;  5HE0 B;  3F3P A;  4ZOZ A;  5GMK n;  4JSN C;  1N6E A;  1YFQ A;  5CXB A;  3SVW D;  4A11 A;  2HKM A;  4A2L A;  3AL8 B;  3BWS A;  2OK6 A;  2G9A A;  4TZ4 A;  2H9M A;  3C75 H;  4JXM A;  4Y7R A;  5TEE A;  3SHF A;  5IGO A;  5JWZ A;  4G56 B;  4JSX C;  1U2V C;  1NEX B;  2IUP A;  3IJ1 A;  4FB1 D;  5THA A;  3E0C A;  5HQG A;  1P22 A;  3V9F A;  2H9L A;  3SBR A;  1S4U X;  4A0B B;  2CE8 A;  3UVN A;  4X60 B;  2HJB A;  2OVR B;  4ES0 A;  4K3J B;  5B4W A;  4PXW A;  4U1E I;  4KFM B;  4AEZ A;  3ZWL B;  3KRX B;  2Z2P A;  4J81 A;  5EAL A;  3PXW D;  4XYI A;  2BBK H;  4O45 A;  4IA9 A;  2IUQ A;  5CYK B;  4PBZ A;  4ZOY A;  3UKU C;  4CY1 A;  3F3F A;  4QL1 A;  2O9K A;  2Q7Q A;  4E5Z B;  3C99 A;  4GZ8 A;  3JPX A;  5A2Q g;  3OKY A;  3BG0 A;  3I2N A;  3GFC A;  4J77 A;  3VGZ A;  2PBI B;  2OVQ B;  3EWE A;  4O1Q D;  2IAA A;  3OL2 A;  4QT8 A;  4HDJ A;  1JOF A;  2AQ5 A;  1R5M A;  1PEV A;  5EML B;  5H1M A;  1B9Y A;  4JSP C;  4L1Q D;  4A0A A;  4ZOX A; 
#chains in the Genus database with same CATH topology
 3K27 A;  5HDB A;  5CXB B;  2AGZ A;  5CXC A;  3RLM D;  5IGQ A;  5H14 A;  4A11 B;  4BP8 A;  4LG8 A;  4E54 A;  2W18 A;  1FWX A;  1O6F A;  3CFS B;  2QR5 A;  3EQ9 A;  5C2V B;  3FGB A;  4CY5 A;  2AH1 A;  1GOT B;  2BCJ B;  3O4G A;  3EI3 A;  3N0E A;  3IUJ A;  2AGX A;  2VC2 A;  2VZ1 A;  4PNK B;  5FFO A;  3NVX A;  2P9U C;  4CZY A;  4A08 A;  2P9N C;  2YMU A;  2CNX A;  4GM8 A;  3UVK A;  2XE4 A;  4QRJ A;  4UI9 R;  4J84 A;  3MMY A;  3JZG A;  4FHL A;  1GP2 B;  1PGU A;  1N6F A;  2CE9 A;  4J87 A;  3C5M A;  2QC5 A;  3MUN A;  1H2W A;  1QNI A;  3SXT D;  4CY3 A;  1L0Q A;  3HFQ A;  3MKQ A;  4I79 A;  3PXT D;  2H13 A;  3JRO A;  3P4F A;  3K26 A;  5C86 A;  2GNQ A;  1UOQ A;  3MKS B;  5EAP A;  2OK4 A;  3OKT A;  4X3E A;  2B5L A;  2EID A;  4OZU A;  4ERZ A;  4ESG A;  1MG3 A;  5TF2 A;  2HES X;  2HJ4 A;  3EQ7 A;  5C9Z B;  4WK0 A;  3I8C A;  1Q47 A;  1TYQ C;  4CC9 A;  4K3I D;  4O02 A;  5FA5 B;  1H2X A;  2VDQ A;  2I3S A;  3NID A;  4JSV C;  3RN1 D;  3I89 A;  4QQE A;  