1XIPA

Crystal structure of the n-terminal domain of nup159
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
381
structure length
367
Chain Sequence
ASSLKDEVPTETSEDFGFKFLGQKQILPSFNEKLPFASLQNLDISNSKSLFVAASGSKAVVGELQLLRDHITSDSTPLTFKWEKEIPDVIFVCFHGDQVLVSTRNALYSLDLEELSEFRTVTSFEKPVFQLKNVNNTLVILNSVNDLSALDLRTKSTKQLAQNVTSFDVTNSQLAVLLKDRSFQSFAWRNGEMEKQFEFSLPSELEELPVEEYSPLSVTILSPQDFLAVFGNVISETDDEVSYDQKMYIIKHIDGSASFQETFDITPPFGQIVRFPYMYKVTLSGLIEPDANVNVLASSCSSEVSIWDSKQVIEPSQDSERAVLPISEETDKDTNPIGVAVDVVTSGLPLVYILNNEGSLQIVGLFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Nucleoporin NUP159
publication title The N-Terminal Domain of Nup159 Forms a beta-Propeller that Functions in mRNA Export by Tethering the Helicase Dbp5 to the Nuclear Pore
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 79
structure length 367
sequence length 381
ec nomenclature
pdb deposition date 2004-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16755 NUP214 Nucleoporin or Nuclear pore complex subunit NUP214=Nup159
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 1xipA00
5I5JA 5EMLB 5HQGA 3EI4B 4MK0B 5HE2B 3EWEA 4PXWA 3EI4A 4QL1A 4LG8A 2UZXB 3FRXA 3PVWB 4I79A 3OTTA 2I3SA 3I89A 3I7NA 3PE7A 2CE8A 4PBZA 3PSLA 2Z2PA 2I0TA 4FA1D 5C9ZB 4A09B 2IUVA 3JZHA 4A09A 3ODTA 3UKUC 1OLZA 4L3HD 3HFQA 4O3UB 2AGZA 2CN3A 1L0QA 3VGZA 1PI6A 4GGCA 3C75H 2OVPB 3MZLA 5HE0B 3IKOA 1GXRA 3RN1D 4GQ2P 3UR4A 2P9NC 1SHYB 3IJ1A 1TBGA 2B5LA 5EAPA 4CZVA 3UVKA 3SFZA 2IUQA 5SXMA 3EI1B 3A0FA 3IIYA 4AEZA 3OKTA 5FLXg 3EI1A 4PSWB 2AH0A 4J87A 4ZN4A 3V9FA 2OVRB 4H5IA 4EWRA 3GFCA 5H17A 3AFCA 4J0WA 3MZKA 4H5JA 4BL0A 4J82A 4Z8LA 5FA5B 4A2MA 2CO0C 5TF2A 4CY5A 1XIPA 1XKSA 2YNOA 5KDOB 2QC5A 4L1QD 4CY3A 4L9OA 2PBIB 2J56H 4X63B 4FAVD 4E5ZB 2IUPA 5CXBA 3KRWB 4E5ZA 5I5MA 4XEIC 3JAMg 5THAA 2P9KC 1JOFA 4ESGA 4D0KA 2H3XA 2HKMA 3ULEC 2OK4A 1GG2B 3RFHA 2TRCB 3GREA 4K3JB 1OMWB 4X3EA 3B7FA 3JROA 2GNQA 3J81g 1PGUA 3V7DB 3EG6A 4XYHA 4J86A 4R7AB 3I8EA 5A2Qg 2BBKH 2H6KA 3I2NA 3KRXB 5GXIA 4JSXC 2XU7A 1B9XA 4GQ1A 2H6NA 5HE1B 4JT5C 5IC7A 4LGNA 4A11B 4ERZA 2G9AA 2HJ4A 1QNIA 3BG0A 2P9PC 3DSMA 2I0SA 4PBYA 1XHMA 4OZUA 5IGOA 2H9MA 4JT6C 4TZ4A 1FWXA 4XYIA 5K1CC 4FA9D 3K26A 4CI2A 1RI6A 2HJBA 5EALA 4A2LA 2I0RA 3SHFA 3VH0A 1A0RB 4JSNC 4QRJA 5EMKB 3RN0D 4O45A 2IWKA 3DM0A 2H47A 4ES0A 1YFQA 2Z2OA 3SXTD 5FKRA 2G99A 2B4EA 5EM2B 3RRMC 1ERJA 5EM2A 3SJLD 3VA6A 4ZOXA 4Y5RD 3OKWA 3RFGA 1S4UX 3N0DA 3P4FA 3CIKB 1MG2A 4J79A 4J81A 5IT9g 2H6QA 4J78A 5CYKA 4IA9A 2GC4A 3L4OD 3UVLA 2B5NA 3SLED 1JMZB 2UZYB 4U7AA 3JZNA 3BG1A 3N0EA 2P9LC 4FWWA 5EMMB 2PM7B 4GM8A 4GGAA 4CI1A 4A0BB 2IAAA 4A0BA 3MXXA 3SBPA 2H9PA 5FKTA 3I7KA 2O9KA 5FQDA 4JXMA 1K8KC 4J84A 4X61B 1PEVA 4E54A 5CXBB 2H9LA 2Q7QA 4J0XA 1MDAH 5TEFA 4CI8A 5GSAA 2HXCA 2PM6B 2AH1A 3EU7A 4YVDA 3OL2B 4X60B 4ZOYA 5EMJB 3AL9A 3OL2A 4O1QD 4L3GD 5I5IA 3AH8B 3DWLC 4O3TB 3J80g 1SQ9A 5GXHA 3MKQA 3SN6B 4Y7RA 2YMUA 3PXSD 4GZ8A 5K19A 5GMKn 3I7PA 2CNXA 3L4MD 3E0CA 2OVQB 2OK6A 5FKSA 2EBSA 3DXKC 1SQJA 4JSVC 4J77A 3BWSA 3MKSB 3C99A 4NSXA 2J57G 4UI9R 3FGBA 5JWZA 2HESX 2XL2A 4D6VA 3EI3A 4CY1A 3IJ0A 1U4CA 4GQBB 1JJUB 4AOWA 4CZXA 4BUJC 2IURA 