2CO0A

Wdr5 and unmodified histone h3 complex at 2.25 angstrom
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
304
structure length
304
Chain Sequence
VKPNYALMFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGMCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNDLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Histone H3 Recognition and Presentation by the Wdr5 Module of the Mll1 Complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords WD-REPEAT PROTEIN 5
total genus 100
structure length 304
sequence length 304
ec nomenclature
pdb deposition date 2006-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2co0A00
2OIZA 5I5IA 3A0FA 5C2WB 2I3SA 5AJAA 5CXCB 5FXYA 2HJ4A 1JOFA 3OKTA 3DSMA 5I5MA 5THAA 5FA5B 4FAND 3AL9A 3U4YA 3B7FA 3JRPA 3N0DA 3KRXB 3C9CA 2AGXA 1FWXA 5H17A 4NSXA 3I7OA 3PVWB 4J0WA 2XL2A 4PSXB 5HE1B 5C2VB 2B5MA 3SVWD 3UR4A 1SHYB 3JZHA 4CI8A 3MKSB 3AH8B 2IUQA 3JZGA 4QT8A 5IJ8E 4TZ4A 5TEFA 5KDOB 2HKMA 4J78A 5EMMB 4K3JB 3JB9L 4OWRA 2GC7A 1S4UX 1N6DA 3V7DB 4J81A 3NVNA 2J56H 4J77A 2I0TA 3UVMA 3MKQA 1MG3A 5TEEA 2G99A 1K8KC 4A11A 4JSVC 3VA6A 5C9ZB 4EWRA 2HKRA 2PM9B 4HDJA 2MTAH 4IMMA 4A0AA 5EAPA 3ODTA 2HYEA 3I7LA 2O9KA 3JROA 2H13A 2OVQB 1NEXB 4JT6C 2OK4A 5GSAA 2CO0A 2H9LA 4ZN4A 5EM2B 1A0RB 3F3PA 5CXBB 3RLMD 2IUPA 4CI1A 4O9DA 4A0AB 3EU7A 3I2NA 5IGQA 2B5LA 3EI3B 1VYHC 4ESGA 3UKUC 3EI1B 4GMBA 3UVKA 1JJUB 3BWSA 1OMWB 2CN3A 4ZOVA 3K27A 3FRXA 2UZYB 1TYQC 5EMJB 3I7PA 3I8CA 4A0BA 4CZYA 4J87A 2H6QA 3PXSD 4U1EI 3ULEC 4J86A 3OKYA 5FQDA 4E5ZA 4PXWA 5CYKA 3RSEC 3J80g 2IURA 2AGYA 2Z2PA 5GMKn 4CI2A 2YNPA 4GQ2P 2Z2NA 2IAAA 4FAVD 2CNXA 3JPXA 2W18A 2XU7A 3EWEA 3PSLA 2H9PA 1GG2B 3PXWD 2IUVA 4AEZA 3SBPA 3SBRA 4FB1D 4H5JA 4JSXC 4JSPC 3W15A 4G56B 4Y7RA 4ERQA 5EALA 3PE7A 3L4OD 4LG8A 4ERZA 3I89A 5GXHA 4J0XA 4R7AB 4YVDA 3RRMC 4A11B 5AMSA 3UVLA 4GQ1A 4QQEA 1N6EA 3V5WB 4PNKB 5TDHB 4JXMA 3I7NA 4A08B 4O3TB 2H14A 3UVNA 2BCJB 3DWLC 5B4WA 3EI4A 1N6FA 3DXMC 4FA9D 4I79A 3L4MD 3AFCA 2H9MA 2CO0C 1PGUA 2QC5A 2I3TA 3MXXA 5IJ7E 2H6NA 4O3UB 1JMZB 4U7AA 3F3FA 4PSWB 1QNIA 3OL2B 3VGZA 4GGCA 1YFQA 4GM9A 4LGNA 2P9IC 2B5NA 4XYHA 4JT5C 2P9NC 4L9OA 2OVRB 3MMYA 2OVPB 2IWKA 4OZUA 4CZVA 2P9PC 5H1MA 5HE3B 5SXMA 4AOWA 5IC7A 3EI3A 2IWFA 3F3GA 3VH0A 4H5IA 5FKSA 5I5JA 4O1QD 3CIKB 3RFGA 4BH6A 3EI2A 2H6KA 5EARA 2OJYA 3V9FA 4ZOZA 2P9SC 3SBQA 4FA1D 2BBKH 3OKYB 4X63B 3OTTA 4L3HD 3ORVD 3IIYA 1RI6A 5GXIA 2P9LC 3EI4B 1B9XA 4J8GA 3HFQA 5A2Qg 2PM9A 3SFZA 4CY5A 4E54A 4QL1A 2XYIA 3JZNA 2XL3A 3RN1D 3RMZD 3AL8A 1PI6A 1XIPA 2Z2OA 4GM3A 3GREA 4A09B 3SLED 4Y5RD 2YNOA 1PBYB 5FLXg 3NVXA 1OLZA 2Q7QA 3ZWLB 3KRWB 3CFVA 2H68A 4J84A 2QXVA 3I7KA 5FKRA 4J79A 1GP2B 5JWZA 1MG2A 1U4CA 4Z8LA 2GC4A 3JAMg 4QRJA 3MZKA 3UKRC 4FWWA 3BG1A 3J81g 3P4FA 5EMLB 2P9UC 4GQBB 4D0KA 4O45A 3PVUB 3DM0A 3OW8A 3IKOA 3N0EA 1GOTB 3IJCA 3IIWA 5EM2A 2CN2A 4E5ZB 3C75H 3MZLA 5CYKB 2AGZA 2UZXB 1L0QA 4CI3A 2H3XA 3EI2B 1U2VC 4KFMB 2I0SA 2GNQA 5FKTA 4CC9A 1XHMA 4UI9R 3OKWA 2AH1A 4CZXA 2H47A 3SJLD 5HYNB 3GFCA 3EG6A 2CE8A 5AFU3 4PBYA 2P9KC 3NVQA 3SN6B 3EI1A 4X3EA 3PSCB 4X61B 2YBAA 5CXCA 4D6VA 4JSNC 2B4EA 5K1CC 4A2LA 3E0CA 5IT9g 5HE2B 4CY2A 4PC0A 4FA5D 2J57G 1P22A 3SWSD 3DXKC 2HXCA 4ZOYA 4FHLA 1B9YA 3I7HA 1MDAH 3C99A 5K19A 4GM8A 4X60B 4BUJC 3RN0D 4J8BA 4A08A 2PM6B 5EAMA 3SXTD 2YB8B 3FGBA 4A7JA 4CY3A 2PBIB 4MK0B 3BG0A 3C5MA 2I0RA 1NR0A 3IJ1A 2HESX 3IJ0A 4A2MA 1GXRA 3SCYA 4GGDA 4CY1A 4A0BB 5IGOA 2AGWA 2YMUA 2TRCB 2AH0A 4JD2C 3I8EA 4K3ID 4FA4D 2EBSA 2PM7B 3PXTD 1ERJA 4ERYA 1K32A 4E54B 5TF2A 3AL8B 5FKQA 2H9NA 3OL2A 2G9AA 1XKSA 5CXBA 2YNNA 4XEIC 3K26A 1SQJA 1TBGA 4L3GD 4N14A 4ES0A 3CFSB 2AQ5A 5H14A 3UVOA 2AGLA 1PEVA 4BL0A 4PBZA 2HJBA 4L1QD 4J73A 2CE9A 4IA9A 1Q47A 4GGAA 3RFHA 4J82A 5EMKB 2OK6A 1SQ9A 3EMHA 3FM0A 1JMXB 5HQGA 4XYIA 4GZ8A 4LG9A 1R5MA 5HE0B 4ZOXA 4A09A 3SMRA 2J55H 3SHFA
