5EAPA

Crystal structure of human wdr5 in complex with compound 9e
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
312
structure length
310
Chain Sequence
GTQSKPTPVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/transcription inhibitor
molecule keywords WD repeat-containing protein 5
publication title Structure-Based Optimization of a Small Molecule Antagonist of the Interaction Between WD Repeat-Containing Protein 5 (WDR5) and Mixed-Lineage Leukemia 1 (MLL1).
pubmed doi rcsb
source organism Homo sapiens
total genus 106
structure length 310
sequence length 312
ec nomenclature
pdb deposition date 2015-10-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5eapA00
2AGLA 4L9OA 2AGYA 3UVKA 3I2NA 4QRJA 5FA5B 4CI3A 4AOWA 4LG9A 2H13A 3AH8B 1NR0A 1GP2B 5K19A 4KFMB 2B4EA 3ZWLB 4ESGA 3JPXA 5THAA 4ERYA 3UVLA 4MK0B 3FM0A 2HESX 5GXHA 4FHLA 5CXBA 4FA4D 2J55H 1XKSA 4CZYA 4FB1D 3JROA 4J77A 4J78A 1NEXB 4UI9R 4CY2A 1N6EA 2XL3A 1TBGA 3B7FA 3I7NA 3J81g 4E5ZA 4JT6C 3RFHA 4J87A 2OIZA 4JSXC 4O3UB 4PBZA 1GXRA 3JZHA 4L3GD 4N14A 4R7AB 4Y5RD 1OLZA 5FQDA 2HKMA 4OWRA 5B4WA 5TEFA 4I79A 5FKSA 1JJUB 4A2LA 4JXMA 3PXSD 1GOTB 4FWWA 4GZ8A 3SFZA 4OZUA 3V9FA 3KRXB 3F3GA 4GM3A 2P9LC 2G99A 3DSMA 2I0TA 3OTTA 3C99A 2YBAA 3EI3B 3SBPA 5GXIA 5SXMA 2YMUA 4FA9D 2I3TA 1SQJA 4J86A 5GMKn 3K27A 2YB8B 3DXMC 2H6KA 2OK6A 3I7OA 4HDJA 4QT8A 3A0FA 5K1CC 4NSXA 2HXCA 3C9CA 4BH6A 5FKQA 2XL2A 2GC7A 3I7PA 3JAMg 4LG8A 1PBYB 3MMYA 3EU7A 4GQBB 2YNPA 3I8EA 3GFCA 5I5JA 1K32A 2PM9B 3F3PA 4YVDA 4D6VA 3EI4B 1RI6A 2I0RA 1SHYB 3UVMA 4J84A 4A08B 3MKQA 3RMZD 3OKTA 2H6QA 3DWLC 2IAAA 1B9YA 4J8GA 4GGCA 5EALA 5IGQA 4ERZA 3EI3A 1ERJA 3OKYB 4ZOXA 3OKWA 2P9NC 4O9DA 2OK4A 3I8CA 5I5MA 3UVNA 4TZ4A 3EI2B 2P9SC 5I5IA 2CO0A 4CZXA 4CI1A 2CO0C 5C9ZB 4CZVA 4IA9A 2BBKH 3MKSB 3MXXA 4Y7RA 2Z2PA 4ZOYA 3L4MD 2XU7A 2HJ4A 5AJAA 3SXTD 5H17A 4XYIA 1R5MA 1SQ9A 3J80g 2PM7B 3RSEC 3JB9L 3U4YA 4GQ2P 4G56B 1FWXA 2PM9A 4GQ1A 3EI4A 2H6NA 5HYNB 3BG1A 3OL2B 4X63B 5IJ7E 2AGWA 3EG6A 5HE1B 4A08A 3AFCA 3VGZA 3PVWB 5FXYA 1PEVA 1A0RB 4U7AA 5AFU3 5HE0B 3OKYA 2QC5A 1PGUA 5IGOA 4Z8LA 2EBSA 3NVNA 4PSWB 5HE3B 2IURA 4ZOZA 5KDOB 3IJ1A 4ES0A 5EAMA 2I0SA 3EI2A 2IUPA 3UKRC 4PNKB 3AL9A 3JRPA 4J0WA 3N0EA 5H1MA 3JZNA 3K26A 3PSCB 1YFQA 2P9PC 5EARA 4J79A 3ORVD 2OVPB 2UZXB 4A2MA 3OW8A 3NVXA 1MDAH 3SHFA 3PVUB 4FA5D 5TDHB 3SJLD 1VYHC 4A0AB 3SCYA 4FAND 3OL2A 3V5WB 3EI1B 3N0DA 3F3FA 4K3ID 3HFQA 3IIYA 2J57G 4ZOVA 3L4OD 4PSXB 1S4UX 5IC7A 2B5MA 5CYKB 3I7HA 2H9PA 5JWZA 2Z2OA 4O45A 3RRMC 2CNXA 5EM2B 1U4CA 3IJ0A 4X3EA 1JMXB 2P9UC 2HKRA 2OVRB 4E54B 2W18A 4A09B 3SBQA 3IIWA 4AEZA 2IWKA 4QQEA 3GREA 3UR4A 2H47A 3DM0A 2OJYA 1JMZB 4XEIC 1K8KC 4ERQA 3I7KA 2Q7QA 4CI2A 5C2VB 4XYHA 2AGZA 3NVQA 4LGNA 3UKUC 3I7LA 2H9NA 3P4FA 5EMJB 4CC9A 4A0AA 5EMLB 2H9MA 3EI1A 2QXVA 5FKRA 5HE2B 3MZLA 4J8BA 4O1QD 2CN3A 5A2Qg 3PXWD 5EMKB 2HYEA 4BUJC 4A11B 5CYKA 3C75H 5TF2A 2TRCB 1OMWB 5EM2A 5H14A 3PXTD 5FLXg 2YNOA 3SMRA 4GGAA 4E54A 1QNIA 4A09A 4QL1A 3BWSA 2H68A 2AGXA 4CI8A 2B5NA 4K3JB 2H9LA 2O9KA 3IJCA 4EWRA 1GG2B 2IUVA 3C5MA 2CN2A 1U2VC 4BL0A 3SBRA 4JD2C 5GSAA 5HQGA 3FRXA 1P22A 4L1QD 2AH0A 2B5LA 5IJ8E 2CE9A 1PI6A 1N6FA 2P9IC 4O3TB 3SWSD 2YNNA 2MTAH 4GM9A 2IWFA 4PBYA 4GM8A 2OVQB 2P9KC 4PC0A 3BG0A 1Q47A 5AMSA 3SLED 4A0BB 3PE7A 5TEEA 1XHMA 3JZGA 4J0XA 4A11A 2UZYB 4J81A 2BCJB 4H5IA 4FAVD 3E0CA 3CIKB 4CY5A 4FA1D 2H14A 3ODTA 1TYQC 2I3SA 4GMBA 2H3XA 3AL8B 5CXCB 2AH1A 3FGBA 5EMMB 3EMHA 2CE8A 5IT9g 3I89A 3KRWB 3VH0A 1L0QA 2GC4A 4X61B 2J56H 4L3HD 2Z2NA 3ULEC 4IMMA 3CFVA 4H5JA 4JSPC 4JSVC 2PBIB 3RN0D 3SVWD 4GGDA 3VA6A 3SN6B 1XIPA 3V7DB 2PM6B 1JOFA 4J73A 5FKTA 1B9XA 4ZN4A 5CXBB 4U1EI 3IKOA 1N6DA 4PXWA 3RLMD 4JT5C 3EWEA 4A0BA 3PSLA 3UVOA 4J82A 2HJBA 2AQ5A 4E5ZB 3DXKC 1MG2A 2IUQA 4JSNC 4D0KA 3MZKA 3CFSB 5C2WB 4CY3A 3W15A 3RFGA 4A7JA 1MG3A 2GNQA 3AL8A 5CXCA 4CY1A 4X60B 2G9AA 2XYIA 5EAPA 3RN1D