2XL3A 1K32A 3K27A 3PVUB 1R5MA 3F3FA 5IJ7E 2YB8B 2OJYA 3SMRA 4A0AB 3MMYA 4ERQA 4LG9A 3ORVD 4A0AA 5EARA 3JRPA 3RMZD 5B4WA 2OIZA 1PBYB 3OKYB 5AFU3 1GOTB 2PM9A 3C5MA 2H9NA 3OKYA 1N6FA 1B9YA 3PXWD 3ZWLB 2I3TA 3NVXA 5C2WB 3DXMC 3CFSB 2P9UC 4CC9A 4JD2C 5H1MA 4FHLA 4J8BA 4PC0A 5CYKB 4ZOZA 5FKQA 1P22A 4G56B 4JSPC 2HYEA 2YNPA 3SWSD 3PXTD 4CI3A 4GM9A 3SBRA 2J55H 3I7LA 4GM3A 1U2VC 3FM0A 3SBQA 4GMBA 2YNNA 2CE9A 1N6DA 2QXVA 4K3ID 4FAND 2YBAA 5FXYA 1Q47A 3JZGA 5AMSA 4U1EI 1JMXB 4FB1D 2B5MA 2XYIA 2HKRA 3RLMD 3IJCA 4KFMB 4ZOVA 2Z2NA 5C2VB 4IMMA 4HDJA 5TEEA 2AGLA 4E54B 4N14A 2CO0A 1TYQC 2H14A 4A08B 4O9DA 3I7OA 3UVOA 5HYNB 4A08A 4A7JA 3CFVA 3AL8B 5IJ8E 3I8CA 3AL8A 2AGYA 1NR0A 2GC7A 4PNKB 3PSCB 3SVWD 1VYHC 5HE3B 5CXCB 4GGDA 2W18A 5CXCA 2MTAH 3UVMA 3EI2B 3EI2A 3RSEC 2P9SC 3SCYA 2BCJB 3UKRC 3C9CA 3JB9L 3NVNA 1MG3A 3IIWA 4J8GA 2P9IC 5TDHB 4QT8A 4CY2A 2H13A 5IGQA 4OWRA 3EI3B 4QQEA 3JPXA 5EAMA 2AGWA 4FA5D 2AQ5A 2CN2A 3EMHA 5H14A 1GP2B 1N6EA 3UVNA 3V5WB 3U4YA 4ERYA 2H68A 4BH6A 4FA4D 4A11A 3F3GA 4J73A 2IWFA 3NVQA 2AGXA 3W15A 4PSXB 3F3PA 2PM9B 5AJAA 3OW8A 1NEXB 3I7HA 4CZYA
chains in the Genus database with same CATH superfamily
5I5JA 5EMLB 3QI0A 5HQGA 3EI4B 4MK0B 5HE2B 3EWEA 4PXWA 2VZ1A 2XZGA 3EI4A 4LG8A 2UZXB 4QL1A 3FRXA 3PVWB 4I79A 5M5RA 3MUNA 3OTTA 2I3SA 3I89A 3I7NA 3QHYB 4G1MA 3PE7A 2CE8A 4PBZA 3PSLA 5E6RA 2VDPA 2Z2PA 2I0TA 4FA1D 5C9ZB 1UOQA 4A09B 2IUVA 3JZHA 4MMXA 4A09A 3ODTA 3UKUC 5E6SA 1OLZA 3VI3A 4L3HD 3HFQA 4O3UB 2AGZA 1QFSA 2CN3A 1L0QA 3VGZA 1PI6A 4GGCA 3IULA 3C75H 2OVPB 3MZLA 5HE0B 3IKOA 1GXRA 3RN1D 4GQ2P 1K3IA 2P9NC 1SHYB 3UR4A 3O4IA 3IJ1A 4MMYA 1TBGA 2B5LA 5EAPA 4CZVA 3UVKA 3SFZA 2IUQA 5SXMA 3EI1B 3A0FA 3IIYA 4AEZA 3OKTA 5FLXg 3EI1A 4PSWB 2AH0A 4J87A 4ZN4A 3V9FA 2OVRB 2VDKA 4H5IA 4EWRA 3GFCA 5H17A 3IJEA 3AFCA 4J0WA 3MZKA 4H5JA 4BL0A 4J82A 4Z8LA 5FA5B 4A2MA 2CO0C 4QAMA 5E6UA 5M5SA 5TF2A 4CY5A 1XIPA 1YR2A 1XKSA 2YNOA 5KDOB 2QC5A 4L1QD 4CY3A 2HU8A 4L9OA 4Z7OA 2PBIB 2J56H 4X63B 4FAVD 4D9SA 1L5GA 4E5ZB 2IUPA 5CXBA 3KRWB 4E5ZA 5I5MA 4XEIC 3JAMg 5THAA 2P9KC 1JOFA 4ESGA 4D0KA 2H3XA 2HKMA 4UM9A 3ULEC 2OK4A 1GG2B 3RFHA 2TRCB 1T2XA 3GREA 4K3JB 1OMWB 4X3EA 3B7FA 1O6FA 4NENA 3JROA 2GNQA 2JKXA 3J81g 1PGUA 4NC4A 3V7DB 3EG6A 4XYHA 3NIGA 4J86A 3I8EA 4R7AB 5A2Qg 2BBKH 2H6KA 3I2NA 1E5TA 5C86A 3KRXB 5GXIA 4JSXC 2XU7A 3FCUA 1B9XA 4GQ1A 4BCCA 2H6NA 5HE1B 4JT5C 4Z7QA 5IC7A 4LGNA 3T3PA 4A11B 4ERZA 2G9AA 2HJ4A 1QNIA 3IURA 1H2XA 3BG0A 3FCSA 3IUQA 2P9PC 3DSMA 1H2YA 2I0SA 4PBYA 3K71A 1UTCA 1XHMA 1JTDB 4OZUA 2H9MA 4JT6C 5IGOA 4TZ4A 1FWXA 4XYIA 5K1CC 1UOPA 2VDRA 4AMZA 4FA9D 3K26A 4CI2A 1RI6A 2HJBA 5EALA 4A2LA 2BKLA 2I0RA 3SHFA 3VH0A 1A0RB 4JSNC 4QRJA 5EMKB 3RN0D 4O45A 2IWKA 3DM0A 2H47A 4ES0A 1YFQA 2Z2OA 3SXTD 5FKRA 1E8NA 2G99A 4NAAA 2B4EA 5EM2B 3RRMC 1ERJA 5EM2A 3SJLD 3VA6A 4ZOXA 4Y5RD 1GOFA 3OKWA 3RFGA 4O02A 4DNUA 1S4UX 3N0DA 3P4FA 3CIKB 1MG2A 4J79A 4J81A 4G1EA 3IUNA 2VDQA 5IT9g 2H6QA 4J78A 5CYKA 4IA9A 1BPOA 2QR5A 2GC4A 3L4OD 3UVLA 2B5NA 3SLED 1JMZB 2UZYB 4U7AA 3JZNA 4DNWA 3BG1A 3N0EA 2P9LC 4FWWA 5EMMB 3NIDA 2PM7B 5FFGA 4GM8A 4GGAA 4WK2A 4CI1A 4A0BB 2IAAA 4A0BA 3MXXA 4WK4A 2H9PA 3SBPA 3K6SA 5FKTA 5M61A 3I7KA 