2CO0A

Wdr5 and unmodified histone h3 complex at 2.25 angstrom
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
304
structure length
304
Chain Sequence
b'VKPNYALMFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGMCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNDLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD-REPEAT PROTEIN 5
molecule tags Transcription
source organism Homo sapiens
publication title Histone H3 Recognition and Presentation by the Wdr5 Module of the Mll1 Complex
pubmed doi rcsb
total genus 100
structure length 304
sequence length 304
ec nomenclature
pdb deposition date 2006-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2co0A00
4GGAA 3UVLA 3EI3A 2PM9A 4K3ID 4BUJC 3KRXB 5A2Qg 4E5ZB 3GFCA 2CE9A 3SMRA 3B7FA 3I7LA 3JAMg 4GM8A 2AQ5A 3OW8A 5HQGA 5CXCA 5THAA 2YNNA 4J73A 3JROA 3UVKA 5TEEA 1N6DA 2TRCB 2UZYB 4XYIA 3JZHA 4D6VA 3AL9A 3EMHA 1B9YA 2IUPA 1JJUB 2PM7B 2H9NA 4YVDA 3SN6B 3AFCA 4A0BB 3V9FA 4QQEA 4ESGA 4QT8A 5FKTA 2P9SC 2G9AA 2BCJB 5EMKB 3MKQA 4HDJA 3OKWA 2I3SA 4JSXC 4CZYA 2B5LA 3UR4A 1SQ9A 4ZN4A 1YFQA 2HYEA 2P9LC 4CY3A 2H68A 3VA6A 4FA9D 5EAMA 4A7JA 4FB1D 4X63B 3U4YA 4GQ1A 3W15A 4CI8A 2J55H 4O1QD 5GXHA 5CYKA 5FXYA 5CXCB 4JSNC 4O3UB 2J57G 4XYHA 4L9OA 1RI6A 4JT5C 4ERYA 2H14A 4JXMA 3EI4A 4CZVA 2AGXA 4A11A 4FHLA 3JPXA 3J81g 4GZ8A 2XL3A 1PBYB 1PEVA 2IUVA 4A08A 3PXTD 5EMMB 1GP2B 2IUQA 3GREA 1MG3A 2QC5A 3CFVA 3JRPA 3OL2B 3L4OD 5CXBA 2HJ4A 2G99A 3I8CA 5FA5B 5SXMA 4XEIC 3RN1D 3C99A 1JOFA 1ERJA 3JZGA 3UKUC 3FM0A 1OLZA 3IIWA 2MTAH 2OK4A 4J86A 1SQJA 5IJ8E 1P22A 4BL0A 1TBGA 4EWRA 5EALA 4NSXA 5AMSA 3V7DB 3DWLC 4O45A 4L3GD 3PE7A 4JSPC 5AFU3 4U7AA 5FQDA 1L0QA 3VGZA 4AEZA 2Z2PA 1B9XA 3SJLD 4E54A 2IWFA 1VYHC 2HKMA 3JB9L 3MKSB 5TDHB 2OIZA 2CN2A 4E5ZA 2B4EA 3J80g 4O9DA 3F3GA 3RFGA 2AGWA 4OWRA 3IIYA 4ZOXA 1GOTB 3PXWD 4LG9A 5HE3B 3UKRC 3A0FA 3EI3B 2Z2OA 4X3EA 3BG0A 4PBYA 3UVNA 2GC7A 4PSWB 3AH8B 2AGLA 4K3JB 3KRWB 4FA4D 4J79A 4PXWA 2CE8A 2H9PA 5I5IA 1PGUA 2YNPA 2OVPB 3PXSD 3EI2B 4U1EI 4J0XA 3SFZA 5AJAA 5FKQA 3SBQA 3ZWLB 3N0DA 3OKYB 2AH1A 4I79A 2I0RA 5EARA 5K1CC 1TYQC 3OKYA 1OMWB 3EG6A 5EMJB 2PBIB 3IJCA 2GC4A 3L4MD 4CZXA 5HE0B 3RSEC 4GMBA 3I2NA 4J8GA 2P9NC 4N14A 3PVWB 2XU7A 3EI1B 3PSLA 4ES0A 3DXKC 2XYIA 1MDAH 3JZNA 2J56H 3F3PA 4O3TB 4FA1D 4FAND 2H6NA 3V5WB 4CI2A 1XHMA 3DSMA 2B5MA 5EM2A 3SBRA 4X61B 3SXTD 4A09B 5IGQA 2QXVA 2OK6A 3EU7A 4A11B 4A0AB 4CY2A 4GQBB 4R7AB 4FWWA 2IAAA 4J0WA 5GXIA 5JWZA 4Y5RD 3OL2A 1PI6A 2PM6B 3I7KA 5CYKB 2OVRB 3SBPA 4GGDA 2HXCA 3MZLA 3BWSA 2H6KA 4A09A 2HESX 5IT9g 4LG8A 2GNQA 3I7PA 1N6EA 5K19A 3C5MA 4MK0B 4L1QD 1K8KC 2HKRA 1K32A 2OJYA 3N0EA 1S4UX 1R5MA 2Z2NA 3RLMD 3MXXA 3IJ1A 2P9KC 3I89A 3NVNA 3SWSD 3NVQA 3RMZD 4JSVC 3EI2A 1Q47A 2H13A 2P9PC 4ERZA 2BBKH 1U4CA 4GM9A 5C9ZB 3ULEC 5GMKn 4Y7RA 5I5MA 3UVOA 2OVQB 4E54B 3BG1A 2YBAA 2H9MA 2P9UC 4FA5D 3OTTA 4A08B 3I7HA 4FAVD 2UZXB 1U2VC 5IC7A 4A2LA 2CO0C 1MG2A 1N6FA 4A0BA 3C75H 1JMXB 5KDOB 3ODTA 5HE2B 3AL8A 3FGBA 2EBSA 3MMYA 4A2MA 5H1MA 5TEFA 2YMUA 5IGOA 4J78A 3C9CA 4LGNA 4CC9A 1NR0A 4ZOYA 4IA9A 2XL2A 4BH6A 5HYNB 3DM0A 3K27A 2I0TA 2I3TA 4J77A 2CN3A 3CFSB 4J8BA 4AOWA 2AGYA 4GGCA 1QNIA 3K26A 4ZOVA 1FWXA 3SHFA 5CXBB 5FKRA 2Q7QA 3SCYA 5EAPA 3I7OA 4D0KA 4L3HD 5B4WA 4ERQA 4QRJA 4PC0A 3IJ0A 4QL1A 5C2WB 3EWEA 4Z8LA 4G56B 1NEXB 3CIKB 3NVXA 3EI1A 5C2VB 2PM9B 4X60B 4KFMB 2B5NA 4CI3A 2YB8B 1GG2B 4J84A 1SHYB 5FLXg 3I8EA 4PNKB 5FKSA 2HJBA 3I7NA 4GM3A 3HFQA 4ZOZA 5IJ7E 1JMZB 1GXRA 4UI9R 3SLED 3RN0D 5I5JA 3SVWD 4H5IA 4PBZA 2IURA 2W18A 5EM2B 4TZ4A 2I0SA 1XKSA 2O9KA 3MZKA 4OZUA 2CO0A 3RFHA 2AGZA 4JD2C 4CY1A 3RRMC 2H3XA 4H5JA 3E0CA 3OKTA 2IWKA 4GQ2P 5EMLB 3F3FA 3UVMA 3FRXA 3IKOA 4J81A 4A0AA 3PVUB 4JT6C 5TF2A 3ORVD 4IMMA 3DXMC 3VH0A 4J87A 2AH0A 1A0RB 2P9IC 3PSCB 2H47A 4CY5A 4PSXB 5H17A 5H14A 3P4FA 5GSAA 2CNXA 3EI4B 4CI1A 4J82A 3AL8B 1XIPA 5HE1B 2H9LA 2H6QA 2YNOA