chains in the Genus database with same CATH superfamily
2JKXA 2AGLA 4L9OA 2AGYA 1I2MB 1H2XA 3UVKA 3I2NA 2VDOA 4QRJA 1VE7A 5FA5B 4CI3A 4AOWA 4LG9A 2H13A 3AH8B 1NR0A 1GP2B 5K19A 4KFMB 2B4EA 3ZWLB 4ESGA 3JPXA 3K72A 5THAA 4ERYA 3UVLA 4Z7QA 4MK0B 3FM0A 2HESX 5GXHA 4FHLA 5CXBA 4FA4D 2J55H 3MVDK 1XKSA 4CZYA 4FB1D 3JROA 5M5RA 4J77A 4J78A 1NEXB 4UI9R 3IUNA 4CY2A 1N6EA 4WJKA 2XL3A 1TBGA 3B7FA 3I7NA 3J81g 4E5ZA 4JT6C 1H2YA 3RFHA 4IRZA 4J87A 2OIZA 4JSXC 4O3UB 4PBZA 1JTDB 2EIBA 3IURA 1GXRA 3JZHA 3NIFA 4L3GD 1E5TA 4N14A 4R7AB 4WK4A 4Y5RD 1OLZA 5FQDA 3VI4A 2HKMA 4OWRA 5B4WA 3IUQA 5TEFA 4I79A 5FKSA 1JJUB 4A2LA 3V4PA 3PXSD 4JXMA 1GOTB 4FWWA 4GZ8A 3SFZA 4OZUA 3V9FA 4NENA 4D9SA 3KRXB 3F3GA 4GM3A 1UTCA 2P9LC 2G99A 3DSMA 2I0TA 3OTTA 3O4JA 3C99A 2YBAA 3EI3B 3SBPA 4MMXA 5GXIA 5SXMA 2YMUA 4FA9D 2I3TA 1SQJA 4J86A 5GMKn 3K27A 2YB8B 3O4IA 1BPOA 3DXMC 1H2ZA 2H6KA 2OK6A 3I7OA 4HDJA 4QT8A 3A0FA 5K1CC 4NSXA 2HXCA 3C9CA 4BH6A 3ZE0A 3O4GA 3K6SA 5FKQA 2VZ3A 2XL2A 2GC7A 3I7PA 3JAMg 4LG8A 5C92A 1PBYB 3MMYA 3EU7A 2YNPA 4GQBB 3I8EA 3EQ7A 3ZDXA 3GFCA 5I5JA 1E8NA 2VDNA 1K32A 2PM9B 3F3PA 2VC2A 4YVDA 4D6VA 3EI4B 1RI6A 2I0RA 4WK2A 2HU7A 1SHYB 2EIDA 3UVMA 4J84A 5M5TA 3MKQA 3RMZD 4A08B 3OKTA 5M5UA 2H6QA 3DWLC 3V4VA 2IAAA 4WK0A 5FFGA 3IUMA 1B9YA 4J8GA 4GGCA 5EALA 5IGQA 4ERZA 3EI3A 1ERJA 3FCSA 3OKYB 4ZOXA 3KCIA 2P9NC 3OKWA 4O9DA 2OK4A 3I8CA 5M61A 5I5MA 3UVNA 4TZ4A 3EI2B 4G55A 2P9SC 4G1MA 2WQ8A 5I5IA 2CO0A 4CZXA 4CI1A 2CO0C 5C9ZB 4CZVA 4AN0A 4IA9A 3IULA 1U8CA 2BBKH 3MKSB 3MXXA 4Y7RA 2Z2PA 4ZOYA 5E6RA 3L4MD 2XU7A 2HJ4A 5AJAA 3SXTD 5H17A 1GOFA 4XYIA 1R5MA 1SQ9A 3J80g 3EQ8A 2PM7B 3RSEC 3JB9L 3U4YA 4GQ2P 4G56B 5FFOA 1FWXA 2PM9A 4GQ1A 3EI4A 2H6NA 4BCCA 3BG1A 5HYNB 1UOOA 4AMZA 3OL2B 4X63B 3ZDYA 5IJ7E 2AGWA 3EG6A 4RE6A 5HE1B 4A08A 3AFCA 3VGZA 3PVWB 2XE4A 5FXYA 3K71A 1PEVA 1A0RB 1TYEA 4U7AA 5AFU3 3QI0A 5HE0B 3OKYA 2QC5A 1PGUA 5IGOA 4Z8LA 2EBSA 3NVNA 4PSWB 5HE3B 2QZPA 2IURA 4ZOZA 5KDOB 3IJEA 4AX4A 3IJ1A 4ES0A 5EAMA 4UM8A 2I0SA 3EI2A 2IUPA 3UKRC 4PNKB 4BCBA 4L1MA 4Z7OA 1O6FA 3AL9A 3JRPA 4J0WA 3N0EA 5H1MA 1T2XA 3JZNA 3K26A 3PSCB 1YFQA 4BP9A 2P9PC 5EARA 4J79A 3ORVD 2OVPB 5C86A 2UZXB 4A2MA 2VDQA 3OW8A 3NVXA 1MDAH 3SHFA 3PVUB 4FA5D 5TDHB 3OF7A 1A12A 3SJLD 1VYHC 4AMYA 4A0AB 3SCYA 4FAND 1YR2A 3OL2A 5M5VA 3V5WB 3EI1B 3N0DA 3F3FA 2VDLA 4K3ID 3HFQA 3IIYA 2J57G 4ZOVA 3L4OD 4PSXB 3EQ9A 4DNUA 4QAMA 1S4UX 5IC7A 2B5MA 5CYKB 3I7HA 4UM9A 4JHPC 2H9PA 2XZGA 2Z2OA 4O45A 3RRMC 2CNXA 5JWZA 5EM2B 1U4CA 3IJ0A 4X3EA 1JMXB 2P9UC 2HKRA 2OVRB 4E54B 2W18A 4A09B 3SBQA 3IIWA 4AEZA 2IWKA 4QQEA 3GREA 3T3PA 3UR4A 2EICA 2H47A 3DM0A 2OJYA 1JMZB 4XEIC 1K8KC 3QHYB 3I7KA 4ERQA 2Q7QA 4CI2A 5C2VB 4XYHA 2AGZA 3NVQA 1VZ2A 4LGNA 3UKUC 3I7LA 2H9NA 1C9IA 1QFMA 1QFSA 3P4FA 5EMJB 1M1XA 4CC9A 4A0AA 2VZ1A 5E6UA 2HU8A 5EMLB 4O2WA 2H9MA 3EI1A 2QXVA 5FKRA 5HE2B 3MZLA 4J8BA 4O1QD 2XDWA 2CN3A 5A2Qg 3PXWD 5EMKB 2HYEA 4BUJC 2BKLA 3MUNA 4A11B 4O02A 5CYKA 3C75H 3O4HA 5TF2A 