5IJ8 E;  5AMS A;  4GGC A;  2OIZ A;  2MTA H;  3SWS D;  3U4Y A;  1GOF A;  3OKY B;  4FA5 D;  2H68 A;  3VH0 A;  3I7N A;  4N14 A;  2VDP A;  5TDH B;  5IJ7 E;  2CN2 A;  2AGY A;  2CO0 C;  4LGN A;  4A2M A;  3IUQ A;  3OL2 B;  4AOW A;  3MZL A;  5HYN B;  4ERY A;  4GM3 A;  3T3P A;  1UTC A;  4J0X A;  1PBY B;  4LG9 A;  1MDA H;  2CO0 A;  3JAM g;  1VE6 A;  1QFM A;  3OW8 A;  3QI0 A;  3RMZ D;  3I7K A;  3NIG A;  2H9P A;  4R7A B;  4A0A B;  4J86 A;  2HKR A;  5FKS A;  5TEF A;  2H3X A;  4FWW A;  3OTT A;  5CXC B;  4E54 B;  4Z7O A;  4CY2 A;  3GRE A;  3RRM C;  2Z2N A;  3VA6 A;  4CI1 A;  1NR0 A;  1UOP A;  3AFC A;  3B7F A;  3EI3 B;  2EBS A;  1O6G A;  3RFH A;  1B9X A;  4JT5 C;  5EM2 A;  3ZDZ A;  2YNP A;  4A08 B;  4X63 B;  5FXY A;  1A12 A;  4AX4 A;  3L4M D;  1A0R B;  1K8K C;  2H6Q A;  3MZK A;  2EIB A;  2XZG A;  4DNV A;  3NVQ A;  3UVL A;  4J8G A;  3SBP A;  3GD1 I;  4A09 A;  1MG2 A;  2H6N A;  3CIK B;  3UVM A;  1XHM A;  1U8C A;  3MXX A;  1VYH C;  4XYH A;  2XDW A;  1I2M B;  1YR2 A;  3EG6 A;  5E6R A;  5HE1 B;  4EWR A;  5IT9 g;  1GG2 B;  4D0K A;  4GGD A;  2AH0 A;  4CI3 A;  4MMX A;  2P9I C;  2HU8 A;  3RN0 D;  4FAN D;  5EMM B;  5I5J A;  4DNW A;  2AGW A;  2HU5 A;  1JV2 A;  4Z8L A;  2VZ3 A;  3EI4 A;  1H2Y A;  3I7L A;  3SLE D;  3NVN A;  2XU7 A;  4GGA A;  5KDO B;  3O4H A;  4FAV D;  2PM6 B;  4ZN4 A;  4L3G D;  3K71 A;  5K19 A;  3RSE C;  3FCU A;  4L3H D;  3I7H A;  1VZ3 A;  2I0S A;  3PSC B;  4GM9 A;  4GQ1 A;  3CFV A;  3ZE0 A;  4MK0 B;  4RE6 A;  2YBA A;  3L4O D;  2UZY B;  4ZOV A;  2IUV A;  2WQ8 A;  3IIW A;  2TRC B;  3AH8 B;  4G1M A;  3K72 A;  2J55 H;  2Z2O A;  3MVD K;  1SQ9 A;  4BH6 A;  4JHN A;  1GOG A;  3SMR A;  3SBQ A;  5EM2 B;  5C2W B;  3PVU B;  1C9I A;  2PM7 B;  5GXI A;  3I7P A;  3SN6 B;  4BUJ C;  2XL2 A;  2YNO A;  4D9S A;  4BP9 A;  3UVO A;  2QZP A;  2OJY A;  4O3U B;  3ZDX A;  3O4I A;  3JRP A;  5AFU 3;  3FM0 A;  5EAR A;  2P9K C;  4MMY A;  5H17 A;  4PSW B;  4A09 B;  4WK4 A;  1UOO A;  3SCY A;  3J81 g;  3C9C A;  4YVD A;  3KRW B;  4AN1 A;  4L1M