chains in the Genus database with same CATH superfamily
2VDLA 4GGAA 1O6FA 4WK2A 3UVLA 3EI3A 2PM9A 4K3ID 4BUJC 1GOFA 3KRXB 5A2Qg 4E5ZB 3GFCA 2CE9A 3SMRA 3B7FA 3I7LA 5M5TA 3JAMg 4GM8A 2AQ5A 1H2ZA 3OW8A 5CXCA 5HQGA 5THAA 2YNNA 4J73A 3JROA 4DNWA 1I2MB 3VI4A 4Z7NA 3UVKA 5TEEA 1N6DA 2TRCB 5FFGA 2UZYB 4XYIA 1JV2A 2VDMA 3JZHA 4D6VA 1UOPA 3AL9A 1JTDB 2VDOA 3EMHA 1B9YA 2IUPA 1JJUB 2XDWA 2PM7B 2H9NA 4YVDA 4AN1A 3SN6B 3AFCA 4O02A 4A0BB 3V9FA 4QQEA 4ESGA 4QT8A 5FKTA 2P9SC 4UM8A 2G9AA 2BCJB 5EMKB 3MKQA 2QZPA 4HDJA 3OKWA 2I3SA 4JSXC 4Z7OA 4CZYA 2B5LA 3UR4A 1SQ9A 4ZN4A 3EQ8A 1YFQA 4G1MA 2HYEA 2P9LC 4CY3A 2H68A 3VA6A 4FA9D 5EAMA 4A7JA 4FB1D 4X63B 3U4YA 4GQ1A 3W15A 1A12A 2J55H 4CI8A 4O1QD 5GXHA 4BCDA 1VE6A 5CYKA 5FXYA 5C86A 5CXCB 4JSNC 4O3UB 3O4JA 1VZ2A 1VE7A 2EIDA 4AMZA 4MMZA 2J57G 4XYHA 4L9OA 2EIBA 1RI6A 4JT5C 4ERYA 2H14A 4JXMA 3EI4A 4CZVA 1T2XA 2AGXA 4A11A 4DNUA 2VDNA 4FHLA 1TYEA 5C92A 3JPXA 3J81g 4GZ8A 2XL3A 1PBYB 1PEVA 2IUVA 1GOGA 4A08A 3PXTD 5EMMB 1GP2B 2IUQA 3GREA 1MG3A 2QC5A 3CFVA 3JRPA 3OL2B 2G99A 3L4OD 2HJ4A 5CXBA 3I8CA 5FA5B 2XE4A 5SXMA 4XEIC 3RN1D 4AN0A 3C99A 1E8MA 1JOFA 1ERJA 1QFSA 5M5SA 3JZGA 5M61A 3UKUC 3FM0A 1OLZA 3IIWA 2MTAH 2OK4A 4J86A 1SQJA 5IJ8E 5E6RA 1P22A 4BL0A 1U8CA 2JKXA 4BCBA 1TBGA 4EWRA 5EALA 1BPOA 3MVDK 4IRZA 4NSXA 5AMSA 3V7DB 4RE6A 3DWLC 4O45A 4L3GD 4UM9A 3PE7A 4JSPC 5AFU3 4U7AA 5FQDA 1L0QA 3VGZA 4AEZA 2Z2PA 1B9XA 3SJLD 4E54A 2IWFA 1VYHC 2HKMA 3JB9L 1GOHA 3MKSB 4MMYA 5TDHB 2VZ3A 2OIZA 2CN2A 4E5ZA 2B4EA 3IUQA 3J80g 4O9DA 4Z7QA 3F3GA 4D9SA 3RFGA 3ZDZA 2AGWA 4OWRA 3IIYA 1UOQA 5HDBA 4ZOXA 1GOTB 3PXWD 4LG9A 3EQ9A 3VI3A 5HE3B 3UKRC 3A0FA 3EI3B 2Z2OA 4G55A 4RE5A 4X3EA 3BG0A 4PBYA 3UVNA 2GC7A 4PSWB 3AH8B 2AGLA 4K3JB 3KRWB 3V4PA 4FA4D 4J79A 4PXWA 2XZGA 2H9LA 2CE8A 2H9PA 5I5IA 4G1EA 5M5RA 1PGUA 2YNPA 2OVPB 3PXSD 3K6SA 3EI2B 4U1EI 3GD1I 4J0XA 3SFZA 5AJAA 1E5TA 5FKQA 1QFMA 3SBQA 3ZWLB 5M5VA 3IVMA 3N0DA 3OKYB 2AH1A 4I79A 2I0RA 1E8NA 5EARA 5K1CC 1TYQC 3OKYA 1OMWB 3EG6A 5EMJB 2PBIB 3IJCA 2EICA 2GC4A 3L4MD 4CZXA 5HE0B 3RSEC 4GMBA 3I2NA 3NIDA 4J8GA 2P9NC 4N14A 3PVWB 2XU7A 3K72A 3EI1B 1YR2A 3PSLA 4ES0A 3DXKC 4O2WA 4BCCA 2XYIA 1MDAH 3JZNA 2J56H 4NBMA 3F3PA 4O3TB 4FA1D 4FAND 2H6NA 3V5WB 3QI0A 4CI2A 1XHMA 3DSMA 1H2YA 1VZ3A 3O4GA 2B5MA 5EM2A 1M1XA 2VZ1A 3SBRA 4X61B 3SXTD 4A09B 5IGQA 2QXVA 2OK6A 4QAMA 3DDUA 3EU7A 3IJEA 3ZDYA 4A11B 4A0AB 4CY2A 2QR5A 4GQBB 4R7AB 4FWWA 2IAAA 4J0WA 5GXIA 5JWZA 3KCIA 4Y5RD 3OL2A 1PI6A 2PM6B 3I7KA 5CYKB 2OVRB 3SBPA 4GGDA 2HXCA 3MZLA 3BWSA 2H6KA 4A09A 2HESX 5IT9g 4LG8A 2GNQA 3I7PA 1N6EA 5K19A 3C5MA 4MK0B 4L1QD 4NAAA 1K8KC 2HKRA 1K32A 2OJYA 3N0EA 1S4UX 3IULA 1R5MA 2Z2NA 3RLMD 3MXXA 3IJ1A 2VC2A 2P9KC 3I89A 2HU8A 5E6SA 3NVNA 3SWSD 3NVQA 3RMZD 3O4HA 3NIGA 4JSVC 3EI2A 3IUNA 1Q47A 2H13A 3IURA 2P9PC 4ERZA 2BBKH 1U4CA 4GM9A 5C9ZB 4WK0A 3ULEC 5GMKn 4Y7RA 1UOOA 3V4VA 5I5MA 3UVOA 2HU5A 2OVQB 4E54B 3BG1A 2YBAA 2H9MA 2P9UC 4FA5D 3OTTA 1C9LA 4A08B 3I7HA 4FAVD 