2CO0A

Wdr5 and unmodified histone h3 complex at 2.25 angstrom
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
304
structure length
304
Chain Sequence
VKPNYALMFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGMCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNDLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD-REPEAT PROTEIN 5
publication title Histone H3 Recognition and Presentation by the Wdr5 Module of the Mll1 Complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 100
structure length 304
sequence length 304
ec nomenclature
pdb deposition date 2006-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2co0A00
1XKSA 4CZXA 2H68A 5SXMA 2XU7A 1MG3A 1FWXA 2AH1A 1PI6A 3V5WB 4BUJC 3ULEC 4E5ZB 4PSXB 2IUVA 3A0FA 4L1QD 4ESGA 2OVQB 1JMXB 3MKQA 2GNQA 3FRXA 3JZGA 3I7NA 1TBGA 3RMZD 5HE0B 2Z2NA 2AH0A 3N0DA 3I7OA 5CYKA 4CI1A 1GXRA 3DSMA 5EMJB 4I79A 4CY1A 1R5MA 3VGZA 4ERZA 1GOTB 3IKOA 3UKRC 1OMWB 1MG2A 2H47A 2YNOA 4XYIA 4AOWA 3C75H 4FB1D 3AH8B 3EU7A 3DWLC 4ZOXA 3CFSB 4O45A 4AEZA 3RN0D 4X60B 3EI2A 1NEXB 2H9NA 4FAVD 3PVWB 3N0EA 5TDHB 3I8EA 3HFQA 5FA5B 5CXBA 4OWRA 2H9LA 4ERQA 2H14A 2I0TA 4A0AA 2IURA 3OKTA 5AMSA 3AL9A 1JJUB 4LG9A 2YNNA 4O9DA 4BH6A 4E54B 2AGYA 5GXIA 2IAAA 1TYQC 5KDOB 2H6QA 4GGAA 5B4WA 4O3TB 4LGNA 2HJBA 2QXVA 4CY5A 5IT9g 3OL2B 3V7DB 3IIYA 4A08A 5FKSA 2H13A 3SMRA 2PM9A 3EI4A 3NVXA 3GREA 2AGLA 2PM7B 4PXWA 2UZYB 3OW8A 4Y7RA 2P9UC 5AFU3 3EG6A 4ZN4A 3OTTA 2XYIA 2CO0A 3OKYB 3JRPA 4QQEA 3CIKB 3MZKA 1PGUA 2P9SC 4JSNC 3L4MD 5IGOA 3KRXB 2CN2A 3J80g 4Z8LA 1JOFA 1GG2B 4XYHA 3C9CA 4J82A 4N14A 3SCYA 3SJLD 3SFZA 3CFVA 3PXSD 2H9PA 3EI1B 3NVQA 3AL8B 5I5MA 3EI3A 3ZWLB 3RSEC 2CN3A 2B4EA 4U7AA 2P9LC 5HE1B 4L3GD 1JMZB 4A2LA 5EM2B 4O3UB 4FHLA 5THAA 2AGWA 2I3SA 1XHMA 3EI2B 1Q47A 3MZLA 5CXCB 2J55H 2HJ4A 4QT8A 5TEEA 2P9KC 4J0WA 2P9PC 4J0XA 3IJ0A 5JWZA 2GC7A 1L0QA 2PBIB 3FGBA 3F3PA 4J8BA 5TEFA 3ODTA 2HYEA 4A0BB 2OK6A 4ES0A 3BG0A 3JZNA 4PSWB 3EMHA 5H17A 2HKRA 3PSCB 2I3TA 1N6FA 4CY2A 3JB9L 4IA9A 5H1MA 2CE9A 5FKQA 4A11B 5IJ7E 5HE2B 3UVLA 4R7AB 2H9MA 1QNIA 4L3HD 2YB8B 2J57G 5HYNB 5EMKB 3GFCA 3IIWA 4PBZA 5I5JA 2P9IC 2H6KA 4A09A 2IWKA 3AFCA 5IJ8E 4E5ZA 3B7FA 3JROA 3I7KA 1SQJA 3ORVD 3PXTD 5H14A 5I5IA 4GZ8A 2W18A 5GMKn 1B9XA 3RRMC 3DXMC 3C99A 2AGXA 4CC9A 3FM0A 4CZYA 4PC0A 4GQ2P 3SBRA 5FLXg 3MKSB 2IUPA 2CNXA 3SXTD 2TRCB 3I7PA 2H6NA 3UKUC 4GQ1A 3MXXA 1B9YA 2J56H 4JD2C 3RLMD 2YMUA 4H5JA 2OJYA 4PBYA 2MTAH 4ZOVA 4JSXC 5HE3B 3SN6B 2Q7QA 5FQDA 3UVOA 4JXMA 4QRJA 2AQ5A 2HESX 3I7LA 3DM0A 2Z2PA 3SVWD 4J8GA 4J81A 2P9NC 5C9ZB 5HQGA 5AJAA 2OVRB 5IC7A 2XL3A 3BG1A 2OVPB 4GM8A 5EARA 2B5LA 4YVDA 4J79A 3SHFA 4IMMA 5CYKB 4FAND 1ERJA 5C2VB 3EWEA 4E54A 2QC5A 3I8CA 3SBQA 4CI3A 4JT6C 1GP2B 4GMBA 3RFHA 3KRWB 3SWSD 2OIZA 3OL2A 1S4UX 4UI9R 4CI2A 2OK4A 5A2Qg 1NR0A 4QL1A 1VYHC 4HDJA 5FKTA 3PE7A 3JAMg 1PBYB 1P22A 4A09B 1U4CA 4JSVC 5CXBB 3UVNA 2EBSA 4JSPC 3OKYA 4PNKB 4A0AB 4TZ4A 2YNPA 2BBKH 3E0CA 3V9FA 1SQ9A 1YFQA 2B5MA 1SHYB 3F3GA 5IGQA 4X63B 5FKRA 4H5IA 4GGDA 3UR4A 3L4OD 4OZUA 4U1EI 1OLZA 3UVMA 3SLED 4XEIC 3EI1A 4Y5RD 4J78A 3AL8A 1K8KC 3J81g 4A08B 3W15A 3PXWD 2GC4A 4EWRA 2PM9B 3EI4B 1MDAH 5EAMA 3PSLA 1XIPA 5C2WB 2HKMA 2I0RA 3JZHA 3OKWA 4LG8A 4ZOZA 5EM2A 3NVNA 4ZOYA 5CXCA 4K3JB 2CE8A 2XL2A 4CZVA 2B5NA 5FXYA 4CI8A 4MK0B 4KFMB 1N6DA 3IJCA 3JPXA 4A0BA 4L9OA 2YBAA 2PM6B 4K3ID 3VH0A 3MMYA 4CY3A 3SBPA 4GGCA 2IWFA 3EI3B 5GSAA 1A0RB 5EMMB 2G99A 3I89A 4J84A 5GXHA 1K32A 2IUQA 4ERYA 5EALA 2UZXB 4J77A 4A11A 3C5MA 2O9KA 4FA4D 4X61B 5EMLB 3U4YA 5TF2A 1PEVA 4D6VA 3K27A 2CO0C 4GM9A 2Z2OA 4GM3A 4NSXA 2H3XA 3PVUB 3VA6A 3UVKA 4O1QD 1RI6A 3K26A 4J86A 3RN1D 3F3FA 4GQBB 4FA9D 4X3EA 3P4FA 4BL0A 4D0KA 4J73A 3I7HA 5K1CC 1U2VC 5EAPA 3I2NA 5K19A 2BCJB 2HXCA 2G9AA 4A7JA 4JT5C 1N6EA 2I0SA 3IJ1A 3DXKC 3BWSA 4FWWA 4FA5D 2AGZA 4FA1D 4G56B 3RFGA 4J87A 4A2MA