chains in the Genus database with same CATH superfamily
2OIZA 5I5IA 1O6GA 3A0FA 2WQ8A 5C2WB 4BP8A 2I3SA 5AJAA 5CXCB 5FXYA 2HJ4A 1JOFA 3OKTA 1JV2A 3DSMA 3QHYB 5I5MA 5THAA 5FA5B 4FAND 3AL9A 3U4YA 3B7FA 3JRPA 3N0DA 3KRXB 3C9CA 2AGXA 1FWXA 1UTCA 5H17A 4NSXA 3MVDK 3I7OA 2VZ1A 3IUJA 4JHNA 3PVWB 4J0WA 2XL2A 5FFOA 4PSXB 5HE1B 3ZE2A 5C2VB 3NIFA 2B5MA 3SVWD 3DDUA 3UR4A 1SHYB 3JZHA 4CI8A 3MKSB 4Z7OA 3AH8B 2IUQA 1A12A 1VE7A 3JZGA 4QT8A 5IJ8E 4TZ4A 5TEFA 5KDOB 2HKMA 4J78A 5EMMB 4K3JB 1H2WA 4OWRA 3JB9L 5M5VA 2GC7A 1S4UX 4DNUA 1N6DA 3V7DB 3V4VA 4J81A 3NVNA 2J56H 4J77A 2I0TA 3UVMA 3MKQA 3IUNA 4MMZA 1MG3A 5TEEA 2G99A 1K8KC 4A11A 4JSVC 3VA6A 1YR2A 5C9ZB 4EWRA 2HU5A 2VDPA 2HKRA 2PM9B 3K72A 4HDJA 2MTAH 4IMMA 4A0AA 5EAPA 5FFGA 3ODTA 2HYEA 1TYEA 2O9KA 3I7LA 3O4GA 3JROA 2H13A 2OVQB 1NEXB 4JT6C 2VDKA 2OK4A 3FCUA 5GSAA 2CO0A 2H9LA 4ZN4A 5EM2B 1A0RB 3F3PA 5CXBB 3RLMD 2IUPA 4CI1A 4O9DA 1E8NA 5M5TA 4BCBA 4A0AB 3EU7A 3I2NA 5IGQA 2B5LA 1BPOA 1VYHC 3EI3B 3IUQA 4ESGA 3UKUC 3EI1B 4GMBA 3UVKA 1JJUB 3BWSA 1OMWB 2CN3A 4ZOVA 1E8MA 3K27A 1UOQA 4MMYA 2VDNA 3FRXA 2UZYB 1M1XA 1TYQC 5EMJB 5C86A 3I7PA 3I8CA 4G1EA 2EICA 4BP9A 4A0BA 4CZYA 4J87A 2H6QA 4JHPC 3PXSD 4U1EI 3ULEC 4J86A 3OKYA 5FQDA 4E5ZA 4PXWA 5CYKA 3RSEC 3J80g 2IURA 2AGYA 4RE5A 1UOOA 2Z2PA 5GMKn 1O6FA 4CI2A 2YNPA 3KCIA 4GQ2P 5M61A 2Z2NA 5M5SA 2IAAA 4FAVD 2CNXA 3JPXA 1E5TA 1T2XA 2W18A 2XU7A 3EWEA 3PSLA 2BKLA 2H9PA 1GG2B 3PXWD 2VDOA 2IUVA 4AEZA 3SBPA 3SBRA 4FB1D 4H5JA 4JSXC 2HU8A 4JSPC 3W15A 5M5UA 1JTDB 4G56B 2VDRA 4Y7RA 4ERQA 5EALA 3PE7A 3L4OD 4LG8A 4AN1A 4ERZA 3I89A 5GXHA 4J0XA 4R7AB 4YVDA 3RRMC 4A11B 5AMSA 3UVLA 2EIDA 4GQ1A 4QQEA 1N6EA 3V5WB 4PNKB 3OF7A 4UM9A 5TDHB 4JXMA 3I7NA 4A08B 4NAAA 4O3TB 2H14A 3UVNA 4AX4A 2BCJB 3DWLC 3IUMA 4G1MA 5C92A 2HU7A 2QR5A 5B4WA 3EI4A 1N6FA 3DXMC 4FA9D 1C9LA 4I79A 3L4MD 2EIEA 3AFCA 2H9MA 2CO0C 1PGUA 3K6SA 2QC5A 1VZ2A 2I3TA 3T3PA 3MXXA 5IJ7E 2H6NA 4O3UB 1JMZB 4U7AA 3F3FA 4PSWB 1QNIA 3OL2B 3VGZA 4GGCA 2VZ3A 1YFQA 4GM9A 4LGNA 2P9IC 2B5NA 4XYHA 4JT5C 2P9NC 2VDLA 4L9OA 1K3IA 2OVRB 3MMYA 3O4JA 2OVPB 2IWKA 4OZUA 4CZVA 2P9PC 5H1MA 5HE3B 5SXMA 4AOWA 1QFMA 3ZE1A 5IC7A 3EI3A 2IWFA 3F3GA 3VH0A 4H5IA 5FKSA 5I5JA 3EQ7A 4O1QD 1H2YA 3CIKB 1C9IA 3RFGA 4BH6A 3EI2A 2H6KA 5E6UA 5EARA 2OJYA 3V9FA 4ZOZA 2P9SC 3SBQA 4FA1D 2BBKH 3OKYB 4X63B 1GOFA 3OTTA 4L3HD 3ORVD 3IIYA 1RI6A 5GXIA 2P9LC 3EI4B 1B9XA 4J8GA 3HFQA 5A2Qg 2PM9A 3SFZA 4CY5A 4Z7NA 4E54A 4QL1A 3ZDYA 2XYIA 3JZNA 2XL3A 3RN1D 3RMZD 3AL8A 1PI6A 1XIPA 2Z2OA 4GM3A 4G55A 3GREA 4A09B 3SLED 4Y5RD 2YNOA 4DNVA 1PBYB 5FLXg 3NVXA 3ZDZA 2XDWA 1OLZA 2Q7QA 3ZWLB 4RE6A 3KRWB 3VI3A 3CFVA 2H68A 4J84A 2QXVA 4NC4A 3I7KA 5FKRA 4J79A 1GP2B 5JWZA 1MG2A 1U4CA 4Z8LA 4DNWA 2GC4A 3JAMg 4QRJA 1VZ3A 3IURA 2JKXA 3MZKA 3UKRC 4FWWA 1H2XA 2QZPA 3BG1A 3J81g 3P4FA 5EMLB 2P9UC 4GQBB 4D0KA 3GC3B 4O45A 3PVUB 3DM0A 3OW8A 3IKOA 4WK0A 3N0EA 1GOTB 3IJCA 3IIWA 4IRZA 5EM2A 1UOPA 2CN2A 4AMYA 4E5ZB 3C75H 3MZLA 2AGZA 4O02A 5CYKB 2UZXB 1L0QA 4CI3A 4WK4A 