2CO0A

Wdr5 and unmodified histone h3 complex at 2.25 angstrom
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
304
structure length
304
Chain Sequence
VKPNYALMFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGMCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNDLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Histone H3 Recognition and Presentation by the Wdr5 Module of the Mll1 Complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords WD-REPEAT PROTEIN 5
total genus 100
structure length 304
sequence length 304
ec nomenclature
pdb deposition date 2006-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2co0A00
2CE8A 2HKMA 4U7AA 5H17A 3FM0A 3BG1A 1VYHC 3HFQA 3PVUB 2HKRA 3CFVA 3GREA 4GGDA 4X63B 4A0BB 3JROA 1OMWB 4L3HD 2H6NA 2HESX 3SHFA 3J81g 3JZGA 4CI8A 3SMRA 3VA6A 1XKSA 4CI2A 4GMBA 1A0RB 1K8KC 1Q47A 4ESGA 5IJ7E 1N6DA 1PEVA 1ERJA 4O3TB 2Q7QA 4X3EA 3RFGA 2XL3A 4GZ8A 4L9OA 3EI4B 5CYKA 3EI3A 4O9DA 3SLED 5EM2B 5I5MA 4FHLA 4J8BA 4FA1D 5C2VB 1MG2A 3OKYB 1N6EA 4JSNC 5FKTA 5AMSA 3PXSD 4IA9A 3I8CA 4CY3A 4FA4D 4A11A 4CI3A 2OVPB 3C9CA 2I0SA 4N14A 4A0BA 3RSEC 3SJLD 3KRXB 4CZXA 5IJ8E 4A11B 4Y7RA 3FRXA 2OJYA 3PSCB 4PC0A 3RN0D 1JJUB 1RI6A 3UVKA 3V7DB 5HQGA 4H5IA 3EWEA 5GMKn 1GG2B 2P9NC 3K27A 3OW8A 5EMLB 5HE2B 2AGWA 5CYKB 2Z2OA 4HDJA 1N6FA 5IGOA 5CXCB 3JPXA 4QL1A 3JZNA 2P9PC 2IUVA 3V9FA 5EARA 3I7HA 2YNOA 3F3GA 4JD2C 2UZXB 3EU7A 4D0KA 4ERQA 4GGAA 1MG3A 3SVWD 2HXCA 3A0FA 2P9UC 5TEFA 5GXIA 3U4YA 4ZOXA 3BWSA 3C75H 4GM9A 5EALA 1XIPA 3AL8B 2OVQB 3NVQA 4ZOYA 2PM7B 3OKTA 4OZUA 5EMJB 3I8EA 1U4CA 4FAVD 4FAND 4FA9D 3I7LA 3PSLA 2AGYA 4J8GA 3K26A 3ODTA 4XEIC 1NEXB 3AL8A 3SFZA 4CY5A 2H3XA 2H6KA 4L1QD 4PBYA 2OK6A 5CXCA 3I7KA 3N0DA 5TF2A 4JT6C 4PXWA 3AL9A 3SCYA 1PBYB 3RLMD 4A0AB 3I7PA 1PI6A 2AGXA 2AGZA 2TRCB 3JB9L 2B5LA 2H9NA 2IAAA 4G56B 3I2NA 2YBAA 1OLZA 4QQEA 4LG9A 2AQ5A 3C99A 5FKQA 3IIWA 4AOWA 2CE9A 3SBPA 4A7JA 2B4EA 2J55H 5B4WA 5SXMA 2HJ4A 4FB1D 4X60B 3CFSB 4A2MA 4J79A 2P9KC 3FGBA 4MK0B 1B9XA 3ORVD 3ZWLB 4GQ2P 5GSAA 4A09A 4PBZA 1SQ9A 5AJAA 4E5ZB 5EMMB 4CZYA 4QT8A 4Y5RD 4JT5C 3NVXA 2IWKA 2AH0A 4E54A 2QXVA 4D6VA 3V5WB 5AFU3 1R5MA 1TBGA 4FA5D 4BH6A 5TDHB 2OK4A 4PSXB 4X61B 2AGLA 4Z8LA 1NR0A 1B9YA 4E54B 2W18A 2PM9B 5FLXg 5EM2A 2J56H 1GXRA 3F3FA 4O45A 3EI4A 3B7FA 3PE7A 3UVLA 2H13A 5JWZA 4I79A 5EAMA 3EI1B 4A08B 2YB8B 4EWRA 4OWRA 2H6QA 2CO0C 4CY2A 3SN6B 4J0WA 5FQDA 3VGZA 4CZVA 3CIKB 2P9SC 4A0AA 3PVWB 3ULEC 3IJCA 3OL2B 4A09B 1S4UX 3EG6A 5EAPA 1XHMA 2OVRB 5K1CC 1TYQC 4KFMB 4J81A 1JMXB 5K19A 4J78A 2HJBA 4CC9A 3I7OA 4ES0A 2YNPA 2HYEA 3JZHA 2XYIA 3EI2B 4GM3A 3IIYA 3OKWA 4ERYA 3KRWB 5IC7A 2PM6B 3UVOA 1SQJA 2PBIB 4QRJA 2G99A 3DXMC 4J77A 5FKSA 2PM9A 2H47A 4O3UB 4ZOZA 2CO0A 3DXKC 1QNIA 4J0XA 3MMYA 2I0RA 5H1MA 5HYNB 3UKUC 2H68A 4A08A 2GC7A 4LGNA 1FWXA 2YNNA 3UVNA 3VH0A 3EI3B 4JSXC 4K3ID 2GC4A 4PSWB 3E0CA 3MZLA 4ERZA 5A2Qg 3GFCA 2QC5A 2B5MA 1K32A 4IMMA 4L3GD 5I5JA 5GXHA 2BBKH 4R7AB 5CXBA 1JOFA 4A2LA 2I3SA 3DM0A 3MKQA 4LG8A 3P4FA 5IT9g 3EMHA 3J80g 1P22A 2IUPA 3OTTA 4GGCA 3RMZD 4J84A 2O9KA 3N0EA 4FWWA 4J87A 3MXXA 2MTAH 3C5MA 2B5NA 3L4OD 4XYHA 3AFCA 2P9IC 2GNQA 2H9PA 2H9MA 3RFHA 3EI2A 5FKRA 4GM8A 3DSMA 5TEEA 3EI1A 4J82A 4ZOVA 3JRPA 3PXWD 4UI9R 3BG0A 4CI1A 1GP2B 1L0QA 1YFQA 3SXTD 3OL2A 4PNKB 3SBRA 2AH1A 2UZYB 3PXTD 1PGUA 2CNXA 3MKSB 3RRMC 5IGQA 1JMZB 3DWLC 1SHYB 2CN3A 4U1EI 4GQBB 2I0TA 1MDAH 3I89A 2XL2A 4BL0A 2H9LA 5EMKB 4JSPC 2I3TA 2IUQA 1U2VC 5THAA 3RN1D 3JAMg 4E5ZA 4K3JB 5KDOB 4GQ1A 4TZ4A 4O1QD 3SBQA 1GOTB 5HE0B 4NSXA 3AH8B 2EBSA 3UVMA 2Z2NA 4JXMA 3L4MD 3OKYA 4CY1A 5FA5B 5FXYA 4J73A 4JSVC 3MZKA 2J57G 5HE3B 2XU7A 2IURA 3NVNA 3UKRC 5I5IA 3W15A 2P9LC 4AEZA 2IWFA 3IJ0A 2G9AA 4H5JA 4ZN4A 5H14A 5CXBB 4BUJC 2CN2A 3UR4A 2BCJB 2Z2PA 2OIZA 3IJ1A 3SWSD 5C2WB 2H14A 5C9ZB 4XYIA 3IKOA 4J86A 2YMUA 3F3PA 3I7NA 4YVDA 5HE1B