chains in the Genus database with same CATH superfamily
1XKSA 4CZXA 2H68A 3MVDK 5SXMA 2XU7A 2QR5A 1MG3A 3NIGA 1FWXA 2AH1A 1PI6A 3V5WB 4BUJC 3ULEC 4E5ZB 4PSXB 2IUVA 1O6GA 3A0FA 4L1QD 4ESGA 2OVQB 1JMXB 3MKQA 2GNQA 3FRXA 3JZGA 2HU8A 1TBGA 3I7NA 1E8MA 3RMZD 5HE0B 2Z2NA 2AH0A 3N0DA 3I7OA 5CYKA 4CI1A 1GOHA 4WK0A 1GXRA 3DSMA 1A12A 5EMJB 4I79A 4CY1A 1R5MA 3VGZA 4ERZA 1GOTB 3IKOA 3UKRC 1OMWB 1MG2A 2H47A 2YNOA 4XYIA 1UOQA 4AOWA 3C75H 4G1MA 4DNWA 4FB1D 3AH8B 3GD1I 1GOGA 3EU7A 3DWLC 4UM9A 4ZOXA 3CFSB 4O45A 4AEZA 2VDOA 3RN0D 1M1XA 4X60B 3EI2A 4Z7OA 5M5RA 1NEXB 2H9NA 4FAVD 3OF7A 3PVWB 3N0EA 5TDHB 3I8EA 3HFQA 5FA5B 5CXBA 4OWRA 2H9LA 4ERQA 2H14A 2I0TA 4A0AA 2IURA 3OKTA 5AMSA 4JHPC 3ZDYA 3AL9A 1JJUB 5M5UA 4LG9A 2YNNA 4O9DA 4RE6A 4BH6A 4E54B 2AGYA 5GXIA 5HDBA 3VI3A 2IAAA 1TYQC 2VDNA 5KDOB 2H6QA 4BCBA 4GGAA 5B4WA 3NIDA 4LGNA 2HJBA 2QXVA 4O3TB 4CY5A 2VDMA 5IT9g 3OL2B 2VDQA 3V7DB 3IIYA 4A08A 5FKSA 2H13A 5FFGA 3SMRA 3MUNA 2PM9A 3EI4A 3NVXA 3GREA 2AGLA 2PM7B 2XE4A 2UZYB 3OW8A 4PXWA 4Y7RA 2P9UC 4WJKA 5AFU3 3EG6A 3IUNA 4ZN4A 4BP9A 3OTTA 2XYIA 3O4JA 2CO0A 1JTDB 3OKYB 1TYEA 3JRPA 3ZDZA 4QQEA 3IULA 3CIKB 3MZKA 1PGUA 2P9SC 4JSNC 3L4MD 5IGOA 3K6SA 1JV2A 3KRXB 2CN2A 3J80g 4Z8LA 1JOFA 1GG2B 4XYHA 2WQ8A 3C9CA 4J82A 4N14A 3SCYA 3SJLD 3SFZA 3CFVA 3PXSD 2H9PA 3EI1B 3NVQA 3AL8B 1H2ZA 3EI3A 5I5MA 4IRZA 3ZWLB 3RSEC 2CN3A 4MMYA 2B4EA 4U7AA 2P9LC 5M5VA 5HE1B 4L3GD 1JMZB 3KCIA 4NC4A 4A2LA 5EM2B 4O3UB 4FHLA 5THAA 2AGWA 2I3SA 1XHMA 4NBMA 3VI4A 3EI2B 1Q47A 1H2XA 3MZLA 5CXCB 2J55H 2HJ4A 4QT8A 5TEEA 2P9KC 4J0WA 2P9PC 4J0XA 3T3PA 3IJ0A 3V4VA 1K3IA 5JWZA 2GC7A 1L0QA 2PBIB 2XDWA 3EQ7A 3F3PA 3FGBA 3IURA 4J8BA 3ODTA 5TEFA 2HYEA 4A0BB 1UTCA 3T3MA 2OK6A 3DDUA 4ES0A 3BG0A 3ZE2A 4NAAA 3JZNA 2QZPA 3EMHA 4PSWB 2HKRA 3PSCB 5H17A 3ZDXA 2I3TA 1N6FA 4CY2A 3JB9L 4IA9A 5H1MA 2CE9A 5FKQA 4A11B 5IJ7E 5HE2B 1VE7A 4AN0A 3UVLA 2JKXA 4R7AB 2H9MA 1QNIA 4L3HD 2YB8B 2J57G 2EIEA 5HYNB 5EMKB 3GFCA 1YR2A 3IIWA 4PBZA 1C9LA 5I5JA 2P9IC 2H6KA 4NENA 1T2XA 4A09A 4G1EA 2IWKA 3O4IA 4AN1A 3AFCA 5IJ8E 4E5ZA 3B7FA 3JROA 3I7KA 3EQ8A 1SQJA 3ORVD 3PXTD 5H14A 4D9SA 2W18A 4GZ8A 5I5IA 5GMKn 1B9XA 3RRMC 3FCUA 3DXMC 3C99A 2AGXA 4CC9A 3FM0A 4CZYA 4PC0A 4GQ2P 3O4GA 3SBRA 5FLXg 3MKSB 2IUPA 4UM8A 2CNXA 5C86A 3SXTD 2TRCB 3I7PA 1VZ3A 2H6NA 3UKUC 1O6FA 4O2WA 4GQ1A 3MXXA 1L5GA 1B9YA 2J56H 4JD2C 3RLMD 1UOPA 2VDKA 2YMUA 4H5JA 2OJYA 4PBYA 2MTAH 3NIFA 4ZOVA 4JSXC 5HE3B 3SN6B 3ZE1A 4AMYA 2Q7QA 5FQDA 3UVOA 4JXMA 4QRJA 2AQ5A 2HESX 1I2MB 2VZ3A 3I7LA 3DM0A 5E6SA 2Z2PA 3SVWD 4J8GA 4J81A 3EQ9A 2EIBA 2P9NC 5C9ZB 5HQGA 5AJAA 2OVRB 5IC7A 3IUQA 2XL3A 3IUMA 3BG1A 4MMZA 2OVPB 4GM8A 5EARA 2B5LA 4YVDA 4J79A 3SHFA 4IMMA 5CYKB 4FAND 5M5SA 1E8NA 1ERJA 3FCSA 3MUOA 5C2VB 1VZ2A 3EWEA 4E54A 2QC5A 3I8CA 3SBQA 4Z7QA 4CI3A 4JT6C 1GP2B 4GMBA 4DNUA 1C9IA 3RFHA 3KRWB 3SWSD 2OIZA 3OL2A 1S4UX 4UI9R 2VZ1A 5E6UA 4CI2A 2OK4A 1QFSA 5A2Qg 1NR0A 4QL1A 3IJEA 1VYHC 4HDJA 5FKTA 3PE7A 1BPOA 3JAMg 1PBYB 1P22A 4A09B 1U4CA 4JSVC 5CXBB 