2CO0A

Wdr5 and unmodified histone h3 complex at 2.25 angstrom
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
304
structure length
304
Chain Sequence
b'VKPNYALMFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGMCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNDLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD-REPEAT PROTEIN 5
publication title Histone H3 Recognition and Presentation by the Wdr5 Module of the Mll1 Complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 100
structure length 304
sequence length 304
ec nomenclature
pdb deposition date 2006-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2co0A00
3NVNA 2XL3A 2PM6B 2OVRB 3UVOA 3SXTD 5TEFA 4NSXA 4J8BA 4PXWA 4CZYA 4PBYA 4J86A 2Z2PA 5CXBB 5EARA 4MK0B 4IA9A 5FXYA 3I89A 3OW8A 5H17A 2B4EA 5IT9g 3P4FA 2QC5A 1N6DA 2UZYB 3IIYA 4GM3A 4JT6C 4ZOVA 5I5IA 3DM0A 3EI4A 4E54B 3AL9A 3KRXB 1B9XA 5JWZA 2AH0A 3RN1D 4J81A 5CYKB 2H9PA 2I3SA 4I79A 3DWLC 4Z8LA 2HJBA 4CI3A 5EM2A 4GGDA 4A0BB 5K1CC 5SXMA 4J87A 1JMXB 4ESGA 3EI1B 4AOWA 2H9LA 3F3FA 2CNXA 4E5ZB 4G56B 2G9AA 5AFU3 3JRPA 3JROA 3SFZA 3PE7A 5CXCA 5IGOA 2P9IC 2IWFA 2UZXB 1OMWB 4BH6A 2H9MA 4JXMA 1XHMA 1SQ9A 3SWSD 2I0RA 4L3GD 4H5IA 3I2NA 5FQDA 2OK4A 2H6NA 3SN6B 2I0SA 4O45A 3U4YA 1K32A 1FWXA 4J73A 5CXBA 4XEIC 3F3PA 5A2Qg 5EALA 2HYEA 2AGXA 5TDHB 4FA1D 2YMUA 3C9CA 4X61B 1GOTB 3JZNA 1K8KC 1GG2B 4X60B 1ERJA 5CYKA 2XYIA 3I8EA 4N14A 4ZOXA 4CZXA 4GZ8A 5EAMA 4U1EI 3I7LA 3FRXA 5B4WA 3ULEC 3EI1A 4GQ1A 1P22A 2IUPA 4PNKB 3EI4B 4Y5RD 3RN0D 4A7JA 4ERZA 2PBIB 3MMYA 1A0RB 4QQEA 4X63B 4JSVC 4A08A 3EI3A 1TBGA 2W18A 4PSWB 5EM2B 2PM7B 3GREA 3NVQA 3C99A 2QXVA 1QNIA 5EAPA 3L4OD 4FA9D 3I7HA 1MDAH 4PSXB 5HQGA 2HESX 4CC9A 4CZVA 1Q47A 5CXCB 4U7AA 2AGZA 1YFQA 3B7FA 4O9DA 2G99A 3ODTA 4JSXC 4CI2A 5GSAA 3J81g 1GP2B 4FA5D 4JSPC 4GQ2P 2IWKA 3BG1A 4FWWA 3AL8A 3C75H 4J77A 3I7PA 2CO0A 5HE3B 4CY1A 4CI1A 4A0AB 2O9KA 2OIZA 3UVLA 4LG8A 5AJAA 5TF2A 2AGYA 2IUVA 4EWRA 2EBSA 4J0WA 3DXKC 3CFSB 2OK6A 3GFCA 4J0XA 4ERQA 5FKSA 3JPXA 4J79A 3JZHA 4A09A 4KFMB 3SJLD 3W15A 4BUJC 5C9ZB 2OVPB 1PGUA 5IJ8E 2H6QA 4O1QD 3UKUC 4L9OA 4A08B 3EI3B 1R5MA 2GC4A 2IURA 2GC7A 3OKYA 2AGWA 4GM8A 1PI6A 4A2MA 4ZOYA 4K3JB 1OLZA 2H47A 4LGNA 2BCJB 3RSEC 3SBPA 3JAMg 4J8GA 2MTAH 2AH1A 3RLMD 5KDOB 4GGAA 4A0AA 2OVQB 3NVXA 3IJ0A 1JJUB 1U4CA 1XKSA 3DSMA 4GMBA 4R7AB 1GXRA 2H6KA 3IKOA 3OL2A 1JMZB 1L0QA 3AL8B 2YNOA 4XYHA 3HFQA 1SQJA 2HXCA 4ERYA 4TZ4A 4A11B 3SBRA 4PBZA 3CIKB 3F3GA 2B5MA 3UR4A 3A0FA 3MZLA 2I3TA 2OJYA 3V5WB 3I7NA 3VGZA 3ORVD 2J57G 2H13A 3N0EA 4Y7RA 3ZWLB 3K27A 4A09B 1JOFA 5C2VB 4PC0A 3V7DB 3E0CA 3I8CA 4CY3A 3V9FA 5THAA 2YNPA 3IJ1A 3VH0A 4H5JA 2HKRA 3I7OA 4K3ID 4IMMA 4BL0A 5IC7A 4QL1A 3OKTA 2B5NA 1N6FA 3OKYB 4OWRA 5GXIA 2P9UC 4FAND 3PXTD 5EMLB 3EMHA 2Z2OA 5HE2B 3PVWB 4JD2C 2PM9A 1PBYB 4JSNC 2P9PC 4FB1D 2HKMA 2IUQA 3PVUB 4ZOZA 4A11A 5FLXg 5HE0B 3EI2A 3K26A 3BWSA 2CO0C 3PSLA 3CFVA 3OL2B 2P9SC 1N6EA 3SMRA 5K19A 3UKRC 3EWEA 3RFGA 4D6VA 2P9LC 3SCYA 5GXHA 5HE1B 4A2LA 4ZN4A 5GMKn 1S4UX 4QT8A 2Z2NA 3UVKA 3BG0A 1NEXB 2Q7QA 5FKRA 3PSCB 4LG9A 3OTTA 2H14A 1MG2A 3IIWA 4GQBB 5H14A 2H3XA 2B5LA 4OZUA 2IAAA 4D0KA 4J78A 5FKTA 3AFCA 1SHYB 3AH8B 1TYQC 4O3TB 2GNQA 2HJ4A 5AMSA 5FKQA 2CE9A 4L1QD 2YNNA 3MKSB 4CY5A 1MG3A 1B9YA 3C5MA 3J80g 2PM9B 5I5JA 4XYIA 4AEZA 3RMZD 2TRCB 5IGQA 2XU7A 4ES0A 4FA4D 3EI2B 1VYHC 1U2VC 2XL2A 5FA5B 3SHFA 4CI8A 3EU7A 4YVDA 2P9NC 5EMMB 3SBQA 3UVNA 4E54A 1XIPA 5IJ7E 3MXXA 2CN2A 3EG6A 4FAVD 5H1MA 2H9NA 3RFHA 4JT5C 2I0TA 2YB8B 3RRMC 4QRJA 3PXSD 5EMKB 5HYNB 4UI9R 3VA6A 4J84A 3JB9L 4A0BA 2H68A 5I5MA 3FGBA 1PEVA 3PXWD 4J82A 2J56H 3SLED 3I7KA 3JZGA 5C2WB 4O3UB 4E5ZA 3MKQA 4HDJA 5TEEA 3FM0A 3L4MD 5EMJB 3IJCA 3N0DA 2YBAA 3UVMA 2P9KC 4GM9A 1RI6A 3SVWD 2J55H 3DXMC 1NR0A 2CE8A 2AGLA 4X3EA 4GGCA 4FHLA 3MZKA 3KRWB 4L3HD 2AQ5A 4CY2A 2BBKH 2CN3A 3OKWA