1K3IA 2UZXB 1U2VC 1L5GA 5IC7A 3ZE1A 4A2LA 2CO0C 1MG2A 2VDQA 1N6FA 3C75H 1JMXB 4A0BA 5KDOB 3ODTA 5HE2B 3AL8A 3FGBA 2EBSA 3MMYA 2VDRA 4A2MA 5H1MA 5TEFA 2YMUA 2WQ8A 5IGOA 4J78A 3C9CA 4LGNA 4CC9A 1NR0A 4ZOYA 3FCSA 4IA9A 2XL2A 3ZE0A 4BH6A 5HYNB 3DM0A 3K27A 2VDKA 2I0TA 2I3TA 4J77A 2CN3A 3CFSB 4J8BA 4WK4A 4AOWA 2AGYA 1H2WA 4GGCA 1QNIA 3K26A 4WJKA 4ZOVA 1FWXA 3SHFA 1UTCA 5CXBB 4NENA 5FKRA 2Q7QA 3SCYA 3IUJA 5EAPA 2HU7A 3I7OA 4L3HD 5B4WA 4D0KA 4ERQA 4QRJA 4PC0A 3QHYB 4NC4A 3IJ0A 4QL1A 2EIEA 4BP8A 5C2WB 3EWEA 4Z8LA 4G56B 1NEXB 3CIKB 3FCUA 4AMYA 3NVXA 3EQ7A 3EI1A 5C2VB 4JHPC 2PM9B 4X60B 3MUOA 4KFMB 2B5NA 4CI3A 2YB8B 1GG2B 5FFOA 4J84A 1SHYB 5FLXg 3I8EA 4PNKB 5FKSA 5M5UA 2HJBA 3I7NA 4GM3A 3HFQA 4ZOZA 5IJ7E 3IUMA 1JMZB 1GXRA 4UI9R 3T3MA 3SLED 1O6GA 3RN0D 5I5JA 3SVWD 4MMXA 4H5IA 2BKLA 4PBZA 2IURA 2W18A 5EM2B 4TZ4A 2I0SA 2VDPA 1XKSA 2O9KA 3MZKA 4DNVA 4L1MA 4JHNA 4OZUA 2CO0A 3RFHA 2AGZA 4JD2C 3GC3B 4CY1A 3ZE2A 1C9IA 3RRMC 2H3XA 4H5JA 3E0CA 3OKTA 2IWKA 4GQ2P 5EMLB 3F3FA 3OF7A 3K71A 4AX4A 3UVMA 3FRXA 3IKOA 4J81A 4A0AA 3MUNA 3PVUB 4JT6C 5TF2A 3ORVD 4IMMA 3DXMC 5E6UA 3VH0A 4J87A 2AH0A 1A0RB 2P9IC 3PSCB 2H47A 4BP9A 4CY5A 4PSXB 1H2XA 5H17A 5H14A 3P4FA 5GSAA 2CNXA 3EI4B 4CI1A 3O4IA 4J82A 3AL8B 1XIPA 5HE1B 3T3PA 3ZDXA 3NIFA 2H6QA 2YNOA
chains in the Genus database with same CATH topology
4GGAA 3UVLA 3EI3A 2PM9A 4K3ID 4BUJC 3KRXB 5A2Qg 4E5ZB 3GFCA 2CE9A 3SMRA 3B7FA 3I7LA 3JAMg 4GM8A 2AQ5A 3OW8A 5HQGA 5CXCA 5THAA 2YNNA 4J73A 3JROA 3UVKA 5TEEA 1N6DA 2TRCB 2UZYB 4XYIA 3JZHA 4D6VA 3AL9A 3EMHA 1B9YA 2IUPA 1JJUB 2PM7B 2H9NA 4YVDA 3SN6B 3AFCA 4A0BB 3V9FA 4QQEA 4ESGA 4QT8A 5FKTA 2P9SC 2G9AA 2BCJB 5EMKB 3MKQA 4HDJA 3OKWA 2I3SA 4JSXC 4CZYA 2B5LA 3UR4A 1SQ9A 4ZN4A 1YFQA 2HYEA 2P9LC 4CY3A 2H68A 3VA6A 4FA9D 5EAMA 4A7JA 4FB1D 4X63B 3U4YA 4GQ1A 3W15A 4CI8A 2J55H 4O1QD 5GXHA 5CYKA 5FXYA 5CXCB 4JSNC 4O3UB 2J57G 4XYHA 4L9OA 1RI6A 4JT5C 4ERYA 2H14A 4JXMA 3EI4A 4CZVA 2AGXA 4A11A 4FHLA 3JPXA 3J81g 4GZ8A 2XL3A 1PBYB 1PEVA 2IUVA 4A08A 3PXTD 5EMMB 1GP2B 2IUQA 3GREA 1MG3A 2QC5A 3CFVA 3JRPA 3OL2B 3L4OD 5CXBA 2HJ4A 2G99A 3I8CA 5FA5B 5SXMA 4XEIC 3RN1D 3C99A 1JOFA 1ERJA 3JZGA 3UKUC 3FM0A 1OLZA 3IIWA 2MTAH 2OK4A 4J86A 1SQJA 5IJ8E 1P22A 4BL0A 1TBGA 4EWRA 5EALA 4NSXA 5AMSA 3V7DB 3DWLC 4O45A 4L3GD 3PE7A 4JSPC 5AFU3 4U7AA 5FQDA 1L0QA 3VGZA 4AEZA 2Z2PA 1B9XA 3SJLD 4E54A 2IWFA 1VYHC 2HKMA 3JB9L 3MKSB 5TDHB 2OIZA 2CN2A 4E5ZA 2B4EA 3J80g 4O9DA 3F3GA 3RFGA 2AGWA 4OWRA 3IIYA 4ZOXA 1GOTB 3PXWD 4LG9A 5HE3B 3UKRC 3A0FA 3EI3B 2Z2OA 4X3EA 3BG0A 4PBYA 3UVNA 2GC7A 4PSWB 3AH8B 2AGLA 4K3JB 3KRWB 4FA4D 4J79A 4PXWA 2CE8A 2H9PA 5I5IA 1PGUA 2YNPA 2OVPB 3PXSD 3EI2B 4U1EI 4J0XA 3SFZA 5AJAA 5FKQA 3SBQA 3ZWLB 3N0DA 3OKYB 2AH1A 4I79A 2I0RA 5EARA 5K1CC 1TYQC 3OKYA 1OMWB 3EG6A 5EMJB 2PBIB 3IJCA 2GC4A 3L4MD 4CZXA 5HE0B 3RSEC 4GMBA 3I2NA 4J8GA 2P9NC 4N14A 3PVWB 2XU7A 3EI1B 3PSLA 4ES0A 3DXKC 2XYIA 1MDAH 3JZNA 2J56H 3F3PA 4O3TB 4FA1D 4FAND 2H6NA 3V5WB 4CI2A 1XHMA 3DSMA 2B5MA 5EM2A 3SBRA 4X61B 3SXTD 4A09B 5IGQA 2QXVA 2OK6A 3EU7A 4A11B 4A0AB 4CY2A 4GQBB 4R7AB 4FWWA 2IAAA 4J0WA 5GXIA 5JWZA 4Y5RD 3OL2A 1PI6A 2PM6B 3I7KA 5CYKB 2OVRB 3SBPA 4GGDA 2HXCA 3MZLA 3BWSA 2H6KA 4A09A 2HESX 5IT9g 4LG8A 2GNQA 3I7PA 1N6EA 5K19A 3C5MA 4MK0B 4L1QD 1K8KC 2HKRA 1K32A 2OJYA 3N0EA 1S4UX 1R5MA 2Z2NA 3RLMD 3MXXA 3IJ1A 2P9KC 3I89A 3NVNA 3SWSD 3NVQA 3RMZD 4JSVC 3EI2A 1Q47A 2H13A 2P9PC 4ERZA 2BBKH 1U4CA 4GM9A 