4AN0A 2H3XA 4QAMA 1U2VC 3EI2B 4KFMB 3VI4A 2I0SA 2GNQA 3IULA 5FKTA 2XZGA 4CC9A 4WJKA 1XHMA 4UI9R 3OKWA 2AH1A 3MUNA 4CZXA 3NIGA 4UM8A 2H47A 3SJLD 3T3MA 5HYNB 3GFCA 4BCDA 1I2MB 3EG6A 2CE8A 5AFU3 4PBYA 2P9KC 3NVQA 3SN6B 3EI1A 3PSCB 3GD1I 4X3EA 1L5GA 4X61B 2YBAA 5CXCA 5M5RA 4D6VA 4JSNC 2B4EA 5K1CC 3NIDA 4MMXA 3E0CA 5HDBA 4A2LA 5IT9g 5HE2B 4CY2A 4PC0A 4Z7QA 4FA5D 3MUOA 2J57G 1P22A 4NBMA 3SWSD 3DXKC 2HXCA 4ZOYA 4BCCA 1H2ZA 1GOHA 4FHLA 3I7HA 1B9YA 1MDAH 3C99A 5K19A 4GM8A 4X60B 4BUJC 3RN0D 4J8BA 4A08A 2EIBA 2PM6B 5EAMA 3SXTD 2YB8B 3IVMA 3FCSA 3FGBA 2XE4A 3IJEA 4A7JA 4CY3A 2PBIB 4MK0B 3BG0A 3C5MA 2I0RA 1NR0A 3IJ1A 2HESX 3EQ9A 3IJ0A 4A2MA 1GXRA 1U8CA 3SCYA 4GGDA 4CY1A 4A0BB 1VE6A 5IGOA 2AGWA 2YMUA 2TRCB 3QI0A 3O4IA 5E6RA 2AH0A 4JD2C 3I8EA 4K3ID 4O2WA 4FA4D 2EBSA 4D9SA 2PM7B 3PXTD 1ERJA 4ERYA 1K32A 4E54B 2VC2A 3O4HA 5TF2A 3ZDXA 3AL8B 5FKQA 2H9NA 3OL2A 2VDMA 2G9AA 5E6SA 1XKSA 4WK2A 5CXBA 2YNNA 4XEIC 3K26A 1SQJA 3K71A 1TBGA 4L3GD 4N14A 4ES0A 3CFSB 2AQ5A 5H14A 3UVOA 2AGLA 1PEVA 4BL0A 4PBZA 3ZE0A 2HJBA 4AMZA 4L1QD 4J73A 2CE9A 1GOGA 4IA9A 1Q47A 4GGAA 3RFHA 3V4PA 4NENA 4J82A 2VDQA 2OK6A 5EMKB 1SQ9A 1QFSA 3EMHA 4L1MA 3FM0A 1JMXB 3EQ8A 5HQGA 4XYIA 4GZ8A 4LG9A 1R5MA 5HE0B 4ZOXA 4A09A 3SMRA 2J55H 3SHFA
chains in the Genus database with same CATH topology
2OIZA 5I5IA 3A0FA 5C2WB 2I3SA 5AJAA 5CXCB 5FXYA 2HJ4A 1JOFA 3OKTA 3DSMA 5I5MA 5THAA 5FA5B 4FAND 3AL9A 3U4YA 3B7FA 3JRPA 3N0DA 3KRXB 3C9CA 2AGXA 1FWXA 5H17A 4NSXA 3I7OA 3PVWB 4J0WA 2XL2A 4PSXB 5HE1B 5C2VB 2B5MA 3SVWD 3UR4A 1SHYB 3JZHA 4CI8A 3MKSB 3AH8B 2IUQA 3JZGA 4QT8A 5IJ8E 4TZ4A 5TEFA 5KDOB 2HKMA 4J78A 5EMMB 4K3JB 3JB9L 4OWRA 2GC7A 1S4UX 1N6DA 3V7DB 4J81A 3NVNA 2J56H 4J77A 2I0TA 3UVMA 3MKQA 1MG3A 5TEEA 2G99A 1K8KC 4A11A 4JSVC 3VA6A 5C9ZB 4EWRA 2HKRA 2PM9B 4HDJA 2MTAH 4IMMA 4A0AA 5EAPA 3ODTA 2HYEA 3I7LA 2O9KA 3JROA 2H13A 2OVQB 1NEXB 4JT6C 2OK4A 5GSAA 2CO0A 2H9LA 4ZN4A 5EM2B 1A0RB 3F3PA 5CXBB 3RLMD 2IUPA 4CI1A 4O9DA 4A0AB 3EU7A 3I2NA 5IGQA 2B5LA 3EI3B 1VYHC 4ESGA 3UKUC 3EI1B 4GMBA 3UVKA 1JJUB 3BWSA 1OMWB 2CN3A 4ZOVA 3K27A 3FRXA 2UZYB 1TYQC 5EMJB 3I7PA 3I8CA 4A0BA 4CZYA 4J87A 2H6QA 3PXSD 4U1EI 3ULEC 4J86A 3OKYA 5FQDA 4E5ZA 4PXWA 5CYKA 3RSEC 3J80g 2IURA 2AGYA 2Z2PA 5GMKn 4CI2A 2YNPA 4GQ2P 2Z2NA 2IAAA 4FAVD 2CNXA 3JPXA 2W18A 2XU7A 3EWEA 3PSLA 2H9PA 1GG2B 3PXWD 2IUVA 4AEZA 3SBPA 3SBRA 4FB1D 4H5JA 4JSXC 4JSPC 3W15A 4G56B 4Y7RA 4ERQA 5EALA 3PE7A 3L4OD 4LG8A 4ERZA 3I89A 5GXHA 4J0XA 4R7AB 4YVDA 3RRMC 4A11B 5AMSA 3UVLA 4GQ1A 4QQEA 1N6EA 3V5WB 4PNKB 5TDHB 4JXMA 3I7NA 4A08B 4O3TB 2H14A 3UVNA 2BCJB 3DWLC 5B4WA 3EI4A 1N6FA 3DXMC 4FA9D 4I79A 3L4MD 3AFCA 2H9MA 2CO0C 1PGUA 2QC5A 2I3TA 3MXXA 5IJ7E 2H6NA 4O3UB 1JMZB 4U7AA 3F3FA 4PSWB 1QNIA 3OL2B 3VGZA 4GGCA 1YFQA 4GM9A 4LGNA 2P9IC 2B5NA 4XYHA 4JT5C 2P9NC 4L9OA 2OVRB 3MMYA 2OVPB 2IWKA 4OZUA 4CZVA 2P9PC 5H1MA 5HE3B 5SXMA 4AOWA 5IC7A 3EI3A 2IWFA 3F3GA 3VH0A 4H5IA 5FKSA 5I5JA 4O1QD 3CIKB 3RFGA 4BH6A 3EI2A 2H6KA 5EARA 2OJYA 3V9FA 4ZOZA 2P9SC 3SBQA 4FA1D 2BBKH 3OKYB 4X63B 3OTTA 4L3HD 3ORVD 3IIYA 1RI6A 5GXIA 2P9LC 3EI4B 1B9XA 4J8GA 3HFQA 5A2Qg 2PM9A 3SFZA 4CY5A 4E54A 4QL1A 2XYIA 3JZNA 2XL3A 3RN1D 3RMZD 3AL8A 1PI6A 1XIPA 2Z2OA 4GM3A 3GREA 4A09B 3SLED 4Y5RD 2YNOA 1PBYB 5FLXg 3NVXA 1OLZA 2Q7QA 3ZWLB 3KRWB 3CFVA 2H68A 4J84A 2QXVA 3I7KA 5FKRA 4J79A 1GP2B 5JWZA 1MG2A 1U4CA 4Z8LA 2GC4A 3JAMg 4QRJA 3MZKA 3UKRC 4FWWA 3BG1A 3J81g 3P4FA 5EMLB 