chains in the Genus database with same CATH superfamily
2CE8A 2HKMA 4U7AA 5H17A 3O4HA 3FM0A 3BG1A 1VYHC 3HFQA 3PVUB 2BKLA 2HKRA 2VZ1A 4AMZA 3CFVA 3GREA 4GGDA 4X63B 4A0BB 3JROA 1I2MB 1OMWB 4L3HD 2H6NA 2HESX 3SHFA 3J81g 3JZGA 4CI8A 3SMRA 3VA6A 3ZE0A 4Z7QA 1VZ3A 1XKSA 4CI2A 4GMBA 1A0RB 1K8KC 1Q47A 4ESGA 5IJ7E 1N6DA 1U8CA 1PEVA 3V4VA 1ERJA 2XDWA 4O3TB 2Q7QA 4L1MA 4X3EA 3RFGA 2XL3A 4GZ8A 4L9OA 3EI4B 5CYKA 3EI3A 4O9DA 3SLED 5EM2B 5I5MA 4FHLA 4J8BA 4FA1D 5C2VB 3OKYB 1MG2A 1N6EA 4JSNC 5FKTA 3FCUA 5E6SA 5AMSA 3PXSD 4IA9A 3I8CA 4CY3A 3QHYB 4A11A 4FA4D 4AN1A 3O4IA 4CI3A 2OVPB 3C9CA 2I0SA 4N14A 2VDLA 4A0BA 3IJEA 3NIFA 3RSEC 3SJLD 3KRXB 3ZE1A 3MVDK 4RE6A 2VC2A 4CZXA 5IJ8E 1H2YA 4A11B 4Y7RA 1UOQA 3FRXA 2OJYA 3PSCB 4PC0A 5M61A 1JJUB 1RI6A 3RN0D 3UVKA 3FCSA 3V7DB 4BP9A 1O6GA 5HQGA 4H5IA 3T3PA 3GC3B 3IUQA 3EWEA 5GMKn 1GG2B 1TYEA 2P9NC 3K27A 3OW8A 5EMLB 4NBMA 3DDUA 5HE2B 2AGWA 5CYKB 1E8MA 2Z2OA 3IUMA 1L5GA 4HDJA 1N6FA 5IGOA 2XE4A 5CXCB 3IURA 3JPXA 4QL1A 3JZNA 3ZDXA 2P9PC 2IUVA 3V9FA 5EARA 3I7HA 2YNOA 3F3GA 4DNWA 4JD2C 2UZXB 3EU7A 4NAAA 4D0KA 4ERQA 4GGAA 1MG3A 3SVWD 2HXCA 3A0FA 2P9UC 5TEFA 5GXIA 1K3IA 3U4YA 4ZOXA 1BPOA 3BWSA 2VDKA 3EQ8A 3C75H 4GM9A 5EALA 1XIPA 3K6SA 3AL8B 2OVQB 3NVQA 4ZOYA 2PM7B 3OKTA 4OZUA 2VZ3A 5EMJB 3I8EA 1U4CA 4FAVD 5C92A 4FAND 4UM9A 4FA9D 4D9SA 1VZ2A 3I7LA 3PSLA 2AGYA 4WK0A 4J8GA 3K26A 3O4GA 3ODTA 3IUJA 4XEIC 1NEXB 3AL8A 2VDQA 3SFZA 2XZGA 4CY5A 2H3XA 2HU8A 2H6KA 4L1QD 4PBYA 1H2XA 2OK6A 5CXCA 5C86A 3I7KA 3N0DA 5TF2A 4JT6C 4PXWA 5FFOA 3AL9A 3SCYA 1PBYB 3RLMD 4A0AB 3I7PA 1PI6A 2AGXA 2AGZA 2TRCB 3JB9L 2B5LA 2H9NA 2IAAA 4G56B 3I2NA 2YBAA 1OLZA 2QR5A 4QQEA 3V4PA 4Z7OA 4LG9A 2AQ5A 3C99A 5FKQA 3IIWA 4AOWA 2CE9A 3SBPA 4A7JA 2B4EA 2J55H 4G55A 5B4WA 5SXMA 4RE5A 4AN0A 2HJ4A 4FB1D 4X60B 3CFSB 4A2MA 4J79A 4BCDA 1H2ZA 2P9KC 4NC4A 3FGBA 4MK0B 1B9XA 4O2WA 2VDPA 3ORVD 4MMXA 3ZWLB 4GQ2P 1E8NA 5GSAA 4A09A 4PBZA 1SQ9A 5AJAA 3MUOA 5EMMB 4E5ZB 4CZYA 1T2XA 1VE6A 4MMYA 3ZE2A 4QT8A 4Y5RD 4JT5C 3NVXA 2IWKA 2EIEA 3QI0A 2AH0A 4E54A 2QXVA 5M5UA 4AX4A 4D6VA 3V5WB 5AFU3 1R5MA 1TBGA 4FA5D 1UOOA 4BH6A 5TDHB 2OK4A 4PSXB 1C9LA 4X61B 2AGLA 4Z8LA 1NR0A 1B9YA 4E54B 2W18A 2PM9B 5FLXg 5EM2A 2J56H 1GXRA 3F3FA 4O45A 1YR2A 3EI4A 4O02A 4DNUA 3B7FA 3PE7A 3UVLA 2H13A 5JWZA 4I79A 5EAMA 3EI1B 4A08B 2YB8B 1JV2A 4EWRA 4OWRA 1VE7A 2CO0C 2H6QA 4CY2A 4DNVA 3SN6B 5E6UA 4J0WA 5FQDA 3VGZA 4CZVA 3T3MA 3CIKB 2P9SC 4A0AA 3PVWB 4JHPC 3ULEC 3K72A 1M1XA 2EICA 3IJCA 3OL2B 4JHNA 4A09B 1S4UX 3EG6A 5EAPA 1A12A 1XHMA 2OVRB 5HDBA 5K1CC 1TYQC 4KFMB 4J81A 1JMXB 5K19A 4J78A 2HJBA 5M5RA 4CC9A 3I7OA 4ES0A 2YNPA 2HYEA 3JZHA 2XYIA 3EI2B 4GM3A 3IIYA 3OKWA 3NIDA 4ERYA 2WQ8A 3KRWB 5IC7A 2PM6B 2HU7A 3UVOA 1SQJA 5FFGA 2PBIB 4QRJA 2G99A 3DXMC 4J77A 5FKSA 3VI3A 2PM9A 2H47A 4O3UB 4ZOZA 4IRZA 1GOHA 2CO0A 3DXKC 1QNIA 4J0XA 3MMYA 2I0RA 5H1MA 5HYNB 3UKUC 2H68A 4UM8A 4A08A 2HU5A 2GC7A 4BP8A 2VDMA 4LGNA 1FWXA 2YNNA 3UVNA 3VH0A 3EI3B 1O6FA 4JSXC 3K71A 4K3ID 4Z7NA 2GC4A 4PSWB 