5C9ZB 3ULEC 5GMKn 4Y7RA 5I5MA 3UVOA 2OVQB 4E54B 3BG1A 2YBAA 2H9MA 2P9UC 4FA5D 3OTTA 4A08B 3I7HA 4FAVD 2UZXB 1U2VC 5IC7A 4A2LA 2CO0C 1MG2A 1N6FA 4A0BA 3C75H 1JMXB 5KDOB 3ODTA 5HE2B 3AL8A 3FGBA 2EBSA 3MMYA 4A2MA 5H1MA 5TEFA 2YMUA 5IGOA 4J78A 3C9CA 4LGNA 4CC9A 1NR0A 4ZOYA 4IA9A 2XL2A 4BH6A 5HYNB 3DM0A 3K27A 2I0TA 2I3TA 4J77A 2CN3A 3CFSB 4J8BA 4AOWA 2AGYA 4GGCA 1QNIA 3K26A 4ZOVA 1FWXA 3SHFA 5CXBB 5FKRA 2Q7QA 3SCYA 5EAPA 3I7OA 4D0KA 4L3HD 5B4WA 4ERQA 4QRJA 4PC0A 3IJ0A 4QL1A 5C2WB 3EWEA 4Z8LA 4G56B 1NEXB 3CIKB 3NVXA 3EI1A 5C2VB 2PM9B 4X60B 4KFMB 2B5NA 4CI3A 2YB8B 1GG2B 4J84A 1SHYB 5FLXg 3I8EA 4PNKB 5FKSA 2HJBA 3I7NA 4GM3A 3HFQA 4ZOZA 5IJ7E 1JMZB 1GXRA 4UI9R 3SLED 3RN0D 5I5JA 3SVWD 4H5IA 4PBZA 2IURA 2W18A 5EM2B 4TZ4A 2I0SA 1XKSA 2O9KA 3MZKA 4OZUA 2CO0A 3RFHA 2AGZA 4JD2C 4CY1A 3RRMC 2H3XA 4H5JA 3E0CA 3OKTA 2IWKA 4GQ2P 5EMLB 3F3FA 3UVMA 3FRXA 3IKOA 4J81A 4A0AA 3PVUB 4JT6C 5TF2A 3ORVD 4IMMA 3DXMC 3VH0A 4J87A 2AH0A 1A0RB 2P9IC 3PSCB 2H47A 4CY5A 4PSXB 5H17A 5H14A 3P4FA 5GSAA 2CNXA 3EI4B 4CI1A 4J82A 3AL8B 1XIPA 5HE1B 2H9LA 2H6QA 2YNOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GGA A;  3UVL A;  3EI3 A;  2PM9 A;  4K3I D;  4BUJ C;  3KRX B;  5A2Q g;  4E5Z B;  3GFC A;  2CE9 A;  3SMR A;  3B7F A;  3I7L A;  3JAM g;  4GM8 A;  2AQ5 A;  3OW8 A;  5HQG A;  5CXC A;  5THA A;  2YNN A;  4J73 A;  3JRO A;  3UVK A;  5TEE A;  1N6D A;  2TRC B;  2UZY B;  4XYI A;  3JZH A;  4D6V A;  3AL9 A;  3EMH A;  1B9Y A;  2IUP A;  1JJU B;  2PM7 B;  2H9N A;  4YVD A;  3SN6 B;  3AFC A;  4A0B B;  3V9F A;  4QQE A;  4ESG A;  4QT8 A;  5FKT A;  2P9S C;  2G9A A;  2BCJ B;  5EMK B;  3MKQ A;  4HDJ A;  3OKW A;  2I3S A;  4JSX C;  4CZY A;  2B5L A;  3UR4 A;  1SQ9 A;  4ZN4 A;  1YFQ A;  2HYE A;  2P9L C;  4CY3 A;  2H68 A;  3VA6 A;  4FA9 D;  5EAM A;  4A7J A;  4FB1 D;  4X63 B;  3U4Y A;  4GQ1 A;  3W15 A;  4CI8 A;  2J55 H;  4O1Q D;  5GXH A;  5CYK A;  5FXY A;  5CXC B;  4JSN C;  4O3U B;  2J57 G;  4XYH A;  4L9O A;  1RI6 A;  4JT5 C;  4ERY A;  2H14 A;  4JXM A;  3EI4 A;  4CZV A;  2AGX A;  4A11 A;  4FHL A;  3JPX A;  3J81 g;  4GZ8 A;  2XL3 A;  1PBY B;  1PEV A;  2IUV A;  4A08 A;  3PXT D;  5EMM B;  1GP2 B;  2IUQ A;  3GRE A;  1MG3 A;  2QC5 A;  3CFV A;  3JRP A;  3OL2 B;  3L4O D;  5CXB A;  2HJ4 A;  2G99 A;  3I8C A;  5FA5 B;  5SXM A;  4XEI C;  3RN1 D;  3C99 A;  1JOF A;  1ERJ A;  3JZG A;  3UKU C;  3FM0 A;  1OLZ A;  3IIW A;  2MTA H;  2OK4 A;  4J86 A;  1SQJ A;  5IJ8 E;  1P22 A;  4BL0 A;  1TBG A;  4EWR A;  5EAL A;  4NSX A;  5AMS A;  3V7D B;  3DWL C;  4O45 A;  4L3G D;  3PE7 A;  4JSP C;  5AFU 3;  4U7A A;  5FQD A;  1L0Q A;  3VGZ A;  4AEZ A;  2Z2P A;  1B9X A;  3SJL D;  4E54 A;  2IWF A;  1VYH C;  2HKM A;  3JB9 L;  3MKS B;  5TDH B;  2OIZ A;  2CN2 A;  4E5Z A;  2B4E A;  3J80 g;  4O9D A;  3F3G A;  3RFG A;  2AGW A;  4OWR A;  3IIY A;  4ZOX A;  1GOT B;  3PXW D;  4LG9 A;  5HE3 B;  3UKR C;  3A0F A;  3EI3 B;  2Z2O A;  4X3E A;  3BG0 A;  4PBY A;  3UVN A;  2GC7 A;  4PSW B;  3AH8 B;  2AGL A;  4K3J B;  3KRW B;  4FA4 D;  4J79 A;  4PXW A;  2CE8 A;  2H9P A;  5I5I A;  1PGU A;  2YNP A;  2OVP B;  3PXS D;  3EI2 B;  4U1E I;  4J0X A;  3SFZ A;  5AJA A;  5FKQ A;  3SBQ A;  3ZWL B;  3N0D A;  3OKY B;  2AH1 A;  4I79 A;  2I0R A;  5EAR A;  5K1C C;  1TYQ C;  3OKY A;  1OMW B;  3EG6 A;  5EMJ B;  2PBI B;  3IJC A;  2GC4 A;  3L4M D;  4CZX A;  5HE0 B;  3RSE C;  4GMB A;  3I2N A;  4J8G A;  2P9N C;  4N14 A;  3PVW B;  