2P9UC 4GQBB 4D0KA 4O45A 3PVUB 3DM0A 3OW8A 3IKOA 3N0EA 1GOTB 3IJCA 3IIWA 5EM2A 2CN2A 4E5ZB 3C75H 3MZLA 5CYKB 2AGZA 2UZXB 1L0QA 4CI3A 2H3XA 3EI2B 1U2VC 4KFMB 2I0SA 2GNQA 5FKTA 4CC9A 1XHMA 4UI9R 3OKWA 2AH1A 4CZXA 2H47A 3SJLD 5HYNB 3GFCA 3EG6A 2CE8A 5AFU3 4PBYA 2P9KC 3NVQA 3SN6B 3EI1A 4X3EA 3PSCB 4X61B 2YBAA 5CXCA 4D6VA 4JSNC 2B4EA 5K1CC 4A2LA 3E0CA 5IT9g 5HE2B 4CY2A 4PC0A 4FA5D 2J57G 1P22A 3SWSD 3DXKC 2HXCA 4ZOYA 4FHLA 1B9YA 3I7HA 1MDAH 3C99A 5K19A 4GM8A 4X60B 4BUJC 3RN0D 4J8BA 4A08A 2PM6B 5EAMA 3SXTD 2YB8B 3FGBA 4A7JA 4CY3A 2PBIB 4MK0B 3BG0A 3C5MA 2I0RA 1NR0A 3IJ1A 2HESX 3IJ0A 4A2MA 1GXRA 3SCYA 4GGDA 4CY1A 4A0BB 5IGOA 2AGWA 2YMUA 2TRCB 2AH0A 4JD2C 3I8EA 4K3ID 4FA4D 2EBSA 2PM7B 3PXTD 1ERJA 4ERYA 1K32A 4E54B 5TF2A 3AL8B 5FKQA 2H9NA 3OL2A 2G9AA 1XKSA 5CXBA 2YNNA 4XEIC 3K26A 1SQJA 1TBGA 4L3GD 4N14A 4ES0A 3CFSB 2AQ5A 5H14A 3UVOA 2AGLA 1PEVA 4BL0A 4PBZA 2HJBA 4L1QD 4J73A 2CE9A 4IA9A 1Q47A 4GGAA 3RFHA 4J82A 5EMKB 2OK6A 1SQ9A 3EMHA 3FM0A 1JMXB 5HQGA 4XYIA 4GZ8A 4LG9A 1R5MA 5HE0B 4ZOXA 4A09A 3SMRA 2J55H 3SHFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OIZ A;  5I5I A;  3A0F A;  5C2W B;  2I3S A;  5AJA A;  5CXC B;  5FXY A;  2HJ4 A;  1JOF A;  3OKT A;  3DSM A;  5I5M A;  5THA A;  5FA5 B;  4FAN D;  3AL9 A;  3U4Y A;  3B7F A;  3JRP A;  3N0D A;  3KRX B;  3C9C A;  2AGX A;  1FWX A;  5H17 A;  4NSX A;  3I7O A;  3PVW B;  4J0W A;  2XL2 A;  4PSX B;  5HE1 B;  5C2V B;  2B5M A;  3SVW D;  3UR4 A;  1SHY B;  3JZH A;  4CI8 A;  3MKS B;  3AH8 B;  2IUQ A;  3JZG A;  4QT8 A;  5IJ8 E;  4TZ4 A;  5TEF A;  5KDO B;  2HKM A;  4J78 A;  5EMM B;  4K3J B;  3JB9 L;  4OWR A;  2GC7 A;  1S4U X;  1N6D A;  3V7D B;  4J81 A;  3NVN A;  2J56 H;  4J77 A;  2I0T A;  3UVM A;  3MKQ A;  1MG3 A;  5TEE A;  2G99 A;  1K8K C;  4A11 A;  4JSV C;  3VA6 A;  5C9Z B;  4EWR A;  2HKR A;  2PM9 B;  4HDJ A;  2MTA H;  4IMM A;  4A0A A;  5EAP A;  3ODT A;  2HYE A;  3I7L A;  2O9K A;  3JRO A;  2H13 A;  2OVQ B;  1NEX B;  4JT6 C;  2OK4 A;  5GSA A;  2CO0 A;  2H9L A;  4ZN4 A;  5EM2 B;  1A0R B;  3F3P A;  5CXB B;  3RLM D;  2IUP A;  4CI1 A;  4O9D A;  4A0A B;  3EU7 A;  3I2N A;  5IGQ A;  2B5L A;  3EI3 B;  1VYH C;  4ESG A;  3UKU C;  3EI1 B;  4GMB A;  3UVK A;  1JJU B;  3BWS A;  1OMW B;  2CN3 A;  4ZOV A;  3K27 A;  3FRX A;  2UZY B;  1TYQ C;  5EMJ B;  3I7P A;  3I8C A;  4A0B A;  4CZY A;  4J87 A;  2H6Q A;  3PXS D;  4U1E I;  3ULE C;  4J86 A;  3OKY A;  5FQD A;  4E5Z A;  4PXW A;  5CYK A;  3RSE C;  3J80 g;  2IUR A;  2AGY A;  2Z2P A;  5GMK n;  4CI2 A;  2YNP A;  4GQ2 P;  2Z2N A;  2IAA A;  4FAV D;  2CNX A;  3JPX A;  2W18 A;  2XU7 A;  3EWE A;  3PSL A;  2H9P A;  1GG2 B;  3PXW D;  2IUV A;  4AEZ A;  3SBP A;  3SBR A;  4FB1 D;  4H5J A;  4JSX C;  4JSP C;  3W15 A;  4G56 B;  4Y7R A;  4ERQ A;  5EAL A;  3PE7 A;  3L4O D;  4LG8 A;  4ERZ A;  3I89 A;  5GXH A;  4J0X A;  4R7A B;  4YVD A;  3RRM C;  4A11 B;  5AMS A;  3UVL A;  4GQ1 A;  4QQE A;  1N6E A;  3V5W B;  4PNK B;  5TDH B;  4JXM A;  3I7N A;  4A08 B;  4O3T B;  2H14 A;  3UVN A;  2BCJ B;  3DWL C;  5B4W A;  3EI4 A;  1N6F A;  3DXM C;  4FA9 D;  4I79 A;  3L4M D;  3AFC A;  2H9M A;  2CO0 C;  1PGU A;  2QC5 A;  2I3T A;  3MXX A;  5IJ7 E;  2H6N A;  4O3U B;  1JMZ B;  4U7A A;  3F3F A;  4PSW B;  1QNI A;  3OL2 B;  3VGZ A;  4GGC A;  1YFQ A;  4GM9 A;  4LGN A;  2P9I C;  2B5N A;  4XYH A;  4JT5 C;  2P9N C;  4L9O A;  2OVR B;  3MMY A;  2OVP B;  2IWK A;  4OZU A;  4CZV A;  