5EAPA

Crystal structure of human wdr5 in complex with compound 9e
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
312
structure length
310
Chain Sequence
GTQSKPTPVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD repeat-containing protein 5
publication title Structure-Based Optimization of a Small Molecule Antagonist of the Interaction Between WD Repeat-Containing Protein 5 (WDR5) and Mixed-Lineage Leukemia 1 (MLL1).
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/transcription inhibitor
total genus 106
structure length 310
sequence length 312
ec nomenclature
pdb deposition date 2015-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5eapA00
2OVPB 4ERZA 1PEVA 3PXWD 4H5JA 4CY3A 1SHYB 2PM7B 4FA9D 3U4YA 5IC7A 2G99A 3C75H 3FM0A 3B7FA 4CI8A 4XYIA 5A2Qg 1XHMA 2HKRA 4GM8A 5FLXg 3DSMA 4KFMB 5FKSA 3SMRA 5C9ZB 2J55H 3OKYA 4OWRA 4CZXA 3IJ1A 4O3TB 3DM0A 1GG2B 2O9KA 4O45A 4R7AB 3I7NA 2H3XA 4GGCA 4E5ZB 5JWZA 4NSXA 4QQEA 1SQJA 1GXRA 3RFGA 3EI3B 3K26A 3EWEA 3EI4A 3RN1D 2BCJB 3F3GA 5IGOA 2H9NA 4A0BB 3SBQA 2Z2PA 2YNNA 3IIYA 2GC4A 2Z2OA 3BG1A 5FKTA 3AH8B 4J86A 4JD2C 4A0AB 2IUQA 3FRXA 2H14A 2OIZA 3RRMC 3IKOA 4HDJA 2I0RA 3UVKA 1TYQC 3RSEC 2AGYA 1PGUA 4JT6C 5CYKA 2PM9A 1MG3A 2H6QA 2CE8A 4ZOZA 3RN0D 3SWSD 4CY2A 5C2WB 4FA4D 2HESX 2OVQB 4CY1A 1XIPA 4CZYA 2AH0A 2P9IC 5EMKB 3ORVD 4L3HD 1PBYB 2OJYA 5GMKn 5IJ7E 1P22A 1MG2A 3JPXA 1NR0A 4PBZA 4J84A 1TBGA 3PSCB 4D6VA 5HQGA 4OZUA 5I5JA 1B9YA 2AGWA 4XEIC 1QNIA 1U4CA 4IA9A 4PSWB 4CZVA 1YFQA 3DWLC 3V7DB 2OK6A 3OL2B 3JZGA 3DXMC 4I79A 2CNXA 5CXCA 2CO0A 4GQ2P 4J87A 3NVNA 1XKSA 4GQBB 2I0TA 4J82A 3PXTD 5EARA 5FQDA 3OKYB 5H14A 2P9LC 3EMHA 4CI2A 4GQ1A 2HXCA 4FB1D 4QL1A 2XU7A 3RMZD 2QXVA 3C99A 1N6FA 3PVWB 3SFZA 4IMMA 4A11A 2AGXA 2PBIB 4Z8LA 4J78A 4FAVD 3EI4B 2YMUA 5IJ8E 4ZN4A 3I7HA 3DXKC 3C5MA 2J57G 3C9CA 4JXMA 3L4OD 5EAMA 3I8EA 5THAA 4AOWA 2H9LA 5AJAA 2H13A 3A0FA 4E54B 3VH0A 2B5LA 3ULEC 4CC9A 3I2NA 4CI3A 1B9XA 4JSVC 4CY5A 1OMWB 3AL9A 4FA1D 5EALA 2P9PC 3SN6B 3UVNA 4A08B 2HYEA 3CFSB 2PM9B 5I5MA 2UZXB 4MK0B 4N14A 5AFU3 4JT5C 5H17A 3SXTD 4PXWA 2IAAA 5FKQA 2BBKH 4JSPC 4QT8A 4FA5D 4PC0A 3W15A 4X60B 3SBPA 1RI6A 1GOTB 2I3TA 2P9UC 1N6DA 4GZ8A 3IJ0A 3SHFA 4CI1A 3IJCA 2AGLA 2B5NA 4XYHA 3AFCA 3I7KA 4X3EA 4L3GD 2YB8B 1S4UX 3FGBA 3MKSB 3MZKA 4ERQA 2H9PA 4G56B 3UVLA 3J80g 2H6KA 3EI3A 2XL2A 4GGAA 5GXHA 2B4EA 3UVOA 3MMYA 2I3SA 1K32A 3UKUC 2P9KC 2CO0C 4A0BA 3HFQA 4U7AA 4J8GA 3K27A 4FWWA 5HE2B 2IWFA 1N6EA 3OKTA 3I7LA 1K8KC 1MDAH 2Z2NA 3IIWA 2HJBA 1A0RB 2CE9A 3EI1A 3EI2A 2CN3A 4X63B 5AMSA 1FWXA 4BL0A 3OW8A 4A11B 2OVRB 5TEFA 3RLMD 2Q7QA 3VGZA 2XYIA 3PXSD 4Y7RA 1Q47A 4GM3A 4U1EI 3SLED 3JZHA 3N0EA 5CXBA 3V9FA 2G9AA 3AL8A 5TEEA 3MZLA 5SXMA 5K19A 4GM9A 4BUJC 5EMMB 4QRJA 2GC7A 3NVXA 2EBSA 3JROA 4JSXC 4GMBA 3F3PA 5EMJB 1OLZA 3N0DA 3F3FA 2MTAH 3ODTA 3PVUB 4JSNC 4ERYA 2TRCB 3P4FA 4O3UB 3MKQA 1JOFA 4YVDA 4ZOXA 4A09A 5K1CC 2AGZA 2IURA 4J81A 1NEXB 5GSAA 3ZWLB 4D0KA 2YBAA 5FA5B 3GREA 2I0SA 4AEZA 5HYNB 3JRPA 5CYKB 3SVWD 5EM2A 3VA6A 1JMXB 4J0XA 3L4MD 4A2MA 2H9MA 3MXXA 3EU7A 4A7JA 1L0QA 4FAND 3BG0A 2B5MA 3NVQA 4LGNA 1JMZB 1VYHC 5KDOB 3GFCA 3RFHA 3SJLD 1ERJA 5FXYA 2IUVA 3E0CA 3SBRA 4J79A 2GNQA 4PNKB 4K3JB 4O9DA 5FKRA 1R5MA 3I89A 4E54A 4E5ZA 1PI6A 2UZYB 4J8BA 4ZOVA 2YNOA 3EI1B 3EI2B 4O1QD 4UI9R 4A08A 3OTTA 5CXCB 2QC5A 5EMLB 3UVMA 2H6NA 5IGQA 2OK4A 4Y5RD 5GXIA 3PSLA 1SQ9A 3KRWB 5HE3B 4A0AA 3CIKB 3I8CA 4J77A 3UR4A 4H5IA 3V5WB 5CXBB 4X61B 3AL8B 4ZOYA 3PE7A 4TZ4A 1JJUB 4FHLA 5HE0B 4LG9A 5TF2A 3JZNA 5EAPA 4ES0A 3EG6A 2CN2A 3J81g 4L9OA 1GP2B 3UKRC 5TDHB 4J0WA 3OKWA 2PM6B 2IWKA 3I7PA 4K3ID 2P9SC 4L1QD 4BH6A 4PBYA 2AH1A 5IT9g 2H68A 2H47A 4A09B 4A2LA 2XL3A 1U2VC 4ESGA 2HKMA 2AQ5A 2J56H 5H1MA 2YNPA 3JAMg 3CFVA 4J73A 4PSXB 3JB9L 4EWRA 5HE1B 2P9NC 5B4WA 3BWSA 3KRXB 4GGDA 2IUPA 3I7OA 2HJ4A 4LG8A 5I5IA 5EM2B 2W18A 3SCYA 5C2VB 3OL2A