chains in the Genus database with same CATH superfamily
3NVNA 2XL3A 2PM6B 4AMZA 2OVRB 3V4PA 4AN0A 3UVOA 3SXTD 3O4JA 5HDBA 1JV2A 5TEFA 4NSXA 1JTDB 4J8BA 4PXWA 4CZYA 5M5SA 5M5RA 4PBYA 4J86A 3O4GA 2Z2PA 2WQ8A 5CXBB 5EARA 4MK0B 4IA9A 5FXYA 3I89A 5E6RA 3GC3B 3OW8A 4IRZA 2VDRA 5H17A 2B4EA 5IT9g 3P4FA 2QC5A 1N6DA 2UZYB 3IIYA 3NIDA 4GM3A 4JT6C 4ZOVA 5I5IA 4MMZA 3DM0A 3EI4A 4E54B 5M5UA 3AL9A 3KRXB 1B9XA 5JWZA 2AH0A 4MMXA 3RN1D 1K3IA 4J81A 5CYKB 2H9PA 2I3SA 2VDOA 3DWLC 4I79A 4Z8LA 2XE4A 2HJBA 4CI3A 5EM2A 3K71A 4GGDA 3VI4A 4A0BB 5K1CC 5SXMA 4J87A 1JMXB 4ESGA 3EI1B 4MMYA 4AOWA 2VDPA 2H9LA 3F3FA 2CNXA 4E5ZB 4G56B 1E8MA 1TYEA 2G9AA 5AFU3 3JRPA 3JROA 3SFZA 4G1MA 3PE7A 5CXCA 5IGOA 1C9LA 4AX4A 2P9IC 3ZDZA 2IWFA 2UZXB 1OMWB 4BH6A 2H9MA 4JXMA 1XHMA 1SQ9A 3SWSD 2I0RA 4L3GD 3IUJA 3I2NA 4H5IA 5FQDA 2OK4A 2H6NA 3SN6B 2I0SA 4O45A 4Z7OA 3U4YA 1K32A 1FWXA 4J73A 5CXBA 4XEIC 3F3PA 5A2Qg 5EALA 2HYEA 2AGXA 5TDHB 4FA1D 5FFOA 2YMUA 3C9CA 4X61B 5FFGA 1GOTB 3IVMA 3JZNA 1K8KC 3T3PA 1GG2B 4X60B 1ERJA 5CYKA 2XYIA 3I8EA 4N14A 1VE6A 4ZOXA 2BKLA 4CZXA 3NIFA 4GZ8A 1O6GA 5EAMA 4U1EI 3I7LA 3FRXA 5B4WA 3ULEC 3EI1A 4GQ1A 1P22A 2IUPA 4PNKB 3EI4B 4Y5RD 3RN0D 1H2XA 4A7JA 4ERZA 2PBIB 3MMYA 4NAAA 1A0RB 4QQEA 4X63B 4JSVC 4A08A 3EI3A 4DNWA 3IURA 3ZE0A 1TBGA 2W18A 4PSWB 5M5VA 5EM2B 2PM7B 3GREA 4UM8A 3NVQA 3C99A 2QXVA 3EQ7A 3IUMA 1QNIA 5EAPA 3L4OD 4FA9D 3I7HA 1MDAH 4PSXB 5HQGA 2HESX 4CC9A 4CZVA 1Q47A 5CXCB 2XZGA 4U7AA 2AGZA 1YFQA 2VDMA 1VZ3A 3B7FA 4O9DA 2G99A 3ODTA 4JSXC 4CI2A 5GSAA 3J81g 3O4HA 1GP2B 4FA5D 4JSPC 4GQ2P 3EQ9A 2IWKA 3BG1A 4FWWA 3AL8A 3C75H 3KCIA 3IUNA 4J77A 3I7PA 2CO0A 5HE3B 1I2MB 4CY1A 4CI1A 4A0AB 2O9KA 2OIZA 3UVLA 3ZE2A 3ZDXA 3K72A 3MUOA 4LG8A 5AJAA 2EICA 2AGYA 5TF2A 2IUVA 4EWRA 2EBSA 4J0WA 1E5TA 3DXKC 3CFSB 2OK6A 3QHYB 3GFCA 4J0XA 4QAMA 5FKSA 4ERQA 3JPXA 4J79A 3JZHA 4A09A 4KFMB 3GD1I 3SJLD 3W15A 4BUJC 5C9ZB 2OVPB 1PGUA 5IJ8E 3MVDK 2H6QA 4O1QD 3UKUC 4L9OA 4A08B 3EI3B 1R5MA 2GC4A 2IURA 2GC7A 1GOHA 3OKYA 2AGWA 4GM8A 1PI6A 5C86A 1UOOA 4WJKA 4A2MA 4ZOYA 4NENA 4K3JB 5M61A 1OLZA 2H47A 4LGNA 2BCJB 3RSEC 3SBPA 4Z7QA 3JAMg 4J8GA 1E8NA 2MTAH 1H2WA 2AH1A 3RLMD 5KDOB 4BP9A 4GGAA 4A0AA 2OVQB 3NVXA 3IJ0A 2EIDA 1JJUB 1U4CA 1XKSA 3DSMA 3O4IA 4GMBA 4R7AB 1VZ2A 1BPOA 1GXRA 2H6KA 3NIGA 4G1EA 3IKOA 1QFSA 3OL2A 1JMZB 3IJEA 4UM9A 4D9SA 1L0QA 3AL8B 4WK2A 4NC4A 2YNOA 2QR5A 4XYHA 3HFQA 1SQJA 2HXCA 4ERYA 4TZ4A 4A11B 2VDNA 5E6SA 1UOPA 4BCCA 3SBRA 4PBZA 3CIKB 3F3GA 2B5MA 3UR4A 3A0FA 3MZLA 2VDLA 2I3TA 4AN1A 2OJYA 3IULA 3V5WB 3I7NA 3VGZA 3ORVD 2J57G 2H13A 3N0EA 4Y7RA 3ZWLB 3K27A 3T3MA 4A09B 1JOFA 5C2VB 3VI3A 4PC0A 3V7DB 3E0CA 2EIBA 3I8CA 4CY3A 3V9FA 5THAA 2YNPA 3IJ1A 3VH0A 4BCDA 4H5JA 2HKRA 3I7OA 4K3ID 4IMMA 4BL0A 5IC7A 4QL1A 3OKTA 2B5NA 1N6FA 3OKYB 4OWRA 1H2YA 4DNUA 5GXIA 2P9UC 1VE7A 1H2ZA 4FAND 3PXTD 4WK4A 5EMLB 3EMHA 2Z2OA 5HE2B 3PVWB 4JD2C 2PM9A 1U8CA 1PBYB 4JSNC 2P9PC 4FB1D 1L5GA 3K6SA 2HKMA 2IUQA 3PVUB 4ZOZA 4A11A 5FLXg 5HE0B 3EI2A 3K26A 3BWSA 