2P9P C;  5H1M A;  5HE3 B;  5SXM A;  4AOW A;  5IC7 A;  3EI3 A;  2IWF A;  3F3G A;  3VH0 A;  4H5I A;  5FKS A;  5I5J A;  4O1Q D;  3CIK B;  3RFG A;  4BH6 A;  3EI2 A;  2H6K A;  5EAR A;  2OJY A;  3V9F A;  4ZOZ A;  2P9S C;  3SBQ A;  4FA1 D;  2BBK H;  3OKY B;  4X63 B;  3OTT A;  4L3H D;  3ORV D;  3IIY A;  1RI6 A;  5GXI A;  2P9L C;  3EI4 B;  1B9X A;  4J8G A;  3HFQ A;  5A2Q g;  2PM9 A;  3SFZ A;  4CY5 A;  4E54 A;  4QL1 A;  2XYI A;  3JZN A;  2XL3 A;  3RN1 D;  3RMZ D;  3AL8 A;  1PI6 A;  1XIP A;  2Z2O A;  4GM3 A;  3GRE A;  4A09 B;  3SLE D;  4Y5R D;  2YNO A;  1PBY B;  5FLX g;  3NVX A;  1OLZ A;  2Q7Q A;  3ZWL B;  3KRW B;  3CFV A;  2H68 A;  4J84 A;  2QXV A;  3I7K A;  5FKR A;  4J79 A;  1GP2 B;  5JWZ A;  1MG2 A;  1U4C A;  4Z8L A;  2GC4 A;  3JAM g;  4QRJ A;  3MZK A;  3UKR C;  4FWW A;  3BG1 A;  3J81 g;  3P4F A;  5EML B;  2P9U C;  4GQB B;  4D0K A;  4O45 A;  3PVU B;  3DM0 A;  3OW8 A;  3IKO A;  3N0E A;  1GOT B;  3IJC A;  3IIW A;  5EM2 A;  2CN2 A;  4E5Z B;  3C75 H;  3MZL A;  5CYK B;  2AGZ A;  2UZX B;  1L0Q A;  4CI3 A;  2H3X A;  3EI2 B;  1U2V C;  4KFM B;  2I0S A;  2GNQ A;  5FKT A;  4CC9 A;  1XHM A;  4UI9 R;  3OKW A;  2AH1 A;  4CZX A;  2H47 A;  3SJL D;  5HYN B;  3GFC A;  3EG6 A;  2CE8 A;  5AFU 3;  4PBY A;  2P9K C;  3NVQ A;  3SN6 B;  3EI1 A;  4X3E A;  3PSC B;  4X61 B;  2YBA A;  5CXC A;  4D6V A;  4JSN C;  2B4E A;  5K1C C;  4A2L A;  3E0C A;  5IT9 g;  5HE2 B;  4CY2 A;  4PC0 A;  4FA5 D;  2J57 G;  1P22 A;  3SWS D;  3DXK C;  2HXC A;  4ZOY A;  4FHL A;  1B9Y A;  3I7H A;  1MDA H;  3C99 A;  5K19 A;  4GM8 A;  4X60 B;  4BUJ C;  3RN0 D;  4J8B A;  4A08 A;  2PM6 B;  5EAM A;  3SXT D;  2YB8 B;  3FGB A;  4A7J A;  4CY3 A;  2PBI B;  4MK0 B;  3BG0 A;  3C5M A;  2I0R A;  1NR0 A;  3IJ1 A;  2HES X;  3IJ0 A;  4A2M A;  1GXR A;  3SCY A;  4GGD A;  4CY1 A;  4A0B B;  5IGO A;  2AGW A;  2YMU A;  2TRC B;  2AH0 A;  4JD2 C;  3I8E A;  4K3I D;  4FA4 D;  2EBS A;  2PM7 B;  3PXT D;  1ERJ A;  4ERY A;  1K32 A;  4E54 B;  5TF2 A;  3AL8 B;  5FKQ A;  2H9N A;  3OL2 A;  2G9A A;  1XKS A;  5CXB A;  2YNN A;  4XEI C;  3K26 A;  1SQJ A;  1TBG A;  4L3G D;  4N14 A;  4ES0 A;  3CFS B;  2AQ5 A;  5H14 A;  3UVO A;  2AGL A;  1PEV A;  4BL0 A;  4PBZ A;  2HJB A;  4L1Q D;  4J73 A;  2CE9 A;  4IA9 A;  1Q47 A;  4GGA A;  3RFH A;  4J82 A;  5EMK B;  2OK6 A;  1SQ9 A;  3EMH A;  3FM0 A;  1JMX B;  5HQG A;  4XYI A;  4GZ8 A;  4LG9 A;  1R5M A;  5HE0 B;  4ZOX A;  4A09 A;  3SMR A;  2J55 H;  3SHF A; 
#chains in the Genus database with same CATH topology
 2OIZ A;  5I5I A;  1O6G A;  3A0F A;  2WQ8 A;  5C2W B;  4BP8 A;  2I3S A;  5AJA A;  5CXC B;  5FXY A;  2HJ4 A;  1JOF A;  3OKT A;  1JV2 A;  3DSM A;  3QHY B;  5I5M A;  5THA A;  5FA5 B;  4FAN D;  3AL9 A;  3U4Y A;  3B7F A;  3JRP A;  3N0D A;  3KRX B;  3C9C A;  2AGX A;  1FWX A;  1UTC A;  5H17 A;  4NSX A;  3MVD K;  3I7O A;  2VZ1 A;  3IUJ A;  4JHN A;  3PVW B;  4J0W A;  2XL2 A;  5FFO A;  4PSX B;  5HE1 B;  3ZE2 A;  5C2V B;  3NIF A;  2B5M A;  3SVW D;  3DDU A;  3UR4 A;  1SHY B;  3JZH A;  4CI8 A;  3MKS B;  4Z7O A;  3AH8 B;  2IUQ A;  1A12 A;  1VE7 A;  3JZG A;  4QT8 A;  5IJ8 E;  4TZ4 A;  5TEF A;  5KDO B;  2HKM A;  4J78 A;  5EMM B;  4K3J B;  1H2W A;  4OWR A;  3JB9 L;  5M5V A;  2GC7 A;  1S4U X;  4DNU A;  1N6D A;  3V7D B;  3V4V A;  4J81 A;  3NVN A;  2J56 H;  4J77 A;  2I0T A;  3UVM A;  3MKQ A;  3IUN A;  4MMZ A;  1MG3 A;  5TEE A;  2G99 A;  1K8K C;  4A11 A;  4JSV C;  3VA6 