chains in the Genus database with same CATH superfamily
1VZ3A 2OVPB 4ERZA 1PEVA 1O6FA 3PXWD 4H5JA 4CY3A 1SHYB 2PM7B 4FA9D 5M5RA 3U4YA 5IC7A 2G99A 3C75H 3FM0A 3B7FA 4CI8A 4XYIA 5A2Qg 1XHMA 2HKRA 4GM8A 5FLXg 3DSMA 4NBMA 4KFMB 5FKSA 3SMRA 1C9IA 5C9ZB 2J55H 3GC3B 3OKYA 4OWRA 4CZXA 4AMZA 3IJ1A 4O3TB 3DM0A 1GG2B 1GOGA 2O9KA 4O45A 4R7AB 3I7NA 2H3XA 2VC2A 3VI4A 4GGCA 4WJKA 4E5ZB 5JWZA 4NSXA 4QQEA 4WK4A 3QHYB 1SQJA 1GXRA 3RFGA 2VDRA 3EI3B 3K26A 4QAMA 1YR2A 3EWEA 3EI4A 3RN1D 2BCJB 2VZ1A 3F3GA 5IGOA 2EIDA 2H9NA 4A0BB 1U8CA 3SBQA 1H2WA 2Z2PA 2YNNA 3IIYA 2GC4A 1UTCA 2Z2OA 3BG1A 5FKTA 3K6SA 3AH8B 4J86A 4BCBA 4JD2C 4A0AB 1JV2A 5E6SA 2IUQA 3FRXA 2H14A 2OIZA 4JHPC 3RRMC 3IKOA 4HDJA 2I0RA 2XDWA 3UVKA 1TYQC 3RSEC 3T3MA 2AGYA 1PGUA 4JT6C 1K3IA 5CYKA 2PM9A 2VDQA 1MG3A 2H6QA 2CE8A 4ZOZA 3RN0D 3SWSD 4CY2A 4Z7NA 1VE7A 5C2WB 4FA4D 3NIFA 3T3PA 2HESX 2OVQB 4CY1A 4D9SA 1XIPA 4CZYA 2VDOA 4BP9A 5C86A 2AH0A 2P9IC 1UOOA 5EMKB 3ORVD 4L3HD 1PBYB 2OJYA 2VZ3A 5GMKn 5IJ7E 1P22A 1MG2A 3JPXA 1E5TA 2HU7A 2HU5A 1NR0A 4PBZA 4J84A 2VDLA 5FFOA 1TBGA 3PSCB 4D6VA 2VDKA 5HQGA 4OZUA 5I5JA 1B9YA 2AGWA 4XEIC 1QNIA 1U4CA 4IA9A 4AN1A 4PSWB 4CZVA 1YFQA 3DWLC 3V7DB 2OK6A 3OL2B 3EQ7A 4G55A 3JZGA 4O2WA 1E8MA 1GOFA 3DXMC 4I79A 2CNXA 5CXCA 2CO0A 4GQ2P 3MUNA 4J87A 3NVNA 1XKSA 4DNWA 4GQBB 2XE4A 1T2XA 2I0TA 4J82A 3PXTD 4RE5A 5EARA 5FQDA 3OKYB 5H14A 2P9LC 3EMHA 4CI2A 3GD1I 4GQ1A 2HXCA 4FB1D 4QL1A 2XU7A 3RMZD 4AMYA 2QXVA 3C99A 1N6FA 3PVWB 3SFZA 4IMMA 5HDBA 4A11A 2AGXA 2PBIB 1L5GA 4Z8LA 1VE6A 4J78A 4FAVD 3EI4B 2YMUA 5IJ8E 4ZN4A 3I7HA 3ZE1A 3DXKC 3C5MA 3IVMA 2J57G 3C9CA 4JXMA 3L4OD 5EAMA 3DDUA 5FFGA 2XZGA 3I8EA 4O02A 5THAA 4G1MA 4AOWA 2H9LA 5AJAA 2H13A 3A0FA 4E54B 3VH0A 3QI0A 4MMYA 2B5LA 3ULEC 4CC9A 3I2NA 3ZDYA 4CI3A 1B9XA 4JSVC 4CY5A 1OMWB 3AL9A 4FA1D 5EALA 2P9PC 5E6UA 3SN6B 1UOPA 3UVNA 4A08B 2HYEA 3CFSB 2PM9B 5I5MA 2UZXB 4MK0B 4N14A 5AFU3 4JT5C 5H17A 3V4PA 3SXTD 4WK0A 4PXWA 2IAAA 5FKQA 4MMXA 1TYEA 2BBKH 2QR5A 4JSPC 4QT8A 4FA5D 4PC0A 3ZE2A 3W15A 4Z7OA 2BKLA 4X60B 3SBPA 1RI6A 1GOTB 2I3TA 2P9UC 1N6DA 1QFSA 3KCIA 4GZ8A 1H2XA 3IJ0A 3SHFA 4CI1A 3IJCA 2AGLA 2B5NA 4JHNA 4XYHA 3AFCA 3I7KA 1JTDB 4X3EA 4L3GD 2YB8B 1S4UX 3FGBA 3MKSB 3MZKA 4ERQA 2H9PA 4G56B 3UVLA 3J80g 2H6KA 3EI3A 2XL2A 4GGAA 3NIGA 5GXHA 2B4EA 5E6RA 3UVOA 4WK2A 3MMYA 2I3SA 4UM9A 1K32A 3UKUC 2P9KC 2CO0C 3K72A 4A0BA 3HFQA 1VZ2A 4U7AA 3IUMA 2HU8A 4J8GA 3K27A 4RE6A 4FWWA 4UM8A 5HE2B 2IWFA 1N6EA 3OKTA 3I7LA 1E8NA 1K8KC 1MDAH 2Z2NA 3IIWA 2HJBA 1A0RB 4IRZA 2CE9A 3EI1A 3EI2A 2CN3A 4X63B 5AMSA 1FWXA 4BL0A 3OW8A 4A11B 4Z7QA 2OVRB 3IUNA 5TEFA 3FCSA 3RLMD 2Q7QA 3VGZA 2WQ8A 2XYIA 3PXSD 4Y7RA 1Q47A 4GM3A 3ZE0A 4U1EI 2EIBA 3SLED 5M61A 3IUJA 3JZHA 3K71A 3N0EA 5CXBA 3V9FA 2G9AA 3AL8A 5TEEA 3MZLA 5SXMA 3ZDZA 5K19A 4GM9A 4BUJC 5EMMB 4QRJA 5M5SA 2GC7A 3NVXA 2EBSA 4BCDA 3JROA 4JSXC 4GMBA 1QFMA 3F3PA 5EMJB 1UOQA 1OLZA 5M5VA 3N0DA 3F3FA 2MTAH 3ODTA 3PVUB 4JSNC 4ERYA 2TRCB 3P4FA 4O3UB 3MKQA 1JOFA 