3E0CA 3MZLA 4ERZA 5A2Qg 3GFCA 5E6RA 5M5VA 2QC5A 2B5MA 1K32A 2JKXA 4IMMA 4L3GD 5I5JA 1GOGA 5GXHA 2BBKH 4R7AB 5CXBA 1JOFA 4A2LA 2I3SA 3DM0A 5M5SA 3MKQA 4LG8A 3P4FA 5IT9g 3EMHA 3J80g 1P22A 2IUPA 3OTTA 4GGCA 1GOFA 4BCBA 1C9IA 3RMZD 4J84A 2O9KA 1UTCA 3N0EA 4FWWA 4J87A 3MXXA 1JTDB 2MTAH 3IULA 3NIGA 3C5MA 2B5NA 3L4OD 4XYHA 3AFCA 2P9IC 2GNQA 1QFMA 2H9PA 2H9MA 4WK2A 3RFHA 3EI2A 3ZDYA 5FKRA 4GM8A 1H2WA 3DSMA 5TEEA 3EI1A 4J82A 4ZOVA 3ZDZA 3JRPA 2EIBA 3PXWD 4UI9R 3BG0A 4CI1A 3GD1I 1GP2B 1L0QA 1YFQA 3SXTD 2VDOA 3O4JA 4G1EA 3OL2A 4PNKB 3SBRA 4BCCA 2AH1A 2UZYB 3EQ9A 3PXTD 1PGUA 2CNXA 3MKSB 3RRMC 5IGQA 1JMZB 3DWLC 3IUNA 1SHYB 2CN3A 4U1EI 4GQBB 2I0TA 1MDAH 3I89A 2XL2A 3MUNA 4BL0A 2H9LA 4QAMA 5EMKB 4JSPC 3OF7A 2I3TA 3VI4A 2IUQA 1U2VC 5THAA 3RN1D 3JAMg 1UOPA 5M5TA 2VDRA 2VDNA 4E5ZA 4K3JB 4MMZA 4GQ1A 4TZ4A 5KDOB 4WK4A 4O1QD 3SBQA 1GOTB 5HE0B 4NSXA 3AH8B 2EBSA 1QFSA 3UVMA 2Z2NA 4JXMA 3L4MD 3OKYA 4CY1A 5FA5B 5FXYA 4J73A 4JSVC 3MZKA 2J57G 5HE3B 2XU7A 2IURA 3NVNA 3UKRC 5I5IA 4G1MA 3W15A 4NENA 2P9LC 4AEZA 2IWFA 4AMYA 3IJ0A 2G9AA 4H5JA 4ZN4A 5H14A 5CXBB 4BUJC 2CN2A 3UR4A 2BCJB 2Z2PA 2OIZA 3IJ1A 3SWSD 3KCIA 5C2WB 1E5TA 2H14A 5C9ZB 2EIDA 4WJKA 4XYIA 3IKOA 4J86A 3IVMA 2YMUA 3F3PA 3I7NA 2QZPA 3EQ7A 4YVDA 5HE1B
chains in the Genus database with same CATH topology
2CE8A 2HKMA 4U7AA 5H17A 3FM0A 3BG1A 1VYHC 3HFQA 3PVUB 2HKRA 3CFVA 3GREA 4GGDA 4X63B 4A0BB 3JROA 1OMWB 4L3HD 2H6NA 2HESX 3SHFA 3J81g 3JZGA 4CI8A 3SMRA 3VA6A 1XKSA 4CI2A 4GMBA 1A0RB 1K8KC 1Q47A 4ESGA 5IJ7E 1N6DA 1PEVA 1ERJA 4O3TB 2Q7QA 4X3EA 3RFGA 2XL3A 4GZ8A 4L9OA 3EI4B 5CYKA 3EI3A 4O9DA 3SLED 5EM2B 5I5MA 4FHLA 4J8BA 4FA1D 5C2VB 1MG2A 3OKYB 1N6EA 4JSNC 5FKTA 5AMSA 3PXSD 4IA9A 3I8CA 4CY3A 4FA4D 4A11A 4CI3A 2OVPB 3C9CA 2I0SA 4N14A 4A0BA 3RSEC 3SJLD 3KRXB 4CZXA 5IJ8E 4A11B 4Y7RA 3FRXA 2OJYA 3PSCB 4PC0A 3RN0D 1JJUB 1RI6A 3UVKA 3V7DB 5HQGA 4H5IA 3EWEA 5GMKn 1GG2B 2P9NC 3K27A 3OW8A 5EMLB 5HE2B 2AGWA 5CYKB 2Z2OA 4HDJA 1N6FA 5IGOA 5CXCB 3JPXA 4QL1A 3JZNA 2P9PC 2IUVA 3V9FA 5EARA 3I7HA 2YNOA 3F3GA 4JD2C 2UZXB 3EU7A 4D0KA 4ERQA 4GGAA 1MG3A 3SVWD 2HXCA 3A0FA 2P9UC 5TEFA 5GXIA 3U4YA 4ZOXA 3BWSA 3C75H 4GM9A 5EALA 1XIPA 3AL8B 2OVQB 3NVQA 4ZOYA 2PM7B 3OKTA 4OZUA 5EMJB 3I8EA 1U4CA 4FAVD 4FAND 4FA9D 3I7LA 3PSLA 2AGYA 4J8GA 3K26A 3ODTA 4XEIC 1NEXB 3AL8A 3SFZA 4CY5A 2H3XA 2H6KA 4L1QD 4PBYA 2OK6A 5CXCA 3I7KA 3N0DA 5TF2A 4JT6C 4PXWA 3AL9A 3SCYA 1PBYB 3RLMD 4A0AB 3I7PA 1PI6A 2AGXA 2AGZA 2TRCB 3JB9L 2B5LA 2H9NA 2IAAA 4G56B 3I2NA 2YBAA 1OLZA 4QQEA 4LG9A 2AQ5A 3C99A 5FKQA 3IIWA 4AOWA 2CE9A 3SBPA 4A7JA 2B4EA 2J55H 5B4WA 5SXMA 2HJ4A 4FB1D 4X60B 3CFSB 4A2MA 4J79A 2P9KC 3FGBA 4MK0B 1B9XA 3ORVD 3ZWLB 4GQ2P 5GSAA 4A09A 4PBZA 1SQ9A 5AJAA 4E5ZB 5EMMB 4CZYA 4QT8A 4Y5RD 4JT5C 3NVXA 2IWKA 2AH0A 4E54A 2QXVA 4D6VA 3V5WB 5AFU3 1R5MA 1TBGA 4FA5D 4BH6A 5TDHB 2OK4A 4PSXB 4X61B 2AGLA 4Z8LA 1NR0A 1B9YA 4E54B 2W18A 2PM9B 5FLXg 5EM2A 2J56H 1GXRA 3F3FA 4O45A 3EI4A 3B7FA 3PE7A 3UVLA 2H13A 5JWZA 4I79A 5EAMA 3EI1B 4A08B 2YB8B 4EWRA 4OWRA 2H6QA 2CO0C 4CY2A 3SN6B 4J0WA 5FQDA 3VGZA 4CZVA 3CIKB 2P9SC 4A0AA 3PVWB 3ULEC 3IJCA 3OL2B 4A09B 1S4UX 3EG6A 5EAPA 1XHMA 2OVRB 5K1CC 1TYQC 4KFMB 4J81A 1JMXB 5K19A 4J78A 2HJBA 4CC9A 3I7OA 4ES0A 2YNPA 2HYEA 3JZHA 2XYIA 3EI2B 4GM3A 3IIYA 3OKWA 4ERYA 3KRWB 5IC7A 2PM6B 3UVOA 1SQJA 2PBIB 4QRJA 2G99A 3DXMC 4J77A 5FKSA 2PM9A 2H47A 4O3UB 4ZOZA 2CO0A 3DXKC 1QNIA 4J0XA 3MMYA 2I0RA 5H1MA 