A;  1YR2 A;  5C9Z B;  4EWR A;  2HU5 A;  2VDP A;  2HKR A;  2PM9 B;  3K72 A;  4HDJ A;  2MTA H;  4IMM A;  4A0A A;  5EAP A;  5FFG A;  3ODT A;  2HYE A;  1TYE A;  2O9K A;  3I7L A;  3O4G A;  3JRO A;  2H13 A;  2OVQ B;  1NEX B;  4JT6 C;  2VDK A;  2OK4 A;  3FCU A;  5GSA A;  2CO0 A;  2H9L A;  4ZN4 A;  5EM2 B;  1A0R B;  3F3P A;  5CXB B;  3RLM D;  2IUP A;  4CI1 A;  4O9D A;  1E8N A;  5M5T A;  4BCB A;  4A0A B;  3EU7 A;  3I2N A;  5IGQ A;  2B5L A;  1BPO A;  1VYH C;  3EI3 B;  3IUQ A;  4ESG A;  3UKU C;  3EI1 B;  4GMB A;  3UVK A;  1JJU B;  3BWS A;  1OMW B;  2CN3 A;  4ZOV A;  1E8M A;  3K27 A;  1UOQ A;  4MMY A;  2VDN A;  3FRX A;  2UZY B;  1M1X A;  1TYQ C;  5EMJ B;  5C86 A;  3I7P A;  3I8C A;  4G1E A;  2EIC A;  4BP9 A;  4A0B A;  4CZY A;  4J87 A;  2H6Q A;  4JHP C;  3PXS D;  4U1E I;  3ULE C;  4J86 A;  3OKY A;  5FQD A;  4E5Z A;  4PXW A;  5CYK A;  3RSE C;  3J80 g;  2IUR A;  2AGY A;  4RE5 A;  1UOO A;  2Z2P A;  5GMK n;  1O6F A;  4CI2 A;  2YNP A;  3KCI A;  4GQ2 P;  5M61 A;  2Z2N A;  5M5S A;  2IAA A;  4FAV D;  2CNX A;  3JPX A;  1E5T A;  1T2X A;  2W18 A;  2XU7 A;  3EWE A;  3PSL A;  2BKL A;  2H9P A;  1GG2 B;  3PXW D;  2VDO A;  2IUV A;  4AEZ A;  3SBP A;  3SBR A;  4FB1 D;  4H5J A;  4JSX C;  2HU8 A;  4JSP C;  3W15 A;  5M5U A;  1JTD B;  4G56 B;  2VDR A;  4Y7R A;  4ERQ A;  5EAL A;  3PE7 A;  3L4O D;  4LG8 A;  4AN1 A;  4ERZ A;  3I89 A;  5GXH A;  4J0X A;  4R7A B;  4YVD A;  3RRM C;  4A11 B;  5AMS A;  3UVL A;  2EID A;  4GQ1 A;  4QQE A;  1N6E A;  3V5W B;  4PNK B;  3OF7 A;  4UM9 A;  5TDH B;  4JXM A;  3I7N A;  4A08 B;  4NAA A;  4O3T B;  2H14 A;  3UVN A;  4AX4 A;  2BCJ B;  3DWL C;  3IUM A;  4G1M A;  5C92 A;  2HU7 A;  2QR5 A;  5B4W A;  3EI4 A;  1N6F A;  3DXM C;  4FA9 D;  1C9L A;  4I79 A;  3L4M D;  2EIE A;  3AFC A;  2H9M A;  2CO0 C;  1PGU A;  3K6S A;  2QC5 A;  1VZ2 A;  2I3T A;  3T3P A;  3MXX A;  5IJ7 E;  2H6N A;  4O3U B;  1JMZ B;  4U7A A;  3F3F A;  4PSW B;  1QNI A;  3OL2 B;  3VGZ A;  4GGC A;  2VZ3 A;  1YFQ A;  4GM9 A;  4LGN A;  2P9I C;  2B5N A;  4XYH A;  4JT5 C;  2P9N C;  2VDL A;  4L9O A;  1K3I A;  2OVR B;  3MMY A;  3O4J A;  2OVP B;  2IWK A;  4OZU A;  4CZV A;  2P9P C;  5H1M A;  5HE3 B;  5SXM A;  4AOW A;  1QFM A;  3ZE1 A;  5IC7 A;  3EI3 A;  2IWF A;  3F3G A;  3VH0 A;  4H5I A;  5FKS A;  5I5J A;  3EQ7 A;  4O1Q D;  1H2Y A;  3CIK B;  1C9I A;  3RFG A;  4BH6 A;  3EI2 A;  2H6K A;  5E6U A;  5EAR A;  2OJY A;  3V9F A;  4ZOZ A;  2P9S C;  3SBQ A;  4FA1 D;  2BBK H;  3OKY B;  4X63 B;  1GOF A;  3OTT A;  4L3H D;  3ORV D;  3IIY A;  1RI6 A;  5GXI A;  2P9L C;  3EI4 B;  1B9X A;  4J8G A;  3HFQ A;  5A2Q g;  2PM9 A;  3SFZ A;  4CY5 A;  4Z7N A;  4E54 A;  4QL1 A;  3ZDY A;  2XYI A;  3JZN A;  2XL3 A;  3RN1 D;  3RMZ D;  3AL8 A;  1PI6 A;  1XIP A;  2Z2O A;  4GM3 A;  4G55 A;  3GRE A;  4A09 B;  3SLE D;  4Y5R D;  2YNO A;  4DNV A;  1PBY B;  5FLX g;  3NVX A;  3ZDZ A;  2XDW A;  1OLZ A;  2Q7Q A;  3ZWL B;  4RE6 A;  3KRW B;  3VI3 A;  3CFV A;  2H68 A;  4J84 A;  2QXV A;  4NC4 A;  3I7K A;  5FKR A;  4J79 A;  1GP2 B;  5JWZ A;  1MG2 A;  1U4C A;  4Z8L A;  4DNW A;  2GC4 A;  3JAM g;  4QRJ A;  1VZ3 A;  3IUR A;  2JKX A;  3MZK A;  3UKR C;  4FWW A;  1H2X A;  2QZP A;  3BG1 A;  3J81 g;  3P4F A;  5EML B;  2P9U C;  4GQB B;  4D0K A;  3GC3 B;  4O45 A;  3PVU B;  3DM0 A;  3OW8 A;  3IKO A;  4WK0 A;  3N0E A;  1GOT B;  3IJC A;  3IIW A;  4IRZ A;  5EM2 A;  1UOP A;  2CN2 A;  4AMY A;  4E5Z B;  3C75 H;  