2TRCB 1OMWB 5EM2A 5H14A 3PXTD 5FLXg 2YNOA 3DDUA 3SMRA 4GGAA 4E54A 4G1EA 4NC4A 1QNIA 2VDPA 4A09A 4QL1A 3BWSA 2HU5A 2H68A 2AGXA 4CI8A 2B5NA 2VDMA 4K3JB 2H9LA 2O9KA 3IJCA 4EWRA 1GG2B 2IUVA 3C5MA 2CN2A 1U2VC 4BL0A 3SBRA 4JD2C 5GSAA 5HQGA 3FRXA 1P22A 4MMYA 1JV2A 4L1QD 2AH0A 2B5LA 5IJ8E 2CE9A 1PI6A 1GOHA 1N6FA 2P9IC 3GD1I 4O3TB 3SWSD 2YNNA 2MTAH 4GM9A 2IWFA 4PBYA 4GM8A 3FCUA 2OVQB 2P9KC 4PC0A 3BG0A 1Q47A 3IUJA 5AMSA 3SLED 5E6SA 3NIGA 3NIDA 4A0BB 3PE7A 5TEEA 1XHMA 2QR5A 3JZGA 1E8MA 4J0XA 4A11A 2UZYB 3GC3B 1VE6A 4J81A 2BCJB 4H5IA 4FAVD 3E0CA 3CIKB 4CY5A 4FA1D 4JHNA 4DNVA 2H14A 3ODTA 1H2WA 1TYQC 2I3SA 2VDKA 4GMBA 2H3XA 3AL8B 5CXCB 5M5SA 2AH1A 3FGBA 1VZ3A 3ZE2A 5EMMB 3EMHA 2CE8A 5IT9g 3I89A 3T3MA 3VI3A 3KRWB 3VH0A 1L0QA 2GC4A 4X61B 2J56H 4L3HD 2Z2NA 3ULEC 4IMMA 3CFVA 4H5JA 2EIEA 3ZE1A 4JSPC 4AN1A 4JSVC 1UOPA 2PBIB 3RN0D 3SVWD 4GGDA 3VA6A 4BP8A 4NAAA 3SN6B 1XIPA 3V7DB 3ZDZA 2PM6B 1JOFA 3MUOA 4J73A 5FKTA 1B9XA 4ZN4A 5HDBA 5CXBB 4U1EI 3IKOA 1N6DA 1L5GA 4PXWA 3RLMD 4JT5C 4BCDA 4RE5A 1UOQA 3EWEA 4A0BA 1GOGA 1K3IA 3PSLA 3UVOA 4J82A 2HJBA 2VDRA 3IVMA 2AQ5A 4E5ZB 3DXKC 1MG2A 2IUQA 4JSNC 4D0KA 3MZKA 3CFSB 4MMZA 5C2WB 4CY3A 1O6GA 3W15A 3RFGA 4A7JA 1MG3A 4DNWA 2GNQA 3AL8A 5CXCA 4CY1A 1C9LA 4X60B 2G9AA 4Z7NA 2XYIA 5EAPA 4NBMA 3RN1D
chains in the Genus database with same CATH topology
2AGLA 4L9OA 2AGYA 3UVKA 3I2NA 4QRJA 5FA5B 4CI3A 4AOWA 4LG9A 2H13A 3AH8B 1NR0A 1GP2B 5K19A 4KFMB 2B4EA 3ZWLB 4ESGA 3JPXA 5THAA 4ERYA 3UVLA 4MK0B 3FM0A 2HESX 5GXHA 4FHLA 5CXBA 4FA4D 2J55H 1XKSA 4CZYA 4FB1D 3JROA 4J77A 4J78A 1NEXB 4UI9R 4CY2A 1N6EA 2XL3A 1TBGA 3B7FA 3I7NA 3J81g 4E5ZA 4JT6C 3RFHA 4J87A 2OIZA 4JSXC 4O3UB 4PBZA 1GXRA 3JZHA 4L3GD 4N14A 4R7AB 4Y5RD 1OLZA 5FQDA 2HKMA 4OWRA 5B4WA 5TEFA 4I79A 5FKSA 1JJUB 4A2LA 4JXMA 3PXSD 1GOTB 4FWWA 4GZ8A 3SFZA 4OZUA 3V9FA 3KRXB 3F3GA 4GM3A 2P9LC 2G99A 3DSMA 2I0TA 3OTTA 3C99A 2YBAA 3EI3B 3SBPA 5GXIA 5SXMA 2YMUA 4FA9D 2I3TA 1SQJA 4J86A 5GMKn 3K27A 2YB8B 3DXMC 2H6KA 2OK6A 3I7OA 4HDJA 4QT8A 3A0FA 5K1CC 4NSXA 2HXCA 3C9CA 4BH6A 5FKQA 2XL2A 2GC7A 3I7PA 3JAMg 4LG8A 1PBYB 3MMYA 3EU7A 4GQBB 2YNPA 3I8EA 3GFCA 5I5JA 1K32A 2PM9B 3F3PA 4YVDA 4D6VA 3EI4B 1RI6A 2I0RA 1SHYB 3UVMA 4J84A 4A08B 3MKQA 3RMZD 3OKTA 2H6QA 3DWLC 2IAAA 1B9YA 4J8GA 4GGCA 5EALA 5IGQA 4ERZA 3EI3A 1ERJA 3OKYB 4ZOXA 3OKWA 2P9NC 4O9DA 2OK4A 3I8CA 5I5MA 3UVNA 4TZ4A 3EI2B 2P9SC 5I5IA 2CO0A 4CZXA 4CI1A 2CO0C 5C9ZB 4CZVA 4IA9A 2BBKH 3MKSB 3MXXA 4Y7RA 2Z2PA 4ZOYA 3L4MD 2XU7A 2HJ4A 5AJAA 3SXTD 5H17A 4XYIA 1R5MA 1SQ9A 3J80g 2PM7B 3RSEC 3JB9L 3U4YA 4GQ2P 4G56B 1FWXA 2PM9A 4GQ1A 3EI4A 2H6NA 5HYNB 3BG1A 3OL2B 4X63B 5IJ7E 2AGWA 3EG6A 5HE1B 4A08A 3AFCA 3VGZA 3PVWB 5FXYA 1PEVA 1A0RB 4U7AA 5AFU3 5HE0B 3OKYA 2QC5A 1PGUA 5IGOA 4Z8LA 2EBSA 3NVNA 4PSWB 5HE3B 2IURA 4ZOZA 5KDOB 3IJ1A 4ES0A 5EAMA 2I0SA 3EI2A 2IUPA 3UKRC 4PNKB 3AL9A 3JRPA 4J0WA 3N0EA 5H1MA 3JZNA 3K26A 3PSCB 1YFQA 2P9PC 5EARA 4J79A 3ORVD 2OVPB 2UZXB 4A2MA 3OW8A 3NVXA 1MDAH 3SHFA 3PVUB 4FA5D 5TDHB 3SJLD 1VYHC 4A0AB 3SCYA 4FAND 3OL2A 3V5WB 3EI1B 3N0DA 3F3FA 4K3ID 3HFQA 3IIYA 2J57G 4ZOVA 3L4OD 4PSXB 1S4UX 5IC7A 2B5MA 5CYKB 3I7HA 2H9PA 5JWZA 2Z2OA 4O45A 3RRMC 2CNXA 5EM2B 1U4CA 3IJ0A 4X3EA 1JMXB 2P9UC 2HKRA 2OVRB 4E54B 2W18A 4A09B 3SBQA 3IIWA 4AEZA 2IWKA 4QQEA 3GREA 3UR4A 2H47A 3DM0A 2OJYA 1JMZB 4XEIC 1K8KC 4ERQA 3I7KA 2Q7QA 4CI2A 5C2VB 4XYHA 2AGZA 3NVQA 4LGNA 3UKUC 3I7LA 2H9NA 3P4FA 5EMJB 4CC9A 4A0AA 