2HU8A 2CO0C 3PSLA 3CFVA 4NBMA 1QFMA 3OL2B 2P9SC 1N6EA 3SMRA 5K19A 3UKRC 3EWEA 3RFGA 4D6VA 2VZ3A 2VDQA 2P9LC 3SCYA 5GXHA 5HE1B 4A2LA 4ZN4A 5GMKn 1S4UX 4QT8A 2Z2NA 3UVKA 3BG0A 3EQ8A 1NEXB 2Q7QA 5FKRA 3PSCB 5C92A 3FCSA 4LG9A 3OTTA 2H14A 1MG2A 3IIWA 2HU7A 4GQBB 5H14A 4BCBA 2H3XA 2B5LA 4OZUA 2IAAA 1C9IA 4DNVA 4D0KA 4J78A 5FKTA 3AFCA 1SHYB 3AH8B 5M5TA 1TYQC 4O3TB 2GNQA 1YR2A 2HJ4A 4RE6A 5AMSA 3QI0A 5FKQA 2VDKA 2CE9A 4L1QD 1O6FA 2YNNA 3MKSB 3ZDYA 4CY5A 1MG3A 1B9YA 3C5MA 4Z7NA 2EIEA 4L1MA 3J80g 2XDWA 1A12A 2PM9B 5I5JA 1UOQA 4XYIA 3FCUA 4AEZA 3RMZD 2TRCB 2JKXA 5IGQA 2XU7A 4ES0A 4FA4D 3DDUA 4O02A 3EI2B 1VYHC 1U2VC 4JHNA 2XL2A 5FA5B 5E6UA 3SHFA 3EU7A 4CI8A 4YVDA 2P9NC 3ZE1A 5EMMB 3SBQA 3UVNA 2QZPA 4E54A 1XIPA 4G55A 5IJ7E 3MXXA 2CN2A 3EG6A 4FAVD 4O2WA 3MUNA 5H1MA 2H9NA 3RFHA 1GOGA 2VC2A 2HU5A 4JT5C 2I0TA 2YB8B 3RRMC 3IUQA 4QRJA 3PXSD 1M1XA 4RE5A 4UI9R 5EMKB 4J84A 3VA6A 1GOFA 4AMYA 5HYNB 4A0BA 3JB9L 2H68A 4BP8A 5I5MA 3FGBA 1PEVA 3PXWD 4J82A 2J56H 3SLED 3I7KA 3JZGA 5C2WB 4O3UB 4JHPC 4E5ZA 3MKQA 4HDJA 5TEEA 3FM0A 3L4MD 5EMJB 3IJCA 3N0DA 2YBAA 3UVMA 2P9KC 4GM9A 1RI6A 3SVWD 3OF7A 2VZ1A 2J55H 3DXMC 1NR0A 2CE8A 1T2XA 2AGLA 4X3EA 4GGCA 4FHLA 3MZKA 3KRWB 4L3HD 2AQ5A 4CY2A 3V4VA 2BBKH 2CN3A 3OKWA 1UTCA 4WK0A
chains in the Genus database with same CATH topology
3NVNA 2XL3A 2PM6B 2OVRB 3UVOA 3SXTD 5TEFA 4NSXA 4J8BA 4PXWA 4CZYA 4PBYA 4J86A 2Z2PA 5CXBB 5EARA 4MK0B 4IA9A 5FXYA 3I89A 3OW8A 5H17A 2B4EA 5IT9g 3P4FA 2QC5A 1N6DA 2UZYB 3IIYA 4GM3A 4JT6C 4ZOVA 5I5IA 3DM0A 3EI4A 4E54B 3AL9A 3KRXB 1B9XA 5JWZA 2AH0A 3RN1D 4J81A 5CYKB 2H9PA 2I3SA 4I79A 3DWLC 4Z8LA 2HJBA 4CI3A 5EM2A 4GGDA 4A0BB 5K1CC 5SXMA 4J87A 1JMXB 4ESGA 3EI1B 4AOWA 2H9LA 3F3FA 2CNXA 4E5ZB 4G56B 2G9AA 5AFU3 3JRPA 3JROA 3SFZA 3PE7A 5CXCA 5IGOA 2P9IC 2IWFA 2UZXB 1OMWB 4BH6A 2H9MA 4JXMA 1XHMA 1SQ9A 3SWSD 2I0RA 4L3GD 4H5IA 3I2NA 5FQDA 2OK4A 2H6NA 3SN6B 2I0SA 4O45A 3U4YA 1K32A 1FWXA 4J73A 5CXBA 4XEIC 3F3PA 5A2Qg 5EALA 2HYEA 2AGXA 5TDHB 4FA1D 2YMUA 3C9CA 4X61B 1GOTB 3JZNA 1K8KC 1GG2B 4X60B 1ERJA 5CYKA 2XYIA 3I8EA 4N14A 4ZOXA 4CZXA 4GZ8A 5EAMA 4U1EI 3I7LA 3FRXA 5B4WA 3ULEC 3EI1A 4GQ1A 1P22A 2IUPA 4PNKB 3EI4B 4Y5RD 3RN0D 4A7JA 4ERZA 2PBIB 3MMYA 1A0RB 4QQEA 4X63B 4JSVC 4A08A 3EI3A 1TBGA 2W18A 4PSWB 5EM2B 2PM7B 3GREA 3NVQA 3C99A 2QXVA 1QNIA 5EAPA 3L4OD 4FA9D 3I7HA 1MDAH 4PSXB 5HQGA 2HESX 4CC9A 4CZVA 1Q47A 5CXCB 4U7AA 2AGZA 1YFQA 3B7FA 4O9DA 2G99A 3ODTA 4JSXC 4CI2A 5GSAA 3J81g 1GP2B 4FA5D 4JSPC 4GQ2P 2IWKA 3BG1A 4FWWA 3AL8A 3C75H 4J77A 3I7PA 2CO0A 5HE3B 4CY1A 4CI1A 4A0AB 2O9KA 2OIZA 3UVLA 4LG8A 5AJAA 5TF2A 2AGYA 2IUVA 4EWRA 2EBSA 4J0WA 3DXKC 3CFSB 2OK6A 3GFCA 4J0XA 4ERQA 5FKSA 3JPXA 4J79A 3JZHA 4A09A 4KFMB 3SJLD 3W15A 4BUJC 5C9ZB 2OVPB 1PGUA 5IJ8E 2H6QA 4O1QD 3UKUC 4L9OA 4A08B 3EI3B 1R5MA 2GC4A 2IURA 2GC7A 3OKYA 2AGWA 4GM8A 1PI6A 4A2MA 4ZOYA 4K3JB 1OLZA 2H47A 4LGNA 2BCJB 3RSEC 3SBPA 3JAMg 4J8GA 2MTAH 2AH1A 3RLMD 5KDOB 4GGAA 4A0AA 2OVQB 3NVXA 3IJ0A 1JJUB 1U4CA 1XKSA 3DSMA 4GMBA 4R7AB 1GXRA 2H6KA 3IKOA 3OL2A 1JMZB 1L0QA 3AL8B 2YNOA 4XYHA 3HFQA 1SQJA 2HXCA 4ERYA 4TZ4A 4A11B 3SBRA 4PBZA 3CIKB 3F3GA 2B5MA 3UR4A 3A0FA 3MZLA 2I3TA 2OJYA 3V5WB 3I7NA 3VGZA 3ORVD 2J57G 2H13A 3N0EA 4Y7RA 3ZWLB 3K27A 4A09B 1JOFA 5C2VB 4PC0A 3V7DB 3E0CA 3I8CA 4CY3A 3V9FA 5THAA 2YNPA 3IJ1A 3VH0A 4H5JA 2HKRA 3I7OA 4K3ID 4IMMA 4BL0A 5IC7A 4QL1A 3OKTA 2B5NA 1N6FA 3OKYB 4OWRA 5GXIA 2P9UC 4FAND 3PXTD 