3MZL A;  2AGZ A;  4O02 A;  5CYK B;  2UZX B;  1L0Q A;  4CI3 A;  4WK4 A;  4AN0 A;  2H3X A;  4QAM A;  1U2V C;  3EI2 B;  4KFM B;  3VI4 A;  2I0S A;  2GNQ A;  3IUL A;  5FKT A;  2XZG A;  4CC9 A;  4WJK A;  1XHM A;  4UI9 R;  3OKW A;  2AH1 A;  3MUN A;  4CZX A;  3NIG A;  4UM8 A;  2H47 A;  3SJL D;  3T3M A;  5HYN B;  3GFC A;  4BCD A;  1I2M B;  3EG6 A;  2CE8 A;  5AFU 3;  4PBY A;  2P9K C;  3NVQ A;  3SN6 B;  3EI1 A;  3PSC B;  3GD1 I;  4X3E A;  1L5G A;  4X61 B;  2YBA A;  5CXC A;  5M5R A;  4D6V A;  4JSN C;  2B4E A;  5K1C C;  3NID A;  4MMX A;  3E0C A;  5HDB A;  4A2L A;  5IT9 g;  5HE2 B;  4CY2 A;  4PC0 A;  4Z7Q A;  4FA5 D;  3MUO A;  2J57 G;  1P22 A;  4NBM A;  3SWS D;  3DXK C;  2HXC A;  4ZOY A;  4BCC A;  1H2Z A;  1GOH A;  4FHL A;  3I7H A;  1B9Y A;  1MDA H;  3C99 A;  5K19 A;  4GM8 A;  4X60 B;  4BUJ C;  3RN0 D;  4J8B A;  4A08 A;  2EIB A;  2PM6 B;  5EAM A;  3SXT D;  2YB8 B;  3IVM A;  3FCS A;  3FGB A;  2XE4 A;  3IJE A;  4A7J A;  4CY3 A;  2PBI B;  4MK0 B;  3BG0 A;  3C5M A;  2I0R A;  1NR0 A;  3IJ1 A;  2HES X;  3EQ9 A;  3IJ0 A;  4A2M A;  1GXR A;  1U8C A;  3SCY A;  4GGD A;  4CY1 A;  4A0B B;  1VE6 A;  5IGO A;  2AGW A;  2YMU A;  2TRC B;  3QI0 A;  3O4I A;  5E6R A;  2AH0 A;  4JD2 C;  3I8E A;  4K3I D;  4O2W A;  4FA4 D;  2EBS A;  4D9S A;  2PM7 B;  3PXT D;  1ERJ A;  4ERY A;  1K32 A;  4E54 B;  2VC2 A;  3O4H A;  5TF2 A;  3ZDX A;  3AL8 B;  5FKQ A;  2H9N A;  3OL2 A;  2VDM A;  2G9A A;  5E6S A;  1XKS A;  4WK2 A;  5CXB A;  2YNN A;  4XEI C;  3K26 A;  1SQJ A;  3K71 A;  1TBG A;  4L3G D;  4N14 A;  4ES0 A;  3CFS B;  2AQ5 A;  5H14 A;  3UVO A;  2AGL A;  1PEV A;  4BL0 A;  4PBZ A;  3ZE0 A;  2HJB A;  4AMZ A;  4L1Q D;  4J73 A;  2CE9 A;  1GOG A;  4IA9 A;  1Q47 A;  4GGA A;  3RFH A;  3V4P A;  4NEN A;  4J82 A;  2VDQ A;  2OK6 A;  5EMK B;  1SQ9 A;  1QFS A;  3EMH A;  4L1M A;  3FM0 A;  1JMX B;  3EQ8 A;  5HQG A;  4XYI A;  4GZ8 A;  4LG9 A;  1R5M A;  5HE0 B;  4ZOX A;  4A09 A;  3SMR A;  2J55 H;  3SHF A; 
#chains in the Genus database with same CATH homology
 2OIZ A;  5I5I A;  3A0F A;  5C2W B;  2I3S A;  5AJA A;  5CXC B;  5FXY A;  2HJ4 A;  1JOF A;  3OKT A;  3DSM A;  5I5M A;  5THA A;  5FA5 B;  4FAN D;  3AL9 A;  3U4Y A;  3B7F A;  3JRP A;  3N0D A;  3KRX B;  3C9C A;  2AGX A;  1FWX A;  5H17 A;  4NSX A;  3I7O A;  3PVW B;  4J0W A;  2XL2 A;  4PSX B;  5HE1 B;  5C2V B;  2B5M A;  3SVW D;  3UR4 A;  1SHY B;  3JZH A;  4CI8 A;  3MKS B;  3AH8 B;  2IUQ A;  3JZG A;  4QT8 A;  5IJ8 E;  4TZ4 A;  5TEF A;  5KDO B;  2HKM A;  4J78 A;  5EMM B;  4K3J B;  3JB9 L;  4OWR A;  2GC7 A;  1S4U X;  1N6D A;  3V7D B;  4J81 A;  3NVN A;  2J56 H;  4J77 A;  2I0T A;  3UVM A;  3MKQ A;  1MG3 A;  5TEE A;  2G99 A;  1K8K C;  4A11 A;  4JSV C;  3VA6 A;  5C9Z B;  4EWR A;  2HKR A;  2PM9 B;  4HDJ A;  2MTA H;  4IMM A;  4A0A A;  5EAP A;  3ODT A;  2HYE A;  3I7L A;  2O9K A;  3JRO A;  2H13 A;  2OVQ B;  1NEX B;  4JT6 C;  2OK4 A;  5GSA A;  2CO0 A;  2H9L A;  4ZN4 A;  5EM2 B;  1A0R B;  3F3P A;  5CXB B;  3RLM D;  2IUP A;  4CI1 A;  4O9D A;  4A0A B;  3EU7 A;  3I2N A;  5IGQ A;  2B5L A;  3EI3 B;  1VYH C;  4ESG A;  3UKU C;  3EI1 B;  4GMB A;  3UVK A;  1JJU B;  3BWS A;  1OMW B;  2CN3 A;  4ZOV A;  3K27 A;  3FRX A;  2UZY B;  1TYQ C;  5EMJ B;  3I7P A;  3I8C A;  4A0B A;  4CZY A;  4J87 A;  2H6Q A;  3PXS D;  4U1E I;  3ULE C;  4J86 A;  3OKY A;  5FQD A;  4E5Z A;  4PXW A;  5CYK A;  3RSE C;  3J80 g;  2IUR A;  2AGY A;  2Z2P A;  