5EMLB 2H9MA 3EI1A 2QXVA 5FKRA 5HE2B 3MZLA 4J8BA 4O1QD 2CN3A 5A2Qg 3PXWD 5EMKB 2HYEA 4BUJC 4A11B 5CYKA 3C75H 5TF2A 2TRCB 1OMWB 5EM2A 5H14A 3PXTD 5FLXg 2YNOA 3SMRA 4GGAA 4E54A 1QNIA 4A09A 4QL1A 3BWSA 2H68A 2AGXA 4CI8A 2B5NA 4K3JB 2H9LA 2O9KA 3IJCA 4EWRA 1GG2B 2IUVA 3C5MA 2CN2A 1U2VC 4BL0A 3SBRA 4JD2C 5GSAA 5HQGA 3FRXA 1P22A 4L1QD 2AH0A 2B5LA 5IJ8E 2CE9A 1PI6A 1N6FA 2P9IC 4O3TB 3SWSD 2YNNA 2MTAH 4GM9A 2IWFA 4PBYA 4GM8A 2OVQB 2P9KC 4PC0A 3BG0A 1Q47A 5AMSA 3SLED 4A0BB 3PE7A 5TEEA 1XHMA 3JZGA 4J0XA 4A11A 2UZYB 4J81A 2BCJB 4H5IA 4FAVD 3E0CA 3CIKB 4CY5A 4FA1D 2H14A 3ODTA 1TYQC 2I3SA 4GMBA 2H3XA 3AL8B 5CXCB 2AH1A 3FGBA 5EMMB 3EMHA 2CE8A 5IT9g 3I89A 3KRWB 3VH0A 1L0QA 2GC4A 4X61B 2J56H 4L3HD 2Z2NA 3ULEC 4IMMA 3CFVA 4H5JA 4JSPC 4JSVC 2PBIB 3RN0D 3SVWD 4GGDA 3VA6A 3SN6B 1XIPA 3V7DB 2PM6B 1JOFA 4J73A 5FKTA 1B9XA 4ZN4A 5CXBB 4U1EI 3IKOA 1N6DA 4PXWA 3RLMD 4JT5C 3EWEA 4A0BA 3PSLA 3UVOA 4J82A 2HJBA 2AQ5A 4E5ZB 3DXKC 1MG2A 2IUQA 4JSNC 4D0KA 3MZKA 3CFSB 5C2WB 4CY3A 3W15A 3RFGA 4A7JA 1MG3A 2GNQA 3AL8A 5CXCA 4CY1A 4X60B 2G9AA 2XYIA 5EAPA 3RN1D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AGL A;  4L9O A;  2AGY A;  3UVK A;  3I2N A;  4QRJ A;  5FA5 B;  4CI3 A;  4AOW A;  4LG9 A;  2H13 A;  3AH8 B;  1NR0 A;  1GP2 B;  5K19 A;  4KFM B;  2B4E A;  3ZWL B;  4ESG A;  3JPX A;  5THA A;  4ERY A;  3UVL A;  4MK0 B;  3FM0 A;  2HES X;  5GXH A;  4FHL A;  5CXB A;  4FA4 D;  2J55 H;  1XKS A;  4CZY A;  4FB1 D;  3JRO A;  4J77 A;  4J78 A;  1NEX B;  4UI9 R;  4CY2 A;  1N6E A;  2XL3 A;  1TBG A;  3B7F A;  3I7N A;  3J81 g;  4E5Z A;  4JT6 C;  3RFH A;  4J87 A;  2OIZ A;  4JSX C;  4O3U B;  4PBZ A;  1GXR A;  3JZH A;  4L3G D;  4N14 A;  4R7A B;  4Y5R D;  1OLZ A;  5FQD A;  2HKM A;  4OWR A;  5B4W A;  5TEF A;  4I79 A;  5FKS A;  1JJU B;  4A2L A;  4JXM A;  3PXS D;  1GOT B;  4FWW A;  4GZ8 A;  3SFZ A;  4OZU A;  3V9F A;  3KRX B;  3F3G A;  4GM3 A;  2P9L C;  2G99 A;  3DSM A;  2I0T A;  3OTT A;  3C99 A;  2YBA A;  3EI3 B;  3SBP A;  5GXI A;  5SXM A;  2YMU A;  4FA9 D;  2I3T A;  1SQJ A;  4J86 A;  5GMK n;  3K27 A;  2YB8 B;  3DXM C;  2H6K A;  2OK6 A;  3I7O A;  4HDJ A;  4QT8 A;  3A0F A;  5K1C C;  4NSX A;  2HXC A;  3C9C A;  4BH6 A;  5FKQ A;  2XL2 A;  2GC7 A;  3I7P A;  3JAM g;  4LG8 A;  1PBY B;  3MMY A;  3EU7 A;  4GQB B;  2YNP A;  3I8E A;  3GFC A;  5I5J A;  1K32 A;  2PM9 B;  3F3P A;  4YVD A;  4D6V A;  3EI4 B;  1RI6 A;  2I0R A;  1SHY B;  3UVM A;  4J84 A;  4A08 B;  3MKQ A;  3RMZ D;  3OKT A;  2H6Q A;  3DWL C;  2IAA A;  1B9Y A;  4J8G A;  4GGC A;  5EAL A;  5IGQ A;  4ERZ A;  3EI3 A;  1ERJ A;  3OKY B;  4ZOX A;  3OKW A;  2P9N C;  4O9D A;  2OK4 A;  3I8C A;  5I5M A;  3UVN A;  4TZ4 A;  3EI2 B;  2P9S C;  5I5I A;  2CO0 A;  4CZX A;  4CI1 A;  2CO0 C;  5C9Z B;  4CZV A;  4IA9 A;  2BBK H;  3MKS B;  3MXX A;  4Y7R A;  2Z2P A;  4ZOY A;  3L4M D;  2XU7 A;  2HJ4 A;  5AJA A;  3SXT D;  5H17 A;  4XYI A;  1R5M A;  1SQ9 A;  3J80 g;  2PM7 B;  3RSE C;  3JB9 L;  3U4Y A;  4GQ2 P;  4G56 B;  1FWX A;  2PM9 A;  4GQ1 A;  3EI4 A;  2H6N A;  5HYN B;  3BG1 A;  3OL2 B;  4X63 B;  5IJ7 E;  2AGW A;  3EG6 A;  5HE1 B;  4A08 A;  3AFC A;  3VGZ A;  3PVW B;  5FXY A;  1PEV A;  1A0R B;  4U7A A;  5AFU 3;  5HE0 B;  3OKY A;  2QC5 A;  1PGU A;  5IGO A;  4Z8L A;  2EBS A;  3NVN A;  4PSW B;  5HE3 B;  2IUR A;  4ZOZ A;  5KDO B;  3IJ1 A;  4ES0 A;  5EAM A;  2I0S A;  3EI2 A;  2IUP A;  3UKR C;  4PNK B;  3AL9 A;  3JRP A;  4J0W