2XU7 A;  3EI1 B;  3PSL A;  4ES0 A;  3DXK C;  2XYI A;  1MDA H;  3JZN A;  2J56 H;  3F3P A;  4O3T B;  4FA1 D;  4FAN D;  2H6N A;  3V5W B;  4CI2 A;  1XHM A;  3DSM A;  2B5M A;  5EM2 A;  3SBR A;  4X61 B;  3SXT D;  4A09 B;  5IGQ A;  2QXV A;  2OK6 A;  3EU7 A;  4A11 B;  4A0A B;  4CY2 A;  4GQB B;  4R7A B;  4FWW A;  2IAA A;  4J0W A;  5GXI A;  5JWZ A;  4Y5R D;  3OL2 A;  1PI6 A;  2PM6 B;  3I7K A;  5CYK B;  2OVR B;  3SBP A;  4GGD A;  2HXC A;  3MZL A;  3BWS A;  2H6K A;  4A09 A;  2HES X;  5IT9 g;  4LG8 A;  2GNQ A;  3I7P A;  1N6E A;  5K19 A;  3C5M A;  4MK0 B;  4L1Q D;  1K8K C;  2HKR A;  1K32 A;  2OJY A;  3N0E A;  1S4U X;  1R5M A;  2Z2N A;  3RLM D;  3MXX A;  3IJ1 A;  2P9K C;  3I89 A;  3NVN A;  3SWS D;  3NVQ A;  3RMZ D;  4JSV C;  3EI2 A;  1Q47 A;  2H13 A;  2P9P C;  4ERZ A;  2BBK H;  1U4C A;  4GM9 A;  5C9Z B;  3ULE C;  5GMK n;  4Y7R A;  5I5M A;  3UVO A;  2OVQ B;  4E54 B;  3BG1 A;  2YBA A;  2H9M A;  2P9U C;  4FA5 D;  3OTT A;  4A08 B;  3I7H A;  4FAV D;  2UZX B;  1U2V C;  5IC7 A;  4A2L A;  2CO0 C;  1MG2 A;  1N6F A;  4A0B A;  3C75 H;  1JMX B;  5KDO B;  3ODT A;  5HE2 B;  3AL8 A;  3FGB A;  2EBS A;  3MMY A;  4A2M A;  5H1M A;  5TEF A;  2YMU A;  5IGO A;  4J78 A;  3C9C A;  4LGN A;  4CC9 A;  1NR0 A;  4ZOY A;  4IA9 A;  2XL2 A;  4BH6 A;  5HYN B;  3DM0 A;  3K27 A;  2I0T A;  2I3T A;  4J77 A;  2CN3 A;  3CFS B;  4J8B A;  4AOW A;  2AGY A;  4GGC A;  1QNI A;  3K26 A;  4ZOV A;  1FWX A;  3SHF A;  5CXB B;  5FKR A;  2Q7Q A;  3SCY A;  5EAP A;  3I7O A;  4D0K A;  4L3H D;  5B4W A;  4ERQ A;  4QRJ A;  4PC0 A;  3IJ0 A;  4QL1 A;  5C2W B;  3EWE A;  4Z8L A;  4G56 B;  1NEX B;  3CIK B;  3NVX A;  3EI1 A;  5C2V B;  2PM9 B;  4X60 B;  4KFM B;  2B5N A;  4CI3 A;  2YB8 B;  1GG2 B;  4J84 A;  1SHY B;  5FLX g;  3I8E A;  4PNK B;  5FKS A;  2HJB A;  3I7N A;  4GM3 A;  3HFQ A;  4ZOZ A;  5IJ7 E;  1JMZ B;  1GXR A;  4UI9 R;  3SLE D;  3RN0 D;  5I5J A;  3SVW D;  4H5I A;  4PBZ A;  2IUR A;  2W18 A;  5EM2 B;  4TZ4 A;  2I0S A;  1XKS A;  2O9K A;  3MZK A;  4OZU A;  2CO0 A;  3RFH A;  2AGZ A;  4JD2 C;  4CY1 A;  3RRM C;  2H3X A;  4H5J A;  3E0C A;  3OKT A;  2IWK A;  4GQ2 P;  5EML B;  3F3F A;  3UVM A;  3FRX A;  3IKO A;  4J81 A;  4A0A A;  3PVU B;  4JT6 C;  5TF2 A;  3ORV D;  4IMM A;  3DXM C;  3VH0 A;  4J87 A;  2AH0 A;  1A0R B;  2P9I C;  3PSC B;  2H47 A;  4CY5 A;  4PSX B;  5H17 A;  5H14 A;  3P4F A;  5GSA A;  2CNX A;  3EI4 B;  4CI1 A;  4J82 A;  3AL8 B;  1XIP A;  5HE1 B;  2H9L A;  2H6Q A;  2YNO A; 
#chains in the Genus database with same CATH topology
 2VDL A;  4GGA A;  1O6F A;  4WK2 A;  3UVL A;  3EI3 A;  2PM9 A;  4K3I D;  4BUJ C;  1GOF A;  3KRX B;  5A2Q g;  4E5Z B;  3GFC A;  2CE9 A;  3SMR A;  3B7F A;  3I7L A;  5M5T A;  3JAM g;  4GM8 A;  2AQ5 A;  1H2Z A;  3OW8 A;  5CXC A;  5HQG A;  5THA A;  2YNN A;  4J73 A;  3JRO A;  4DNW A;  1I2M B;  3VI4 A;  4Z7N A;  3UVK A;  5TEE A;  1N6D A;  2TRC B;  5FFG A;  2UZY B;  4XYI A;  1JV2 A;  2VDM A;  3JZH A;  4D6V A;  1UOP A;  3AL9 A;  1JTD B;  2VDO A;  3EMH A;  1B9Y A;  2IUP A;  1JJU B;  2XDW A;  2PM7 B;  2H9N A;  4YVD A;  4AN1 A;  3SN6 B;  3AFC A;  4O02 A;  4A0B B;  3V9F A;  4QQE A;  4ESG A;  4QT8 A;  5FKT A;  2P9S C;  4UM8 A;  2G9A A;  2BCJ B;  5EMK B;  3MKQ A;  2QZP A;  4HDJ A;  3OKW A;  2I3S A;  4JSX C;  4Z7O A;  4CZY A;  2B5L A;  3UR4 A;  1SQ9 A;  4ZN4 A;  3EQ8 A;  1YFQ A;  4G1M A;  2HYE A;  2P9L C;  4CY3 A;  2H68 A;  3VA6 A;  4FA9 D;  5EAM A;  