3UVNA 2EBSA 4JSPC 3OKYA 3QI0A 5FFOA 4AX4A 1H2WA 4PNKB 4A0AB 4TZ4A 2YNPA 2BBKH 3E0CA 3V9FA 1SQ9A 1YFQA 2B5MA 2VC2A 1SHYB 3F3GA 5IGQA 4X63B 5FKRA 4AMZA 4H5IA 4GGDA 3UR4A 3L4OD 4OZUA 4U1EI 1OLZA 3UVMA 3SLED 4XEIC 2VDRA 3EI1A 4Y5RD 4J78A 3AL8A 3IVMA 1K8KC 3J81g 4A08B 3IUJA 3W15A 3PXWD 2GC4A 4WK4A 4EWRA 2PM9B 3EI4B 3V4PA 1MDAH 5EAMA 4BCDA 3PSLA 2VDPA 1XIPA 5C2WB 2HKMA 5M61A 2I0RA 3JZHA 3OKWA 4WK2A 4LG8A 4ZOZA 4L1MA 5EM2A 3NVNA 4ZOYA 1UOOA 5CXCA 2EIDA 4K3JB 2CE8A 2HU5A 2XL2A 4RE5A 4CZVA 2B5NA 5FXYA 4CI8A 1QFMA 5M5TA 4MK0B 1H2YA 1N6DA 2EICA 3JPXA 3IJCA 4KFMB 4A0BA 4L9OA 2YBAA 2PM6B 4K3ID 3VH0A 3MMYA 4CY3A 3SBPA 4GGCA 4BCCA 4JHNA 2IWFA 3EI3B 2HU7A 5GSAA 1A0RB 5EMMB 2G99A 3I89A 4J84A 5GXHA 1K32A 2IUQA 4ERYA 4BP8A 5EALA 2UZXB 4J77A 4A11A 3K71A 3C5MA 4G55A 2O9KA 4FA4D 4X61B 5EMLB 3U4YA 5TF2A 1PEVA 4D6VA 3K27A 2CO0C 2XZGA 4GM9A 2Z2OA 4GM3A 3GC3B 4NSXA 2H3XA 1E5TA 3PVUB 3VA6A 3UVKA 4O1QD 1RI6A 4MMXA 3K26A 4J86A 3RN1D 2VDLA 3F3FA 4GQBB 3QHYB 4FA9D 1U8CA 4X3EA 3P4FA 4BL0A 4D0KA 5C92A 4J73A 3I7HA 4DNVA 5K1CC 3O4HA 1U2VC 4QAMA 5EAPA 3K72A 3I2NA 5K19A 4Z7NA 2BCJB 2HXCA 2G9AA 4A7JA 2BKLA 3ZE0A 1N6EA 4JT5C 2I0SA 3IJ1A 4O02A 3DXKC 5E6RA 1GOFA 3BWSA 4FWWA 1VE6A 4FA5D 2AGZA 4FA1D 4G56B 3RFGA 4J87A 4A2MA
chains in the Genus database with same CATH topology
1XKSA 4CZXA 2H68A 5SXMA 2XU7A 1MG3A 1FWXA 2AH1A 1PI6A 3V5WB 4BUJC 3ULEC 4E5ZB 4PSXB 2IUVA 3A0FA 4L1QD 4ESGA 2OVQB 1JMXB 3MKQA 2GNQA 3FRXA 3JZGA 3I7NA 1TBGA 3RMZD 5HE0B 2Z2NA 2AH0A 3N0DA 3I7OA 5CYKA 4CI1A 1GXRA 3DSMA 5EMJB 4I79A 4CY1A 1R5MA 3VGZA 4ERZA 1GOTB 3IKOA 3UKRC 1OMWB 1MG2A 2H47A 2YNOA 4XYIA 4AOWA 3C75H 4FB1D 3AH8B 3EU7A 3DWLC 4ZOXA 3CFSB 4O45A 4AEZA 3RN0D 4X60B 3EI2A 1NEXB 2H9NA 4FAVD 3PVWB 3N0EA 5TDHB 3I8EA 3HFQA 5FA5B 5CXBA 4OWRA 2H9LA 4ERQA 2H14A 2I0TA 4A0AA 2IURA 3OKTA 5AMSA 3AL9A 1JJUB 4LG9A 2YNNA 4O9DA 4BH6A 4E54B 2AGYA 5GXIA 2IAAA 1TYQC 5KDOB 2H6QA 4GGAA 5B4WA 4O3TB 4LGNA 2HJBA 2QXVA 4CY5A 5IT9g 3OL2B 3V7DB 3IIYA 4A08A 5FKSA 2H13A 3SMRA 2PM9A 3EI4A 3NVXA 3GREA 2AGLA 2PM7B 4PXWA 2UZYB 3OW8A 4Y7RA 2P9UC 5AFU3 3EG6A 4ZN4A 3OTTA 2XYIA 2CO0A 3OKYB 3JRPA 4QQEA 3CIKB 3MZKA 1PGUA 2P9SC 4JSNC 3L4MD 5IGOA 3KRXB 2CN2A 3J80g 4Z8LA 1JOFA 1GG2B 4XYHA 3C9CA 4J82A 4N14A 3SCYA 3SJLD 3SFZA 3CFVA 3PXSD 2H9PA 3EI1B 3NVQA 3AL8B 5I5MA 3EI3A 3ZWLB 3RSEC 2CN3A 2B4EA 4U7AA 2P9LC 5HE1B 4L3GD 1JMZB 4A2LA 5EM2B 4O3UB 4FHLA 5THAA 2AGWA 2I3SA 1XHMA 3EI2B 1Q47A 3MZLA 5CXCB 2J55H 2HJ4A 4QT8A 5TEEA 2P9KC 4J0WA 2P9PC 4J0XA 3IJ0A 5JWZA 2GC7A 1L0QA 2PBIB 3FGBA 3F3PA 4J8BA 5TEFA 3ODTA 2HYEA 4A0BB 2OK6A 4ES0A 3BG0A 3JZNA 4PSWB 3EMHA 5H17A 2HKRA 3PSCB 2I3TA 1N6FA 4CY2A 3JB9L 4IA9A 5H1MA 2CE9A 5FKQA 4A11B 5IJ7E 5HE2B 3UVLA 4R7AB 2H9MA 1QNIA 4L3HD 2YB8B 2J57G 5HYNB 5EMKB 3GFCA 3IIWA 4PBZA 5I5JA 2P9IC 2H6KA 4A09A 2IWKA 3AFCA 5IJ8E 4E5ZA 3B7FA 3JROA 3I7KA 1SQJA 3ORVD 3PXTD 5H14A 5I5IA 4GZ8A 2W18A 5GMKn 1B9XA 3RRMC 3DXMC 3C99A 2AGXA 4CC9A 3FM0A 4CZYA 4PC0A 4GQ2P 3SBRA 5FLXg 3MKSB 2IUPA 2CNXA 3SXTD 2TRCB 3I7PA 2H6NA 3UKUC 4GQ1A 3MXXA 1B9YA 2J56H 4JD2C 3RLMD 2YMUA 4H5JA 2OJYA 4PBYA 2MTAH 4ZOVA 4JSXC 5HE3B 3SN6B 2Q7QA 5FQDA 3UVOA 4JXMA 4QRJA 2AQ5A 2HESX 3I7LA 3DM0A 2Z2PA 3SVWD 4J8GA 4J81A 2P9NC 5C9ZB 5HQGA 5AJAA 2OVRB 5IC7A 2XL3A 3BG1A 2OVPB 4GM8A 5EARA 2B5LA 4YVDA 4J79A 3SHFA 4IMMA 5CYKB 4FAND 1ERJA 5C2VB 3EWEA 4E54A 2QC5A 3I8CA 3SBQA 4CI3A 4JT6C 1GP2B 4GMBA 3RFHA 3KRWB 3SWSD 2OIZA 3OL2A 