A;  3N0E A;  5H1M A;  3JZN A;  3K26 A;  3PSC B;  1YFQ A;  2P9P C;  5EAR A;  4J79 A;  3ORV D;  2OVP B;  2UZX B;  4A2M A;  3OW8 A;  3NVX A;  1MDA H;  3SHF A;  3PVU B;  4FA5 D;  5TDH B;  3SJL D;  1VYH C;  4A0A B;  3SCY A;  4FAN D;  3OL2 A;  3V5W B;  3EI1 B;  3N0D A;  3F3F A;  4K3I D;  3HFQ A;  3IIY A;  2J57 G;  4ZOV A;  3L4O D;  4PSX B;  1S4U X;  5IC7 A;  2B5M A;  5CYK B;  3I7H A;  2H9P A;  5JWZ A;  2Z2O A;  4O45 A;  3RRM C;  2CNX A;  5EM2 B;  1U4C A;  3IJ0 A;  4X3E A;  1JMX B;  2P9U C;  2HKR A;  2OVR B;  4E54 B;  2W18 A;  4A09 B;  3SBQ A;  3IIW A;  4AEZ A;  2IWK A;  4QQE A;  3GRE A;  3UR4 A;  2H47 A;  3DM0 A;  2OJY A;  1JMZ B;  4XEI C;  1K8K C;  4ERQ A;  3I7K A;  2Q7Q A;  4CI2 A;  5C2V B;  4XYH A;  2AGZ A;  3NVQ A;  4LGN A;  3UKU C;  3I7L A;  2H9N A;  3P4F A;  5EMJ B;  4CC9 A;  4A0A A;  5EML B;  2H9M A;  3EI1 A;  2QXV A;  5FKR A;  5HE2 B;  3MZL A;  4J8B A;  4O1Q D;  2CN3 A;  5A2Q g;  3PXW D;  5EMK B;  2HYE A;  4BUJ C;  4A11 B;  5CYK A;  3C75 H;  5TF2 A;  2TRC B;  1OMW B;  5EM2 A;  5H14 A;  3PXT D;  5FLX g;  2YNO A;  3SMR A;  4GGA A;  4E54 A;  1QNI A;  4A09 A;  4QL1 A;  3BWS A;  2H68 A;  2AGX A;  4CI8 A;  2B5N A;  4K3J B;  2H9L A;  2O9K A;  3IJC A;  4EWR A;  1GG2 B;  2IUV A;  3C5M A;  2CN2 A;  1U2V C;  4BL0 A;  3SBR A;  4JD2 C;  5GSA A;  5HQG A;  3FRX A;  1P22 A;  4L1Q D;  2AH0 A;  2B5L A;  5IJ8 E;  2CE9 A;  1PI6 A;  1N6F A;  2P9I C;  4O3T B;  3SWS D;  2YNN A;  2MTA H;  4GM9 A;  2IWF A;  4PBY A;  4GM8 A;  2OVQ B;  2P9K C;  4PC0 A;  3BG0 A;  1Q47 A;  5AMS A;  3SLE D;  4A0B B;  3PE7 A;  5TEE A;  1XHM A;  3JZG A;  4J0X A;  4A11 A;  2UZY B;  4J81 A;  2BCJ B;  4H5I A;  4FAV D;  3E0C A;  3CIK B;  4CY5 A;  4FA1 D;  2H14 A;  3ODT A;  1TYQ C;  2I3S A;  4GMB A;  2H3X A;  3AL8 B;  5CXC B;  2AH1 A;  3FGB A;  5EMM B;  3EMH A;  2CE8 A;  5IT9 g;  3I89 A;  3KRW B;  3VH0 A;  1L0Q A;  2GC4 A;  4X61 B;  2J56 H;  4L3H D;  2Z2N A;  3ULE C;  4IMM A;  3CFV A;  4H5J A;  4JSP C;  4JSV C;  2PBI B;  3RN0 D;  3SVW D;  4GGD A;  3VA6 A;  3SN6 B;  1XIP A;  3V7D B;  2PM6 B;  1JOF A;  4J73 A;  5FKT A;  1B9X A;  4ZN4 A;  5CXB B;  4U1E I;  3IKO A;  1N6D A;  4PXW A;  3RLM D;  4JT5 C;  3EWE A;  4A0B A;  3PSL A;  3UVO A;  4J82 A;  2HJB A;  2AQ5 A;  4E5Z B;  3DXK C;  1MG2 A;  2IUQ A;  4JSN C;  4D0K A;  3MZK A;  3CFS B;  5C2W B;  4CY3 A;  3W15 A;  3RFG A;  4A7J A;  1MG3 A;  2GNQ A;  3AL8 A;  5CXC A;  4CY1 A;  4X60 B;  2G9A A;  2XYI A;  5EAP A;  3RN1 D; 
#chains in the Genus database with same CATH topology
 2JKX A;  2AGL A;  4L9O A;  2AGY A;  1I2M B;  1H2X A;  3UVK A;  3I2N A;  2VDO A;  4QRJ A;  1VE7 A;  5FA5 B;  4CI3 A;  4AOW A;  4LG9 A;  2H13 A;  3AH8 B;  1NR0 A;  1GP2 B;  5K19 A;  4KFM B;  2B4E A;  3ZWL B;  4ESG A;  3JPX A;  3K72 A;  5THA A;  4ERY A;  3UVL A;  4Z7Q A;  4MK0 B;  3FM0 A;  2HES X;  5GXH A;  4FHL A;  5CXB A;  4FA4 D;  2J55 H;  3MVD K;  1XKS A;  4CZY A;  4FB1 D;  3JRO A;  5M5R A;  4J77 A;  4J78 A;  1NEX B;  4UI9 R;  3IUN A;  4CY2 A;  1N6E A;  4WJK A;  2XL3 A;  1TBG A;  3B7F A;  3I7N A;  3J81 g;  4E5Z A;  4JT6 C;  1H2Y A;  3RFH A;  4IRZ A;  4J87 A;  2OIZ A;  4JSX C;  4O3U B;  4PBZ A;  1JTD B;  2EIB A;  3IUR A;  1GXR A;  3JZH A;  3NIF A;  4L3G D;  1E5T A;  4N14 A;  4R7A B;  4WK4 A;  4Y5R D;  1OLZ A;  5FQD A;  3VI4 A;  2HKM A;  4OWR A;  5B4W A;  3IUQ A;  5TEF A;  4I79 A;  5FKS A;  1JJU B;  4A2L A;  3V4P A;  3PXS D;  4JXM