5EMLB 3EMHA 2Z2OA 5HE2B 3PVWB 4JD2C 2PM9A 1PBYB 4JSNC 2P9PC 4FB1D 2HKMA 2IUQA 3PVUB 4ZOZA 4A11A 5FLXg 5HE0B 3EI2A 3K26A 3BWSA 2CO0C 3PSLA 3CFVA 3OL2B 2P9SC 1N6EA 3SMRA 5K19A 3UKRC 3EWEA 3RFGA 4D6VA 2P9LC 3SCYA 5GXHA 5HE1B 4A2LA 4ZN4A 5GMKn 1S4UX 4QT8A 2Z2NA 3UVKA 3BG0A 1NEXB 2Q7QA 5FKRA 3PSCB 4LG9A 3OTTA 2H14A 1MG2A 3IIWA 4GQBB 5H14A 2H3XA 2B5LA 4OZUA 2IAAA 4D0KA 4J78A 5FKTA 3AFCA 1SHYB 3AH8B 1TYQC 4O3TB 2GNQA 2HJ4A 5AMSA 5FKQA 2CE9A 4L1QD 2YNNA 3MKSB 4CY5A 1MG3A 1B9YA 3C5MA 3J80g 2PM9B 5I5JA 4XYIA 4AEZA 3RMZD 2TRCB 5IGQA 2XU7A 4ES0A 4FA4D 3EI2B 1VYHC 1U2VC 2XL2A 5FA5B 3SHFA 4CI8A 3EU7A 4YVDA 2P9NC 5EMMB 3SBQA 3UVNA 4E54A 1XIPA 5IJ7E 3MXXA 2CN2A 3EG6A 4FAVD 5H1MA 2H9NA 3RFHA 4JT5C 2I0TA 2YB8B 3RRMC 4QRJA 3PXSD 5EMKB 5HYNB 4UI9R 3VA6A 4J84A 3JB9L 4A0BA 2H68A 5I5MA 3FGBA 1PEVA 3PXWD 4J82A 2J56H 3SLED 3I7KA 3JZGA 5C2WB 4O3UB 4E5ZA 3MKQA 4HDJA 5TEEA 3FM0A 3L4MD 5EMJB 3IJCA 3N0DA 2YBAA 3UVMA 2P9KC 4GM9A 1RI6A 3SVWD 2J55H 3DXMC 1NR0A 2CE8A 2AGLA 4X3EA 4GGCA 4FHLA 3MZKA 3KRWB 4L3HD 2AQ5A 4CY2A 2BBKH 2CN3A 3OKWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NVN A;  2XL3 A;  2PM6 B;  2OVR B;  3UVO A;  3SXT D;  5TEF A;  4NSX A;  4J8B A;  4PXW A;  4CZY A;  4PBY A;  4J86 A;  2Z2P A;  5CXB B;  5EAR A;  4MK0 B;  4IA9 A;  5FXY A;  3I89 A;  3OW8 A;  5H17 A;  2B4E A;  5IT9 g;  3P4F A;  2QC5 A;  1N6D A;  2UZY B;  3IIY A;  4GM3 A;  4JT6 C;  4ZOV A;  5I5I A;  3DM0 A;  3EI4 A;  4E54 B;  3AL9 A;  3KRX B;  1B9X A;  5JWZ A;  2AH0 A;  3RN1 D;  4J81 A;  5CYK B;  2H9P A;  2I3S A;  4I79 A;  3DWL C;  4Z8L A;  2HJB A;  4CI3 A;  5EM2 A;  4GGD A;  4A0B B;  5K1C C;  5SXM A;  4J87 A;  1JMX B;  4ESG A;  3EI1 B;  4AOW A;  2H9L A;  3F3F A;  2CNX A;  4E5Z B;  4G56 B;  2G9A A;  5AFU 3;  3JRP A;  3JRO A;  3SFZ A;  3PE7 A;  5CXC A;  5IGO A;  2P9I C;  2IWF A;  2UZX B;  1OMW B;  4BH6 A;  2H9M A;  4JXM A;  1XHM A;  1SQ9 A;  3SWS D;  2I0R A;  4L3G D;  4H5I A;  3I2N A;  5FQD A;  2OK4 A;  2H6N A;  3SN6 B;  2I0S A;  4O45 A;  3U4Y A;  1K32 A;  1FWX A;  4J73 A;  5CXB A;  4XEI C;  3F3P A;  5A2Q g;  5EAL A;  2HYE A;  2AGX A;  5TDH B;  4FA1 D;  2YMU A;  3C9C A;  4X61 B;  1GOT B;  3JZN A;  1K8K C;  1GG2 B;  4X60 B;  1ERJ A;  5CYK A;  2XYI A;  3I8E A;  4N14 A;  4ZOX A;  4CZX A;  4GZ8 A;  5EAM A;  4U1E I;  3I7L A;  3FRX A;  5B4W A;  3ULE C;  3EI1 A;  4GQ1 A;  1P22 A;  2IUP A;  4PNK B;  3EI4 B;  4Y5R D;  3RN0 D;  4A7J A;  4ERZ A;  2PBI B;  3MMY A;  1A0R B;  4QQE A;  4X63 B;  4JSV C;  4A08 A;  3EI3 A;  1TBG A;  2W18 A;  4PSW B;  5EM2 B;  2PM7 B;  3GRE A;  3NVQ A;  3C99 A;  2QXV A;  1QNI A;  5EAP A;  3L4O D;  4FA9 D;  3I7H A;  1MDA H;  4PSX B;  5HQG A;  2HES X;  4CC9 A;  4CZV A;  1Q47 A;  5CXC B;  4U7A A;  2AGZ A;  1YFQ A;  3B7F A;  4O9D A;  2G99 A;  3ODT A;  4JSX C;  4CI2 A;  5GSA A;  3J81 g;  1GP2 B;  4FA5 D;  4JSP C;  4GQ2 P;  2IWK A;  3BG1 A;  4FWW A;  3AL8 A;  3C75 H;  4J77 A;  3I7P A;  2CO0 A;  5HE3 B;  4CY1 A;  4CI1 A;  4A0A B;  2O9K A;  2OIZ A;  3UVL A;  4LG8 A;  5AJA A;  5TF2 A;  2AGY A;  2IUV A;  4EWR A;  2EBS A;  4J0W A;  3DXK C;  3CFS B;  2OK6 A;  3GFC A;  4J0X A;  4ERQ A;  5FKS A;  3JPX A;  4J79 A;  3JZH A;  4A09 A;  4KFM B;  3SJL D;  3W15 A;  4BUJ C;  5C9Z B;  2OVP B;  1PGU A;  5IJ8 E;  2H6Q A;  4O1Q D;  3UKU C;  4L9O A;  4A08 B;  3EI3 B;  1R5M A;  2GC4 A;  2IUR A;  2GC7 A;  3OKY A;  2AGW A;  4GM8 A;  1PI6 A;  4A2M A;  4ZOY A;  4K3J B;  1OLZ A;  2H47 A;  4LGN A;  2BCJ B;  3RSE C;  3SBP A;  3JAM g;  4J8G A;  2MTA H;  2AH1 A;  3RLM D;  5KDO B;  4GGA A;  4A0A A;  2OVQ B;  3NVX A;  3IJ0 A;  1JJU B;  1U4C A;  1XKS A;  3DSM A;  4GMB A;  4R7A B;  1GXR A;  2H6K A;  3IKO A;  3OL2 A;  1JMZ B;  1L0Q A;  3AL8 B;  2YNO A;  4XYH A;  3HFQ A;  1SQJ A;  2HXC A;  4ERY A;  4TZ4 A;  4A11 B;  3SBR A;  4PBZ A;  3CIK B;  3F3G A;  2B5M A;  3UR4 A;  3A0F A;  3MZL A;  2I3T A;  2OJY A;  3V5W B;  3I7N A;  3VGZ A;  3ORV D;  2J57 G;  2H13 A;  3N0E A;  4Y7R A;  3ZWL B;  3K27 A;  4A09 B;  1JOF A;  5C2V B;  4PC0 A;  3V7D B;  3E0C A;  3I8C A;  4CY3 A;  3V9F A;  5THA A;  2YNP A;  3IJ1 A;  3VH0 A;  4H5J A;  2HKR A;  3I7O A;  4K3I D;  4IMM A;  4BL0 A;  5IC7 A;  4QL1 A;  3OKT A;  2B5N A;  1N6F A;  3OKY B;  4OWR A;  5GXI A;  2P9U C;  4FAN D;  3PXT D;  5EML B;  3EMH A;  2Z2O A;  5HE2 B;  3PVW B;  4JD2 C;  2PM9 A;  1PBY B;  4JSN C;  2P9P C;  4FB1 D;  2HKM A;  2IUQ A;  3PVU B;  4ZOZ A;  4A11 A;  5FLX g;  5HE0 B;  3EI2 A;  3K26 A;  3BWS A;  2CO0 C;  3PSL A;  3CFV A;  3OL2 B;  2P9S C;  1N6E A;  3SMR A;  5K19 A;  3UKR C;  3EWE A;  3RFG A;  4D6V A;  2P9L C;  3SCY A;  5GXH A;  5HE1 B;  4A2L A;  4ZN4 A;  5GMK n;  1S4U X;  4QT8 A;  2Z2N A;  3UVK A;  3BG0 A;  1NEX B;  2Q7Q A;  5FKR A;  3PSC B;  4LG9 A;  3OTT A;  2H14 A;  1MG2 A;  3IIW A;  4GQB B;  5H14 A;  2H3X A;  2B5L A;  4OZU A;  2IAA A;  4D0K A;  4J78 A;  5FKT A;  3AFC A;  1SHY B;  3AH8 B;  1TYQ C;  4O3T B;  2GNQ A;  2HJ4 A;  5AMS A;  5FKQ A;  2CE9 A;  4L1Q D;  2YNN A;  3MKS B;  4CY5 A;  1MG3 A;  1B9Y A;  3C5M A;  3J80 g;  2PM9 B;  5I5J A;  4XYI A;  4AEZ A;  3RMZ D;  2TRC B;  5IGQ A;  2XU7 A;  4ES0 A;  4FA4 D;  3EI2 B;  1VYH C;  1U2V C;  2XL2 A;  5FA5 B;  3SHF A;  4CI8 A;  3EU7 A;  4YVD A;  2P9N C;  5EMM B;  3SBQ A;  3UVN A;  4E54 A;  1XIP A;  5IJ7 E;  3MXX A;  2CN2 A;  3EG6 A;  4FAV D;  5H1M A;  2H9N A;  3RFH A;  4JT5 C;  2I0T A;  2YB8 B;  3RRM C;  4QRJ A;  3PXS D;  5EMK B;  5HYN B;  4UI9 R;  3VA6 A;  4J84 A;  3JB9 L;  4A0B A;  2H68 A;  5I5M A;  3FGB A;  1PEV A;  3PXW D;  4J82 A;  2J56 H;  3SLE D;  3I7K A;  3JZG A;  5C2W B;  4O3U B;  4E5Z A;  3MKQ A;  4HDJ A;  5TEE A;  3FM0 A;  3L4M D;  5EMJ B;  3IJC A;  3N0D A;  2YBA A;  3UVM A;  2P9K C;  4GM9 A;  1RI6 A;  3SVW D;  2J55 H;  3DXM C;  1NR0 A;  2CE8 A;  2AGL A;  4X3E A;  4GGC A;  4FHL A;  3MZK A;  3KRW B;  4L3H D;  2AQ5 A;  4CY2 A;  2BBK H;  2CN3 A;  3OKW A; 
#chains in the Genus database with same CATH topology
 3NVN A;  2XL3 A;  2PM6 B;  4AMZ A;  2OVR B;  3V4P A;  4AN0 A;  3UVO A;  3SXT D;  3O4J A;  5HDB A;  1JV2 A;  5TEF A;  4NSX A;  1JTD B;  4J8B A;  4PXW A;  4CZY A;  5M5S A;  5M5R A;  4PBY A;  4J86 A;  3O4G A;  2Z2P A;  2WQ8 A;  5CXB B;  5EAR A;  4MK0 B;  4IA9 A;  5FXY A;  3I89 A;  5E6R A;  3GC3 B;  3OW8 A;  4IRZ A;  2VDR A;  5H17 A;  2B4E A;  5IT9 g;  3P4F A;  2QC5 A;  1N6D A;  2UZY B;  3IIY A;  3NID A;  4GM3 A;  4JT6 C;  4ZOV A;  5I5I A;  4MMZ A;  3DM0 A;  3EI4 A;  4E54 B;  5M5U A;  3AL9 A;  3KRX B;  1B9X A;  5JWZ A;  2AH0 A;  4MMX A;  3RN1 D;  1K3I A;  4J81 A;  5CYK B;  2H9P A;  2I3S A;  2VDO A;  3DWL C;  4I79 A;  4Z8L A;  2XE4 A;  2HJB A;  4CI3 A;  5EM2 A;  3K71 A;  4GGD A;  3VI4 A;  4A0B B;  5K1C C;  5SXM A;  4J87 A;  1JMX B;  4ESG A;  3EI1 B;  4MMY A;  4AOW A;  2VDP A;  2H9L A;  3F3F A;  2CNX A;  4E5Z B;  4G56 B;  1E8M A;  1TYE A;  2G9A A;  