1S4UX 4UI9R 4CI2A 2OK4A 5A2Qg 1NR0A 4QL1A 1VYHC 4HDJA 5FKTA 3PE7A 3JAMg 1PBYB 1P22A 4A09B 1U4CA 4JSVC 5CXBB 3UVNA 2EBSA 4JSPC 3OKYA 4PNKB 4A0AB 4TZ4A 2YNPA 2BBKH 3E0CA 3V9FA 1SQ9A 1YFQA 2B5MA 1SHYB 3F3GA 5IGQA 4X63B 5FKRA 4H5IA 4GGDA 3UR4A 3L4OD 4OZUA 4U1EI 1OLZA 3UVMA 3SLED 4XEIC 3EI1A 4Y5RD 4J78A 3AL8A 1K8KC 3J81g 4A08B 3W15A 3PXWD 2GC4A 4EWRA 2PM9B 3EI4B 1MDAH 5EAMA 3PSLA 1XIPA 5C2WB 2HKMA 2I0RA 3JZHA 3OKWA 4LG8A 4ZOZA 5EM2A 3NVNA 4ZOYA 5CXCA 4K3JB 2CE8A 2XL2A 4CZVA 2B5NA 5FXYA 4CI8A 4MK0B 4KFMB 1N6DA 3IJCA 3JPXA 4A0BA 4L9OA 2YBAA 2PM6B 4K3ID 3VH0A 3MMYA 4CY3A 3SBPA 4GGCA 2IWFA 3EI3B 5GSAA 1A0RB 5EMMB 2G99A 3I89A 4J84A 5GXHA 1K32A 2IUQA 4ERYA 5EALA 2UZXB 4J77A 4A11A 3C5MA 2O9KA 4FA4D 4X61B 5EMLB 3U4YA 5TF2A 1PEVA 4D6VA 3K27A 2CO0C 4GM9A 2Z2OA 4GM3A 4NSXA 2H3XA 3PVUB 3VA6A 3UVKA 4O1QD 1RI6A 3K26A 4J86A 3RN1D 3F3FA 4GQBB 4FA9D 4X3EA 3P4FA 4BL0A 4D0KA 4J73A 3I7HA 5K1CC 1U2VC 5EAPA 3I2NA 5K19A 2BCJB 2HXCA 2G9AA 4A7JA 4JT5C 1N6EA 2I0SA 3IJ1A 3DXKC 3BWSA 4FWWA 4FA5D 2AGZA 4FA1D 4G56B 3RFGA 4J87A 4A2MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XKS A;  4CZX A;  2H68 A;  5SXM A;  2XU7 A;  1MG3 A;  1FWX A;  2AH1 A;  1PI6 A;  3V5W B;  4BUJ C;  3ULE C;  4E5Z B;  4PSX B;  2IUV A;  3A0F A;  4L1Q D;  4ESG A;  2OVQ B;  1JMX B;  3MKQ A;  2GNQ A;  3FRX A;  3JZG A;  3I7N A;  1TBG A;  3RMZ D;  5HE0 B;  2Z2N A;  2AH0 A;  3N0D A;  3I7O A;  5CYK A;  4CI1 A;  1GXR A;  3DSM A;  5EMJ B;  4I79 A;  4CY1 A;  1R5M A;  3VGZ A;  4ERZ A;  1GOT B;  3IKO A;  3UKR C;  1OMW B;  1MG2 A;  2H47 A;  2YNO A;  4XYI A;  4AOW A;  3C75 H;  4FB1 D;  3AH8 B;  3EU7 A;  3DWL C;  4ZOX A;  3CFS B;  4O45 A;  4AEZ A;  3RN0 D;  4X60 B;  3EI2 A;  1NEX B;  2H9N A;  4FAV D;  3PVW B;  3N0E A;  5TDH B;  3I8E A;  3HFQ A;  5FA5 B;  5CXB A;  4OWR A;  2H9L A;  4ERQ A;  2H14 A;  2I0T A;  4A0A A;  2IUR A;  3OKT A;  5AMS A;  3AL9 A;  1JJU B;  4LG9 A;  2YNN A;  4O9D A;  4BH6 A;  4E54 B;  2AGY A;  5GXI A;  2IAA A;  1TYQ C;  5KDO B;  2H6Q A;  4GGA A;  5B4W A;  4O3T B;  4LGN A;  2HJB A;  2QXV A;  4CY5 A;  5IT9 g;  3OL2 B;  3V7D B;  3IIY A;  4A08 A;  5FKS A;  2H13 A;  3SMR A;  2PM9 A;  3EI4 A;  3NVX A;  3GRE A;  2AGL A;  2PM7 B;  4PXW A;  2UZY B;  3OW8 A;  4Y7R A;  2P9U C;  5AFU 3;  3EG6 A;  4ZN4 A;  3OTT A;  2XYI A;  2CO0 A;  3OKY B;  3JRP A;  4QQE A;  3CIK B;  3MZK A;  1PGU A;  2P9S C;  4JSN C;  3L4M D;  5IGO A;  3KRX B;  2CN2 A;  3J80 g;  4Z8L A;  1JOF A;  1GG2 B;  4XYH A;  3C9C A;  4J82 A;  4N14 A;  3SCY A;  3SJL D;  3SFZ A;  3CFV A;  3PXS D;  2H9P A;  3EI1 B;  3NVQ A;  3AL8 B;  5I5M A;  3EI3 A;  3ZWL B;  3RSE C;  2CN3 A;  2B4E A;  4U7A A;  2P9L C;  5HE1 B;  4L3G D;  1JMZ B;  4A2L A;  5EM2 B;  4O3U B;  4FHL A;  5THA A;  2AGW A;  2I3S A;  1XHM A;  3EI2 B;  1Q47 A;  3MZL A;  5CXC B;  2J55 H;  2HJ4 A;  4QT8 A;  5TEE A;  2P9K C;  4J0W A;  2P9P C;  4J0X A;  3IJ0 A;  5JWZ A;  2GC7 A;  1L0Q A;  2PBI B;  3FGB A;  3F3P A;  4J8B A;  5TEF A;  3ODT A;  2HYE A;  4A0B B;  2OK6 A;  4ES0 A;  3BG0 A;  3JZN A;  4PSW B;  3EMH A;  5H17 A;  2HKR A;  3PSC B;  2I3T A;  1N6F A;  4CY2 A;  3JB9 L;  4IA9 A;  5H1M A;  2CE9 A;  5FKQ A;  4A11 B;  5IJ7 E;  5HE2 B;  3UVL A;  4R7A B;  2H9M A;  1QNI A;  4L3H D;  2YB8 B;  2J57 G;  5HYN B;  5EMK B;  3GFC A;  3IIW A;  4PBZ A;  5I5J A;  2P9I C;  2H6K A;  4A09 A;  2IWK A;  3AFC A;  5IJ8 E;  4E5Z A;  3B7F A;  3JRO A;  3I7K A;  