A;  1GOT B;  4FWW A;  4GZ8 A;  3SFZ A;  4OZU A;  3V9F A;  4NEN A;  4D9S A;  3KRX B;  3F3G A;  4GM3 A;  1UTC A;  2P9L C;  2G99 A;  3DSM A;  2I0T A;  3OTT A;  3O4J A;  3C99 A;  2YBA A;  3EI3 B;  3SBP A;  4MMX A;  5GXI A;  5SXM A;  2YMU A;  4FA9 D;  2I3T A;  1SQJ A;  4J86 A;  5GMK n;  3K27 A;  2YB8 B;  3O4I A;  1BPO A;  3DXM C;  1H2Z A;  2H6K A;  2OK6 A;  3I7O A;  4HDJ A;  4QT8 A;  3A0F A;  5K1C C;  4NSX A;  2HXC A;  3C9C A;  4BH6 A;  3ZE0 A;  3O4G A;  3K6S A;  5FKQ A;  2VZ3 A;  2XL2 A;  2GC7 A;  3I7P A;  3JAM g;  4LG8 A;  5C92 A;  1PBY B;  3MMY A;  3EU7 A;  2YNP A;  4GQB B;  3I8E A;  3EQ7 A;  3ZDX A;  3GFC A;  5I5J A;  1E8N A;  2VDN A;  1K32 A;  2PM9 B;  3F3P A;  2VC2 A;  4YVD A;  4D6V A;  3EI4 B;  1RI6 A;  2I0R A;  4WK2 A;  2HU7 A;  1SHY B;  2EID A;  3UVM A;  4J84 A;  5M5T A;  3MKQ A;  3RMZ D;  4A08 B;  3OKT A;  5M5U A;  2H6Q A;  3DWL C;  3V4V A;  2IAA A;  4WK0 A;  5FFG A;  3IUM A;  1B9Y A;  4J8G A;  4GGC A;  5EAL A;  5IGQ A;  4ERZ A;  3EI3 A;  1ERJ A;  3FCS A;  3OKY B;  4ZOX A;  3KCI A;  2P9N C;  3OKW A;  4O9D A;  2OK4 A;  3I8C A;  5M61 A;  5I5M A;  3UVN A;  4TZ4 A;  3EI2 B;  4G55 A;  2P9S C;  4G1M A;  2WQ8 A;  5I5I A;  2CO0 A;  4CZX A;  4CI1 A;  2CO0 C;  5C9Z B;  4CZV A;  4AN0 A;  4IA9 A;  3IUL A;  1U8C A;  2BBK H;  3MKS B;  3MXX A;  4Y7R A;  2Z2P A;  4ZOY A;  5E6R A;  3L4M D;  2XU7 A;  2HJ4 A;  5AJA A;  3SXT D;  5H17 A;  1GOF A;  4XYI A;  1R5M A;  1SQ9 A;  3J80 g;  3EQ8 A;  2PM7 B;  3RSE C;  3JB9 L;  3U4Y A;  4GQ2 P;  4G56 B;  5FFO A;  1FWX A;  2PM9 A;  4GQ1 A;  3EI4 A;  2H6N A;  4BCC A;  3BG1 A;  5HYN B;  1UOO A;  4AMZ A;  3OL2 B;  4X63 B;  3ZDY A;  5IJ7 E;  2AGW A;  3EG6 A;  4RE6 A;  5HE1 B;  4A08 A;  3AFC A;  3VGZ A;  3PVW B;  2XE4 A;  5FXY A;  3K71 A;  1PEV A;  1A0R B;  1TYE A;  4U7A A;  5AFU 3;  3QI0 A;  5HE0 B;  3OKY A;  2QC5 A;  1PGU A;  5IGO A;  4Z8L A;  2EBS A;  3NVN A;  4PSW B;  5HE3 B;  2QZP A;  2IUR A;  4ZOZ A;  5KDO B;  3IJE A;  4AX4 A;  3IJ1 A;  4ES0 A;  5EAM A;  4UM8 A;  2I0S A;  3EI2 A;  2IUP A;  3UKR C;  4PNK B;  4BCB A;  4L1M A;  4Z7O A;  1O6F A;  3AL9 A;  3JRP A;  4J0W A;  3N0E A;  5H1M A;  1T2X A;  3JZN A;  3K26 A;  3PSC B;  1YFQ A;  4BP9 A;  2P9P C;  5EAR A;  4J79 A;  3ORV D;  2OVP B;  5C86 A;  2UZX B;  4A2M A;  2VDQ A;  3OW8 A;  3NVX A;  1MDA H;  3SHF A;  3PVU B;  4FA5 D;  5TDH B;  3OF7 A;  1A12 A;  3SJL D;  1VYH C;  4AMY A;  4A0A B;  3SCY A;  4FAN D;  1YR2 A;  3OL2 A;  5M5V A;  3V5W B;  3EI1 B;  3N0D A;  3F3F A;  2VDL A;  4K3I D;  3HFQ A;  3IIY A;  2J57 G;  4ZOV A;  3L4O D;  4PSX B;  3EQ9 A;  4DNU A;  4QAM A;  1S4U X;  5IC7 A;  2B5M A;  5CYK B;  3I7H A;  4UM9 A;  4JHP C;  2H9P A;  2XZG A;  2Z2O A;  4O45 A;  3RRM C;  2CNX A;  5JWZ A;  5EM2 B;  1U4C A;  3IJ0 A;  4X3E A;  1JMX B;  2P9U C;  2HKR A;  2OVR B;  4E54 B;  2W18 A;  4A09 B;  3SBQ A;  3IIW A;  4AEZ A;  2IWK A;  4QQE A;  3GRE A;  3T3P A;  3UR4 A;  2EIC A;  2H47 A;  3DM0 A;  2OJY A;  1JMZ B;  4XEI C;  1K8K C;  3QHY B;  3I7K A;  4ERQ A;  2Q7Q A;  4CI2 A;  5C2V B;  4XYH A;  2AGZ A;  3NVQ A;  1VZ2 A;  4LGN A;  3UKU C;  3I7L A;  2H9N A;  1C9I A;  1QFM A;  1QFS A;  3P4F A;  5EMJ B;  1M1X A;  4CC9 A;  4A0A A;  2VZ1 A;  5E6U A;  2HU8 A;  5EML B;  4O2W A;  2H9M A;  3EI1 A;  2QXV A;  5FKR A;  5HE2 B;  3MZL A;  4J8B A;  4O1Q D;  2XDW A;  2CN3 A;  5A2Q g;  3PXW D;  5EMK B;  2HYE A;  4BUJ C;  2BKL A;  3MUN A;  4A11 B;  4O02 