5HYNB 3UKUC 2H68A 4A08A 2GC7A 4LGNA 1FWXA 2YNNA 3UVNA 3VH0A 3EI3B 4JSXC 4K3ID 2GC4A 4PSWB 3E0CA 3MZLA 4ERZA 5A2Qg 3GFCA 2QC5A 2B5MA 1K32A 4IMMA 4L3GD 5I5JA 5GXHA 2BBKH 4R7AB 5CXBA 1JOFA 4A2LA 2I3SA 3DM0A 3MKQA 4LG8A 3P4FA 5IT9g 3EMHA 3J80g 1P22A 2IUPA 3OTTA 4GGCA 3RMZD 4J84A 2O9KA 3N0EA 4FWWA 4J87A 3MXXA 2MTAH 3C5MA 2B5NA 3L4OD 4XYHA 3AFCA 2P9IC 2GNQA 2H9PA 2H9MA 3RFHA 3EI2A 5FKRA 4GM8A 3DSMA 5TEEA 3EI1A 4J82A 4ZOVA 3JRPA 3PXWD 4UI9R 3BG0A 4CI1A 1GP2B 1L0QA 1YFQA 3SXTD 3OL2A 4PNKB 3SBRA 2AH1A 2UZYB 3PXTD 1PGUA 2CNXA 3MKSB 3RRMC 5IGQA 1JMZB 3DWLC 1SHYB 2CN3A 4U1EI 4GQBB 2I0TA 1MDAH 3I89A 2XL2A 4BL0A 2H9LA 5EMKB 4JSPC 2I3TA 2IUQA 1U2VC 5THAA 3RN1D 3JAMg 4E5ZA 4K3JB 5KDOB 4GQ1A 4TZ4A 4O1QD 3SBQA 1GOTB 5HE0B 4NSXA 3AH8B 2EBSA 3UVMA 2Z2NA 4JXMA 3L4MD 3OKYA 4CY1A 5FA5B 5FXYA 4J73A 4JSVC 3MZKA 2J57G 5HE3B 2XU7A 2IURA 3NVNA 3UKRC 5I5IA 3W15A 2P9LC 4AEZA 2IWFA 3IJ0A 2G9AA 4H5JA 4ZN4A 5H14A 5CXBB 4BUJC 2CN2A 3UR4A 2BCJB 2Z2PA 2OIZA 3IJ1A 3SWSD 5C2WB 2H14A 5C9ZB 4XYIA 3IKOA 4J86A 2YMUA 3F3PA 3I7NA 4YVDA 5HE1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CE8 A;  2HKM A;  4U7A A;  5H17 A;  3FM0 A;  3BG1 A;  1VYH C;  3HFQ A;  3PVU B;  2HKR A;  3CFV A;  3GRE A;  4GGD A;  4X63 B;  4A0B B;  3JRO A;  1OMW B;  4L3H D;  2H6N A;  2HES X;  3SHF A;  3J81 g;  3JZG A;  4CI8 A;  3SMR A;  3VA6 A;  1XKS A;  4CI2 A;  4GMB A;  1A0R B;  1K8K C;  1Q47 A;  4ESG A;  5IJ7 E;  1N6D A;  1PEV A;  1ERJ A;  4O3T B;  2Q7Q A;  4X3E A;  3RFG A;  2XL3 A;  4GZ8 A;  4L9O A;  3EI4 B;  5CYK A;  3EI3 A;  4O9D A;  3SLE D;  5EM2 B;  5I5M A;  4FHL A;  4J8B A;  4FA1 D;  5C2V B;  1MG2 A;  3OKY B;  1N6E A;  4JSN C;  5FKT A;  5AMS A;  3PXS D;  4IA9 A;  3I8C A;  4CY3 A;  4FA4 D;  4A11 A;  4CI3 A;  2OVP B;  3C9C A;  2I0S A;  4N14 A;  4A0B A;  3RSE C;  3SJL D;  3KRX B;  4CZX A;  5IJ8 E;  4A11 B;  4Y7R A;  3FRX A;  2OJY A;  3PSC B;  4PC0 A;  3RN0 D;  1JJU B;  1RI6 A;  3UVK A;  3V7D B;  5HQG A;  4H5I A;  3EWE A;  5GMK n;  1GG2 B;  2P9N C;  3K27 A;  3OW8 A;  5EML B;  5HE2 B;  2AGW A;  5CYK B;  2Z2O A;  4HDJ A;  1N6F A;  5IGO A;  5CXC B;  3JPX A;  4QL1 A;  3JZN A;  2P9P C;  2IUV A;  3V9F A;  5EAR A;  3I7H A;  2YNO A;  3F3G A;  4JD2 C;  2UZX B;  3EU7 A;  4D0K A;  4ERQ A;  4GGA A;  1MG3 A;  3SVW D;  2HXC A;  3A0F A;  2P9U C;  5TEF A;  5GXI A;  3U4Y A;  4ZOX A;  3BWS A;  3C75 H;  4GM9 A;  5EAL A;  1XIP A;  3AL8 B;  2OVQ B;  3NVQ A;  4ZOY A;  2PM7 B;  3OKT A;  4OZU A;  5EMJ B;  3I8E A;  1U4C A;  4FAV D;  4FAN D;  4FA9 D;  3I7L A;  3PSL A;  2AGY A;  4J8G A;  3K26 A;  3ODT A;  4XEI C;  1NEX B;  3AL8 A;  3SFZ A;  4CY5 A;  2H3X A;  2H6K A;  4L1Q D;  4PBY A;  2OK6 A;  5CXC A;  3I7K A;  3N0D A;  5TF2 A;  4JT6 C;  4PXW A;  3AL9 A;  3SCY A;  1PBY B;  3RLM D;  4A0A B;  3I7P A;  1PI6 A;  2AGX A;  2AGZ A;  2TRC B;  3JB9 L;  2B5L A;  2H9N A;  2IAA A;  4G56 B;  3I2N A;  2YBA A;  1OLZ A;  4QQE A;  4LG9 A;  2AQ5 A;  3C99 A;  5FKQ A;  3IIW A;  4AOW A;  2CE9 A;  3SBP A;  4A7J A;  2B4E A;  2J55 H;  5B4W A;  5SXM A;  2HJ4 A;  4FB1 D;  4X60 B;  3CFS B;  4A2M A;  4J79 A;  2P9K C;  3FGB A;  4MK0 B;  1B9X A;  3ORV D;  3ZWL B;  4GQ2 P;  5GSA A;  4A09 A;  4PBZ A;  1SQ9 A;  5AJA A;  4E5Z B;  5EMM B;  4CZY A;  4QT8 A;  4Y5R D;  4JT5 C;  3NVX A;  2IWK A;  2AH0 A;  4E54 A;  2QXV A;  4D6V A;  3V5W B;  5AFU 3;  1R5M A;  1TBG A;  4FA5 D;  4BH6 A;  5TDH B;  2OK4 A;  4PSX B;  4X61 B;  2AGL A;  4Z8L A;  1NR0 A;  1B9Y A;  4E54 B;  2W18 A;  2PM9 B;  5FLX g;  5EM2 A;  2J56 H;  1GXR A;  3F3F A;  4O45 A;  3EI4 A;  3B7F A;  3PE7 A;  3UVL A;  2H13 A;  5JWZ A;  4I79 A;  5EAM A;  3EI1 B;  4A08 B;  2YB8 B;  4EWR A;  4OWR A;  2H6Q A;  2CO0 C;  4CY2 A;  3SN6 B;  4J0W A;  5FQD A;  3VGZ A;  4CZV A;  3CIK B;  2P9S C;  4A0A A;  3PVW B;  3ULE C;  3IJC A;  3OL2 B;  4A09 B;  1S4U X;  3EG6 A;  5EAP A;  1XHM A;  2OVR B;  5K1C C;  1TYQ C;  4KFM B;  4J81 A;  1JMX B;  5K19 A;  4J78 A;  2HJB A;  4CC9 A;  3I7O A;  4ES0 A;  2YNP A;  2HYE A;  3JZH A;  2XYI A;  3EI2 B;  4GM3 A;  3IIY A;  3OKW A;  4ERY A;  3KRW B;  5IC7 A;  2PM6 B;  3UVO A;  1SQJ A;  2PBI B;  4QRJ A;  2G99 A;  3DXM C;  4J77 A;  5FKS A;  2PM9 A;  2H47 A;  4O3U B;  4ZOZ A;  2CO0 A;  3DXK C;  1QNI A;  4J0X A;  3MMY A;  2I0R A;  5H1M A;  5HYN B;  3UKU C;  2H68 A;  4A08 A;  2GC7 A;  4LGN A;  1FWX A;  2YNN A;  3UVN A;  3VH0 A;  3EI3 B;  4JSX C;  4K3I D;  2GC4 A;  4PSW B;  3E0C A;  3MZL A;  4ERZ A;  5A2Q g;  3GFC A;  2QC5 A;  2B5M A;  1K32 A;  4IMM A;  4L3G D;  5I5J A;  5GXH A;  2BBK H;  4R7A B;  5CXB A;  1JOF A;  4A2L A;  2I3S A;  3DM0 A;  3MKQ A;  4LG8 A;  3P4F A;  5IT9 g;  3EMH A;  3J80 g;  1P22 A;  2IUP A;  3OTT A;  4GGC A;  3RMZ D;  4J84 A;  2O9K A;  3N0E A;  4FWW A;  4J87 A;  3MXX A;  2MTA H;  3C5M A;  2B5N A;  3L4O D;  4XYH A;  3AFC A;  2P9I C;  2GNQ A;  2H9P A;  2H9M A;  3RFH A;  3EI2 A;  5FKR A;  4GM8 A;  3DSM A;  5TEE A;  3EI1 A;  4J82 A;  4ZOV A;  3JRP A;  3PXW D;  4UI9 R;  3BG0 A;  4CI1 A;  1GP2 B;  1L0Q A;  1YFQ A;  3SXT D;  3OL2 A;  4PNK B;  3SBR A;  2AH1 A;  2UZY B;  3PXT D;  1PGU A;  2CNX A;  3MKS B;  3RRM C;  5IGQ A;  1JMZ B;  3DWL C;  1SHY B;  2CN3 A;  4U1E I;  4GQB B;  2I0T A;  1MDA H;  3I89 A;  2XL2 A;  4BL0 A;  2H9L A;  5EMK B;  4JSP C;  2I3T A;  2IUQ A;  1U2V C;  5THA A;  3RN1 D;  3JAM g;  4E5Z A;  4K3J B;  5KDO B;  4GQ1 A;  4TZ4 A;  4O1Q D;  3SBQ A;  1GOT B;  5HE0 B;  4NSX A;  3AH8 B;  2EBS A;  3UVM A;  2Z2N A;  4JXM A;  3L4M D;  3OKY A;  4CY1 A;  5FA5 B;  5FXY A;  4J73 A;  4JSV C;  3MZK A;  2J57 G;  5HE3 B;  2XU7 A;  2IUR A;  3NVN A;  3UKR C;  5I5I A;  3W15 A;  2P9L C;  4AEZ A;  2IWF A;  3IJ0 A;  2G9A A;  4H5J A;  4ZN4 A;  5H14 A;  5CXB B;  4BUJ C;  2CN2 A;  3UR4 A;  2BCJ B;  2Z2P A;  2OIZ A;  3IJ1 A;  3SWS D;  5C2W B;  2H14 A;  5C9Z B;  4XYI A;  3IKO A;  4J86 A;  2YMU A;  3F3P A;  3I7N A;  4YVD A;  5HE1 B; 
#chains in the Genus database with same CATH topology
 2CE8 A;  2HKM A;  4U7A A;  5H17 A;  3O4H A;  3FM0 A;  3BG1 A;  1VYH C;  3HFQ A;  3PVU B;  2BKL A;  2HKR A;  2VZ1 A;  4AMZ A;  3CFV A;  3GRE A;  4GGD A;  4X63 B;  4A0B B;  3JRO A;  1I2M B;  1OMW B;  4L3H D;  2H6N A;  2HES X;  3SHF A;  3J81 g;  3JZG A;  4CI8 A;  3SMR A;  3VA6 A;  3ZE0 A;  4Z7Q A;  1VZ3 A;  1XKS A;  4CI2 A;  4GMB A;  1A0R B;  1K8K C;  1Q47 A;  4ESG A;  5IJ7 E;  1N6D A;  1U8C A;  1PEV A;  3V4V A;  1ERJ A;  2XDW A;  4O3T B;  2Q7Q A;  4L1M A;  4X3E A;  3RFG A;  2XL3 A;  4GZ8 A;  4L9O A;  3EI4 B;  5CYK A;  3EI3 A;  4O9D A;  3SLE D;  5EM2 B;  5I5M A;  4FHL A;  4J8B A;  4FA1 D;  5C2V B;  3OKY B;  1MG2 A;  1N6E A;  4JSN C;  5FKT A;  3FCU A;  5E6S A;  5AMS A;  3PXS D;  4IA9 A;  3I8C A;  4CY3 A;  3QHY B;  4A11 A;  4FA4 D;  4AN1 A;  3O4I A;  4CI3 A;  2OVP B;  3C9C A;  2I0S A;  4N14 A;  2VDL A;  4A0B A;  3IJE A;  3NIF A;  3RSE C;  3SJL D;  3KRX