3O4HA 4YVDA 4ZOXA 4A09A 5K1CC 2AGZA 4BP8A 2IURA 4J81A 3OF7A 1NEXB 1O6GA 3EQ8A 5GSAA 3ZWLB 4D0KA 2YBAA 5FA5B 3GREA 2I0SA 4AEZA 4DNUA 5HYNB 3JRPA 5CYKB 3SVWD 5EM2A 1BPOA 3VA6A 1JMXB 4J0XA 3L4MD 4A2MA 5C92A 3ZDXA 2H9MA 3MXXA 1C9LA 3EU7A 4A7JA 1L0QA 4FAND 3BG0A 2B5MA 4BCCA 3NVQA 4LGNA 5M5UA 1JMZB 1VYHC 5KDOB 3GFCA 3RFHA 3SJLD 1ERJA 5FXYA 2IUVA 3E0CA 3SBRA 2VDMA 4J79A 2GNQA 4PNKB 4K3JB 3NIDA 4DNVA 4O9DA 5FKRA 1R5MA 1I2MB 3I89A 2EIEA 3IURA 4AX4A 4E54A 4E5ZA 1PI6A 2UZYB 2JKXA 4J8BA 3MVDK 4ZOVA 2YNOA 1H2ZA 2VDPA 3EI1B 3EI2B 4O1QD 3IJEA 4UI9R 4A08A 3OTTA 5CXCB 1A12A 1GOHA 2QC5A 5EMLB 3UVMA 3MUOA 2H6NA 5IGQA 4G1EA 2OK4A 4Y5RD 5GXIA 3PSLA 1SQ9A 5M5TA 3KRWB 5HE3B 4NAAA 4A0AA 3CIKB 3O4IA 3I8CA 2EICA 4J77A 3UR4A 3FCUA 4H5IA 3V5WB 5CXBB 4X61B 3AL8B 3V4VA 2QZPA 4ZOYA 3PE7A 3IULA 4TZ4A 1JJUB 3VI3A 4FHLA 3O4JA 4L1MA 5HE0B 4LG9A 5TF2A 4AN0A 3JZNA 5EAPA 4ES0A 3EG6A 2CN2A 3J81g 4L9OA 1GP2B 3UKRC 5TDHB 4J0WA 4NC4A 3OKWA 2PM6B 2IWKA 3EQ9A 3I7PA 3IUQA 4K3ID 2P9SC 4L1QD 4BH6A 4PBYA 2AH1A 1H2YA 5IT9g 2H68A 2H47A 3O4GA 4A09B 4A2LA 2XL3A 1U2VC 2VDNA 4ESGA 2HKMA 2AQ5A 2J56H 5H1MA 2YNPA 3JAMg 3CFVA 4J73A 4PSXB 3JB9L 4EWRA 4NENA 5HE1B 2P9NC 5B4WA 3BWSA 3KRXB 4GGDA 1M1XA 2IUPA 3I7OA 2HJ4A 4LG8A 5I5IA 5EM2B 2W18A 3SCYA 4MMZA 5C2VB 3OL2A
chains in the Genus database with same CATH topology
2OVPB 4ERZA 1PEVA 3PXWD 4H5JA 4CY3A 1SHYB 2PM7B 4FA9D 3U4YA 5IC7A 2G99A 3C75H 3FM0A 3B7FA 4CI8A 4XYIA 5A2Qg 1XHMA 2HKRA 4GM8A 5FLXg 3DSMA 4KFMB 5FKSA 3SMRA 5C9ZB 2J55H 3OKYA 4OWRA 4CZXA 3IJ1A 4O3TB 3DM0A 1GG2B 2O9KA 4O45A 4R7AB 3I7NA 2H3XA 4GGCA 4E5ZB 5JWZA 4NSXA 4QQEA 1SQJA 1GXRA 3RFGA 3EI3B 3K26A 3EWEA 3EI4A 3RN1D 2BCJB 3F3GA 5IGOA 2H9NA 4A0BB 3SBQA 2Z2PA 2YNNA 3IIYA 2GC4A 2Z2OA 3BG1A 5FKTA 3AH8B 4J86A 4JD2C 4A0AB 2IUQA 3FRXA 2H14A 2OIZA 3RRMC 3IKOA 4HDJA 2I0RA 3UVKA 1TYQC 3RSEC 2AGYA 1PGUA 4JT6C 5CYKA 2PM9A 1MG3A 2H6QA 2CE8A 4ZOZA 3RN0D 3SWSD 4CY2A 5C2WB 4FA4D 2HESX 2OVQB 4CY1A 1XIPA 4CZYA 2AH0A 2P9IC 5EMKB 3ORVD 4L3HD 1PBYB 2OJYA 5GMKn 5IJ7E 1P22A 1MG2A 3JPXA 1NR0A 4PBZA 4J84A 1TBGA 3PSCB 4D6VA 5HQGA 4OZUA 5I5JA 1B9YA 2AGWA 4XEIC 1QNIA 1U4CA 4IA9A 4PSWB 4CZVA 1YFQA 3DWLC 3V7DB 2OK6A 3OL2B 3JZGA 3DXMC 4I79A 2CNXA 5CXCA 2CO0A 4GQ2P 4J87A 3NVNA 1XKSA 4GQBB 2I0TA 4J82A 3PXTD 5EARA 5FQDA 3OKYB 5H14A 2P9LC 3EMHA 4CI2A 4GQ1A 2HXCA 4FB1D 4QL1A 2XU7A 3RMZD 2QXVA 3C99A 1N6FA 3PVWB 3SFZA 4IMMA 4A11A 2AGXA 2PBIB 4Z8LA 4J78A 4FAVD 3EI4B 2YMUA 5IJ8E 4ZN4A 3I7HA 3DXKC 3C5MA 2J57G 3C9CA 4JXMA 3L4OD 5EAMA 3I8EA 5THAA 4AOWA 2H9LA 5AJAA 2H13A 3A0FA 4E54B 3VH0A 2B5LA 3ULEC 4CC9A 3I2NA 4CI3A 1B9XA 4JSVC 4CY5A 1OMWB 3AL9A 4FA1D 5EALA 2P9PC 3SN6B 3UVNA 4A08B 2HYEA 3CFSB 2PM9B 5I5MA 2UZXB 4MK0B 4N14A 5AFU3 4JT5C 5H17A 3SXTD 4PXWA 2IAAA 5FKQA 2BBKH 4JSPC 4QT8A 4FA5D 4PC0A 3W15A 4X60B 3SBPA 1RI6A 1GOTB 2I3TA 2P9UC 1N6DA 4GZ8A 3IJ0A 3SHFA 4CI1A 3IJCA 2AGLA 2B5NA 4XYHA 3AFCA 3I7KA 4X3EA 4L3GD 2YB8B 1S4UX 3FGBA 3MKSB 3MZKA 4ERQA 2H9PA 4G56B 3UVLA 3J80g 2H6KA 3EI3A 2XL2A 4GGAA 5GXHA 2B4EA 3UVOA 3MMYA 2I3SA 1K32A 3UKUC 2P9KC 2CO0C 4A0BA 3HFQA 4U7AA 4J8GA 3K27A 4FWWA 5HE2B 2IWFA 1N6EA 3OKTA 3I7LA 1K8KC 1MDAH 2Z2NA 3IIWA 2HJBA 1A0RB 2CE9A 3EI1A 3EI2A 2CN3A 4X63B 5AMSA 1FWXA 4BL0A 3OW8A 4A11B 2OVRB 5TEFA 3RLMD 2Q7QA 3VGZA 2XYIA 3PXSD 4Y7RA 1Q47A 4GM3A 4U1EI 3SLED 3JZHA 3N0EA 5CXBA 3V9FA 2G9AA 3AL8A 5TEEA 3MZLA 5SXMA 5K19A 4GM9A 4BUJC 5EMMB 4QRJA 2GC7A 3NVXA 2EBSA 3JROA 