1SQJ A;  3ORV D;  3PXT D;  5H14 A;  5I5I A;  4GZ8 A;  2W18 A;  5GMK n;  1B9X A;  3RRM C;  3DXM C;  3C99 A;  2AGX A;  4CC9 A;  3FM0 A;  4CZY A;  4PC0 A;  4GQ2 P;  3SBR A;  5FLX g;  3MKS B;  2IUP A;  2CNX A;  3SXT D;  2TRC B;  3I7P A;  2H6N A;  3UKU C;  4GQ1 A;  3MXX A;  1B9Y A;  2J56 H;  4JD2 C;  3RLM D;  2YMU A;  4H5J A;  2OJY A;  4PBY A;  2MTA H;  4ZOV A;  4JSX C;  5HE3 B;  3SN6 B;  2Q7Q A;  5FQD A;  3UVO A;  4JXM A;  4QRJ A;  2AQ5 A;  2HES X;  3I7L A;  3DM0 A;  2Z2P A;  3SVW D;  4J8G A;  4J81 A;  2P9N C;  5C9Z B;  5HQG A;  5AJA A;  2OVR B;  5IC7 A;  2XL3 A;  3BG1 A;  2OVP B;  4GM8 A;  5EAR A;  2B5L A;  4YVD A;  4J79 A;  3SHF A;  4IMM A;  5CYK B;  4FAN D;  1ERJ A;  5C2V B;  3EWE A;  4E54 A;  2QC5 A;  3I8C A;  3SBQ A;  4CI3 A;  4JT6 C;  1GP2 B;  4GMB A;  3RFH A;  3KRW B;  3SWS D;  2OIZ A;  3OL2 A;  1S4U X;  4UI9 R;  4CI2 A;  2OK4 A;  5A2Q g;  1NR0 A;  4QL1 A;  1VYH C;  4HDJ A;  5FKT A;  3PE7 A;  3JAM g;  1PBY B;  1P22 A;  4A09 B;  1U4C A;  4JSV C;  5CXB B;  3UVN A;  2EBS A;  4JSP C;  3OKY A;  4PNK B;  4A0A B;  4TZ4 A;  2YNP A;  2BBK H;  3E0C A;  3V9F A;  1SQ9 A;  1YFQ A;  2B5M A;  1SHY B;  3F3G A;  5IGQ A;  4X63 B;  5FKR A;  4H5I A;  4GGD A;  3UR4 A;  3L4O D;  4OZU A;  4U1E I;  1OLZ A;  3UVM A;  3SLE D;  4XEI C;  3EI1 A;  4Y5R D;  4J78 A;  3AL8 A;  1K8K C;  3J81 g;  4A08 B;  3W15 A;  3PXW D;  2GC4 A;  4EWR A;  2PM9 B;  3EI4 B;  1MDA H;  5EAM A;  3PSL A;  1XIP A;  5C2W B;  2HKM A;  2I0R A;  3JZH A;  3OKW A;  4LG8 A;  4ZOZ A;  5EM2 A;  3NVN A;  4ZOY A;  5CXC A;  4K3J B;  2CE8 A;  2XL2 A;  4CZV A;  2B5N A;  5FXY A;  4CI8 A;  4MK0 B;  4KFM B;  1N6D A;  3IJC A;  3JPX A;  4A0B A;  4L9O A;  2YBA A;  2PM6 B;  4K3I D;  3VH0 A;  3MMY A;  4CY3 A;  3SBP A;  4GGC A;  2IWF A;  3EI3 B;  5GSA A;  1A0R B;  5EMM B;  2G99 A;  3I89 A;  4J84 A;  5GXH A;  1K32 A;  2IUQ A;  4ERY A;  5EAL A;  2UZX B;  4J77 A;  4A11 A;  3C5M A;  2O9K A;  4FA4 D;  4X61 B;  5EML B;  3U4Y A;  5TF2 A;  1PEV A;  4D6V A;  3K27 A;  2CO0 C;  4GM9 A;  2Z2O A;  4GM3 A;  4NSX A;  2H3X A;  3PVU B;  3VA6 A;  3UVK A;  4O1Q D;  1RI6 A;  3K26 A;  4J86 A;  3RN1 D;  3F3F A;  4GQB B;  4FA9 D;  4X3E A;  3P4F A;  4BL0 A;  4D0K A;  4J73 A;  3I7H A;  5K1C C;  1U2V C;  5EAP A;  3I2N A;  5K19 A;  2BCJ B;  2HXC A;  2G9A A;  4A7J A;  4JT5 C;  1N6E A;  2I0S A;  3IJ1 A;  3DXK C;  3BWS A;  4FWW A;  4FA5 D;  2AGZ A;  4FA1 D;  4G56 B;  3RFG A;  4J87 A;  4A2M A; 
#chains in the Genus database with same CATH topology
 1XKS A;  4CZX A;  2H68 A;  3MVD K;  5SXM A;  2XU7 A;  2QR5 A;  1MG3 A;  3NIG A;  1FWX A;  2AH1 A;  1PI6 A;  3V5W B;  4BUJ C;  3ULE C;  4E5Z B;  4PSX B;  2IUV A;  1O6G A;  3A0F A;  4L1Q D;  4ESG A;  2OVQ B;  1JMX B;  3MKQ A;  2GNQ A;  3FRX A;  3JZG A;  2HU8 A;  1TBG A;  3I7N A;  1E8M A;  3RMZ D;  5HE0 B;  2Z2N A;  2AH0 A;  3N0D A;  3I7O A;  5CYK A;  4CI1 A;  1GOH A;  4WK0 A;  1GXR A;  3DSM A;  1A12 A;  5EMJ B;  4I79 A;  4CY1 A;  1R5M A;  3VGZ A;  4ERZ A;  1GOT B;  3IKO A;  3UKR C;  1OMW B;  1MG2 A;  2H47 A;  2YNO A;  4XYI A;  1UOQ A;  4AOW A;  3C75 H;  4G1M A;  4DNW A;  4FB1 D;  3AH8 B;  3GD1 I;  1GOG A;  3EU7 A;  3DWL C;  4UM9 A;  4ZOX A;  3CFS B;  4O45 A;  4AEZ A;  2VDO A;  3RN0 D;  1M1X A;  4X60 B;  3EI2 A;  4Z7O A;  5M5R A;  1NEX B;  2H9N A;  4FAV D;  3OF7 A;  3PVW B;  3N0E A;  5TDH B;  3I8E A;  3HFQ A;  5FA5 B;  5CXB A;  4OWR A;  2H9L A;  4ERQ A;  2H14 A;  2I0T A;  4A0A A;  2IUR A;  3OKT A;  5AMS A;  4JHP C;  3ZDY A;  3AL9 A;  1JJU B;  5M5U A;  4LG9 A;  2YNN A;  4O9D A;  4RE6 A;  4BH6 A;  4E54 B;  2AGY A;  5GXI A;  5HDB A;  3VI3 A;  2IAA A;  1TYQ C;  2VDN A;  5KDO B;  2H6Q A;  4BCB A;  4GGA A;  5B4W A;  3NID A;  4LGN A;  2HJB A;  2QXV A;  4O3T B;  4CY5 A;  2VDM A;  5IT9 g;  3OL2 B;  2VDQ A;  3V7D B;  3IIY A;  4A08 A;  5FKS A;  2H13 A;  5FFG A;  3SMR A;  3MUN A;  2PM9 A;  3EI4 A;  3NVX A;  3GRE A;  2AGL A;  2PM7 B;  2XE4 A;  2UZY B;  3OW8 A;  4PXW A;  4Y7R A;  2P9U C;  4WJK A;  5AFU 3;  3EG6 A;  3IUN A;  4ZN4 A;  4BP9 A;  3OTT A;  2XYI A;  3O4J A;  2CO0 A;  1JTD B;  3OKY B;  1TYE A;  3JRP A;  3ZDZ A;  4QQE A;  3IUL A;  3CIK B;  3MZK A;  1PGU A;  2P9S C;  4JSN C;  3L4M D;  5IGO A;  3K6S A;  1JV2 A;  3KRX B;  2CN2 A;  3J80 g;  4Z8L A;  1JOF A;  1GG2 B;  4XYH A;  2WQ8 A;  3C9C A;  4J82 A;  4N14 A;  3SCY A;  3SJL D;  3SFZ A;  3CFV A;  3PXS D;  2H9P A;  3EI1 B;  3NVQ A;  3AL8 B;  1H2Z A;  3EI3 A;  5I5M A;  4IRZ A;  3ZWL B;  3RSE C;  2CN3 A;  4MMY A;  2B4E A;  4U7A A;  2P9L C;  5M5V A;  5HE1 B;  4L3G D;  1JMZ B;  3KCI A;  4NC4 A;  4A2L A;  5EM2 B;  4O3U B;  4FHL A;  5THA A;  2AGW A;  2I3S A;  1XHM A;  4NBM A;  3VI4 A;  3EI2 B;  1Q47 A;  1H2X A;  3MZL A;  5CXC B;  2J55 H;  2HJ4 A;  4QT8 A;  5TEE A;  2P9K C;  4J0W A;  2P9P C;  4J0X A;  3T3P A;  3IJ0 A;  3V4V A;  1K3I A;  5JWZ A;  2GC7 A;  1L0Q A;  2PBI B;  2XDW A;  3EQ7 A;  3F3P A;  3FGB A;  3IUR A;  4J8B A;  3ODT A;  5TEF A;  2HYE A;  4A0B B;  1UTC A;  3T3M A;  2OK6 A;  3DDU A;  4ES0 A;  3BG0 A;  3ZE2 A;  4NAA A;  3JZN A;  2QZP A;  3EMH A;  4PSW B;  2HKR A;  3PSC B;  5H17 A;  3ZDX A;  2I3T A;  1N6F A;  4CY2 A;  3JB9 L;  4IA9 A;  5H1M A;  2CE9 A;  5FKQ A;  4A11 B;  5IJ7 E;  5HE2 B;  1VE7 A;  4AN0 A;  3UVL A;  2JKX A;  4R7A B;  2H9M A;  1QNI A;  4L3H D;  2YB8 B;  2J57 G;  2EIE A;  5HYN B;  5EMK B;  3GFC A;  1YR2 A;  3IIW A;  4PBZ A;  1C9L A;  5I5J A;  2P9I C;  2H6K A;  4NEN A;  1T2X A;  4A09 A;  4G1E A;  2IWK A;  3O4I A;  4AN1 A;  3AFC A;  5IJ8 E;  4E5Z A;  3B7F A;  3JRO A;  3I7K A;  3EQ8 A;  1SQJ A;  3ORV D;  3PXT D;  5H14 A;  4D9S A;  2W18 A;  4GZ8 A;  5I5I A;  5GMK n;  1B9X A;  3RRM C;  3FCU A;  3DXM C;  3C99 A;  2AGX A;  4CC9 A;  3FM0 A;  4CZY A;  4PC0 A;  4GQ2 P;  3O4G A;  3SBR A;  5FLX g;  3MKS B;  2IUP A;  4UM8 A;  2CNX A;  5C86 A;  3SXT D;  2TRC B;  3I7P A;  1VZ3 A;  2H6N A;  3UKU C;  1O6F A;  4O2W A;  4GQ1 A;  3MXX A;  1L5G A;  1B9Y A;  2J56 H;  4JD2 C;  3RLM D;  1UOP A;  2VDK A;  2YMU A;  4H5J A;  2OJY A;  4PBY A;  2MTA H;  3NIF A;  4ZOV A;  4JSX C;  5HE3 B;  3SN6 B;  3ZE1 A;  4AMY A;  2Q7Q A;  5FQD A;  3UVO A;  4JXM A;  4QRJ A;  2AQ5 A;  2HES X;  1I2M B;  2VZ3 A;  3I7L A;  3DM0 A;  5E6S A;  2Z2P A;  3SVW D;  4J8G A;  4J81 A;  3EQ9 A;  2EIB A;  2P9N C;  5C9Z B;  5HQG A;  5AJA A;  2OVR B;  5IC7 A;  3IUQ A;  2XL3 A;  3IUM A;  3BG1 A;  4MMZ A;  2OVP B;  4GM8 A;  5EAR A;  2B5L A;  4YVD A;  4J79 A;  3SHF A;  4IMM A;  5CYK B;  4FAN D;  5M5S A;  1E8N A;  1ERJ A;  3FCS A;  3MUO A;  5C2V B;  1VZ2 A;  3EWE A;  4E54 A;  2QC5 A;  3I8C A;  3SBQ A;  4Z7Q A;  4CI3 A;  4JT6 C;  1GP2 B;  4GMB A;  4DNU A;  1C9I A;  3RFH A;  3KRW B;  3SWS D;  2OIZ A;  3OL2 A;  1S4U X;  4UI9 R;  2VZ1 A;  5E6U A;  4CI2 A;  2OK4 A;  1QFS A;  5A2Q g;  1NR0 A;  4QL1 A;  3IJE A;  1VYH C;  4HDJ A;  5FKT A;  3PE7 A;  