B;  3ZE1 A;  3MVD K;  4RE6 A;  2VC2 A;  4CZX A;  5IJ8 E;  1H2Y A;  4A11 B;  4Y7R A;  1UOQ A;  3FRX A;  2OJY A;  3PSC B;  4PC0 A;  5M61 A;  1JJU B;  1RI6 A;  3RN0 D;  3UVK A;  3FCS A;  3V7D B;  4BP9 A;  1O6G A;  5HQG A;  4H5I A;  3T3P A;  3GC3 B;  3IUQ A;  3EWE A;  5GMK n;  1GG2 B;  1TYE A;  2P9N C;  3K27 A;  3OW8 A;  5EML B;  4NBM A;  3DDU A;  5HE2 B;  2AGW A;  5CYK B;  1E8M A;  2Z2O A;  3IUM A;  1L5G A;  4HDJ A;  1N6F A;  5IGO A;  2XE4 A;  5CXC B;  3IUR A;  3JPX A;  4QL1 A;  3JZN A;  3ZDX A;  2P9P C;  2IUV A;  3V9F A;  5EAR A;  3I7H A;  2YNO A;  3F3G A;  4DNW A;  4JD2 C;  2UZX B;  3EU7 A;  4NAA A;  4D0K A;  4ERQ A;  4GGA A;  1MG3 A;  3SVW D;  2HXC A;  3A0F A;  2P9U C;  5TEF A;  5GXI A;  1K3I A;  3U4Y A;  4ZOX A;  1BPO A;  3BWS A;  2VDK A;  3EQ8 A;  3C75 H;  4GM9 A;  5EAL A;  1XIP A;  3K6S A;  3AL8 B;  2OVQ B;  3NVQ A;  4ZOY A;  2PM7 B;  3OKT A;  4OZU A;  2VZ3 A;  5EMJ B;  3I8E A;  1U4C A;  4FAV D;  5C92 A;  4FAN D;  4UM9 A;  4FA9 D;  4D9S A;  1VZ2 A;  3I7L A;  3PSL A;  2AGY A;  4WK0 A;  4J8G A;  3K26 A;  3O4G A;  3ODT A;  3IUJ A;  4XEI C;  1NEX B;  3AL8 A;  2VDQ A;  3SFZ A;  2XZG A;  4CY5 A;  2H3X A;  2HU8 A;  2H6K A;  4L1Q D;  4PBY A;  1H2X A;  2OK6 A;  5CXC A;  5C86 A;  3I7K A;  3N0D A;  5TF2 A;  4JT6 C;  4PXW A;  5FFO A;  3AL9 A;  3SCY A;  1PBY B;  3RLM D;  4A0A B;  3I7P A;  1PI6 A;  2AGX A;  2AGZ A;  2TRC B;  3JB9 L;  2B5L A;  2H9N A;  2IAA A;  4G56 B;  3I2N A;  2YBA A;  1OLZ A;  2QR5 A;  4QQE A;  3V4P A;  4Z7O A;  4LG9 A;  2AQ5 A;  3C99 A;  5FKQ A;  3IIW A;  4AOW A;  2CE9 A;  3SBP A;  4A7J A;  2B4E A;  2J55 H;  4G55 A;  5B4W A;  5SXM A;  4RE5 A;  4AN0 A;  2HJ4 A;  4FB1 D;  4X60 B;  3CFS B;  4A2M A;  4J79 A;  4BCD A;  1H2Z A;  2P9K C;  4NC4 A;  3FGB A;  4MK0 B;  1B9X A;  4O2W A;  2VDP A;  3ORV D;  4MMX A;  3ZWL B;  4GQ2 P;  1E8N A;  5GSA A;  4A09 A;  4PBZ A;  1SQ9 A;  5AJA A;  3MUO A;  5EMM B;  4E5Z B;  4CZY A;  1T2X A;  1VE6 A;  4MMY A;  3ZE2 A;  4QT8 A;  4Y5R D;  4JT5 C;  3NVX A;  2IWK A;  2EIE A;  3QI0 A;  2AH0 A;  4E54 A;  2QXV A;  5M5U A;  4AX4 A;  4D6V A;  3V5W B;  5AFU 3;  1R5M A;  1TBG A;  4FA5 D;  1UOO A;  4BH6 A;  5TDH B;  2OK4 A;  4PSX B;  1C9L A;  4X61 B;  2AGL A;  4Z8L A;  1NR0 A;  1B9Y A;  4E54 B;  2W18 A;  2PM9 B;  5FLX g;  5EM2 A;  2J56 H;  1GXR A;  3F3F A;  4O45 A;  1YR2 A;  3EI4 A;  4O02 A;  4DNU A;  3B7F A;  3PE7 A;  3UVL A;  2H13 A;  5JWZ A;  4I79 A;  5EAM A;  3EI1 B;  4A08 B;  2YB8 B;  1JV2 A;  4EWR A;  4OWR A;  1VE7 A;  2CO0 C;  2H6Q A;  4CY2 A;  4DNV A;  3SN6 B;  5E6U A;  4J0W A;  5FQD A;  3VGZ A;  4CZV A;  3T3M A;  3CIK B;  2P9S C;  4A0A A;  3PVW B;  4JHP C;  3ULE C;  3K72 A;  1M1X A;  2EIC A;  3IJC A;  3OL2 B;  4JHN A;  4A09 B;  1S4U X;  3EG6 A;  5EAP A;  1A12 A;  1XHM A;  2OVR B;  5HDB A;  5K1C C;  1TYQ C;  4KFM B;  4J81 A;  1JMX B;  5K19 A;  4J78 A;  2HJB A;  5M5R A;  4CC9 A;  3I7O A;  4ES0 A;  2YNP A;  2HYE A;  3JZH A;  2XYI A;  3EI2 B;  4GM3 A;  3IIY A;  3OKW A;  3NID A;  4ERY A;  2WQ8 A;  3KRW B;  5IC7 A;  2PM6 B;  2HU7 A;  3UVO A;  1SQJ A;  5FFG A;  2PBI B;  4QRJ A;  2G99 A;  3DXM C;  4J77 A;  5FKS A;  3VI3 A;  2PM9 A;  2H47 A;  4O3U B;  4ZOZ A;  4IRZ A;  1GOH A;  2CO0 A;  3DXK C;  1QNI A;  4J0X A;  3MMY A;  2I0R A;  5H1M A;  5HYN B;  3UKU C;  2H68 A;  4UM8 A;  4A08 A;  2HU5 A;  2GC7 A;  4BP8 A;  2VDM A;  4LGN A;  1FWX A;  2YNN A;  3UVN A;  3VH0 A;  