4JSXC 4GMBA 3F3PA 5EMJB 1OLZA 3N0DA 3F3FA 2MTAH 3ODTA 3PVUB 4JSNC 4ERYA 2TRCB 3P4FA 4O3UB 3MKQA 1JOFA 4YVDA 4ZOXA 4A09A 5K1CC 2AGZA 2IURA 4J81A 1NEXB 5GSAA 3ZWLB 4D0KA 2YBAA 5FA5B 3GREA 2I0SA 4AEZA 5HYNB 3JRPA 5CYKB 3SVWD 5EM2A 3VA6A 1JMXB 4J0XA 3L4MD 4A2MA 2H9MA 3MXXA 3EU7A 4A7JA 1L0QA 4FAND 3BG0A 2B5MA 3NVQA 4LGNA 1JMZB 1VYHC 5KDOB 3GFCA 3RFHA 3SJLD 1ERJA 5FXYA 2IUVA 3E0CA 3SBRA 4J79A 2GNQA 4PNKB 4K3JB 4O9DA 5FKRA 1R5MA 3I89A 4E54A 4E5ZA 1PI6A 2UZYB 4J8BA 4ZOVA 2YNOA 3EI1B 3EI2B 4O1QD 4UI9R 4A08A 3OTTA 5CXCB 2QC5A 5EMLB 3UVMA 2H6NA 5IGQA 2OK4A 4Y5RD 5GXIA 3PSLA 1SQ9A 3KRWB 5HE3B 4A0AA 3CIKB 3I8CA 4J77A 3UR4A 4H5IA 3V5WB 5CXBB 4X61B 3AL8B 4ZOYA 3PE7A 4TZ4A 1JJUB 4FHLA 5HE0B 4LG9A 5TF2A 3JZNA 5EAPA 4ES0A 3EG6A 2CN2A 3J81g 4L9OA 1GP2B 3UKRC 5TDHB 4J0WA 3OKWA 2PM6B 2IWKA 3I7PA 4K3ID 2P9SC 4L1QD 4BH6A 4PBYA 2AH1A 5IT9g 2H68A 2H47A 4A09B 4A2LA 2XL3A 1U2VC 4ESGA 2HKMA 2AQ5A 2J56H 5H1MA 2YNPA 3JAMg 3CFVA 4J73A 4PSXB 3JB9L 4EWRA 5HE1B 2P9NC 5B4WA 3BWSA 3KRXB 4GGDA 2IUPA 3I7OA 2HJ4A 4LG8A 5I5IA 5EM2B 2W18A 3SCYA 5C2VB 3OL2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OVP B;  4ERZ A;  1PEV A;  3PXW D;  4H5J A;  4CY3 A;  1SHY B;  2PM7 B;  4FA9 D;  3U4Y A;  5IC7 A;  2G99 A;  3C75 H;  3FM0 A;  3B7F A;  4CI8 A;  4XYI A;  5A2Q g;  1XHM A;  2HKR A;  4GM8 A;  5FLX g;  3DSM A;  4KFM B;  5FKS A;  3SMR A;  5C9Z B;  2J55 H;  3OKY A;  4OWR A;  4CZX A;  3IJ1 A;  4O3T B;  3DM0 A;  1GG2 B;  2O9K A;  4O45 A;  4R7A B;  3I7N A;  2H3X A;  4GGC A;  4E5Z B;  5JWZ A;  4NSX A;  4QQE A;  1SQJ A;  1GXR A;  3RFG A;  3EI3 B;  3K26 A;  3EWE A;  3EI4 A;  3RN1 D;  2BCJ B;  3F3G A;  5IGO A;  2H9N A;  4A0B B;  3SBQ A;  2Z2P A;  2YNN A;  3IIY A;  2GC4 A;  2Z2O A;  3BG1 A;  5FKT A;  3AH8 B;  4J86 A;  4JD2 C;  4A0A B;  2IUQ A;  3FRX A;  2H14 A;  2OIZ A;  3RRM C;  3IKO A;  4HDJ A;  2I0R A;  3UVK A;  1TYQ C;  3RSE C;  2AGY A;  1PGU A;  4JT6 C;  5CYK A;  2PM9 A;  1MG3 A;  2H6Q A;  2CE8 A;  4ZOZ A;  3RN0 D;  3SWS D;  4CY2 A;  5C2W B;  4FA4 D;  2HES X;  2OVQ B;  4CY1 A;  1XIP A;  4CZY A;  2AH0 A;  2P9I C;  5EMK B;  3ORV D;  4L3H D;  1PBY B;  2OJY A;  5GMK n;  5IJ7 E;  1P22 A;  1MG2 A;  3JPX A;  1NR0 A;  4PBZ A;  4J84 A;  1TBG A;  3PSC B;  4D6V A;  5HQG A;  4OZU A;  5I5J A;  1B9Y A;  2AGW A;  4XEI C;  1QNI A;  1U4C A;  4IA9 A;  4PSW B;  4CZV A;  1YFQ A;  3DWL C;  3V7D B;  2OK6 A;  3OL2 B;  3JZG A;  3DXM C;  4I79 A;  2CNX A;  5CXC A;  2CO0 A;  4GQ2 P;  4J87 A;  3NVN A;  1XKS A;  4GQB B;  2I0T A;  4J82 A;  3PXT D;  5EAR A;  5FQD A;  3OKY B;  5H14 A;  2P9L C;  3EMH A;  4CI2 A;  4GQ1 A;  2HXC A;  4FB1 D;  4QL1 A;  2XU7 A;  3RMZ D;  2QXV A;  3C99 A;  1N6F A;  3PVW B;  3SFZ A;  4IMM A;  4A11 A;  2AGX A;  2PBI B;  4Z8L A;  4J78 A;  4FAV D;  3EI4 B;  2YMU A;  5IJ8 E;  4ZN4 A;  3I7H A;  3DXK C;  3C5M A;  2J57 G;  3C9C A;  4JXM A;  3L4O D;  5EAM A;  3I8E A;  5THA A;  4AOW A;  2H9L A;  5AJA A;  2H13 A;  3A0F A;  4E54 B;  3VH0 A;  2B5L A;  3ULE C;  4CC9 A;  3I2N A;  4CI3 A;  1B9X A;  4JSV C;  4CY5 A;  1OMW B;  3AL9 A;  4FA1 D;  5EAL A;  2P9P C;  3SN6 B;  3UVN A;  4A08 B;  2HYE A;  3CFS B;  2PM9 B;  5I5M A;  2UZX B;  4MK0 B;  4N14 A;  5AFU 3;  4JT5 C;  5H17 A;  3SXT D;  4PXW A;  2IAA A;  5FKQ A;  2BBK H;  4JSP C;  4QT8 A;  4FA5 D;  4PC0 A;  3W15 A;  4X60 B;  3SBP A;  1RI6 A;  1GOT B;  2I3T A;  2P9U C;  1N6D A;  4GZ8 A;  3IJ0 A;  3SHF A;  4CI1 