4A7J A;  4FB1 D;  4X63 B;  3U4Y A;  4GQ1 A;  3W15 A;  1A12 A;  2J55 H;  4CI8 A;  4O1Q D;  5GXH A;  4BCD A;  1VE6 A;  5CYK A;  5FXY A;  5C86 A;  5CXC B;  4JSN C;  4O3U B;  3O4J A;  1VZ2 A;  1VE7 A;  2EID A;  4AMZ A;  4MMZ A;  2J57 G;  4XYH A;  4L9O A;  2EIB A;  1RI6 A;  4JT5 C;  4ERY A;  2H14 A;  4JXM A;  3EI4 A;  4CZV A;  1T2X A;  2AGX A;  4A11 A;  4DNU A;  2VDN A;  4FHL A;  1TYE A;  5C92 A;  3JPX A;  3J81 g;  4GZ8 A;  2XL3 A;  1PBY B;  1PEV A;  2IUV A;  1GOG A;  4A08 A;  3PXT D;  5EMM B;  1GP2 B;  2IUQ A;  3GRE A;  1MG3 A;  2QC5 A;  3CFV A;  3JRP A;  3OL2 B;  2G99 A;  3L4O D;  2HJ4 A;  5CXB A;  3I8C A;  5FA5 B;  2XE4 A;  5SXM A;  4XEI C;  3RN1 D;  4AN0 A;  3C99 A;  1E8M A;  1JOF A;  1ERJ A;  1QFS A;  5M5S A;  3JZG A;  5M61 A;  3UKU C;  3FM0 A;  1OLZ A;  3IIW A;  2MTA H;  2OK4 A;  4J86 A;  1SQJ A;  5IJ8 E;  5E6R A;  1P22 A;  4BL0 A;  1U8C A;  2JKX A;  4BCB A;  1TBG A;  4EWR A;  5EAL A;  1BPO A;  3MVD K;  4IRZ A;  4NSX A;  5AMS A;  3V7D B;  4RE6 A;  3DWL C;  4O45 A;  4L3G D;  4UM9 A;  3PE7 A;  4JSP C;  5AFU 3;  4U7A A;  5FQD A;  1L0Q A;  3VGZ A;  4AEZ A;  2Z2P A;  1B9X A;  3SJL D;  4E54 A;  2IWF A;  1VYH C;  2HKM A;  3JB9 L;  1GOH A;  3MKS B;  4MMY A;  5TDH B;  2VZ3 A;  2OIZ A;  2CN2 A;  4E5Z A;  2B4E A;  3IUQ A;  3J80 g;  4O9D A;  4Z7Q A;  3F3G A;  4D9S A;  3RFG A;  3ZDZ A;  2AGW A;  4OWR A;  3IIY A;  1UOQ A;  5HDB A;  4ZOX A;  1GOT B;  3PXW D;  4LG9 A;  3EQ9 A;  3VI3 A;  5HE3 B;  3UKR C;  3A0F A;  3EI3 B;  2Z2O A;  4G55 A;  4RE5 A;  4X3E A;  3BG0 A;  4PBY A;  3UVN A;  2GC7 A;  4PSW B;  3AH8 B;  2AGL A;  4K3J B;  3KRW B;  3V4P A;  4FA4 D;  4J79 A;  4PXW A;  2XZG A;  2H9L A;  2CE8 A;  2H9P A;  5I5I A;  4G1E A;  5M5R A;  1PGU A;  2YNP A;  2OVP B;  3PXS D;  3K6S A;  3EI2 B;  4U1E I;  3GD1 I;  4J0X A;  3SFZ A;  5AJA A;  1E5T A;  5FKQ A;  1QFM A;  3SBQ A;  3ZWL B;  5M5V A;  3IVM A;  3N0D A;  3OKY B;  2AH1 A;  4I79 A;  2I0R A;  1E8N A;  5EAR A;  5K1C C;  1TYQ C;  3OKY A;  1OMW B;  3EG6 A;  5EMJ B;  2PBI B;  3IJC A;  2EIC A;  2GC4 A;  3L4M D;  4CZX A;  5HE0 B;  3RSE C;  4GMB A;  3I2N A;  3NID A;  4J8G A;  2P9N C;  4N14 A;  3PVW B;  2XU7 A;  3K72 A;  3EI1 B;  1YR2 A;  3PSL A;  4ES0 A;  3DXK C;  4O2W A;  4BCC A;  2XYI A;  1MDA H;  3JZN A;  2J56 H;  4NBM A;  3F3P A;  4O3T B;  4FA1 D;  4FAN D;  2H6N A;  3V5W B;  3QI0 A;  4CI2 A;  1XHM A;  3DSM A;  1H2Y A;  1VZ3 A;  3O4G A;  2B5M A;  5EM2 A;  1M1X A;  2VZ1 A;  3SBR A;  4X61 B;  3SXT D;  4A09 B;  5IGQ A;  2QXV A;  2OK6 A;  4QAM A;  3DDU A;  3EU7 A;  3IJE A;  3ZDY A;  4A11 B;  4A0A B;  4CY2 A;  2QR5 A;  4GQB B;  4R7A B;  4FWW A;  2IAA A;  4J0W A;  5GXI A;  5JWZ A;  3KCI A;  4Y5R D;  3OL2 A;  1PI6 A;  2PM6 B;  3I7K A;  5CYK B;  2OVR B;  3SBP A;  4GGD A;  2HXC A;  3MZL A;  3BWS A;  2H6K A;  4A09 A;  2HES X;  5IT9 g;  4LG8 A;  2GNQ A;  3I7P A;  1N6E A;  5K19 A;  3C5M A;  4MK0 B;  4L1Q D;  4NAA A;  1K8K C;  2HKR A;  1K32 A;  2OJY A;  3N0E A;  1S4U X;  3IUL A;  1R5M A;  2Z2N A;  3RLM D;  3MXX A;  3IJ1 A;  2VC2 A;  2P9K C;  3I89 A;  2HU8 A;  5E6S A;  3NVN A;  3SWS D;  3NVQ A;  3RMZ D;  3O4H A;  3NIG A;  4JSV C;  3EI2 A;  3IUN A;  1Q47 A;  2H13 A;  3IUR A;  2P9P C;  4ERZ A;  2BBK H;  1U4C A;  4GM9 A;  5C9Z B;  4WK0 A;  3ULE C;  5GMK n;  4Y7R A;  1UOO A;  3V4V A;  5I5M A;  3UVO A;  2HU5 A;  2OVQ B;  4E54 B;  3BG1 A;  2YBA A;  2H9M A;  2P9U C;  4FA5 D;  3OTT A;  