2O9KA 5FQDA 4JXMA 1K8KC 4J84A 4X61B 4Z7NA 1PEVA 2XDWA 4E54A 5CXBB 2H9LA 2Q7QA 1JV2A 4J0XA 5M5TA 1MDAH 3MUOA 4DNVA 5TEFA 4CI8A 5GSAA 2EICA 2HXCA 2PM6B 2AH1A 1GOGA 3EU7A 2VC2A 4YVDA 3OL2B 1C9IA 4X60B 4ZOYA 5EMJB 3AL9A 3OL2A 3IUJA 4O1QD 4L3GD 4JHNA 3AH8B 5I5IA 4BP9A 3DWLC 4O3TB 4AN0A 1SQ9A 5C92A 3J80g 5GXHA 4MMZA 3O4HA 3MKQA 5M5UA 3SN6B 4Y7RA 2YMUA 3PXSD 4GZ8A 5K19A 5GMKn 3I7PA 2CNXA 3L4MD 3E0CA 2OVQB 2OK6A 5FKSA 2EBSA 3DXKC 3K72A 2VZ3A 3VI4A 1SQJA 4JSVC 4J77A 3BWSA 3EQ9A 3MKSB 3C99A 3O4JA 4NSXA 3NIFA 2J57G 3IVMA 3OF7A 3FGBA 4UI9R 3ZE2A 2HESX 2XL2A 4D6VA 5JWZA 3EI3A 4CY1A 3GD1I 1H2WA 3IJ0A 1U4CA 4GQBB 1JJUB 3GC3B 4AOWA 4AN1A 4BCBA 4CZXA 4BUJC 2IURA 2XL3A 1K32A 3K27A 3PVUB 1R5MA 3ZDYA 3F3FA 5IJ7E 2YB8B 2OJYA 3SMRA 4A0AB 3MMYA 4ERQA 4LG9A 3IUMA 3ORVD 4A0AA 5EARA 3JRPA 3RMZD 5B4WA 2OIZA 1PBYB 3OKYB 5AFU3 1GOTB 2PM9A 3C5MA 2H9NA 3OKYA 3V4VA 1N6FA 2XE4A 1B9YA 3PXWD 5FFOA 3ZWLB 3O4GA 2I3TA 3NVXA 4AX4A 5C2WB 3DXMC 4WJKA 3CFSB 2P9UC 4CC9A 2VDNA 2EIEA 4JD2C 5H1MA 4FHLA 4J8BA 2WQ8A 4PC0A 5CYKB 4ZOZA 5FKQA 1P22A 1QFMA 4G56B 4WK0A 3T3MA 4JSPC 2HU5A 3DDUA 1VZ2A 2YNPA 2HYEA 3SWSD 1H2ZA 3MVDK 3PXTD 4CI3A 4GM9A 3SBRA 2J55H 3I7LA 4GM3A 4BCDA 1U2VC 3FM0A 3SBQA 3ZDXA 4GMBA 2YNNA 2CE9A 1N6DA 2QXVA 4K3ID 4FAND 2YBAA 2QZPA 5FXYA 1Q47A 3JZGA 5AMSA 4UM8A 4G55A 4U1EI 1JMXB 4FB1D 2HU7A 2B5MA 2XYIA 2HKRA 1O6GA 3RLMD 3ZE0A 3IJCA 4KFMB 4ZOVA 2Z2NA 5M5VA 5C2VB 4IMMA 1VE6A 4HDJA 5TEEA 2AGLA 4E54B 4N14A 2CO0A 4RE6A 1VZ3A 1TYQC 2H14A 4A08B 4O9DA 3I7OA 3UVOA 5HYNB 4A08A 4A7JA 3CFVA 1UOOA 3AL8B 5IJ8E 3I8CA 3AL8A 2AGYA 4O2WA 1NR0A 3EQ8A 1TYEA 2GC7A 4PNKB 3PSCB 3SVWD 1VYHC 4JHPC 2EIBA 4NBMA 5HE3B 3ZDZA 5CXCB 4GGDA 2W18A 1A12A 5CXCA 1C9LA 3KCIA 2MTAH 4RE5A 1GOHA 3UVMA 3EI2B 1I2MB 3EI2A 3RSEC 2VDMA 2P9SC 3SCYA 2BCJB 5HDBA 1M1XA 3UKRC 3C9CA 3JB9L 3NVNA 1MG3A 3IIWA 4AMYA 4J8GA 2P9IC 5TDHB 4QT8A 3ZE1A 4CY2A 2H13A 5IGQA 4OWRA 3EI3B 4QQEA 3JPXA 5EAMA 4L1MA 4IRZA 2AGWA 2VDOA 2EIDA 4FA5D 2AQ5A 2CN2A 3EMHA 5H14A 1GP2B 1N6EA 3UVNA 3V5WB 3U4YA 4ERYA 2H68A 3V4PA 4BH6A 4FA4D 2VDLA 4A11A 3F3GA 4J73A 2IWFA 3NVQA 1E8MA 2AGXA 3W15A 4PSXB 1VE7A 3F3PA 2PM9B 3EQ7A 5AJAA 1U8CA 3OW8A 1NEXB 3I7HA 4BP8A 4CZYA
chains in the Genus database with same CATH topology
5I5JA 5EMLB 5HQGA 3EI4B 4MK0B 5HE2B 3EWEA 4PXWA 3EI4A 4QL1A 4LG8A 2UZXB 3FRXA 3PVWB 4I79A 3OTTA 2I3SA 3I89A 3I7NA 3PE7A 2CE8A 4PBZA 3PSLA 2Z2PA 2I0TA 4FA1D 5C9ZB 4A09B 2IUVA 3JZHA 4A09A 3ODTA 3UKUC 1OLZA 4L3HD 3HFQA 4O3UB 2AGZA 2CN3A 1L0QA 3VGZA 1PI6A 4GGCA 3C75H 2OVPB 3MZLA 5HE0B 3IKOA 1GXRA 3RN1D 4GQ2P 3UR4A 2P9NC 1SHYB 3IJ1A 1TBGA 2B5LA 5EAPA 4CZVA 3UVKA 3SFZA 2IUQA 5SXMA 3EI1B 3A0FA 3IIYA 4AEZA 3OKTA 5FLXg 3EI1A 4PSWB 2AH0A 4J87A 4ZN4A 3V9FA 2OVRB 4H5IA 4EWRA 3GFCA 5H17A 3AFCA 4J0WA 3MZKA 4H5JA 4BL0A 4J82A 4Z8LA 5FA5B 4A2MA 2CO0C 5TF2A 4CY5A 1XIPA 1XKSA 2YNOA 5KDOB 2QC5A 4L1QD 4CY3A 4L9OA 2PBIB 2J56H 4X63B 4FAVD 4E5ZB 2IUPA 5CXBA 3KRWB 4E5ZA 5I5MA 4XEIC 3JAMg 5THAA 2P9KC 1JOFA 4ESGA 4D0KA 2H3XA 2HKMA 3ULEC 2OK4A 1GG2B 3RFHA 2TRCB 3GREA 4K3JB 1OMWB 4X3EA 3B7FA 3JROA 2GNQA 3J81g 1PGUA 3V7DB 3EG6A 4XYHA 4J86A 4R7AB 3I8EA 5A2Qg 2BBKH 2H6KA 3I2NA 3KRXB 5GXIA 4JSXC 2XU7A 