A;  3IJC A;  2AGL A;  2B5N A;  4XYH A;  3AFC A;  3I7K A;  4X3E A;  4L3G D;  2YB8 B;  1S4U X;  3FGB A;  3MKS B;  3MZK A;  4ERQ A;  2H9P A;  4G56 B;  3UVL A;  3J80 g;  2H6K A;  3EI3 A;  2XL2 A;  4GGA A;  5GXH A;  2B4E A;  3UVO A;  3MMY A;  2I3S A;  1K32 A;  3UKU C;  2P9K C;  2CO0 C;  4A0B A;  3HFQ A;  4U7A A;  4J8G A;  3K27 A;  4FWW A;  5HE2 B;  2IWF A;  1N6E A;  3OKT A;  3I7L A;  1K8K C;  1MDA H;  2Z2N A;  3IIW A;  2HJB A;  1A0R B;  2CE9 A;  3EI1 A;  3EI2 A;  2CN3 A;  4X63 B;  5AMS A;  1FWX A;  4BL0 A;  3OW8 A;  4A11 B;  2OVR B;  5TEF A;  3RLM D;  2Q7Q A;  3VGZ A;  2XYI A;  3PXS D;  4Y7R A;  1Q47 A;  4GM3 A;  4U1E I;  3SLE D;  3JZH A;  3N0E A;  5CXB A;  3V9F A;  2G9A A;  3AL8 A;  5TEE A;  3MZL A;  5SXM A;  5K19 A;  4GM9 A;  4BUJ C;  5EMM B;  4QRJ A;  2GC7 A;  3NVX A;  2EBS A;  3JRO A;  4JSX C;  4GMB A;  3F3P A;  5EMJ B;  1OLZ A;  3N0D A;  3F3F A;  2MTA H;  3ODT A;  3PVU B;  4JSN C;  4ERY A;  2TRC B;  3P4F A;  4O3U B;  3MKQ A;  1JOF A;  4YVD A;  4ZOX A;  4A09 A;  5K1C C;  2AGZ A;  2IUR A;  4J81 A;  1NEX B;  5GSA A;  3ZWL B;  4D0K A;  2YBA A;  5FA5 B;  3GRE A;  2I0S A;  4AEZ A;  5HYN B;  3JRP A;  5CYK B;  3SVW D;  5EM2 A;  3VA6 A;  1JMX B;  4J0X A;  3L4M D;  4A2M A;  2H9M A;  3MXX A;  3EU7 A;  4A7J A;  1L0Q A;  4FAN D;  3BG0 A;  2B5M A;  3NVQ A;  4LGN A;  1JMZ B;  1VYH C;  5KDO B;  3GFC A;  3RFH A;  3SJL D;  1ERJ A;  5FXY A;  2IUV A;  3E0C A;  3SBR A;  4J79 A;  2GNQ A;  4PNK B;  4K3J B;  4O9D A;  5FKR A;  1R5M A;  3I89 A;  4E54 A;  4E5Z A;  1PI6 A;  2UZY B;  4J8B A;  4ZOV A;  2YNO A;  3EI1 B;  3EI2 B;  4O1Q D;  4UI9 R;  4A08 A;  3OTT A;  5CXC B;  2QC5 A;  5EML B;  3UVM A;  2H6N A;  5IGQ A;  2OK4 A;  4Y5R D;  5GXI A;  3PSL A;  1SQ9 A;  3KRW B;  5HE3 B;  4A0A A;  3CIK B;  3I8C A;  4J77 A;  3UR4 A;  4H5I A;  3V5W B;  5CXB B;  4X61 B;  3AL8 B;  4ZOY A;  3PE7 A;  4TZ4 A;  1JJU B;  4FHL A;  5HE0 B;  4LG9 A;  5TF2 A;  3JZN A;  5EAP A;  4ES0 A;  3EG6 A;  2CN2 A;  3J81 g;  4L9O A;  1GP2 B;  3UKR C;  5TDH B;  4J0W A;  3OKW A;  2PM6 B;  2IWK A;  3I7P A;  4K3I D;  2P9S C;  4L1Q D;  4BH6 A;  4PBY A;  2AH1 A;  5IT9 g;  2H68 A;  2H47 A;  4A09 B;  4A2L A;  2XL3 A;  1U2V C;  4ESG A;  2HKM A;  2AQ5 A;  2J56 H;  5H1M A;  2YNP A;  3JAM g;  3CFV A;  4J73 A;  4PSX B;  3JB9 L;  4EWR A;  5HE1 B;  2P9N C;  5B4W A;  3BWS A;  3KRX B;  4GGD A;  2IUP A;  3I7O A;  2HJ4 A;  4LG8 A;  5I5I A;  5EM2 B;  2W18 A;  3SCY A;  5C2V B;  3OL2 A; 
#chains in the Genus database with same CATH topology
 1VZ3 A;  2OVP B;  4ERZ A;  1PEV A;  1O6F A;  3PXW D;  4H5J A;  4CY3 A;  1SHY B;  2PM7 B;  4FA9 D;  5M5R A;  3U4Y A;  5IC7 A;  2G99 A;  3C75 H;  3FM0 A;  3B7F A;  4CI8 A;  4XYI A;  5A2Q g;  1XHM A;  2HKR A;  4GM8 A;  5FLX g;  3DSM A;  4NBM A;  4KFM B;  5FKS A;  3SMR A;  1C9I A;  5C9Z B;  2J55 H;  3GC3 B;  3OKY A;  4OWR A;  4CZX A;  4AMZ A;  3IJ1 A;  4O3T B;  3DM0 A;  1GG2 B;  1GOG A;  2O9K A;  4O45 A;  4R7A B;  3I7N A;  2H3X A;  2VC2 A;  3VI4 A;  4GGC A;  4WJK A;  4E5Z B;  5JWZ A;  4NSX A;  4QQE A;  4WK4 A;  3QHY B;  1SQJ A;  1GXR A;  3RFG A;  2VDR A;  3EI3 B;  3K26 A;  4QAM A;  1YR2 A;  3EWE A;  3EI4 A;  3RN1 D;  2BCJ B;  2VZ1 A;  3F3G A;  5IGO A;  2EID A;  2H9N A;  4A0B B;  1U8C A;  3SBQ A;  1H2W A;  2Z2P A;  2YNN A;  3IIY A;  2GC4 A;  1UTC A;  2Z2O A;  3BG1 A;  5FKT A;  3K6S A;  3AH8 B;  4J86 A;  4BCB A;  4JD2 C;  4A0A B;  1JV2 A;  