3EI3 B;  1O6F A;  4JSX C;  3K71 A;  4K3I D;  4Z7N A;  2GC4 A;  4PSW B;  3E0C A;  3MZL A;  4ERZ A;  5A2Q g;  3GFC A;  5E6R A;  5M5V A;  2QC5 A;  2B5M A;  1K32 A;  2JKX A;  4IMM A;  4L3G D;  5I5J A;  1GOG A;  5GXH A;  2BBK H;  4R7A B;  5CXB A;  1JOF A;  4A2L A;  2I3S A;  3DM0 A;  5M5S A;  3MKQ A;  4LG8 A;  3P4F A;  5IT9 g;  3EMH A;  3J80 g;  1P22 A;  2IUP A;  3OTT A;  4GGC A;  1GOF A;  4BCB A;  1C9I A;  3RMZ D;  4J84 A;  2O9K A;  1UTC A;  3N0E A;  4FWW A;  4J87 A;  3MXX A;  1JTD B;  2MTA H;  3IUL A;  3NIG A;  3C5M A;  2B5N A;  3L4O D;  4XYH A;  3AFC A;  2P9I C;  2GNQ A;  1QFM A;  2H9P A;  2H9M A;  4WK2 A;  3RFH A;  3EI2 A;  3ZDY A;  5FKR A;  4GM8 A;  1H2W A;  3DSM A;  5TEE A;  3EI1 A;  4J82 A;  4ZOV A;  3ZDZ A;  3JRP A;  2EIB A;  3PXW D;  4UI9 R;  3BG0 A;  4CI1 A;  3GD1 I;  1GP2 B;  1L0Q A;  1YFQ A;  3SXT D;  2VDO A;  3O4J A;  4G1E A;  3OL2 A;  4PNK B;  3SBR A;  4BCC A;  2AH1 A;  2UZY B;  3EQ9 A;  3PXT D;  1PGU A;  2CNX A;  3MKS B;  3RRM C;  5IGQ A;  1JMZ B;  3DWL C;  3IUN A;  1SHY B;  2CN3 A;  4U1E I;  4GQB B;  2I0T A;  1MDA H;  3I89 A;  2XL2 A;  3MUN A;  4BL0 A;  2H9L A;  4QAM A;  5EMK B;  4JSP C;  3OF7 A;  2I3T A;  3VI4 A;  2IUQ A;  1U2V C;  5THA A;  3RN1 D;  3JAM g;  1UOP A;  5M5T A;  2VDR A;  2VDN A;  4E5Z A;  4K3J B;  4MMZ A;  4GQ1 A;  4TZ4 A;  5KDO B;  4WK4 A;  4O1Q D;  3SBQ A;  1GOT B;  5HE0 B;  4NSX A;  3AH8 B;  2EBS A;  1QFS A;  3UVM A;  2Z2N A;  4JXM A;  3L4M D;  3OKY A;  4CY1 A;  5FA5 B;  5FXY A;  4J73 A;  4JSV C;  3MZK A;  2J57 G;  5HE3 B;  2XU7 A;  2IUR A;  3NVN A;  3UKR C;  5I5I A;  4G1M A;  3W15 A;  4NEN A;  2P9L C;  4AEZ A;  2IWF A;  4AMY A;  3IJ0 A;  2G9A A;  4H5J A;  4ZN4 A;  5H14 A;  5CXB B;  4BUJ C;  2CN2 A;  3UR4 A;  2BCJ B;  2Z2P A;  2OIZ A;  3IJ1 A;  3SWS D;  3KCI A;  5C2W B;  1E5T A;  2H14 A;  5C9Z B;  2EID A;  4WJK A;  4XYI A;  3IKO A;  4J86 A;  3IVM A;  2YMU A;  3F3P A;  3I7N A;  2QZP A;  3EQ7 A;  4YVD A;  5HE1 B; 
#chains in the Genus database with same CATH homology
 2CE8 A;  2HKM A;  4U7A A;  5H17 A;  3FM0 A;  3BG1 A;  1VYH C;  3HFQ A;  3PVU B;  2HKR A;  3CFV A;  3GRE A;  4GGD A;  4X63 B;  4A0B B;  3JRO A;  1OMW B;  4L3H D;  2H6N A;  2HES X;  3SHF A;  3J81 g;  3JZG A;  4CI8 A;  3SMR A;  3VA6 A;  1XKS A;  4CI2 A;  4GMB A;  1A0R B;  1K8K C;  1Q47 A;  4ESG A;  5IJ7 E;  1N6D A;  1PEV A;  1ERJ A;  4O3T B;  2Q7Q A;  4X3E A;  3RFG A;  2XL3 A;  4GZ8 A;  4L9O A;  3EI4 B;  5CYK A;  3EI3 A;  4O9D A;  3SLE D;  5EM2 B;  5I5M A;  4FHL A;  4J8B A;  4FA1 D;  5C2V B;  1MG2 A;  3OKY B;  1N6E A;  4JSN C;  5FKT A;  5AMS A;  3PXS D;  4IA9 A;  3I8C A;  4CY3 A;  4FA4 D;  4A11 A;  4CI3 A;  2OVP B;  3C9C A;  2I0S A;  4N14 A;  4A0B A;  3RSE C;  3SJL D;  3KRX B;  4CZX A;  5IJ8 E;  4A11 B;  4Y7R A;  3FRX A;  2OJY A;  3PSC B;  4PC0 A;  3RN0 D;  1JJU B;  1RI6 A;  3UVK A;  3V7D B;  5HQG A;  4H5I A;  3EWE A;  5GMK n;  1GG2 B;  2P9N C;  3K27 A;  3OW8 A;  5EML B;  5HE2 B;  2AGW A;  5CYK B;  2Z2O A;  4HDJ A;  1N6F A;  5IGO A;  5CXC B;  3JPX A;  4QL1 A;  3JZN A;  2P9P C;  2IUV A;  3V9F A;  5EAR A;  3I7H A;  2YNO A;  3F3G A;  4JD2 C;  2UZX B;  3EU7 A;  4D0K A;  4ERQ A;  4GGA A;  1MG3 A;  3SVW D;  2HXC A;  3A0F A;  2P9U C;  5TEF A;  5GXI A;  3U4Y A;  4ZOX A;  3BWS A;  3C75 H;  4GM9 A;  5EAL A;  1XIP A;  3AL8 B;  2OVQ B;  3NVQ A;  4ZOY A;  2PM7 B;  3OKT A;  4OZU A;  5EMJ B;  3I8E A;  1U4C A;  