1B9XA 4GQ1A 2H6NA 5HE1B 4JT5C 5IC7A 4LGNA 4A11B 4ERZA 2G9AA 2HJ4A 1QNIA 3BG0A 2P9PC 3DSMA 2I0SA 4PBYA 1XHMA 4OZUA 5IGOA 2H9MA 4JT6C 4TZ4A 1FWXA 4XYIA 5K1CC 4FA9D 3K26A 4CI2A 1RI6A 2HJBA 5EALA 4A2LA 2I0RA 3SHFA 3VH0A 1A0RB 4JSNC 4QRJA 5EMKB 3RN0D 4O45A 2IWKA 3DM0A 2H47A 4ES0A 1YFQA 2Z2OA 3SXTD 5FKRA 2G99A 2B4EA 5EM2B 3RRMC 1ERJA 5EM2A 3SJLD 3VA6A 4ZOXA 4Y5RD 3OKWA 3RFGA 1S4UX 3N0DA 3P4FA 3CIKB 1MG2A 4J79A 4J81A 5IT9g 2H6QA 4J78A 5CYKA 4IA9A 2GC4A 3L4OD 3UVLA 2B5NA 3SLED 1JMZB 2UZYB 4U7AA 3JZNA 3BG1A 3N0EA 2P9LC 4FWWA 5EMMB 2PM7B 4GM8A 4GGAA 4CI1A 4A0BB 2IAAA 4A0BA 3MXXA 3SBPA 2H9PA 5FKTA 3I7KA 2O9KA 5FQDA 4JXMA 1K8KC 4J84A 4X61B 1PEVA 4E54A 5CXBB 2H9LA 2Q7QA 4J0XA 1MDAH 5TEFA 4CI8A 5GSAA 2HXCA 2PM6B 2AH1A 3EU7A 4YVDA 3OL2B 4X60B 4ZOYA 5EMJB 3AL9A 3OL2A 4O1QD 4L3GD 5I5IA 3AH8B 3DWLC 4O3TB 3J80g 1SQ9A 5GXHA 3MKQA 3SN6B 4Y7RA 2YMUA 3PXSD 4GZ8A 5K19A 5GMKn 3I7PA 2CNXA 3L4MD 3E0CA 2OVQB 2OK6A 5FKSA 2EBSA 3DXKC 1SQJA 4JSVC 4J77A 3BWSA 3MKSB 3C99A 4NSXA 2J57G 4UI9R 3FGBA 5JWZA 2HESX 2XL2A 4D6VA 3EI3A 4CY1A 3IJ0A 1U4CA 4GQBB 1JJUB 4AOWA 4CZXA 4BUJC 2IURA 2XL3A 1K32A 3K27A 3PVUB 1R5MA 3F3FA 5IJ7E 2YB8B 2OJYA 3SMRA 4A0AB 3MMYA 4ERQA 4LG9A 3ORVD 4A0AA 5EARA 3JRPA 3RMZD 5B4WA 2OIZA 1PBYB 3OKYB 5AFU3 1GOTB 2PM9A 3C5MA 2H9NA 3OKYA 1N6FA 1B9YA 3PXWD 3ZWLB 2I3TA 3NVXA 5C2WB 3DXMC 3CFSB 2P9UC 4CC9A 4JD2C 5H1MA 4FHLA 4J8BA 4PC0A 5CYKB 4ZOZA 5FKQA 1P22A 4G56B 4JSPC 2HYEA 2YNPA 3SWSD 3PXTD 4CI3A 4GM9A 3SBRA 2J55H 3I7LA 4GM3A 1U2VC 3FM0A 3SBQA 4GMBA 2YNNA 2CE9A 1N6DA 2QXVA 4K3ID 4FAND 2YBAA 5FXYA 1Q47A 3JZGA 5AMSA 4U1EI 1JMXB 4FB1D 2B5MA 2XYIA 2HKRA 3RLMD 3IJCA 4KFMB 4ZOVA 2Z2NA 5C2VB 4IMMA 4HDJA 5TEEA 2AGLA 4E54B 4N14A 2CO0A 1TYQC 2H14A 4A08B 4O9DA 3I7OA 3UVOA 5HYNB 4A08A 4A7JA 3CFVA 3AL8B 5IJ8E 3I8CA 3AL8A 2AGYA 1NR0A 2GC7A 4PNKB 3PSCB 3SVWD 1VYHC 5HE3B 5CXCB 4GGDA 2W18A 5CXCA 2MTAH 3UVMA 3EI2B 3EI2A 3RSEC 2P9SC 3SCYA 2BCJB 3UKRC 3C9CA 3JB9L 3NVNA 1MG3A 3IIWA 4J8GA 2P9IC 5TDHB 4QT8A 4CY2A 2H13A 5IGQA 4OWRA 3EI3B 4QQEA 3JPXA 5EAMA 2AGWA 4FA5D 2AQ5A 2CN2A 3EMHA 5H14A 1GP2B 1N6EA 3UVNA 3V5WB 3U4YA 4ERYA 2H68A 4BH6A 4FA4D 4A11A 3F3GA 4J73A 2IWFA 3NVQA 2AGXA 3W15A 4PSXB 3F3PA 2PM9B 5AJAA 3OW8A 1NEXB 3I7HA 4CZYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I5J A;  5EML B;  5HQG A;  3EI4 B;  4MK0 B;  5HE2 B;  3EWE A;  4PXW A;  3EI4 A;  4QL1 A;  4LG8 A;  2UZX B;  3FRX A;  3PVW B;  4I79 A;  3OTT A;  2I3S A;  3I89 A;  3I7N A;  3PE7 A;  2CE8 A;  4PBZ A;  3PSL A;  2Z2P A;  2I0T A;  4FA1 D;  5C9Z B;  4A09 B;  2IUV A;  3JZH A;  4A09 A;  3ODT A;  3UKU C;  1OLZ A;  4L3H D;  3HFQ A;  4O3U B;  2AGZ A;  2CN3 A;  1L0Q A;  3VGZ A;  1PI6 A;  4GGC A;  3C75 H;  2OVP B;  3MZL A;  5HE0 B;  3IKO A;  1GXR A;  3RN1 D;  4GQ2 P;  3UR4 A;  2P9N C;  1SHY B;  3IJ1 A;  1TBG A;  2B5L A;  5EAP A;  4CZV A;  3UVK A;  3SFZ A;  2IUQ A;  5SXM A;  3EI1 B;  3A0F A;  3IIY A;  4AEZ A;  3OKT A;  5FLX g;  3EI1 A;  4PSW B;  2AH0 A;  4J87 A;  4ZN4 A;  3V9F A;  2OVR B;  4H5I A;  4EWR A;  3GFC A;  5H17 A;  3AFC A;  4J0W A;  3MZK A;  4H5J A;  4BL0 A;  4J82 A;  4Z8L A;  5FA5 B;  4A2M A;  2CO0 C;  5TF2 A;  4CY5 A;  1XIP A;  1XKS