1BPO A;  3JAM g;  1PBY B;  1P22 A;  4A09 B;  1U4C A;  4JSV C;  5CXB B;  3UVN A;  2EBS A;  4JSP C;  3OKY A;  3QI0 A;  5FFO A;  4AX4 A;  1H2W A;  4PNK B;  4A0A B;  4TZ4 A;  2YNP A;  2BBK H;  3E0C A;  3V9F A;  1SQ9 A;  1YFQ A;  2B5M A;  2VC2 A;  1SHY B;  3F3G A;  5IGQ A;  4X63 B;  5FKR A;  4AMZ A;  4H5I A;  4GGD A;  3UR4 A;  3L4O D;  4OZU A;  4U1E I;  1OLZ A;  3UVM A;  3SLE D;  4XEI C;  2VDR A;  3EI1 A;  4Y5R D;  4J78 A;  3AL8 A;  3IVM A;  1K8K C;  3J81 g;  4A08 B;  3IUJ A;  3W15 A;  3PXW D;  2GC4 A;  4WK4 A;  4EWR A;  2PM9 B;  3EI4 B;  3V4P A;  1MDA H;  5EAM A;  4BCD A;  3PSL A;  2VDP A;  1XIP A;  5C2W B;  2HKM A;  5M61 A;  2I0R A;  3JZH A;  3OKW A;  4WK2 A;  4LG8 A;  4ZOZ A;  4L1M A;  5EM2 A;  3NVN A;  4ZOY A;  1UOO A;  5CXC A;  2EID A;  4K3J B;  2CE8 A;  2HU5 A;  2XL2 A;  4RE5 A;  4CZV A;  2B5N A;  5FXY A;  4CI8 A;  1QFM A;  5M5T A;  4MK0 B;  1H2Y A;  1N6D A;  2EIC A;  3JPX A;  3IJC A;  4KFM B;  4A0B A;  4L9O A;  2YBA A;  2PM6 B;  4K3I D;  3VH0 A;  3MMY A;  4CY3 A;  3SBP A;  4GGC A;  4BCC A;  4JHN A;  2IWF A;  3EI3 B;  2HU7 A;  5GSA A;  1A0R B;  5EMM B;  2G99 A;  3I89 A;  4J84 A;  5GXH A;  1K32 A;  2IUQ A;  4ERY A;  4BP8 A;  5EAL A;  2UZX B;  4J77 A;  4A11 A;  3K71 A;  3C5M A;  4G55 A;  2O9K A;  4FA4 D;  4X61 B;  5EML B;  3U4Y A;  5TF2 A;  1PEV A;  4D6V A;  3K27 A;  2CO0 C;  2XZG A;  4GM9 A;  2Z2O A;  4GM3 A;  3GC3 B;  4NSX A;  2H3X A;  1E5T A;  3PVU B;  3VA6 A;  3UVK A;  4O1Q D;  1RI6 A;  4MMX A;  3K26 A;  4J86 A;  3RN1 D;  2VDL A;  3F3F A;  4GQB B;  3QHY B;  4FA9 D;  1U8C A;  4X3E A;  3P4F A;  4BL0 A;  4D0K A;  5C92 A;  4J73 A;  3I7H A;  4DNV A;  5K1C C;  3O4H A;  1U2V C;  4QAM A;  5EAP A;  3K72 A;  3I2N A;  5K19 A;  4Z7N A;  2BCJ B;  2HXC A;  2G9A A;  4A7J A;  2BKL A;  3ZE0 A;  1N6E A;  4JT5 C;  2I0S A;  3IJ1 A;  4O02 A;  3DXK C;  5E6R A;  1GOF A;  3BWS A;  4FWW A;  1VE6 A;  4FA5 D;  2AGZ A;  4FA1 D;  4G56 B;  3RFG A;  4J87 A;  4A2M A; 
#chains in the Genus database with same CATH homology
 1XKS A;  4CZX A;  2H68 A;  5SXM A;  2XU7 A;  1MG3 A;  1FWX A;  2AH1 A;  1PI6 A;  3V5W B;  4BUJ C;  3ULE C;  4E5Z B;  4PSX B;  2IUV A;  3A0F A;  4L1Q D;  4ESG A;  2OVQ B;  1JMX B;  3MKQ A;  2GNQ A;  3FRX A;  3JZG A;  3I7N A;  1TBG A;  3RMZ D;  5HE0 B;  2Z2N A;  2AH0 A;  3N0D A;  3I7O A;  5CYK A;  4CI1 A;  1GXR A;  3DSM A;  5EMJ B;  4I79 A;  4CY1 A;  1R5M A;  3VGZ A;  4ERZ A;  1GOT B;  3IKO A;  3UKR C;  1OMW B;  1MG2 A;  2H47 A;  2YNO A;  4XYI A;  4AOW A;  3C75 H;  4FB1 D;  3AH8 B;  3EU7 A;  3DWL C;  4ZOX A;  3CFS B;  4O45 A;  4AEZ A;  3RN0 D;  4X60 B;  3EI2 A;  1NEX B;  2H9N A;  4FAV D;  3PVW B;  3N0E A;  5TDH B;  3I8E A;  3HFQ A;  5FA5 B;  5CXB A;  4OWR A;  2H9L A;  4ERQ A;  2H14 A;  2I0T A;  4A0A A;  2IUR A;  3OKT A;  5AMS A;  3AL9 A;  1JJU B;  4LG9 A;  2YNN A;  4O9D A;  4BH6 A;  4E54 B;  2AGY A;  5GXI A;  2IAA A;  1TYQ C;  5KDO B;  2H6Q A;  4GGA A;  5B4W A;  4O3T B;  4LGN A;  2HJB A;  2QXV A;  4CY5 A;  5IT9 g;  3OL2 B;  3V7D B;  3IIY A;  4A08 A;  5FKS A;  2H13 A;  3SMR A;  2PM9 A;  3EI4 A;  3NVX A;  3GRE A;  2AGL A;  2PM7 B;  4PXW A;  2UZY B;  3OW8 A;  4Y7R A;  2P9U C;  5AFU 3;  3EG6 A;  4ZN4 A;  3OTT A;  2XYI A;  2CO0 A;  3OKY B;  3JRP A;  4QQE A;  3CIK B;  3MZK A;  1PGU A;  2P9S C;  4JSN C;  3L4M D;  5IGO A;  3KRX B;  2CN2 A;  3J80 g;  4Z8L A;  1JOF A;  1GG2 B;  4XYH A;  3C9C A;  4J82 A;  