1C9L A;  4A08 B;  3I7H A;  4FAV D;  1K3I A;  2UZX B;  1U2V C;  1L5G A;  5IC7 A;  3ZE1 A;  4A2L A;  2CO0 C;  1MG2 A;  2VDQ A;  1N6F A;  3C75 H;  1JMX B;  4A0B A;  5KDO B;  3ODT A;  5HE2 B;  3AL8 A;  3FGB A;  2EBS A;  3MMY A;  2VDR A;  4A2M A;  5H1M A;  5TEF A;  2YMU A;  2WQ8 A;  5IGO A;  4J78 A;  3C9C A;  4LGN A;  4CC9 A;  1NR0 A;  4ZOY A;  3FCS A;  4IA9 A;  2XL2 A;  3ZE0 A;  4BH6 A;  5HYN B;  3DM0 A;  3K27 A;  2VDK A;  2I0T A;  2I3T A;  4J77 A;  2CN3 A;  3CFS B;  4J8B A;  4WK4 A;  4AOW A;  2AGY A;  1H2W A;  4GGC A;  1QNI A;  3K26 A;  4WJK A;  4ZOV A;  1FWX A;  3SHF A;  1UTC A;  5CXB B;  4NEN A;  5FKR A;  2Q7Q A;  3SCY A;  3IUJ A;  5EAP A;  2HU7 A;  3I7O A;  4L3H D;  5B4W A;  4D0K A;  4ERQ A;  4QRJ A;  4PC0 A;  3QHY B;  4NC4 A;  3IJ0 A;  4QL1 A;  2EIE A;  4BP8 A;  5C2W B;  3EWE A;  4Z8L A;  4G56 B;  1NEX B;  3CIK B;  3FCU A;  4AMY A;  3NVX A;  3EQ7 A;  3EI1 A;  5C2V B;  4JHP C;  2PM9 B;  4X60 B;  3MUO A;  4KFM B;  2B5N A;  4CI3 A;  2YB8 B;  1GG2 B;  5FFO A;  4J84 A;  1SHY B;  5FLX g;  3I8E A;  4PNK B;  5FKS A;  5M5U A;  2HJB A;  3I7N A;  4GM3 A;  3HFQ A;  4ZOZ A;  5IJ7 E;  3IUM A;  1JMZ B;  1GXR A;  4UI9 R;  3T3M A;  3SLE D;  1O6G A;  3RN0 D;  5I5J A;  3SVW D;  4MMX A;  4H5I A;  2BKL A;  4PBZ A;  2IUR A;  2W18 A;  5EM2 B;  4TZ4 A;  2I0S A;  2VDP A;  1XKS A;  2O9K A;  3MZK A;  4DNV A;  4L1M A;  4JHN A;  4OZU A;  2CO0 A;  3RFH A;  2AGZ A;  4JD2 C;  3GC3 B;  4CY1 A;  3ZE2 A;  1C9I A;  3RRM C;  2H3X A;  4H5J A;  3E0C A;  3OKT A;  2IWK A;  4GQ2 P;  5EML B;  3F3F A;  3OF7 A;  3K71 A;  4AX4 A;  3UVM A;  3FRX A;  3IKO A;  4J81 A;  4A0A A;  3MUN A;  3PVU B;  4JT6 C;  5TF2 A;  3ORV D;  4IMM A;  3DXM C;  5E6U A;  3VH0 A;  4J87 A;  2AH0 A;  1A0R B;  2P9I C;  3PSC B;  2H47 A;  4BP9 A;  4CY5 A;  4PSX B;  1H2X A;  5H17 A;  5H14 A;  3P4F A;  5GSA A;  2CNX A;  3EI4 B;  4CI1 A;  3O4I A;  4J82 A;  3AL8 B;  1XIP A;  5HE1 B;  3T3P A;  3ZDX A;  3NIF A;  2H6Q A;  2YNO A; 
#chains in the Genus database with same CATH homology
 4GGA A;  3UVL A;  3EI3 A;  2PM9 A;  4K3I D;  4BUJ C;  3KRX B;  5A2Q g;  4E5Z B;  3GFC A;  2CE9 A;  3SMR A;  3B7F A;  3I7L A;  3JAM g;  4GM8 A;  2AQ5 A;  3OW8 A;  5HQG A;  5CXC A;  5THA A;  2YNN A;  4J73 A;  3JRO A;  3UVK A;  5TEE A;  1N6D A;  2TRC B;  2UZY B;  4XYI A;  3JZH A;  4D6V A;  3AL9 A;  3EMH A;  1B9Y A;  2IUP A;  1JJU B;  2PM7 B;  2H9N A;  4YVD A;  3SN6 B;  3AFC A;  4A0B B;  3V9F A;  4QQE A;  4ESG A;  4QT8 A;  5FKT A;  2P9S C;  2G9A A;  2BCJ B;  5EMK B;  3MKQ A;  4HDJ A;  3OKW A;  2I3S A;  4JSX C;  4CZY A;  2B5L A;  3UR4 A;  1SQ9 A;  4ZN4 A;  1YFQ A;  2HYE A;  2P9L C;  4CY3 A;  2H68 A;  3VA6 A;  4FA9 D;  5EAM A;  4A7J A;  4FB1 D;  4X63 B;  3U4Y A;  4GQ1 A;  3W15 A;  4CI8 A;  2J55 H;  4O1Q D;  5GXH A;  5CYK A;  5FXY A;  5CXC B;  4JSN C;  4O3U B;  2J57 G;  4XYH A;  4L9O A;  1RI6 A;  4JT5 C;  4ERY A;  2H14 A;  4JXM A;  3EI4 A;  4CZV A;  2AGX A;  4A11 A;  4FHL A;  3JPX A;  3J81 g;  4GZ8 A;  2XL3 A;  1PBY B;  1PEV A;  2IUV A;  4A08 A;  3PXT D;  5EMM B;  1GP2 B;  2IUQ A;  3GRE A;  1MG3 A;  2QC5 A;  3CFV A;  3JRP A;  3OL2 B;  3L4O D;  5CXB A;  2HJ4 A;  2G99 A;  3I8C A;  5FA5 B;  5SXM A;  4XEI C;  3RN1 D;  3C99 A;  1JOF A;  1ERJ A;  3JZG A;  3UKU C;  3FM0 A;  1OLZ A;  3IIW A;  2MTA H;  2OK4 A;  4J86 A;  1SQJ A;  5IJ8 E;  1P22 A;  4BL0 A;  1TBG A;  4EWR A;  5EAL A;  4NSX A;  5AMS A;  3V7D