A;  5CYK A;  3C75 H;  3O4H A;  5TF2 A;  2TRC B;  1OMW B;  5EM2 A;  5H14 A;  3PXT D;  5FLX g;  2YNO A;  3DDU A;  3SMR A;  4GGA A;  4E54 A;  4G1E A;  4NC4 A;  1QNI A;  2VDP A;  4A09 A;  4QL1 A;  3BWS A;  2HU5 A;  2H68 A;  2AGX A;  4CI8 A;  2B5N A;  2VDM A;  4K3J B;  2H9L A;  2O9K A;  3IJC A;  4EWR A;  1GG2 B;  2IUV A;  3C5M A;  2CN2 A;  1U2V C;  4BL0 A;  3SBR A;  4JD2 C;  5GSA A;  5HQG A;  3FRX A;  1P22 A;  4MMY A;  1JV2 A;  4L1Q D;  2AH0 A;  2B5L A;  5IJ8 E;  2CE9 A;  1PI6 A;  1GOH A;  1N6F A;  2P9I C;  3GD1 I;  4O3T B;  3SWS D;  2YNN A;  2MTA H;  4GM9 A;  2IWF A;  4PBY A;  4GM8 A;  3FCU A;  2OVQ B;  2P9K C;  4PC0 A;  3BG0 A;  1Q47 A;  3IUJ A;  5AMS A;  3SLE D;  5E6S A;  3NIG A;  3NID A;  4A0B B;  3PE7 A;  5TEE A;  1XHM A;  2QR5 A;  3JZG A;  1E8M A;  4J0X A;  4A11 A;  2UZY B;  3GC3 B;  1VE6 A;  4J81 A;  2BCJ B;  4H5I A;  4FAV D;  3E0C A;  3CIK B;  4CY5 A;  4FA1 D;  4JHN A;  4DNV A;  2H14 A;  3ODT A;  1H2W A;  1TYQ C;  2I3S A;  2VDK A;  4GMB A;  2H3X A;  3AL8 B;  5CXC B;  5M5S A;  2AH1 A;  3FGB A;  1VZ3 A;  3ZE2 A;  5EMM B;  3EMH A;  2CE8 A;  5IT9 g;  3I89 A;  3T3M A;  3VI3 A;  3KRW B;  3VH0 A;  1L0Q A;  2GC4 A;  4X61 B;  2J56 H;  4L3H D;  2Z2N A;  3ULE C;  4IMM A;  3CFV A;  4H5J A;  2EIE A;  3ZE1 A;  4JSP C;  4AN1 A;  4JSV C;  1UOP A;  2PBI B;  3RN0 D;  3SVW D;  4GGD A;  3VA6 A;  4BP8 A;  4NAA A;  3SN6 B;  1XIP A;  3V7D B;  3ZDZ A;  2PM6 B;  1JOF A;  3MUO A;  4J73 A;  5FKT A;  1B9X A;  4ZN4 A;  5HDB A;  5CXB B;  4U1E I;  3IKO A;  1N6D A;  1L5G A;  4PXW A;  3RLM D;  4JT5 C;  4BCD A;  4RE5 A;  1UOQ A;  3EWE A;  4A0B A;  1GOG A;  1K3I A;  3PSL A;  3UVO A;  4J82 A;  2HJB A;  2VDR A;  3IVM A;  2AQ5 A;  4E5Z B;  3DXK C;  1MG2 A;  2IUQ A;  4JSN C;  4D0K A;  3MZK A;  3CFS B;  4MMZ A;  5C2W B;  4CY3 A;  1O6G A;  3W15 A;  3RFG A;  4A7J A;  1MG3 A;  4DNW A;  2GNQ A;  3AL8 A;  5CXC A;  4CY1 A;  1C9L A;  4X60 B;  2G9A A;  4Z7N A;  2XYI A;  5EAP A;  4NBM A;  3RN1 D; 
#chains in the Genus database with same CATH homology
 2AGL A;  4L9O A;  2AGY A;  3UVK A;  3I2N A;  4QRJ A;  5FA5 B;  4CI3 A;  4AOW A;  4LG9 A;  2H13 A;  3AH8 B;  1NR0 A;  1GP2 B;  5K19 A;  4KFM B;  2B4E A;  3ZWL B;  4ESG A;  3JPX A;  5THA A;  4ERY A;  3UVL A;  4MK0 B;  3FM0 A;  2HES X;  5GXH A;  4FHL A;  5CXB A;  4FA4 D;  2J55 H;  1XKS A;  4CZY A;  4FB1 D;  3JRO A;  4J77 A;  4J78 A;  1NEX B;  4UI9 R;  4CY2 A;  1N6E A;  2XL3 A;  1TBG A;  3B7F A;  3I7N A;  3J81 g;  4E5Z A;  4JT6 C;  3RFH A;  4J87 A;  2OIZ A;  4JSX C;  4O3U B;  4PBZ A;  1GXR A;  3JZH A;  4L3G D;  4N14 A;  4R7A B;  4Y5R D;  1OLZ A;  5FQD A;  2HKM A;  4OWR A;  5B4W A;  5TEF A;  4I79 A;  5FKS A;  1JJU B;  4A2L A;  4JXM A;  3PXS D;  1GOT B;  4FWW A;  4GZ8 A;  3SFZ A;  4OZU A;  3V9F A;  3KRX B;  3F3G A;  4GM3 A;  2P9L C;  2G99 A;  3DSM A;  2I0T A;  3OTT A;  3C99 A;  2YBA A;  3EI3 B;  3SBP A;  5GXI A;  5SXM A;  2YMU A;  4FA9 D;  2I3T A;  1SQJ A;  4J86 A;  5GMK n;  3K27 A;  2YB8 B;  3DXM C;  2H6K A;  2OK6 A;  3I7O A;  4HDJ A;  4QT8 A;  3A0F A;  5K1C C;  4NSX A;  2HXC A;  3C9C A;  4BH6 A;  5FKQ A;  2XL2 A;  2GC7 A;  3I7P A;  3JAM g;  4LG8 A;  1PBY B;  3MMY A;  3EU7 A;  4GQB B;  2YNP A;  3I8E A;  3GFC A;  5I5J A;  1K32 A;  2PM9 B;  3F3P A;  4YVD A;  4D6V A;  3EI4 B;  1RI6 A;  2I0R A;  1SHY B;  3UVM A;  4J84 A;  4A08 B;  3MKQ A;  3RMZ D;  3OKT A;  2H6Q A;  3DWL C;  2IAA A;  1B9Y A;  4J8G