5GMK n;  4CI2 A;  2YNP A;  4GQ2 P;  2Z2N A;  2IAA A;  4FAV D;  2CNX A;  3JPX A;  2W18 A;  2XU7 A;  3EWE A;  3PSL A;  2H9P A;  1GG2 B;  3PXW D;  2IUV A;  4AEZ A;  3SBP A;  3SBR A;  4FB1 D;  4H5J A;  4JSX C;  4JSP C;  3W15 A;  4G56 B;  4Y7R A;  4ERQ A;  5EAL A;  3PE7 A;  3L4O D;  4LG8 A;  4ERZ A;  3I89 A;  5GXH A;  4J0X A;  4R7A B;  4YVD A;  3RRM C;  4A11 B;  5AMS A;  3UVL A;  4GQ1 A;  4QQE A;  1N6E A;  3V5W B;  4PNK B;  5TDH B;  4JXM A;  3I7N A;  4A08 B;  4O3T B;  2H14 A;  3UVN A;  2BCJ B;  3DWL C;  5B4W A;  3EI4 A;  1N6F A;  3DXM C;  4FA9 D;  4I79 A;  3L4M D;  3AFC A;  2H9M A;  2CO0 C;  1PGU A;  2QC5 A;  2I3T A;  3MXX A;  5IJ7 E;  2H6N A;  4O3U B;  1JMZ B;  4U7A A;  3F3F A;  4PSW B;  1QNI A;  3OL2 B;  3VGZ A;  4GGC A;  1YFQ A;  4GM9 A;  4LGN A;  2P9I C;  2B5N A;  4XYH A;  4JT5 C;  2P9N C;  4L9O A;  2OVR B;  3MMY A;  2OVP B;  2IWK A;  4OZU A;  4CZV A;  2P9P C;  5H1M A;  5HE3 B;  5SXM A;  4AOW A;  5IC7 A;  3EI3 A;  2IWF A;  3F3G A;  3VH0 A;  4H5I A;  5FKS A;  5I5J A;  4O1Q D;  3CIK B;  3RFG A;  4BH6 A;  3EI2 A;  2H6K A;  5EAR A;  2OJY A;  3V9F A;  4ZOZ A;  2P9S C;  3SBQ A;  4FA1 D;  2BBK H;  3OKY B;  4X63 B;  3OTT A;  4L3H D;  3ORV D;  3IIY A;  1RI6 A;  5GXI A;  2P9L C;  3EI4 B;  1B9X A;  4J8G A;  3HFQ A;  5A2Q g;  2PM9 A;  3SFZ A;  4CY5 A;  4E54 A;  4QL1 A;  2XYI A;  3JZN A;  2XL3 A;  3RN1 D;  3RMZ D;  3AL8 A;  1PI6 A;  1XIP A;  2Z2O A;  4GM3 A;  3GRE A;  4A09 B;  3SLE D;  4Y5R D;  2YNO A;  1PBY B;  5FLX g;  3NVX A;  1OLZ A;  2Q7Q A;  3ZWL B;  3KRW B;  3CFV A;  2H68 A;  4J84 A;  2QXV A;  3I7K A;  5FKR A;  4J79 A;  1GP2 B;  5JWZ A;  1MG2 A;  1U4C A;  4Z8L A;  2GC4 A;  3JAM g;  4QRJ A;  3MZK A;  3UKR C;  4FWW A;  3BG1 A;  3J81 g;  3P4F A;  5EML B;  2P9U C;  4GQB B;  4D0K A;  4O45 A;  3PVU B;  3DM0 A;  3OW8 A;  3IKO A;  3N0E A;  1GOT B;  3IJC A;  3IIW A;  5EM2 A;  2CN2 A;  4E5Z B;  3C75 H;  3MZL A;  5CYK B;  2AGZ A;  2UZX B;  1L0Q A;  4CI3 A;  2H3X A;  3EI2 B;  1U2V C;  4KFM B;  2I0S A;  2GNQ A;  5FKT A;  4CC9 A;  1XHM A;  4UI9 R;  3OKW A;  2AH1 A;  4CZX A;  2H47 A;  3SJL D;  5HYN B;  3GFC A;  3EG6 A;  2CE8 A;  5AFU 3;  4PBY A;  2P9K C;  3NVQ A;  3SN6 B;  3EI1 A;  4X3E A;  3PSC B;  4X61 B;  2YBA A;  5CXC A;  4D6V A;  4JSN C;  2B4E A;  5K1C C;  4A2L A;  3E0C A;  5IT9 g;  5HE2 B;  4CY2 A;  4PC0 A;  4FA5 D;  2J57 G;  1P22 A;  3SWS D;  3DXK C;  2HXC A;  4ZOY A;  4FHL A;  1B9Y A;  3I7H A;  1MDA H;  3C99 A;  5K19 A;  4GM8 A;  4X60 B;  4BUJ C;  3RN0 D;  4J8B A;  4A08 A;  2PM6 B;  5EAM A;  3SXT D;  2YB8 B;  3FGB A;  4A7J A;  4CY3 A;  2PBI B;  4MK0 B;  3BG0 A;  3C5M A;  2I0R A;  1NR0 A;  3IJ1 A;  2HES X;  3IJ0 A;  4A2M A;  1GXR A;  3SCY A;  4GGD A;  4CY1 A;  4A0B B;  5IGO A;  2AGW A;  2YMU A;  2TRC B;  2AH0 A;  4JD2 C;  3I8E A;  4K3I D;  4FA4 D;  2EBS A;  2PM7 B;  3PXT D;  1ERJ A;  4ERY A;  1K32 A;  4E54 B;  5TF2 A;  3AL8 B;  5FKQ A;  2H9N A;  3OL2 A;  2G9A A;  1XKS A;  5CXB A;  2YNN A;  4XEI C;  3K26 A;  1SQJ A;  1TBG A;  4L3G D;  4N14 A;  4ES0 A;  3CFS B;  2AQ5 A;  5H14 A;  3UVO A;  2AGL A;  1PEV A;  4BL0 A;  4PBZ A;  2HJB A;  4L1Q D;  4J73 A;  2CE9 A;  4IA9 A;  1Q47 A;  4GGA A;  3RFH A;  4J82 A;  5EMK B;  2OK6 A;  1SQ9 A;  3EMH A;  3FM0 A;  1JMX B;  5HQG A;  4XYI A;  4GZ8 A;  4LG9 A;  1R5M A;  5HE0 B;  4ZOX A;  4A09 A;  3SMR A;  2J55 H;  3SHF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...