B;  3DWL C;  4O45 A;  4L3G D;  3PE7 A;  4JSP C;  5AFU 3;  4U7A A;  5FQD A;  1L0Q A;  3VGZ A;  4AEZ A;  2Z2P A;  1B9X A;  3SJL D;  4E54 A;  2IWF A;  1VYH C;  2HKM A;  3JB9 L;  3MKS B;  5TDH B;  2OIZ A;  2CN2 A;  4E5Z A;  2B4E A;  3J80 g;  4O9D A;  3F3G A;  3RFG A;  2AGW A;  4OWR A;  3IIY A;  4ZOX A;  1GOT B;  3PXW D;  4LG9 A;  5HE3 B;  3UKR C;  3A0F A;  3EI3 B;  2Z2O A;  4X3E A;  3BG0 A;  4PBY A;  3UVN A;  2GC7 A;  4PSW B;  3AH8 B;  2AGL A;  4K3J B;  3KRW B;  4FA4 D;  4J79 A;  4PXW A;  2CE8 A;  2H9P A;  5I5I A;  1PGU A;  2YNP A;  2OVP B;  3PXS D;  3EI2 B;  4U1E I;  4J0X A;  3SFZ A;  5AJA A;  5FKQ A;  3SBQ A;  3ZWL B;  3N0D A;  3OKY B;  2AH1 A;  4I79 A;  2I0R A;  5EAR A;  5K1C C;  1TYQ C;  3OKY A;  1OMW B;  3EG6 A;  5EMJ B;  2PBI B;  3IJC A;  2GC4 A;  3L4M D;  4CZX A;  5HE0 B;  3RSE C;  4GMB A;  3I2N A;  4J8G A;  2P9N C;  4N14 A;  3PVW B;  2XU7 A;  3EI1 B;  3PSL A;  4ES0 A;  3DXK C;  2XYI A;  1MDA H;  3JZN A;  2J56 H;  3F3P A;  4O3T B;  4FA1 D;  4FAN D;  2H6N A;  3V5W B;  4CI2 A;  1XHM A;  3DSM A;  2B5M A;  5EM2 A;  3SBR A;  4X61 B;  3SXT D;  4A09 B;  5IGQ A;  2QXV A;  2OK6 A;  3EU7 A;  4A11 B;  4A0A B;  4CY2 A;  4GQB B;  4R7A B;  4FWW A;  2IAA A;  4J0W A;  5GXI A;  5JWZ A;  4Y5R D;  3OL2 A;  1PI6 A;  2PM6 B;  3I7K A;  5CYK B;  2OVR B;  3SBP A;  4GGD A;  2HXC A;  3MZL A;  3BWS A;  2H6K A;  4A09 A;  2HES X;  5IT9 g;  4LG8 A;  2GNQ A;  3I7P A;  1N6E A;  5K19 A;  3C5M A;  4MK0 B;  4L1Q D;  1K8K C;  2HKR A;  1K32 A;  2OJY A;  3N0E A;  1S4U X;  1R5M A;  2Z2N A;  3RLM D;  3MXX A;  3IJ1 A;  2P9K C;  3I89 A;  3NVN A;  3SWS D;  3NVQ A;  3RMZ D;  4JSV C;  3EI2 A;  1Q47 A;  2H13 A;  2P9P C;  4ERZ A;  2BBK H;  1U4C A;  4GM9 A;  5C9Z B;  3ULE C;  5GMK n;  4Y7R A;  5I5M A;  3UVO A;  2OVQ B;  4E54 B;  3BG1 A;  2YBA A;  2H9M A;  2P9U C;  4FA5 D;  3OTT A;  4A08 B;  3I7H A;  4FAV D;  2UZX B;  1U2V C;  5IC7 A;  4A2L A;  2CO0 C;  1MG2 A;  1N6F A;  4A0B A;  3C75 H;  1JMX B;  5KDO B;  3ODT A;  5HE2 B;  3AL8 A;  3FGB A;  2EBS A;  3MMY A;  4A2M A;  5H1M A;  5TEF A;  2YMU A;  5IGO A;  4J78 A;  3C9C A;  4LGN A;  4CC9 A;  1NR0 A;  4ZOY A;  4IA9 A;  2XL2 A;  4BH6 A;  5HYN B;  3DM0 A;  3K27 A;  2I0T A;  2I3T A;  4J77 A;  2CN3 A;  3CFS B;  4J8B A;  4AOW A;  2AGY A;  4GGC A;  1QNI A;  3K26 A;  4ZOV A;  1FWX A;  3SHF A;  5CXB B;  5FKR A;  2Q7Q A;  3SCY A;  5EAP A;  3I7O A;  4D0K A;  4L3H D;  5B4W A;  4ERQ A;  4QRJ A;  4PC0 A;  3IJ0 A;  4QL1 A;  5C2W B;  3EWE A;  4Z8L A;  4G56 B;  1NEX B;  3CIK B;  3NVX A;  3EI1 A;  5C2V B;  2PM9 B;  4X60 B;  4KFM B;  2B5N A;  4CI3 A;  2YB8 B;  1GG2 B;  4J84 A;  1SHY B;  5FLX g;  3I8E A;  4PNK B;  5FKS A;  2HJB A;  3I7N A;  4GM3 A;  3HFQ A;  4ZOZ A;  5IJ7 E;  1JMZ B;  1GXR A;  4UI9 R;  3SLE D;  3RN0 D;  5I5J A;  3SVW D;  4H5I A;  4PBZ A;  2IUR A;  2W18 A;  5EM2 B;  4TZ4 A;  2I0S A;  1XKS A;  2O9K A;  3MZK A;  4OZU A;  2CO0 A;  3RFH A;  2AGZ A;  4JD2 C;  4CY1 A;  3RRM C;  2H3X A;  4H5J A;  3E0C A;  3OKT A;  2IWK A;  4GQ2 P;  5EML B;  3F3F A;  3UVM A;  3FRX A;  3IKO A;  4J81 A;  4A0A A;  3PVU B;  4JT6 C;  5TF2 A;  3ORV D;  4IMM A;  3DXM C;  3VH0 A;  4J87 A;  2AH0 A;  1A0R B;  2P9I C;  3PSC B;  2H47 A;  4CY5 A;  4PSX B;  5H17 A;  5H14 A;  3P4F A;  5GSA A;  2CNX A;  3EI4 B;  4CI1 A;  4J82 A;  3AL8 B;  1XIP A;  5HE1 B;  2H9L A;  2H6Q A;  2YNO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...