A;  2YNO A;  5KDO B;  2QC5 A;  4L1Q D;  4CY3 A;  4L9O A;  2PBI B;  2J56 H;  4X63 B;  4FAV D;  4E5Z B;  2IUP A;  5CXB A;  3KRW B;  4E5Z A;  5I5M A;  4XEI C;  3JAM g;  5THA A;  2P9K C;  1JOF A;  4ESG A;  4D0K A;  2H3X A;  2HKM A;  3ULE C;  2OK4 A;  1GG2 B;  3RFH A;  2TRC B;  3GRE A;  4K3J B;  1OMW B;  4X3E A;  3B7F A;  3JRO A;  2GNQ A;  3J81 g;  1PGU A;  3V7D B;  3EG6 A;  4XYH A;  4J86 A;  4R7A B;  3I8E A;  5A2Q g;  2BBK H;  2H6K A;  3I2N A;  3KRX B;  5GXI A;  4JSX C;  2XU7 A;  1B9X A;  4GQ1 A;  2H6N A;  5HE1 B;  4JT5 C;  5IC7 A;  4LGN A;  4A11 B;  4ERZ A;  2G9A A;  2HJ4 A;  1QNI A;  3BG0 A;  2P9P C;  3DSM A;  2I0S A;  4PBY A;  1XHM A;  4OZU A;  5IGO A;  2H9M A;  4JT6 C;  4TZ4 A;  1FWX A;  4XYI A;  5K1C C;  4FA9 D;  3K26 A;  4CI2 A;  1RI6 A;  2HJB A;  5EAL A;  4A2L A;  2I0R A;  3SHF A;  3VH0 A;  1A0R B;  4JSN C;  4QRJ A;  5EMK B;  3RN0 D;  4O45 A;  2IWK A;  3DM0 A;  2H47 A;  4ES0 A;  1YFQ A;  2Z2O A;  3SXT D;  5FKR A;  2G99 A;  2B4E A;  5EM2 B;  3RRM C;  1ERJ A;  5EM2 A;  3SJL D;  3VA6 A;  4ZOX A;  4Y5R D;  3OKW A;  3RFG A;  1S4U X;  3N0D A;  3P4F A;  3CIK B;  1MG2 A;  4J79 A;  4J81 A;  5IT9 g;  2H6Q A;  4J78 A;  5CYK A;  4IA9 A;  2GC4 A;  3L4O D;  3UVL A;  2B5N A;  3SLE D;  1JMZ B;  2UZY B;  4U7A A;  3JZN A;  3BG1 A;  3N0E A;  2P9L C;  4FWW A;  5EMM B;  2PM7 B;  4GM8 A;  4GGA A;  4CI1 A;  4A0B B;  2IAA A;  4A0B A;  3MXX A;  3SBP A;  2H9P A;  5FKT A;  3I7K A;  2O9K A;  5FQD A;  4JXM A;  1K8K C;  4J84 A;  4X61 B;  1PEV A;  4E54 A;  5CXB B;  2H9L A;  2Q7Q A;  4J0X A;  1MDA H;  5TEF A;  4CI8 A;  5GSA A;  2HXC A;  2PM6 B;  2AH1 A;  3EU7 A;  4YVD A;  3OL2 B;  4X60 B;  4ZOY A;  5EMJ B;  3AL9 A;  3OL2 A;  4O1Q D;  4L3G D;  5I5I A;  3AH8 B;  3DWL C;  4O3T B;  3J80 g;  1SQ9 A;  5GXH A;  3MKQ A;  3SN6 B;  4Y7R A;  2YMU A;  3PXS D;  4GZ8 A;  5K19 A;  5GMK n;  3I7P A;  2CNX A;  3L4M D;  3E0C A;  2OVQ B;  2OK6 A;  5FKS A;  2EBS A;  3DXK C;  1SQJ A;  4JSV C;  4J77 A;  3BWS A;  3MKS B;  3C99 A;  4NSX A;  2J57 G;  4UI9 R;  3FGB A;  5JWZ A;  2HES X;  2XL2 A;  4D6V A;  3EI3 A;  4CY1 A;  3IJ0 A;  1U4C A;  4GQB B;  1JJU B;  4AOW A;  4CZX A;  4BUJ C;  2IUR A;  2XL3 A;  1K32 A;  3K27 A;  3PVU B;  1R5M A;  3F3F A;  5IJ7 E;  2YB8 B;  2OJY A;  3SMR A;  4A0A B;  3MMY A;  4ERQ A;  4LG9 A;  3ORV D;  4A0A A;  5EAR A;  3JRP A;  3RMZ D;  5B4W A;  2OIZ A;  1PBY B;  3OKY B;  5AFU 3;  1GOT B;  2PM9 A;  3C5M A;  2H9N A;  3OKY A;  1N6F A;  1B9Y A;  3PXW D;  3ZWL B;  2I3T A;  3NVX A;  5C2W B;  3DXM C;  3CFS B;  2P9U C;  4CC9 A;  4JD2 C;  5H1M A;  4FHL A;  4J8B A;  4PC0 A;  5CYK B;  4ZOZ A;  5FKQ A;  1P22 A;  4G56 B;  4JSP C;  2HYE A;  2YNP A;  3SWS D;  3PXT D;  4CI3 A;  4GM9 A;  3SBR A;  2J55 H;  3I7L A;  4GM3 A;  1U2V C;  3FM0 A;  3SBQ A;  4GMB A;  2YNN A;  2CE9 A;  1N6D A;  2QXV A;  4K3I D;  4FAN D;  2YBA A;  5FXY A;  1Q47 A;  3JZG A;  5AMS A;  4U1E I;  1JMX B;  4FB1 D;  2B5M A;  2XYI A;  2HKR A;  3RLM D;  3IJC A;  4KFM B;  4ZOV A;  2Z2N A;  5C2V B;  4IMM A;  4HDJ A;  5TEE A;  2AGL A;  4E54 B;  4N14 A;  2CO0 A;  1TYQ C;  2H14 A;  4A08 B;  4O9D A;  3I7O A;  3UVO A;  5HYN B;  4A08 A;  4A7J A;  3CFV