A;  1GXR A;  3O4J A;  3FRX A;  3UKR C;  2H6K A;  2UZX B;  5M5U A;  4IMM A;  4FA4 D;  5AJA A;  1H2Z A;  3IKO A;  2IWK A;  2YNN A;  2GC7 A;  2GC4 A;  4L9O A;  3ULE C;  2HXC A;  3AL9 A;  4QAM A;  2I3T A;  2PM9 A;  3EI1 A;  4JHP C;  4PBY A;  2IWF A;  1RI6 A;  1OMW B;  2I0T A;  2H47 A;  4PC0 A;  3JZN A;  2P9L C;  1E8N A;  3PXS D;  4CI2 A;  2B5N A;  3EI2 A;  1K32 A;  2H9N A;  1VE7 A;  4BCD A;  1SHY B;  4FA1 D;  3EI4 B;  1XIP A;  5M5S A;  4JD2 C;  3V4V A;  2CN3 A;  2I0R A;  3PE7 A;  4CZX A;  1PI6 A;  3BG1 A;  3JZH A;  4H5J A;  3ZE1 A;  4J82 A;  3OKW A;  5HE3 B;  2QXV A;  5E6S A;  3JB9 L;  2VDR A;  3V5W B;  2OVP B;  3EMH A;  3AL8 A;  3UR4 A;  4ERQ A;  5GSA A;  3A0F A;  2B4E A;  5FKQ A;  3DXK C;  5E6U A;  4O9D A;  3RFG A;  4BL0 A;  5EMK B;  3IUM A;  2HYE A;  1SQJ A;  3ODT A;  1XKS A;  3IVM A;  1K3I A;  4U7A A;  3OF7 A;  4CZV A;  3J80 g;  3IUL A;  3PVW B;  4J73 A;  4BCC A;  4GMB A;  2P9S C;  3I8E A;  3I7O A;  4O3T B;  4FA9 D;  3IJE A;  3DM0 A;  3F3G A;  4J78 A;  4WK2 A;  4NBM A;  4A0B A;  1M1X A;  3DSM A;  4G1E A;  3T3M A;  5EAM A;  5FFG A;  5M5T A;  4A7J A;  2J57 G;  3IJ0 A;  1JJU B;  5FKR A;  5FKT A;  2J56 H;  5FLX g;  5GXH A;  4PSX B;  4X61 B;  4MMZ A;  5HE2 B;  3PSL A;  4NEN A;  1TBG A;  4Z7Q A;  3ZDY A;  3ORV D;  3EU7 A;  2P9P C;  3VI4 A;  3SFZ A;  5M5R A;  2JKX A;  3V7D B;  5IC7 A;  3W15 A;  3N0D A;  4UM9 A;  3IJC A;  4J79 A;  1E5T A;  4GQ2 P;  4JT6 C;  3KCI A;  5CYK A;  5EMJ B;  2AGL A;  2PM9 B;  5M61 A;  3EI1 B;  4IRZ A;  5I5M A;  4E5Z A;  2XL3 A;  2B5M A;  4D6V A;  4J0W A;  2EIE A;  5FQD A;  1OLZ A;  2XYI A;  4DNU A;  2YB8 B;  1C9L A;  5I5I A;  1JMZ B;  1ERJ A;  4GQB B;  4XEI C;  2H14 A;  4OWR A;  3EI2 B;  2G99 A;  2IUR A;  3VI3 A;  4RE5 A;  4AN0 A;  1U4C A;  2HU7 A;  3IIY A;  3DXM C;  4J8B A;  4Y5R D;  1JMX B;  4NSX A;  2BKL A;  5SXM A;  4UM8 A;  4H5I A;  4CI8 A;  5K1C C;  3SJL D;  3DWL C;  4NAA A;  1N6D A;  5HE0 B;  3F3P A;  4ZOZ A;  5GMK n;  4JSN C;  1N6E A;  1YFQ A;  5CXB A;  3SVW D;  1BPO