5E6S A;  2IUQ A;  3FRX A;  2H14 A;  2OIZ A;  4JHP C;  3RRM C;  3IKO A;  4HDJ A;  2I0R A;  2XDW A;  3UVK A;  1TYQ C;  3RSE C;  3T3M A;  2AGY A;  1PGU A;  4JT6 C;  1K3I A;  5CYK A;  2PM9 A;  2VDQ A;  1MG3 A;  2H6Q A;  2CE8 A;  4ZOZ A;  3RN0 D;  3SWS D;  4CY2 A;  4Z7N A;  1VE7 A;  5C2W B;  4FA4 D;  3NIF A;  3T3P A;  2HES X;  2OVQ B;  4CY1 A;  4D9S A;  1XIP A;  4CZY A;  2VDO A;  4BP9 A;  5C86 A;  2AH0 A;  2P9I C;  1UOO A;  5EMK B;  3ORV D;  4L3H D;  1PBY B;  2OJY A;  2VZ3 A;  5GMK n;  5IJ7 E;  1P22 A;  1MG2 A;  3JPX A;  1E5T A;  2HU7 A;  2HU5 A;  1NR0 A;  4PBZ A;  4J84 A;  2VDL A;  5FFO A;  1TBG A;  3PSC B;  4D6V A;  2VDK A;  5HQG A;  4OZU A;  5I5J A;  1B9Y A;  2AGW A;  4XEI C;  1QNI A;  1U4C A;  4IA9 A;  4AN1 A;  4PSW B;  4CZV A;  1YFQ A;  3DWL C;  3V7D B;  2OK6 A;  3OL2 B;  3EQ7 A;  4G55 A;  3JZG A;  4O2W A;  1E8M A;  1GOF A;  3DXM C;  4I79 A;  2CNX A;  5CXC A;  2CO0 A;  4GQ2 P;  3MUN A;  4J87 A;  3NVN A;  1XKS A;  4DNW A;  4GQB B;  2XE4 A;  1T2X A;  2I0T A;  4J82 A;  3PXT D;  4RE5 A;  5EAR A;  5FQD A;  3OKY B;  5H14 A;  2P9L C;  3EMH A;  4CI2 A;  3GD1 I;  4GQ1 A;  2HXC A;  4FB1 D;  4QL1 A;  2XU7 A;  3RMZ D;  4AMY A;  2QXV A;  3C99 A;  1N6F A;  3PVW B;  3SFZ A;  4IMM A;  5HDB A;  4A11 A;  2AGX A;  2PBI B;  1L5G A;  4Z8L A;  1VE6 A;  4J78 A;  4FAV D;  3EI4 B;  2YMU A;  5IJ8 E;  4ZN4 A;  3I7H A;  3ZE1 A;  3DXK C;  3C5M A;  3IVM A;  2J57 G;  3C9C A;  4JXM A;  3L4O D;  5EAM A;  3DDU A;  5FFG A;  2XZG A;  3I8E A;  4O02 A;  5THA A;  4G1M A;  4AOW A;  2H9L A;  5AJA A;  2H13 A;  3A0F A;  4E54 B;  3VH0 A;  3QI0 A;  4MMY A;  2B5L A;  3ULE C;  4CC9 A;  3I2N A;  3ZDY A;  4CI3 A;  1B9X A;  4JSV C;  4CY5 A;  1OMW B;  3AL9 A;  4FA1 D;  5EAL A;  2P9P C;  5E6U A;  3SN6 B;  1UOP A;  3UVN A;  4A08 B;  2HYE A;  3CFS B;  2PM9 B;  5I5M A;  2UZX B;  4MK0 B;  4N14 A;  5AFU 3;  4JT5 C;  5H17 A;  3V4P A;  3SXT D;  4WK0 A;  4PXW A;  2IAA A;  5FKQ A;  4MMX A;  1TYE A;  2BBK H;  2QR5 A;  4JSP C;  4QT8 A;  4FA5 D;  4PC0 A;  3ZE2 A;  3W15 A;  4Z7O A;  2BKL A;  4X60 B;  3SBP A;  1RI6 A;  1GOT B;  2I3T A;  2P9U C;  1N6D A;  1QFS A;  3KCI A;  4GZ8 A;  1H2X A;  3IJ0 A;  3SHF A;  4CI1 A;  3IJC A;  2AGL A;  2B5N A;  4JHN A;  4XYH A;  3AFC A;  3I7K A;  1JTD B;  4X3E A;  4L3G D;  2YB8 B;  1S4U X;  3FGB A;  3MKS B;  3MZK A;  4ERQ A;  2H9P A;  4G56 B;  3UVL A;  3J80 g;  2H6K A;  3EI3 A;  2XL2 A;  4GGA A;  3NIG A;  5GXH A;  2B4E A;  5E6R A;  3UVO A;  4WK2 A;  3MMY A;  2I3S A;  4UM9 A;  1K32 A;  3UKU C;  2P9K C;  2CO0 C;  3K72 A;  4A0B A;  3HFQ A;  1VZ2 A;  4U7A A;  3IUM A;  2HU8 A;  4J8G A;  3K27 A;  4RE6 A;  4FWW A;  4UM8 A;  5HE2 B;  2IWF A;  1N6E A;  3OKT A;  3I7L A;  1E8N A;  1K8K C;  1MDA H;  2Z2N A;  3IIW A;  2HJB A;  1A0R B;  4IRZ A;  2CE9 A;  3EI1 A;  3EI2 A;  2CN3 A;  4X63 B;  5AMS A;  1FWX A;  4BL0 A;  3OW8 A;  4A11 B;  4Z7Q A;  2OVR B;  3IUN A;  5TEF A;  3FCS A;  3RLM D;  2Q7Q A;  3VGZ A;  2WQ8 A;  2XYI A;  3PXS D;  4Y7R A;  1Q47 A;  4GM3 A;  3ZE0 A;  4U1E I;  2EIB A;  3SLE D;  5M61 A;  3IUJ A;  3JZH A;  3K71 A;  3N0E A;  5CXB A;  3V9F A;  2G9A A;  3AL8 A;  5TEE A;  3MZL A;  5SXM A;  3ZDZ A;  5K19 A;  4GM9 A;  4BUJ C;  5EMM B;  4QRJ A;  5M5S A;  2GC7 A;  3NVX A;  2EBS A;  4BCD A;  3JRO A;  4JSX C;  4GMB A;  1QFM A;  3F3P A;  5EMJ B;  1UOQ A;  1OLZ A;  5M5V A;  3N0D A;  3F3F A;  2MTA H;  3ODT A;  3PVU B;  4JSN C;  4ERY A;  