5AFU 3;  3JRP A;  3JRO A;  3SFZ A;  4G1M A;  3PE7 A;  5CXC A;  5IGO A;  1C9L A;  4AX4 A;  2P9I C;  3ZDZ A;  2IWF A;  2UZX B;  1OMW B;  4BH6 A;  2H9M A;  4JXM A;  1XHM A;  1SQ9 A;  3SWS D;  2I0R A;  4L3G D;  3IUJ A;  3I2N A;  4H5I A;  5FQD A;  2OK4 A;  2H6N A;  3SN6 B;  2I0S A;  4O45 A;  4Z7O A;  3U4Y A;  1K32 A;  1FWX A;  4J73 A;  5CXB A;  4XEI C;  3F3P A;  5A2Q g;  5EAL A;  2HYE A;  2AGX A;  5TDH B;  4FA1 D;  5FFO A;  2YMU A;  3C9C A;  4X61 B;  5FFG A;  1GOT B;  3IVM A;  3JZN A;  1K8K C;  3T3P A;  1GG2 B;  4X60 B;  1ERJ A;  5CYK A;  2XYI A;  3I8E A;  4N14 A;  1VE6 A;  4ZOX A;  2BKL A;  4CZX A;  3NIF A;  4GZ8 A;  1O6G A;  5EAM A;  4U1E I;  3I7L A;  3FRX A;  5B4W A;  3ULE C;  3EI1 A;  4GQ1 A;  1P22 A;  2IUP A;  4PNK B;  3EI4 B;  4Y5R D;  3RN0 D;  1H2X A;  4A7J A;  4ERZ A;  2PBI B;  3MMY A;  4NAA A;  1A0R B;  4QQE A;  4X63 B;  4JSV C;  4A08 A;  3EI3 A;  4DNW A;  3IUR A;  3ZE0 A;  1TBG A;  2W18 A;  4PSW B;  5M5V A;  5EM2 B;  2PM7 B;  3GRE A;  4UM8 A;  3NVQ A;  3C99 A;  2QXV A;  3EQ7 A;  3IUM A;  1QNI A;  5EAP A;  3L4O D;  4FA9 D;  3I7H A;  1MDA H;  4PSX B;  5HQG A;  2HES X;  4CC9 A;  4CZV A;  1Q47 A;  5CXC B;  2XZG A;  4U7A A;  2AGZ A;  1YFQ A;  2VDM A;  1VZ3 A;  3B7F A;  4O9D A;  2G99 A;  3ODT A;  4JSX C;  4CI2 A;  5GSA A;  3J81 g;  3O4H A;  1GP2 B;  4FA5 D;  4JSP C;  4GQ2 P;  3EQ9 A;  2IWK A;  3BG1 A;  4FWW A;  3AL8 A;  3C75 H;  3KCI A;  3IUN A;  4J77 A;  3I7P A;  2CO0 A;  5HE3 B;  1I2M B;  4CY1 A;  4CI1 A;  4A0A B;  2O9K A;  2OIZ A;  3UVL A;  3ZE2 A;  3ZDX A;  3K72 A;  3MUO A;  4LG8 A;  5AJA A;  2EIC A;  2AGY A;  5TF2 A;  2IUV A;  4EWR A;  2EBS A;  4J0W A;  1E5T A;  3DXK C;  3CFS B;  2OK6 A;  3QHY B;  3GFC A;  4J0X A;  4QAM A;  5FKS A;  4ERQ A;  3JPX A;  4J79 A;  3JZH A;  4A09 A;  4KFM B;  3GD1 I;  3SJL D;  3W15 A;  4BUJ C;  5C9Z B;  2OVP B;  1PGU A;  5IJ8 E;  3MVD K;  2H6Q A;  4O1Q D;  3UKU C;  4L9O A;  4A08 B;  3EI3 B;  1R5M A;  2GC4 A;  2IUR A;  2GC7 A;  1GOH A;  3OKY A;  2AGW A;  4GM8 A;  1PI6 A;  5C86 A;  1UOO A;  4WJK A;  4A2M A;  4ZOY A;  4NEN A;  4K3J B;  5M61 A;  1OLZ A;  2H47 A;  4LGN A;  2BCJ B;  3RSE C;  3SBP A;  4Z7Q A;  3JAM g;  4J8G A;  1E8N A;  2MTA H;  1H2W A;  2AH1 A;  3RLM D;  5KDO B;  4BP9 A;  4GGA A;  4A0A A;  2OVQ B;  3NVX A;  3IJ0 A;  2EID A;  1JJU B;  1U4C A;  1XKS A;  3DSM A;  3O4I A;  4GMB A;  4R7A B;  1VZ2 A;  1BPO A;  1GXR A;  2H6K A;  3NIG A;  4G1E A;  3IKO A;  1QFS A;  3OL2 A;  1JMZ B;  3IJE A;  4UM9 A;  4D9S A;  1L0Q A;  3AL8 B;  4WK2 A;  4NC4 A;  2YNO A;  2QR5 A;  4XYH A;  3HFQ A;  1SQJ A;  2HXC A;  4ERY A;  4TZ4 A;  4A11 B;  2VDN A;  5E6S A;  1UOP A;  4BCC A;  3SBR A;  4PBZ A;  3CIK B;  3F3G A;  2B5M A;  3UR4 A;  3A0F A;  3MZL A;  2VDL A;  2I3T A;  4AN1 A;  2OJY A;  3IUL A;  3V5W B;  3I7N A;  3VGZ A;  3ORV D;  2J57 G;  2H13 A;  3N0E A;  4Y7R A;  3ZWL B;  3K27 A;  3T3M A;  4A09 B;  1JOF A;  5C2V B;  3VI3 A;  4PC0 A;  3V7D B;  3E0C A;  2EIB A;  3I8C A;  4CY3 A;  3V9F A;  5THA A;  2YNP A;  3IJ1 A;  3VH0 A;  4BCD A;  4H5J A;  2HKR A;  3I7O A;  4K3I D;  4IMM A;  4BL0 A;  5IC7 A;  4QL1 A;  3OKT A;  2B5N A;  1N6F A;  3OKY B;  4OWR A;  1H2Y A;  4DNU A;  5GXI A;  2P9U C;  1VE7 A;  1H2Z A;  4FAN D;  3PXT D;  4WK4 A;  5EML B;  3EMH A;  2Z2O A;  5HE2 B;  3PVW B;  4JD2 C;  2PM9 A;  1U8C A;  1PBY B;  4JSN C;  2P9P C;  4FB1 D;  1L5G A;  3K6S A;  2HKM A;  2IUQ A;  3PVU