A;  4A11 A;  1JTD B;  2HKM A;  3AL8 B;  3BWS A;  4A2L A;  2OK6 A;  2G9A A;  2VDL A;  4TZ4 A;  2VDO A;  2H9M A;  3C75 H;  4WJK A;  4JXM A;  4Y7R A;  5TEE A;  1GOH A;  3SHF A;  4AMY A;  4AMZ A;  5IGO A;  5JWZ A;  4G56 B;  4JSX C;  1U2V C;  1NEX B;  2IUP A;  4NC4 A;  3IJ1 A;  4FB1 D;  5THA A;  3E0C A;  3IUR A;  5HQG A;  1P22 A;  3V9F A;  2H9L A;  3SBR A;  1S4U X;  4A0B B;  2VDN A;  2VDK A;  2CE8 A;  3UVN A;  4X60 B;  2HJB A;  4Z7N A;  3EQ8 A;  3FCS A;  2OVR B;  4ES0 A;  4K3J B;  5B4W A;  3DDU A;  3K6S A;  4PXW A;  4U1E I;  4KFM B;  4AEZ A;  3IUN A;  1T2X A;  3ZE2 A;  3ZWL B;  3KRX B;  2Z2P A;  3QHY B;  4J81 A;  5EAL A;  3NIF A;  3PXW D;  4XYI A;  2BBK H;  4BCB A;  4O45 A;  3MUO A;  1QFS A;  4IA9 A;  2IUQ A;  5CYK B;  4PBZ A;  1TYE A;  4ZOY A;  3UKU C;  4CY1 A;  3F3F A;  4QL1 A;  2O9K A;  2Q7Q A;  2EIC A;  4E5Z B;  3C99 A;  4GZ8 A;  1E8M A;  3JPX A;  5A2Q g;  5C92 A;  3OKY A;  3BG0 A;  3I2N A;  3GFC A;  4J77 A;  1VZ2 A;  3VGZ A;  2PBI B;  2OVQ B;  3EWE A;  4O1Q D;  1L5G A;  2IAA A;  3V4P A;  3OL2 A;  4QT8 A;  4HDJ A;  1JOF A;  4O2W A;  2AQ5 A;  1R5M A;  1PEV A;  5EML B;  3GC3 B;  5H1M A;  4G55 A;  5M5V A;  2VDM A;  1B9Y A;  4JSP C;  4L1Q D;  4A0A A;  4ZOX A; 
#chains in the Genus database with same CATH homology
 3K27 A;  5CXB B;  2AGZ A;  5CXC A;  3RLM D;  5IGQ A;  5H14 A;  4A11 B;  4E54 A;  4LG8 A;  2W18 A;  1FWX A;  3CFS B;  5C2V B;  3FGB A;  4CY5 A;  2AH1 A;  1GOT B;  2BCJ B;  3EI3 A;  3N0E A;  2AGX A;  4PNK B;  3NVX A;  2P9U C;  4CZY A;  4A08 A;  2P9N C;  2YMU A;  2CNX A;  4GM8 A;  3UVK A;  4QRJ A;  4UI9 R;  4J84 A;  3MMY A;  3JZG A;  4FHL A;  1GP2 B;  1PGU A;  1N6F A;  2CE9 A;  4J87 A;  3C5M A;  2QC5 A;  1QNI A;  3SXT D;  4CY3 A;  1L0Q A;  3HFQ A;  3MKQ A;  4I79 A;  3PXT D;  2H13 A;  3JRO A;  3P4F A;  3K26 A;  2GNQ A;  3MKS B;  5EAP A;  2OK4 A;  3OKT A;  4X3E A;  2B5L A;  4OZU A;  4ERZ A;  4ESG A;  1MG3 A;  5TF2 A;  2HES X;  2HJ4 A;  5C9Z B;  3I8C A;  1Q47 A;  1TYQ C;  4CC9 A;  4K3I D;  5FA5 B;  