2TRC B;  3P4F A;  4O3U B;  3MKQ A;  1JOF A;  3O4H A;  4YVD A;  4ZOX A;  4A09 A;  5K1C C;  2AGZ A;  4BP8 A;  2IUR A;  4J81 A;  3OF7 A;  1NEX B;  1O6G A;  3EQ8 A;  5GSA A;  3ZWL B;  4D0K A;  2YBA A;  5FA5 B;  3GRE A;  2I0S A;  4AEZ A;  4DNU A;  5HYN B;  3JRP A;  5CYK B;  3SVW D;  5EM2 A;  1BPO A;  3VA6 A;  1JMX B;  4J0X A;  3L4M D;  4A2M A;  5C92 A;  3ZDX A;  2H9M A;  3MXX A;  1C9L A;  3EU7 A;  4A7J A;  1L0Q A;  4FAN D;  3BG0 A;  2B5M A;  4BCC A;  3NVQ A;  4LGN A;  5M5U A;  1JMZ B;  1VYH C;  5KDO B;  3GFC A;  3RFH A;  3SJL D;  1ERJ A;  5FXY A;  2IUV A;  3E0C A;  3SBR A;  2VDM A;  4J79 A;  2GNQ A;  4PNK B;  4K3J B;  3NID A;  4DNV A;  4O9D A;  5FKR A;  1R5M A;  1I2M B;  3I89 A;  2EIE A;  3IUR A;  4AX4 A;  4E54 A;  4E5Z A;  1PI6 A;  2UZY B;  2JKX A;  4J8B A;  3MVD K;  4ZOV A;  2YNO A;  1H2Z A;  2VDP A;  3EI1 B;  3EI2 B;  4O1Q D;  3IJE A;  4UI9 R;  4A08 A;  3OTT A;  5CXC B;  1A12 A;  1GOH A;  2QC5 A;  5EML B;  3UVM A;  3MUO A;  2H6N A;  5IGQ A;  4G1E A;  2OK4 A;  4Y5R D;  5GXI A;  3PSL A;  1SQ9 A;  5M5T A;  3KRW B;  5HE3 B;  4NAA A;  4A0A A;  3CIK B;  3O4I A;  3I8C A;  2EIC A;  4J77 A;  3UR4 A;  3FCU A;  4H5I A;  3V5W B;  5CXB B;  4X61 B;  3AL8 B;  3V4V A;  2QZP A;  4ZOY A;  3PE7 A;  3IUL A;  4TZ4 A;  1JJU B;  3VI3 A;  4FHL A;  3O4J A;  4L1M A;  5HE0 B;  4LG9 A;  5TF2 A;  4AN0 A;  3JZN A;  5EAP A;  4ES0 A;  3EG6 A;  2CN2 A;  3J81 g;  4L9O A;  1GP2 B;  3UKR C;  5TDH B;  4J0W A;  4NC4 A;  3OKW A;  2PM6 B;  2IWK A;  3EQ9 A;  3I7P A;  3IUQ A;  4K3I D;  2P9S C;  4L1Q D;  4BH6 A;  4PBY A;  2AH1 A;  1H2Y A;  5IT9 g;  2H68 A;  2H47 A;  3O4G A;  4A09 B;  4A2L A;  2XL3 A;  1U2V C;  2VDN A;  4ESG A;  2HKM A;  2AQ5 A;  2J56 H;  5H1M A;  2YNP A;  3JAM g;  3CFV A;  4J73 A;  4PSX B;  3JB9 L;  4EWR A;  4NEN A;  5HE1 B;  2P9N C;  5B4W A;  3BWS A;  3KRX B;  4GGD A;  1M1X A;  2IUP A;  3I7O A;  2HJ4 A;  4LG8 A;  5I5I A;  5EM2 B;  2W18 A;  3SCY A;  4MMZ A;  5C2V B;  3OL2 A; 
#chains in the Genus database with same CATH homology
 2OVP B;  4ERZ A;  1PEV A;  3PXW D;  4H5J A;  4CY3 A;  1SHY B;  2PM7 B;  4FA9 D;  3U4Y A;  5IC7 A;  2G99 A;  3C75 H;  3FM0 A;  3B7F A;  4CI8 A;  4XYI A;  5A2Q g;  1XHM A;  2HKR A;  4GM8 A;  5FLX g;  3DSM A;  4KFM B;  5FKS A;  3SMR A;  5C9Z B;  2J55 H;  3OKY A;  4OWR A;  4CZX A;  3IJ1 A;  4O3T B;  3DM0 A;  1GG2 B;  2O9K A;  4O45 A;  4R7A B;  3I7N A;  2H3X A;  4GGC A;  4E5Z B;  5JWZ A;  4NSX A;  4QQE A;  1SQJ A;  1GXR A;  3RFG A;  3EI3 B;  3K26 A;  3EWE A;  3EI4 A;  3RN1 D;  2BCJ B;  3F3G A;  5IGO A;  2H9N A;  4A0B B;  3SBQ A;  2Z2P A;  2YNN A;  3IIY A;  2GC4 A;  2Z2O A;  3BG1 A;  5FKT A;  3AH8 B;  4J86 A;  4JD2 C;  4A0A B;  2IUQ A;  3FRX A;  2H14 A;  2OIZ A;  3RRM C;  3IKO A;  4HDJ A;  2I0R A;  3UVK A;  1TYQ C;  3RSE C;  2AGY A;  1PGU A;  4JT6 C;  5CYK A;  2PM9 A;  1MG3 A;  2H6Q A;  2CE8 A;  4ZOZ A;  3RN0 D;  3SWS D;  4CY2 A;  5C2W B;  4FA4 D;  2HES X;  2OVQ B;  4CY1 A;  1XIP A;  4CZY A;  2AH0 A;  2P9I C;  5EMK B;  3ORV D;  4L3H D;  1PBY B;  2OJY A;  5GMK n;  5IJ7 E;  1P22 A;  1MG2 A;  3JPX A;  1NR0 A;  4PBZ A;  4J84 A;  1TBG A;  3PSC B;  4D6V A;  5HQG A;  4OZU A;  5I5J A;  1B9Y A;  2AGW A;  4XEI C;  1QNI A;  1U4C A;  4IA9 A;  4PSW B;  4CZV A;  1YFQ A;  3DWL C;  3V7D B;  2OK6 A;  3OL2 B;  3JZG A;  3DXM C;  4I79 A;  2CNX A;  5CXC A;  2CO0 A;  4GQ2 P;  4J87 A;  3NVN A;  1XKS A;  4GQB B;  2I0T A;  