B;  4ZOZ A;  4A11 A;  5FLX g;  5HE0 B;  3EI2 A;  3K26 A;  3BWS A;  2HU8 A;  2CO0 C;  3PSL A;  3CFV A;  4NBM A;  1QFM A;  3OL2 B;  2P9S C;  1N6E A;  3SMR A;  5K19 A;  3UKR C;  3EWE A;  3RFG A;  4D6V A;  2VZ3 A;  2VDQ A;  2P9L C;  3SCY A;  5GXH A;  5HE1 B;  4A2L A;  4ZN4 A;  5GMK n;  1S4U X;  4QT8 A;  2Z2N A;  3UVK A;  3BG0 A;  3EQ8 A;  1NEX B;  2Q7Q A;  5FKR A;  3PSC B;  5C92 A;  3FCS A;  4LG9 A;  3OTT A;  2H14 A;  1MG2 A;  3IIW A;  2HU7 A;  4GQB B;  5H14 A;  4BCB A;  2H3X A;  2B5L A;  4OZU A;  2IAA A;  1C9I A;  4DNV A;  4D0K A;  4J78 A;  5FKT A;  3AFC A;  1SHY B;  3AH8 B;  5M5T A;  1TYQ C;  4O3T B;  2GNQ A;  1YR2 A;  2HJ4 A;  4RE6 A;  5AMS A;  3QI0 A;  5FKQ A;  2VDK A;  2CE9 A;  4L1Q D;  1O6F A;  2YNN A;  3MKS B;  3ZDY A;  4CY5 A;  1MG3 A;  1B9Y A;  3C5M A;  4Z7N A;  2EIE A;  4L1M A;  3J80 g;  2XDW A;  1A12 A;  2PM9 B;  5I5J A;  1UOQ A;  4XYI A;  3FCU A;  4AEZ A;  3RMZ D;  2TRC B;  2JKX A;  5IGQ A;  2XU7 A;  4ES0 A;  4FA4 D;  3DDU A;  4O02 A;  3EI2 B;  1VYH C;  1U2V C;  4JHN A;  2XL2 A;  5FA5 B;  5E6U A;  3SHF A;  3EU7 A;  4CI8 A;  4YVD A;  2P9N C;  3ZE1 A;  5EMM B;  3SBQ A;  3UVN A;  2QZP A;  4E54 A;  1XIP A;  4G55 A;  5IJ7 E;  3MXX A;  2CN2 A;  3EG6 A;  4FAV D;  4O2W A;  3MUN A;  5H1M A;  2H9N A;  3RFH A;  1GOG A;  2VC2 A;  2HU5 A;  4JT5 C;  2I0T A;  2YB8 B;  3RRM C;  3IUQ A;  4QRJ A;  3PXS D;  1M1X A;  4RE5 A;  4UI9 R;  5EMK B;  4J84 A;  3VA6 A;  1GOF A;  4AMY A;  5HYN B;  4A0B A;  3JB9 L;  2H68 A;  4BP8 A;  5I5M A;  3FGB A;  1PEV A;  3PXW D;  4J82 A;  2J56 H;  3SLE D;  3I7K A;  3JZG A;  5C2W B;  4O3U B;  4JHP C;  4E5Z A;  3MKQ A;  4HDJ A;  5TEE A;  3FM0 A;  3L4M D;  5EMJ B;  3IJC A;  3N0D A;  2YBA A;  3UVM A;  2P9K C;  4GM9 A;  1RI6 A;  3SVW D;  3OF7 A;  2VZ1 A;  2J55 H;  3DXM C;  1NR0 A;  2CE8 A;  1T2X A;  2AGL A;  4X3E A;  4GGC A;  4FHL A;  3MZK A;  3KRW B;  4L3H D;  2AQ5 A;  4CY2 A;  3V4V A;  2BBK H;  2CN3 A;  3OKW A;  1UTC A;  4WK0 A; 
#chains in the Genus database with same CATH homology
 3NVN A;  2XL3 A;  2PM6 B;  2OVR B;  3UVO A;  3SXT D;  5TEF A;  4NSX A;  4J8B A;  4PXW A;  4CZY A;  4PBY A;  4J86 A;  2Z2P A;  5CXB B;  5EAR A;  4MK0 B;  4IA9 A;  5FXY A;  3I89 A;  3OW8 A;  5H17 A;  2B4E A;  5IT9 g;  3P4F A;  2QC5 A;  1N6D A;  2UZY B;  3IIY A;  4GM3 A;  4JT6 C;  4ZOV A;  5I5I A;  3DM0 A;  3EI4 A;  4E54 B;  3AL9 A;  3KRX B;  1B9X A;  5JWZ A;  2AH0 A;  3RN1 D;  4J81 A;  5CYK B;  2H9P A;  2I3S A;  4I79 A;  3DWL C;  4Z8L A;  2HJB A;  4CI3 A;  5EM2 A;  4GGD A;  4A0B B;  5K1C C;  5SXM A;  4J87 A;  1JMX B;  4ESG A;  3EI1 B;  4AOW A;  2H9L A;  3F3F A;  2CNX A;  4E5Z B;  4G56 B;  2G9A A;  5AFU 3;  3JRP A;  3JRO A;  3SFZ A;  3PE7 A;  5CXC A;  5IGO A;  2P9I C;  2IWF A;  2UZX B;  1OMW B;  4BH6 A;  2H9M A;  4JXM A;  1XHM A;  1SQ9 A;  3SWS D;  2I0R A;  4L3G D;  4H5I A;  3I2N A;  5FQD A;  2OK4 A;  2H6N A;  3SN6 B;  2I0S A;  4O45 A;  3U4Y A;  1K32 A;  1FWX A;  4J73 A;  5CXB A;  4XEI C;  3F3P A;  5A2Q g;  5EAL A;  2HYE A;  2AGX A;  5TDH B;  4FA1 D;  2YMU A;  3C9C A;  4X61 B;  1GOT B;  3JZN A;  1K8K C;  1GG2 B;  4X60 B;  1ERJ A;  5CYK A;  2XYI A;  3I8E A;  4N14 A;  4ZOX A;  4CZX A;  4GZ8 A;  5EAM A;  4U1E I;  3I7L A;  3FRX A;  5B4W A;  3ULE C;  3EI1 A;  4GQ1 A;  1P22 A;  2IUP A;  4PNK B;  3EI4 B;  4Y5R D;  3RN0 D;  4A7J A;  4ERZ A;  2PBI B;  3MMY A;  1A0R B;  4QQE A;  4X63 B;  4JSV C;  4A08 A;  