4N14 A;  3SCY A;  3SJL D;  3SFZ A;  3CFV A;  3PXS D;  2H9P A;  3EI1 B;  3NVQ A;  3AL8 B;  5I5M A;  3EI3 A;  3ZWL B;  3RSE C;  2CN3 A;  2B4E A;  4U7A A;  2P9L C;  5HE1 B;  4L3G D;  1JMZ B;  4A2L A;  5EM2 B;  4O3U B;  4FHL A;  5THA A;  2AGW A;  2I3S A;  1XHM A;  3EI2 B;  1Q47 A;  3MZL A;  5CXC B;  2J55 H;  2HJ4 A;  4QT8 A;  5TEE A;  2P9K C;  4J0W A;  2P9P C;  4J0X A;  3IJ0 A;  5JWZ A;  2GC7 A;  1L0Q A;  2PBI B;  3FGB A;  3F3P A;  4J8B A;  5TEF A;  3ODT A;  2HYE A;  4A0B B;  2OK6 A;  4ES0 A;  3BG0 A;  3JZN A;  4PSW B;  3EMH A;  5H17 A;  2HKR A;  3PSC B;  2I3T A;  1N6F A;  4CY2 A;  3JB9 L;  4IA9 A;  5H1M A;  2CE9 A;  5FKQ A;  4A11 B;  5IJ7 E;  5HE2 B;  3UVL A;  4R7A B;  2H9M A;  1QNI A;  4L3H D;  2YB8 B;  2J57 G;  5HYN B;  5EMK B;  3GFC A;  3IIW A;  4PBZ A;  5I5J A;  2P9I C;  2H6K A;  4A09 A;  2IWK A;  3AFC A;  5IJ8 E;  4E5Z A;  3B7F A;  3JRO A;  3I7K A;  1SQJ A;  3ORV D;  3PXT D;  5H14 A;  5I5I A;  4GZ8 A;  2W18 A;  5GMK n;  1B9X A;  3RRM C;  3DXM C;  3C99 A;  2AGX A;  4CC9 A;  3FM0 A;  4CZY A;  4PC0 A;  4GQ2 P;  3SBR A;  5FLX g;  3MKS B;  2IUP A;  2CNX A;  3SXT D;  2TRC B;  3I7P A;  2H6N A;  3UKU C;  4GQ1 A;  3MXX A;  1B9Y A;  2J56 H;  4JD2 C;  3RLM D;  2YMU A;  4H5J A;  2OJY A;  4PBY A;  2MTA H;  4ZOV A;  4JSX C;  5HE3 B;  3SN6 B;  2Q7Q A;  5FQD A;  3UVO A;  4JXM A;  4QRJ A;  2AQ5 A;  2HES X;  3I7L A;  3DM0 A;  2Z2P A;  3SVW D;  4J8G A;  4J81 A;  2P9N C;  5C9Z B;  5HQG A;  5AJA A;  2OVR B;  5IC7 A;  2XL3 A;  3BG1 A;  2OVP B;  4GM8 A;  5EAR A;  2B5L A;  4YVD A;  4J79 A;  3SHF A;  4IMM A;  5CYK B;  4FAN D;  1ERJ A;  5C2V B;  3EWE A;  4E54 A;  2QC5 A;  3I8C A;  3SBQ A;  4CI3 A;  4JT6 C;  1GP2 B;  4GMB A;  3RFH A;  3KRW B;  3SWS D;  2OIZ A;  3OL2 A;  1S4U X;  4UI9 R;  4CI2 A;  2OK4 A;  5A2Q g;  1NR0 A;  4QL1 A;  1VYH C;  4HDJ A;  5FKT A;  3PE7 A;  3JAM g;  1PBY B;  1P22 A;  4A09 B;  1U4C A;  4JSV C;  5CXB B;  3UVN A;  2EBS A;  4JSP C;  3OKY A;  4PNK B;  4A0A B;  4TZ4 A;  2YNP A;  2BBK H;  3E0C A;  3V9F A;  1SQ9 A;  1YFQ A;  2B5M A;  1SHY B;  3F3G A;  5IGQ A;  4X63 B;  5FKR A;  4H5I A;  4GGD A;  3UR4 A;  3L4O D;  4OZU A;  4U1E I;  1OLZ A;  3UVM A;  3SLE D;  4XEI C;  3EI1 A;  4Y5R D;  4J78 A;  3AL8 A;  1K8K C;  3J81 g;  4A08 B;  3W15 A;  3PXW D;  2GC4 A;  4EWR A;  2PM9 B;  3EI4 B;  1MDA H;  5EAM A;  3PSL A;  1XIP A;  5C2W B;  2HKM A;  2I0R A;  3JZH A;  3OKW A;  4LG8 A;  4ZOZ A;  5EM2 A;  3NVN A;  4ZOY A;  5CXC A;  4K3J B;  2CE8 A;  2XL2 A;  4CZV A;  2B5N A;  5FXY A;  4CI8 A;  4MK0 B;  4KFM B;  1N6D A;  3IJC A;  3JPX A;  4A0B A;  4L9O A;  2YBA A;  2PM6 B;  4K3I D;  3VH0 A;  3MMY A;  4CY3 A;  3SBP A;  4GGC A;  2IWF A;  3EI3 B;  5GSA A;  1A0R B;  5EMM B;  2G99 A;  3I89 A;  4J84 A;  5GXH A;  1K32 A;  2IUQ A;  4ERY A;  5EAL A;  2UZX B;  4J77 A;  4A11 A;  3C5M A;  2O9K A;  4FA4 D;  4X61 B;  5EML B;  3U4Y A;  5TF2 A;  1PEV A;  4D6V A;  3K27 A;  2CO0 C;  4GM9 A;  2Z2O A;  4GM3 A;  4NSX A;  2H3X A;  3PVU B;  3VA6 A;  3UVK A;  4O1Q D;  1RI6 A;  3K26 A;  4J86 A;  3RN1 D;  3F3F A;  4GQB B;  4FA9 D;  4X3E A;  3P4F A;  4BL0 A;  4D0K A;  4J73 A;  3I7H A;  5K1C C;  1U2V C;  5EAP A;  3I2N A;  5K19 A;  2BCJ B;  2HXC A;  2G9A A;  4A7J A;  4JT5 C;  1N6E A;  2I0S A;  3IJ1 A;  3DXK C;  3BWS A;  4FWW A;  4FA5 D;  2AGZ A;  4FA1 D;  4G56 B;  3RFG A;  4J87 A;  4A2M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...