A;  3AL8 B;  5IJ8 E;  3I8C A;  3AL8 A;  2AGY A;  1NR0 A;  2GC7 A;  4PNK B;  3PSC B;  3SVW D;  1VYH C;  5HE3 B;  5CXC B;  4GGD A;  2W18 A;  5CXC A;  2MTA H;  3UVM A;  3EI2 B;  3EI2 A;  3RSE C;  2P9S C;  3SCY A;  2BCJ B;  3UKR C;  3C9C A;  3JB9 L;  3NVN A;  1MG3 A;  3IIW A;  4J8G A;  2P9I C;  5TDH B;  4QT8 A;  4CY2 A;  2H13 A;  5IGQ A;  4OWR A;  3EI3 B;  4QQE A;  3JPX A;  5EAM A;  2AGW A;  4FA5 D;  2AQ5 A;  2CN2 A;  3EMH A;  5H14 A;  1GP2 B;  1N6E A;  3UVN A;  3V5W B;  3U4Y A;  4ERY A;  2H68 A;  4BH6 A;  4FA4 D;  4A11 A;  3F3G A;  4J73 A;  2IWF A;  3NVQ A;  2AGX A;  3W15 A;  4PSX B;  3F3P A;  2PM9 B;  5AJA A;  3OW8 A;  1NEX B;  3I7H A;  4CZY A; 
#chains in the Genus database with same CATH topology
 5I5J A;  5EML B;  3QI0 A;  5HQG A;  3EI4 B;  4MK0 B;  5HE2 B;  3EWE A;  4PXW A;  2VZ1 A;  2XZG A;  3EI4 A;  4LG8 A;  2UZX B;  4QL1 A;  3FRX A;  3PVW B;  4I79 A;  5M5R A;  3MUN A;  3OTT A;  2I3S A;  3I89 A;  3I7N A;  3QHY B;  4G1M A;  3PE7 A;  2CE8 A;  4PBZ A;  3PSL A;  5E6R A;  2VDP A;  2Z2P A;  2I0T A;  4FA1 D;  5C9Z B;  1UOQ A;  4A09 B;  2IUV A;  3JZH A;  4MMX A;  4A09 A;  3ODT A;  3UKU C;  5E6S A;  1OLZ A;  3VI3 A;  4L3H D;  3HFQ A;  4O3U B;  2AGZ A;  1QFS A;  2CN3 A;  1L0Q A;  3VGZ A;  1PI6 A;  4GGC A;  3IUL A;  3C75 H;  2OVP B;  3MZL A;  5HE0 B;  3IKO A;  1GXR A;  3RN1 D;  4GQ2 P;  1K3I A;  2P9N C;  1SHY B;  3UR4 A;  3O4I A;  3IJ1 A;  4MMY A;  1TBG A;  2B5L A;  5EAP A;  4CZV A;  3UVK A;  3SFZ A;  2IUQ A;  5SXM A;  3EI1 B;  3A0F A;  3IIY A;  4AEZ A;  3OKT A;  5FLX g;  3EI1 A;  4PSW B;  2AH0 A;  4J87 A;  4ZN4 A;  3V9F A;  2OVR B;  2VDK A;  4H5I A;  4EWR A;  3GFC A;  5H17 A;  3IJE A;  3AFC A;  4J0W A;  3MZK A;  4H5J A;  4BL0 A;  4J82 A;  4Z8L A;  5FA5 B;  4A2M A;  2CO0 C;  4QAM A;  5E6U A;  5M5S A;  5TF2 A;  4CY5 A;  1XIP A;  1YR2 A;  1XKS A;  2YNO A;  5KDO B;  2QC5 A;  4L1Q D;  4CY3 A;  2HU8 A;  4L9O A;  4Z7O A;  2PBI B;  2J56 H;  4X63 B;  4FAV D;  4D9S A;  1L5G A;  4E5Z B;  2IUP A;  5CXB A;  3KRW B;  4E5Z A;  5I5M A;  4XEI C;  3JAM g;  5THA A;  2P9K C;  1JOF A;  4ESG A;  4D0K A;  2H3X A;  2HKM A;  4UM9 A;  3ULE C;  2OK4 A;  1GG2 B;  3RFH A;  2TRC B;  1T2X A;  3GRE A;  4K3J B;  1OMW B;  4X3E A;  3B7F A;  1O6F A;  4NEN A;  3JRO A;  2GNQ A;  2JKX A;  3J81 g;  1PGU A;  4NC4 A;  3V7D B;  3EG6 A;  4XYH A;  3NIG A;  4J86 A;  3I8E A;  4R7A B;  5A2Q g;  2BBK H;  2H6K A;  3I2N A;  1E5T A;  5C86 A;  3KRX B;  5GXI A;  4JSX C;  2XU7 A;  3FCU A;  1B9X A;  4GQ1 A;  4BCC A;  2H6N A;  5HE1 B;  4JT5 C;  4Z7Q A;  5IC7 A;  4LGN A;  3T3P A;  4A11 B;  4ERZ A;  2G9A A;  2HJ4 A;  1QNI A;  3IUR A;  1H2X A;  3BG0 A;  3FCS A;  3IUQ A;  2P9P C;  3DSM A;  1H2Y A;  2I0S A;  4PBY A;  3K71 A;  1UTC A;  1XHM A;  1JTD B;  4OZU A;  2H9M A;  4JT6 C;  5IGO A;  4TZ4 A;  1FWX A;  4XYI A;  5K1C C;  1UOP A;  2VDR A;  4AMZ A;  4FA9 D;  3K26 A;  4CI2 A;  1RI6 A;  2HJB A;  5EAL A;  4A2L A;  2BKL A;  2I0R A;  3SHF A;  3VH0 A;  1A0R B;  4JSN C;  4QRJ A;  5EMK B;  3RN0 D;  4O45 A;  2IWK A;  3DM0 A;  2H47 A;  4ES0 A;  1YFQ A;  2Z2O A;  3SXT D;  5FKR A;  1E8N A;  2G99 A;  4NAA A;  2B4E A;  5EM2 B;  3RRM C;  1ERJ A;  5EM2 A;  3SJL D;  3VA6 A;  4ZOX A;  4Y5R D;  1GOF A;  3OKW A;  3RFG A;  4O02 A;  4DNU A;  1S4U X;  3N0D A;  3P4F A;  3CIK B;  1MG2 A;  4J79 A;  4J81 A;  4G1E A;  3IUN A;  2VDQ A;  5IT9 g;  2H6Q A;  4J78 A;  5CYK A;  4IA9 A;  1BPO A;  2QR5 A;  2GC4 A;  3L4O D;  3UVL A;  2B5N A;  3SLE D;  1JMZ B;  2UZY B;  4U7A A;  3JZN A;  4DNW A;  3BG1 A;  3N0E A;  2P9L C;  4FWW A;  5EMM B;  3NID A;  2PM7 B;  5FFG A;  4GM8 A;  4GGA A;  4WK2 A;  4CI1 A;  4A0B B;  2IAA A;  4A0B A;  3MXX A;  4WK4 A;  2H9P A;  3SBP A;  3K6S A;  5FKT A;  5M61 A;  3I7K A;  2O9K A;  5FQD A;  4JXM A;  1K8K C;  4J84 A;  4X61 B;  4Z7N A;  1PEV A;  2XDW A;  4E54 A;  5CXB B;  2H9L A;  2Q7Q A;  1JV2 A;  4J0X A;  5M5T A;  1MDA H;  3MUO A;  4DNV A;  5TEF A;  4CI8 A;  5GSA A;  2EIC A;  2HXC A;  2PM6 B;  2AH1 A;  1GOG A;  3EU7 A;  2VC2 A;  4YVD A;  3OL2 B;  1C9I A;  4X60 B;  4ZOY A;  5EMJ B;  3AL9 A;  3OL2 A;  3IUJ A;  4O1Q D;  4L3G D;  4JHN A;  3AH8 B;  5I5I A;  4BP9 A;  3DWL C;  4O3T B;  4AN0 A;  1SQ9 A;  5C92 A;  3J80 g;  5GXH A;  4MMZ A;  3O4H A;  3MKQ A;  5M5U A;  3SN6 B;  4Y7R A;  2YMU A;  3PXS D;  4GZ8 A;  5K19 A;  5GMK n;  3I7P A;  2CNX A;  3L4M D;  3E0C A;  2OVQ B;  2OK6 A;  5FKS A;  2EBS A;  3DXK C;  3K72 A;  2VZ3 A;  3VI4 A;  1SQJ A;  4JSV C;  4J77 A;  3BWS A;  3EQ9 A;  3MKS B;  3C99 A;  3O4J A;  4NSX A;  3NIF A;  2J57 G;  3IVM A;  3OF7 A;  3FGB A;  4UI9 R;  3ZE2 A;  2HES X;  2XL2 A;  4D6V A;  5JWZ A;  3EI3 A;  4CY1 A;  3GD1 I;  1H2W A;  3IJ0 A;  1U4C A;  4GQB B;  1JJU B;  3GC3 B;  4AOW A;  4AN1 A;  4BCB A;  4CZX A;  4BUJ C;  2IUR A;  2XL3 A;  1K32 A;  3K27 A;  3PVU B;  1R5M A;  3ZDY A;  3F3F A;  5IJ7 E;  2YB8 B;  2OJY A;  3SMR A;  4A0A B;  3MMY A;  4ERQ A;  4LG9 A;  3IUM A;  3ORV D;  4A0A A;  5EAR A;  3JRP A;  3RMZ D;  5B4W A;  2OIZ A;  1PBY B;  3OKY B;  5AFU 3;  1GOT B;  2PM9 A;  3C5M A;  2H9N A;  3OKY A;  3V4V A;  1N6F A;  2XE4 A;  1B9Y A;  3PXW D;  5FFO A;  3ZWL B;  3O4G A;  2I3T A;  3NVX A;  4AX4 A;  5C2W B;  3DXM C;  4WJK A;  3CFS B;  2P9U C;  4CC9 A;  2VDN A;  2EIE A;  4JD2 C;  5H1M A;  4FHL A;  4J8B A;  2WQ8 A;  4PC0 A;  5CYK B;  4ZOZ A;  5FKQ A;  1P22 A;  1QFM A;  4G56 B;  4WK0 A;  3T3M A;  4JSP C;  2HU5 A;  3DDU A;  1VZ2 A;  2YNP A;  2HYE A;  3SWS D;  1H2Z A;  3MVD K;  3PXT D;  4CI3 A;  4GM9 A;  3SBR A;  2J55 H;  3I7L A;  4GM3 A;  4BCD A;  1U2V C;  3FM0 A;  3SBQ A;  3ZDX A;  4GMB A;  2YNN A;  2CE9 A;  1N6D A;  2QXV A;  4K3I D;  4FAN D;  2YBA A;  2QZP A;  5FXY A;  1Q47 A;  3JZG A;  5AMS A;  4UM8 A;  4G55 A;  4U1E I;  1JMX B;  4FB1 D;  2HU7 A;  2B5M A;  2XYI A;  2HKR A;  1O6G A;  3RLM D;  3ZE0 A;  3IJC A;  4KFM B;  4ZOV A;  2Z2N A;  5M5V A;  5C2V B;  4IMM A;  1VE6 A;  4HDJ A;  5TEE A;  2AGL A;  4E54 B;  4N14 A;  2CO0 A;  4RE6 A;  1VZ3 A;  1TYQ C;  2H14 A;  4A08 B;  4O9D A;  3I7O A;  3UVO A;  5HYN B;  4A08 A;  4A7J A;  3CFV A;  1UOO A;  3AL8 B;  5IJ8 E;  3I8C A;  3AL8 A;  2AGY A;  4O2W A;  1NR0 A;  3EQ8 A;  1TYE A;  2GC7 A;  4PNK B;  3PSC B;  3SVW D;  1VYH C;  4JHP C;  2EIB A;  4NBM A;  5HE3 B;  3ZDZ A;  5CXC B;  4GGD A;  2W18 A;  1A12 A;  5CXC A;  1C9L A;  3KCI A;  2MTA H;  4RE5 A;  1GOH A;  