4J82 A;  3PXT D;  5EAR A;  5FQD A;  3OKY B;  5H14 A;  2P9L C;  3EMH A;  4CI2 A;  4GQ1 A;  2HXC A;  4FB1 D;  4QL1 A;  2XU7 A;  3RMZ D;  2QXV A;  3C99 A;  1N6F A;  3PVW B;  3SFZ A;  4IMM A;  4A11 A;  2AGX A;  2PBI B;  4Z8L A;  4J78 A;  4FAV D;  3EI4 B;  2YMU A;  5IJ8 E;  4ZN4 A;  3I7H A;  3DXK C;  3C5M A;  2J57 G;  3C9C A;  4JXM A;  3L4O D;  5EAM A;  3I8E A;  5THA A;  4AOW A;  2H9L A;  5AJA A;  2H13 A;  3A0F A;  4E54 B;  3VH0 A;  2B5L A;  3ULE C;  4CC9 A;  3I2N A;  4CI3 A;  1B9X A;  4JSV C;  4CY5 A;  1OMW B;  3AL9 A;  4FA1 D;  5EAL A;  2P9P C;  3SN6 B;  3UVN A;  4A08 B;  2HYE A;  3CFS B;  2PM9 B;  5I5M A;  2UZX B;  4MK0 B;  4N14 A;  5AFU 3;  4JT5 C;  5H17 A;  3SXT D;  4PXW A;  2IAA A;  5FKQ A;  2BBK H;  4JSP C;  4QT8 A;  4FA5 D;  4PC0 A;  3W15 A;  4X60 B;  3SBP A;  1RI6 A;  1GOT B;  2I3T A;  2P9U C;  1N6D A;  4GZ8 A;  3IJ0 A;  3SHF A;  4CI1 A;  3IJC A;  2AGL A;  2B5N A;  4XYH A;  3AFC A;  3I7K A;  4X3E A;  4L3G D;  2YB8 B;  1S4U X;  3FGB A;  3MKS B;  3MZK A;  4ERQ A;  2H9P A;  4G56 B;  3UVL A;  3J80 g;  2H6K A;  3EI3 A;  2XL2 A;  4GGA A;  5GXH A;  2B4E A;  3UVO A;  3MMY A;  2I3S A;  1K32 A;  3UKU C;  2P9K C;  2CO0 C;  4A0B A;  3HFQ A;  4U7A A;  4J8G A;  3K27 A;  4FWW A;  5HE2 B;  2IWF A;  1N6E A;  3OKT A;  3I7L A;  1K8K C;  1MDA H;  2Z2N A;  3IIW A;  2HJB A;  1A0R B;  2CE9 A;  3EI1 A;  3EI2 A;  2CN3 A;  4X63 B;  5AMS A;  1FWX A;  4BL0 A;  3OW8 A;  4A11 B;  2OVR B;  5TEF A;  3RLM D;  2Q7Q A;  3VGZ A;  2XYI A;  3PXS D;  4Y7R A;  1Q47 A;  4GM3 A;  4U1E I;  3SLE D;  3JZH A;  3N0E A;  5CXB A;  3V9F A;  2G9A A;  3AL8 A;  5TEE A;  3MZL A;  5SXM A;  5K19 A;  4GM9 A;  4BUJ C;  5EMM B;  4QRJ A;  2GC7 A;  3NVX A;  2EBS A;  3JRO A;  4JSX C;  4GMB A;  3F3P A;  5EMJ B;  1OLZ A;  3N0D A;  3F3F A;  2MTA H;  3ODT A;  3PVU B;  4JSN C;  4ERY A;  2TRC B;  3P4F A;  4O3U B;  3MKQ A;  1JOF A;  4YVD A;  4ZOX A;  4A09 A;  5K1C C;  2AGZ A;  2IUR A;  4J81 A;  1NEX B;  5GSA A;  3ZWL B;  4D0K A;  2YBA A;  5FA5 B;  3GRE A;  2I0S A;  4AEZ A;  5HYN B;  3JRP A;  5CYK B;  3SVW D;  5EM2 A;  3VA6 A;  1JMX B;  4J0X A;  3L4M D;  4A2M A;  2H9M A;  3MXX A;  3EU7 A;  4A7J A;  1L0Q A;  4FAN D;  3BG0 A;  2B5M A;  3NVQ A;  4LGN A;  1JMZ B;  1VYH C;  5KDO B;  3GFC A;  3RFH A;  3SJL D;  1ERJ A;  5FXY A;  2IUV A;  3E0C A;  3SBR A;  4J79 A;  2GNQ A;  4PNK B;  4K3J B;  4O9D A;  5FKR A;  1R5M A;  3I89 A;  4E54 A;  4E5Z A;  1PI6 A;  2UZY B;  4J8B A;  4ZOV A;  2YNO A;  3EI1 B;  3EI2 B;  4O1Q D;  4UI9 R;  4A08 A;  3OTT A;  5CXC B;  2QC5 A;  5EML B;  3UVM A;  2H6N A;  5IGQ A;  2OK4 A;  4Y5R D;  5GXI A;  3PSL A;  1SQ9 A;  3KRW B;  5HE3 B;  4A0A A;  3CIK B;  3I8C A;  4J77 A;  3UR4 A;  4H5I A;  3V5W B;  5CXB B;  4X61 B;  3AL8 B;  4ZOY A;  3PE7 A;  4TZ4 A;  1JJU B;  4FHL A;  5HE0 B;  4LG9 A;  5TF2 A;  3JZN A;  5EAP A;  4ES0 A;  3EG6 A;  2CN2 A;  3J81 g;  4L9O A;  1GP2 B;  3UKR C;  5TDH B;  4J0W A;  3OKW A;  2PM6 B;  2IWK A;  3I7P A;  4K3I D;  2P9S C;  4L1Q D;  4BH6 A;  4PBY A;  2AH1 A;  5IT9 g;  2H68 A;  2H47 A;  4A09 B;  4A2L A;  2XL3 A;  1U2V C;  4ESG A;  2HKM A;  2AQ5 A;  2J56 H;  5H1M A;  2YNP A;  3JAM g;  3CFV A;  4J73 A;  4PSX B;  3JB9 L;  4EWR A;  5HE1 B;  2P9N C;  5B4W A;  3BWS A;  3KRX B;  4GGD A;  2IUP A;  3I7O A;  2HJ4 A;  4LG8 A;  5I5I A;  5EM2 B;  2W18 A;  3SCY A;  5C2V B;  3OL2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...