4FAV D;  4FAN D;  4FA9 D;  3I7L A;  3PSL A;  2AGY A;  4J8G A;  3K26 A;  3ODT A;  4XEI C;  1NEX B;  3AL8 A;  3SFZ A;  4CY5 A;  2H3X A;  2H6K A;  4L1Q D;  4PBY A;  2OK6 A;  5CXC A;  3I7K A;  3N0D A;  5TF2 A;  4JT6 C;  4PXW A;  3AL9 A;  3SCY A;  1PBY B;  3RLM D;  4A0A B;  3I7P A;  1PI6 A;  2AGX A;  2AGZ A;  2TRC B;  3JB9 L;  2B5L A;  2H9N A;  2IAA A;  4G56 B;  3I2N A;  2YBA A;  1OLZ A;  4QQE A;  4LG9 A;  2AQ5 A;  3C99 A;  5FKQ A;  3IIW A;  4AOW A;  2CE9 A;  3SBP A;  4A7J A;  2B4E A;  2J55 H;  5B4W A;  5SXM A;  2HJ4 A;  4FB1 D;  4X60 B;  3CFS B;  4A2M A;  4J79 A;  2P9K C;  3FGB A;  4MK0 B;  1B9X A;  3ORV D;  3ZWL B;  4GQ2 P;  5GSA A;  4A09 A;  4PBZ A;  1SQ9 A;  5AJA A;  4E5Z B;  5EMM B;  4CZY A;  4QT8 A;  4Y5R D;  4JT5 C;  3NVX A;  2IWK A;  2AH0 A;  4E54 A;  2QXV A;  4D6V A;  3V5W B;  5AFU 3;  1R5M A;  1TBG A;  4FA5 D;  4BH6 A;  5TDH B;  2OK4 A;  4PSX B;  4X61 B;  2AGL A;  4Z8L A;  1NR0 A;  1B9Y A;  4E54 B;  2W18 A;  2PM9 B;  5FLX g;  5EM2 A;  2J56 H;  1GXR A;  3F3F A;  4O45 A;  3EI4 A;  3B7F A;  3PE7 A;  3UVL A;  2H13 A;  5JWZ A;  4I79 A;  5EAM A;  3EI1 B;  4A08 B;  2YB8 B;  4EWR A;  4OWR A;  2H6Q A;  2CO0 C;  4CY2 A;  3SN6 B;  4J0W A;  5FQD A;  3VGZ A;  4CZV A;  3CIK B;  2P9S C;  4A0A A;  3PVW B;  3ULE C;  3IJC A;  3OL2 B;  4A09 B;  1S4U X;  3EG6 A;  5EAP A;  1XHM A;  2OVR B;  5K1C C;  1TYQ C;  4KFM B;  4J81 A;  1JMX B;  5K19 A;  4J78 A;  2HJB A;  4CC9 A;  3I7O A;  4ES0 A;  2YNP A;  2HYE A;  3JZH A;  2XYI A;  3EI2 B;  4GM3 A;  3IIY A;  3OKW A;  4ERY A;  3KRW B;  5IC7 A;  2PM6 B;  3UVO A;  1SQJ A;  2PBI B;  4QRJ A;  2G99 A;  3DXM C;  4J77 A;  5FKS A;  2PM9 A;  2H47 A;  4O3U B;  4ZOZ A;  2CO0 A;  3DXK C;  1QNI A;  4J0X A;  3MMY A;  2I0R A;  5H1M A;  5HYN B;  3UKU C;  2H68 A;  4A08 A;  2GC7 A;  4LGN A;  1FWX A;  2YNN A;  3UVN A;  3VH0 A;  3EI3 B;  4JSX C;  4K3I D;  2GC4 A;  4PSW B;  3E0C A;  3MZL A;  4ERZ A;  5A2Q g;  3GFC A;  2QC5 A;  2B5M A;  1K32 A;  4IMM A;  4L3G D;  5I5J A;  5GXH A;  2BBK H;  4R7A B;  5CXB A;  1JOF A;  4A2L A;  2I3S A;  3DM0 A;  3MKQ A;  4LG8 A;  3P4F A;  5IT9 g;  3EMH A;  3J80 g;  1P22 A;  2IUP A;  3OTT A;  4GGC A;  3RMZ D;  4J84 A;  2O9K A;  3N0E A;  4FWW A;  4J87 A;  3MXX A;  2MTA H;  3C5M A;  2B5N A;  3L4O D;  4XYH A;  3AFC A;  2P9I C;  2GNQ A;  2H9P A;  2H9M A;  3RFH A;  3EI2 A;  5FKR A;  4GM8 A;  3DSM A;  5TEE A;  3EI1 A;  4J82 A;  4ZOV A;  3JRP A;  3PXW D;  4UI9 R;  3BG0 A;  4CI1 A;  1GP2 B;  1L0Q A;  1YFQ A;  3SXT D;  3OL2 A;  4PNK B;  3SBR A;  2AH1 A;  2UZY B;  3PXT D;  1PGU A;  2CNX A;  3MKS B;  3RRM C;  5IGQ A;  1JMZ B;  3DWL C;  1SHY B;  2CN3 A;  4U1E I;  4GQB B;  2I0T A;  1MDA H;  3I89 A;  2XL2 A;  4BL0 A;  2H9L A;  5EMK B;  4JSP C;  2I3T A;  2IUQ A;  1U2V C;  5THA A;  3RN1 D;  3JAM g;  4E5Z A;  4K3J B;  5KDO B;  4GQ1 A;  4TZ4 A;  4O1Q D;  3SBQ A;  1GOT B;  5HE0 B;  4NSX A;  3AH8 B;  2EBS A;  3UVM A;  2Z2N A;  4JXM A;  3L4M D;  3OKY A;  4CY1 A;  5FA5 B;  5FXY A;  4J73 A;  4JSV C;  3MZK A;  2J57 G;  5HE3 B;  2XU7 A;  2IUR A;  3NVN A;  3UKR C;  5I5I A;  3W15 A;  2P9L C;  4AEZ A;  2IWF A;  3IJ0 A;  2G9A A;  4H5J A;  4ZN4 A;  5H14 A;  5CXB B;  4BUJ C;  2CN2 A;  3UR4 A;  2BCJ B;  2Z2P A;  2OIZ A;  3IJ1 A;  3SWS D;  5C2W B;  2H14 A;  5C9Z B;  4XYI A;  3IKO A;  4J86 A;  2YMU A;  3F3P A;  3I7N A;  4YVD A;  5HE1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...