3RN1 D;  2I3S A;  4JSV C;  3I89 A;  4QQE A;  5IJ8 E;  5AMS A;  4GGC A;  2OIZ A;  2MTA H;  3SWS D;  3U4Y A;  3OKY B;  4FA5 D;  2H68 A;  3VH0 A;  3I7N A;  4N14 A;  5TDH B;  5IJ7 E;  2CN2 A;  2AGY A;  2CO0 C;  4LGN A;  4A2M A;  3OL2 B;  4AOW A;  3MZL A;  5HYN B;  4ERY A;  4GM3 A;  4J0X A;  1PBY B;  4LG9 A;  1MDA H;  2CO0 A;  3JAM g;  3OW8 A;  3RMZ D;  3I7K A;  4R7A B;  2H9P A;  4A0A B;  4J86 A;  2HKR A;  5FKS A;  5TEF A;  2H3X A;  4FWW A;  3OTT A;  5CXC B;  4E54 B;  4CY2 A;  3GRE A;  3RRM C;  2Z2N A;  3VA6 A;  4CI1 A;  1NR0 A;  3AFC A;  3B7F A;  3EI3 B;  2EBS A;  3RFH A;  1B9X A;  4JT5 C;  5EM2 A;  2YNP A;  4A08 B;  4X63 B;  5FXY A;  3L4M D;  1A0R B;  1K8K C;  2H6Q A;  3MZK A;  3NVQ A;  3UVL A;  4J8G A;  3SBP A;  4A09 A;  1MG2 A;  2H6N A;  3CIK B;  3UVM A;  1XHM A;  3MXX A;  4XYH A;  1VYH C;  3EG6 A;  5HE1 B;  5IT9 g;  4EWR A;  1GG2 B;  4D0K A;  4GGD A;  2AH0 A;  4CI3 A;  2P9I C;  3RN0 D;  4FAN D;  5EMM B;  5I5J A;  2AGW A;  4Z8L A;  3EI4 A;  3I7L A;  3SLE D;  3NVN A;  2XU7 A;  4GGA A;  5KDO B;  4FAV D;  2PM6 B;  4ZN4 A;  4L3G D;  5K19 A;  3RSE C;  4L3H D;  3I7H A;  2I0S A;  3PSC B;  4GM9 A;  4GQ1 A;  3CFV A;  4MK0 B;  2YBA A;  3L4O D;  2UZY B;  4ZOV A;  2IUV A;  3IIW A;  2TRC B;  3AH8 B;  2J55 H;  2Z2O A;  1SQ9 A;  4BH6 A;  3SMR A;  3SBQ A;  5EM2 B;  5C2W B;  3PVU B;  2PM7 B;  5GXI A;  3I7P A;  3SN6 B;  4BUJ C;  2XL2 A;  2YNO A;  3UVO A;  2OJY A;  4O3U B;  3JRP A;  5AFU 3;  3FM0 A;  5EAR A;  2P9K C;  5H17 A;  4PSW B;  4A09 B;  3J81 g;  3SCY A;  3C9C A;  4YVD A;  3KRW B;  1GXR A;  3FRX A;  3UKR C;  2H6K A;  2UZX B;  4IMM A;  4FA4 D;  5AJA A;  3IKO A;  2IWK A;  2YNN A;  2GC7 A;  2GC4 A;  4L9O A;  3ULE C;  2HXC A;  3AL9 A;  2I3T A;  2PM9 A;  3EI1 A;  4PBY A;  2IWF A;  1RI6 A;  1OMW B;  2I0T A;  2H47 A;  4PC0 A;  3JZN A;  2P9L C;  3PXS D;  4CI2 A;  2B5N A;  3EI2 A;  1K32 A;  2H9N A;  1SHY B;  4FA1 D;  3EI4 B;  1XIP A;  4JD2 C;  2CN3 A;  2I0R A;  3PE7 A;  4CZX A;  1PI6 A;  3BG1 A;  3JZH A;  4H5J A;  4J82 