A;  4GGC A;  5EAL A;  5IGQ A;  4ERZ A;  3EI3 A;  1ERJ A;  3OKY B;  4ZOX A;  3OKW A;  2P9N C;  4O9D A;  2OK4 A;  3I8C A;  5I5M A;  3UVN A;  4TZ4 A;  3EI2 B;  2P9S C;  5I5I A;  2CO0 A;  4CZX A;  4CI1 A;  2CO0 C;  5C9Z B;  4CZV A;  4IA9 A;  2BBK H;  3MKS B;  3MXX A;  4Y7R A;  2Z2P A;  4ZOY A;  3L4M D;  2XU7 A;  2HJ4 A;  5AJA A;  3SXT D;  5H17 A;  4XYI A;  1R5M A;  1SQ9 A;  3J80 g;  2PM7 B;  3RSE C;  3JB9 L;  3U4Y A;  4GQ2 P;  4G56 B;  1FWX A;  2PM9 A;  4GQ1 A;  3EI4 A;  2H6N A;  5HYN B;  3BG1 A;  3OL2 B;  4X63 B;  5IJ7 E;  2AGW A;  3EG6 A;  5HE1 B;  4A08 A;  3AFC A;  3VGZ A;  3PVW B;  5FXY A;  1PEV A;  1A0R B;  4U7A A;  5AFU 3;  5HE0 B;  3OKY A;  2QC5 A;  1PGU A;  5IGO A;  4Z8L A;  2EBS A;  3NVN A;  4PSW B;  5HE3 B;  2IUR A;  4ZOZ A;  5KDO B;  3IJ1 A;  4ES0 A;  5EAM A;  2I0S A;  3EI2 A;  2IUP A;  3UKR C;  4PNK B;  3AL9 A;  3JRP A;  4J0W A;  3N0E A;  5H1M A;  3JZN A;  3K26 A;  3PSC B;  1YFQ A;  2P9P C;  5EAR A;  4J79 A;  3ORV D;  2OVP B;  2UZX B;  4A2M A;  3OW8 A;  3NVX A;  1MDA H;  3SHF A;  3PVU B;  4FA5 D;  5TDH B;  3SJL D;  1VYH C;  4A0A B;  3SCY A;  4FAN D;  3OL2 A;  3V5W B;  3EI1 B;  3N0D A;  3F3F A;  4K3I D;  3HFQ A;  3IIY A;  2J57 G;  4ZOV A;  3L4O D;  4PSX B;  1S4U X;  5IC7 A;  2B5M A;  5CYK B;  3I7H A;  2H9P A;  5JWZ A;  2Z2O A;  4O45 A;  3RRM C;  2CNX A;  5EM2 B;  1U4C A;  3IJ0 A;  4X3E A;  1JMX B;  2P9U C;  2HKR A;  2OVR B;  4E54 B;  2W18 A;  4A09 B;  3SBQ A;  3IIW A;  4AEZ A;  2IWK A;  4QQE A;  3GRE A;  3UR4 A;  2H47 A;  3DM0 A;  2OJY A;  1JMZ B;  4XEI C;  1K8K C;  4ERQ A;  3I7K A;  2Q7Q A;  4CI2 A;  5C2V B;  4XYH A;  2AGZ A;  3NVQ A;  4LGN A;  3UKU C;  3I7L A;  2H9N A;  3P4F A;  5EMJ B;  4CC9 A;  4A0A A;  5EML B;  2H9M A;  3EI1 A;  2QXV A;  5FKR A;  5HE2 B;  3MZL A;  4J8B A;  4O1Q D;  2CN3 A;  5A2Q g;  3PXW D;  5EMK B;  2HYE A;  4BUJ C;  4A11 B;  5CYK A;  3C75 H;  5TF2 A;  2TRC B;  1OMW B;  5EM2 A;  5H14 A;  3PXT D;  5FLX g;  2YNO A;  3SMR A;  4GGA A;  4E54 A;  1QNI A;  4A09 A;  4QL1 A;  3BWS A;  2H68 A;  2AGX A;  4CI8 A;  2B5N A;  4K3J B;  2H9L A;  2O9K A;  3IJC A;  4EWR A;  1GG2 B;  2IUV A;  3C5M A;  2CN2 A;  1U2V C;  4BL0 A;  3SBR A;  4JD2 C;  5GSA A;  5HQG A;  3FRX A;  1P22 A;  4L1Q D;  2AH0 A;  2B5L A;  5IJ8 E;  2CE9 A;  1PI6 A;  1N6F A;  2P9I C;  4O3T B;  3SWS D;  2YNN A;  2MTA H;  4GM9 A;  2IWF A;  4PBY A;  4GM8 A;  2OVQ B;  2P9K C;  4PC0 A;  3BG0 A;  1Q47 A;  5AMS A;  3SLE D;  4A0B B;  3PE7 A;  5TEE A;  1XHM A;  3JZG A;  4J0X A;  4A11 A;  2UZY B;  4J81 A;  2BCJ B;  4H5I A;  4FAV D;  3E0C A;  3CIK B;  4CY5 A;  4FA1 D;  2H14 A;  3ODT A;  1TYQ C;  2I3S A;  4GMB A;  2H3X A;  3AL8 B;  5CXC B;  2AH1 A;  3FGB A;  5EMM B;  3EMH A;  2CE8 A;  5IT9 g;  3I89 A;  3KRW B;  3VH0 A;  1L0Q A;  2GC4 A;  4X61 B;  2J56 H;  4L3H D;  2Z2N A;  3ULE C;  4IMM A;  3CFV A;  4H5J A;  4JSP C;  4JSV C;  2PBI B;  3RN0 D;  3SVW D;  4GGD A;  3VA6 A;  3SN6 B;  1XIP A;  3V7D B;  2PM6 B;  1JOF A;  4J73 A;  5FKT A;  1B9X A;  4ZN4 A;  5CXB B;  4U1E I;  3IKO A;  1N6D A;  4PXW A;  3RLM D;  4JT5 C;  3EWE A;  4A0B A;  3PSL A;  3UVO A;  4J82 A;  2HJB A;  2AQ5 A;  4E5Z B;  3DXK C;  1MG2 A;  2IUQ A;  4JSN C;  4D0K A;  3MZK A;  3CFS B;  5C2W B;  4CY3 A;  3W15 A;  3RFG A;  4A7J A;  1MG3 A;  2GNQ A;  3AL8 A;  5CXC A;  4CY1 A;  4X60 B;  2G9A A;  2XYI A;  5EAP A;  3RN1 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...