3EI3 A;  1TBG A;  2W18 A;  4PSW B;  5EM2 B;  2PM7 B;  3GRE A;  3NVQ A;  3C99 A;  2QXV A;  1QNI A;  5EAP A;  3L4O D;  4FA9 D;  3I7H A;  1MDA H;  4PSX B;  5HQG A;  2HES X;  4CC9 A;  4CZV A;  1Q47 A;  5CXC B;  4U7A A;  2AGZ A;  1YFQ A;  3B7F A;  4O9D A;  2G99 A;  3ODT A;  4JSX C;  4CI2 A;  5GSA A;  3J81 g;  1GP2 B;  4FA5 D;  4JSP C;  4GQ2 P;  2IWK A;  3BG1 A;  4FWW A;  3AL8 A;  3C75 H;  4J77 A;  3I7P A;  2CO0 A;  5HE3 B;  4CY1 A;  4CI1 A;  4A0A B;  2O9K A;  2OIZ A;  3UVL A;  4LG8 A;  5AJA A;  5TF2 A;  2AGY A;  2IUV A;  4EWR A;  2EBS A;  4J0W A;  3DXK C;  3CFS B;  2OK6 A;  3GFC A;  4J0X A;  4ERQ A;  5FKS A;  3JPX A;  4J79 A;  3JZH A;  4A09 A;  4KFM B;  3SJL D;  3W15 A;  4BUJ C;  5C9Z B;  2OVP B;  1PGU A;  5IJ8 E;  2H6Q A;  4O1Q D;  3UKU C;  4L9O A;  4A08 B;  3EI3 B;  1R5M A;  2GC4 A;  2IUR A;  2GC7 A;  3OKY A;  2AGW A;  4GM8 A;  1PI6 A;  4A2M A;  4ZOY A;  4K3J B;  1OLZ A;  2H47 A;  4LGN A;  2BCJ B;  3RSE C;  3SBP A;  3JAM g;  4J8G A;  2MTA H;  2AH1 A;  3RLM D;  5KDO B;  4GGA A;  4A0A A;  2OVQ B;  3NVX A;  3IJ0 A;  1JJU B;  1U4C A;  1XKS A;  3DSM A;  4GMB A;  4R7A B;  1GXR A;  2H6K A;  3IKO A;  3OL2 A;  1JMZ B;  1L0Q A;  3AL8 B;  2YNO A;  4XYH A;  3HFQ A;  1SQJ A;  2HXC A;  4ERY A;  4TZ4 A;  4A11 B;  3SBR A;  4PBZ A;  3CIK B;  3F3G A;  2B5M A;  3UR4 A;  3A0F A;  3MZL A;  2I3T A;  2OJY A;  3V5W B;  3I7N A;  3VGZ A;  3ORV D;  2J57 G;  2H13 A;  3N0E A;  4Y7R A;  3ZWL B;  3K27 A;  4A09 B;  1JOF A;  5C2V B;  4PC0 A;  3V7D B;  3E0C A;  3I8C A;  4CY3 A;  3V9F A;  5THA A;  2YNP A;  3IJ1 A;  3VH0 A;  4H5J A;  2HKR A;  3I7O A;  4K3I D;  4IMM A;  4BL0 A;  5IC7 A;  4QL1 A;  3OKT A;  2B5N A;  1N6F A;  3OKY B;  4OWR A;  5GXI A;  2P9U C;  4FAN D;  3PXT D;  5EML B;  3EMH A;  2Z2O A;  5HE2 B;  3PVW B;  4JD2 C;  2PM9 A;  1PBY B;  4JSN C;  2P9P C;  4FB1 D;  2HKM A;  2IUQ A;  3PVU B;  4ZOZ A;  4A11 A;  5FLX g;  5HE0 B;  3EI2 A;  3K26 A;  3BWS A;  2CO0 C;  3PSL A;  3CFV A;  3OL2 B;  2P9S C;  1N6E A;  3SMR A;  5K19 A;  3UKR C;  3EWE A;  3RFG A;  4D6V A;  2P9L C;  3SCY A;  5GXH A;  5HE1 B;  4A2L A;  4ZN4 A;  5GMK n;  1S4U X;  4QT8 A;  2Z2N A;  3UVK A;  3BG0 A;  1NEX B;  2Q7Q A;  5FKR A;  3PSC B;  4LG9 A;  3OTT A;  2H14 A;  1MG2 A;  3IIW A;  4GQB B;  5H14 A;  2H3X A;  2B5L A;  4OZU A;  2IAA A;  4D0K A;  4J78 A;  5FKT A;  3AFC A;  1SHY B;  3AH8 B;  1TYQ C;  4O3T B;  2GNQ A;  2HJ4 A;  5AMS A;  5FKQ A;  2CE9 A;  4L1Q D;  2YNN A;  3MKS B;  4CY5 A;  1MG3 A;  1B9Y A;  3C5M A;  3J80 g;  2PM9 B;  5I5J A;  4XYI A;  4AEZ A;  3RMZ D;  2TRC B;  5IGQ A;  2XU7 A;  4ES0 A;  4FA4 D;  3EI2 B;  1VYH C;  1U2V C;  2XL2 A;  5FA5 B;  3SHF A;  4CI8 A;  3EU7 A;  4YVD A;  2P9N C;  5EMM B;  3SBQ A;  3UVN A;  4E54 A;  1XIP A;  5IJ7 E;  3MXX A;  2CN2 A;  3EG6 A;  4FAV D;  5H1M A;  2H9N A;  3RFH A;  4JT5 C;  2I0T A;  2YB8 B;  3RRM C;  4QRJ A;  3PXS D;  5EMK B;  5HYN B;  4UI9 R;  3VA6 A;  4J84 A;  3JB9 L;  4A0B A;  2H68 A;  5I5M A;  3FGB A;  1PEV A;  3PXW D;  4J82 A;  2J56 H;  3SLE D;  3I7K A;  3JZG A;  5C2W B;  4O3U B;  4E5Z A;  3MKQ A;  4HDJ A;  5TEE A;  3FM0 A;  3L4M D;  5EMJ B;  3IJC A;  3N0D A;  2YBA A;  3UVM A;  2P9K C;  4GM9 A;  1RI6 A;  3SVW D;  2J55 H;  3DXM C;  1NR0 A;  2CE8 A;  2AGL A;  4X3E A;  4GGC A;  4FHL A;  3MZK A;  3KRW B;  4L3H D;  2AQ5 A;  4CY2 A;  2BBK H;  2CN3 A;  3OKW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...