A;  3OKW A;  5HE3 B;  2QXV A;  3JB9 L;  3V5W B;  2OVP B;  3EMH A;  3AL8 A;  3UR4 A;  4ERQ A;  5GSA A;  3A0F A;  2B4E A;  5FKQ A;  3DXK C;  3RFG A;  4O9D A;  4BL0 A;  5EMK B;  2HYE A;  1SQJ A;  3ODT A;  1XKS A;  4U7A A;  4CZV A;  3J80 g;  3PVW B;  4J73 A;  4GMB A;  2P9S C;  3I8E A;  3I7O A;  4O3T B;  4FA9 D;  3DM0 A;  3F3G A;  4J78 A;  4A0B A;  3DSM A;  5EAM A;  4A7J A;  2J57 G;  3IJ0 A;  1JJU B;  5FKR A;  5FKT A;  2J56 H;  5FLX g;  5GXH A;  4PSX B;  4X61 B;  5HE2 B;  3PSL A;  1TBG A;  3ORV D;  3EU7 A;  2P9P C;  3SFZ A;  3V7D B;  5IC7 A;  3W15 A;  3N0D A;  3IJC A;  4J79 A;  4GQ2 P;  4JT6 C;  5CYK A;  5EMJ B;  2AGL A;  2PM9 B;  3EI1 B;  5I5M A;  4E5Z A;  2XL3 A;  2B5M A;  4D6V A;  4J0W A;  5FQD A;  1OLZ A;  2XYI A;  2YB8 B;  5I5I A;  1JMZ B;  1ERJ A;  4GQB B;  4XEI C;  2H14 A;  4OWR A;  3EI2 B;  2G99 A;  2IUR A;  1U4C A;  3IIY A;  3DXM C;  4J8B A;  4Y5R D;  1JMX B;  4NSX A;  5SXM A;  4H5I A;  4CI8 A;  5K1C C;  3SJL D;  3DWL C;  1N6D A;  5HE0 B;  3F3P A;  4ZOZ A;  5GMK n;  4JSN C;  1N6E A;  1YFQ A;  5CXB A;  3SVW D;  4A11 A;  2HKM A;  4A2L A;  3AL8 B;  3BWS A;  2OK6 A;  2G9A A;  4TZ4 A;  2H9M A;  3C75 H;  4JXM A;  4Y7R A;  5TEE A;  3SHF A;  5IGO A;  5JWZ A;  4G56 B;  4JSX C;  1U2V C;  1NEX B;  2IUP A;  3IJ1 A;  4FB1 D;  5THA A;  3E0C A;  5HQG A;  1P22 A;  3V9F A;  2H9L A;  3SBR A;  1S4U X;  4A0B B;  2CE8 A;  3UVN A;  4X60 B;  2HJB A;  2OVR B;  4ES0 A;  4K3J B;  5B4W A;  4PXW A;  4U1E I;  4KFM B;  4AEZ A;  3ZWL B;  3KRX B;  2Z2P A;  4J81 A;  5EAL A;  3PXW D;  4XYI A;  2BBK H;  4O45 A;  4IA9 A;  2IUQ A;  5CYK B;  4PBZ A;  4ZOY A;  3UKU C;  4CY1 A;  3F3F A;  4QL1 A;  2O9K A;  2Q7Q A;  4E5Z B;  3C99 A;  4GZ8 A;  3JPX A;  5A2Q g;  3OKY A;  3BG0 A;  3I2N A;  3GFC A;  4J77 A;  3VGZ A;  2PBI B;  2OVQ B;  3EWE A;  4O1Q D;  2IAA A;  3OL2 A;  4QT8 A;  4HDJ A;  1JOF A;  2AQ5 A;  1R5M A;  1PEV A;  5EML B;  5H1M A;  1B9Y A;  4JSP C;  4L1Q D;  4A0A A;  4ZOX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...