3UVM A;  3EI2 B;  1I2M B;  3EI2 A;  3RSE C;  2VDM A;  2P9S C;  3SCY A;  2BCJ B;  5HDB A;  1M1X A;  3UKR C;  3C9C A;  3JB9 L;  3NVN A;  1MG3 A;  3IIW A;  4AMY A;  4J8G A;  2P9I C;  5TDH B;  4QT8 A;  3ZE1 A;  4CY2 A;  2H13 A;  5IGQ A;  4OWR A;  3EI3 B;  4QQE A;  3JPX A;  5EAM A;  4L1M A;  4IRZ A;  2AGW A;  2VDO A;  2EID A;  4FA5 D;  2AQ5 A;  2CN2 A;  3EMH A;  5H14 A;  1GP2 B;  1N6E A;  3UVN A;  3V5W B;  3U4Y A;  4ERY A;  2H68 A;  3V4P A;  4BH6 A;  4FA4 D;  2VDL A;  4A11 A;  3F3G A;  4J73 A;  2IWF A;  3NVQ A;  1E8M A;  2AGX A;  3W15 A;  4PSX B;  1VE7 A;  3F3P A;  2PM9 B;  3EQ7 A;  5AJA A;  1U8C A;  3OW8 A;  1NEX B;  3I7H A;  4BP8 A;  4CZY A; 
#chains in the Genus database with same CATH homology
 5I5J A;  5EML B;  5HQG A;  3EI4 B;  4MK0 B;  5HE2 B;  3EWE A;  4PXW A;  3EI4 A;  4QL1 A;  4LG8 A;  2UZX B;  3FRX A;  3PVW B;  4I79 A;  3OTT A;  2I3S A;  3I89 A;  3I7N A;  3PE7 A;  2CE8 A;  4PBZ A;  3PSL A;  2Z2P A;  2I0T A;  4FA1 D;  5C9Z B;  4A09 B;  2IUV A;  3JZH A;  4A09 A;  3ODT A;  3UKU C;  1OLZ A;  4L3H D;  3HFQ A;  4O3U B;  2AGZ A;  2CN3 A;  1L0Q A;  3VGZ A;  1PI6 A;  4GGC A;  3C75 H;  2OVP B;  3MZL A;  5HE0 B;  3IKO A;  1GXR A;  3RN1 D;  4GQ2 P;  3UR4 A;  2P9N C;  1SHY B;  3IJ1 A;  1TBG A;  2B5L A;  5EAP A;  4CZV A;  3UVK A;  3SFZ A;  2IUQ A;  5SXM A;  3EI1 B;  3A0F A;  3IIY A;  4AEZ A;  3OKT A;  5FLX g;  3EI1 A;  4PSW B;  2AH0 A;  4J87 A;  4ZN4 A;  3V9F A;  2OVR B;  4H5I A;  4EWR A;  3GFC A;  5H17 A;  3AFC A;  4J0W A;  3MZK A;  4H5J A;  4BL0 A;  4J82 A;  4Z8L A;  5FA5 B;  4A2M A;  2CO0 C;  5TF2 A;  4CY5 A;  1XIP A;  1XKS A;  2YNO A;  5KDO B;  2QC5 A;  4L1Q D;  4CY3 A;  4L9O A;  2PBI B;  2J56 H;  4X63 B;  4FAV D;  4E5Z B;  2IUP A;  5CXB A;  3KRW B;  4E5Z A;  5I5M A;  4XEI C;  3JAM g;  5THA A;  2P9K C;  1JOF A;  4ESG A;  4D0K A;  2H3X A;  2HKM A;  3ULE C;  2OK4 A;  1GG2 B;  3RFH A;  2TRC B;  3GRE A;  4K3J B;  1OMW B;  4X3E A;  3B7F A;  3JRO A;  2GNQ A;  3J81 g;  1PGU A;  3V7D B;  3EG6 A;  4XYH A;  4J86 A;  4R7A B;  3I8E A;  5A2Q g;  2BBK H;  2H6K A;  3I2N A;  3KRX B;  5GXI A;  4JSX C;  2XU7 A;  1B9X A;  4GQ1 A;  2H6N A;  5HE1 B;  4JT5 C;  5IC7 A;  4LGN A;  4A11 B;  4ERZ A;  2G9A A;  2HJ4 A;  1QNI A;  3BG0 A;  2P9P C;  3DSM A;  2I0S A;  4PBY A;  1XHM A;  4OZU A;  5IGO A;  2H9M A;  4JT6 C;  4TZ4 A;  1FWX A;  4XYI A;  5K1C C;  4FA9 D;  3K26 A;  4CI2 A;  1RI6 A;  2HJB A;  5EAL A;  4A2L A;  2I0R A;  3SHF A;  3VH0 A;  1A0R B;  4JSN C;  4QRJ A;  5EMK B;  3RN0 D;  4O45 A;  2IWK A;  3DM0 A;  2H47 A;  4ES0 A;  1YFQ A;  2Z2O A;  3SXT D;  5FKR A;  2G99 A;  2B4E A;  5EM2 B;  3RRM C;  1ERJ A;  5EM2 A;  3SJL D;  3VA6 A;  4ZOX A;  4Y5R D;  3OKW A;  3RFG A;  1S4U X;  3N0D A;  3P4F A;  3CIK B;  1MG2 A;  4J79 A;  4J81 A;  5IT9 g;  2H6Q A;  4J78 A;  5CYK A;  4IA9 A;  2GC4 A;  3L4O D;  3UVL A;  2B5N A;  3SLE D;  1JMZ B;  2UZY B;  4U7A A;  3JZN A;  3BG1 A;  3N0E A;  2P9L C;  4FWW A;  5EMM B;  2PM7 B;  4GM8 A;  4GGA A;  4CI1 A;  4A0B B;  2IAA A;  4A0B A;  3MXX A;  3SBP A;  2H9P A;  5FKT A;  3I7K A;  2O9K A;  5FQD A;  4JXM A;  1K8K C;  4J84 A;  4X61 B;  1PEV A;  4E54 A;  5CXB B;  2H9L A;  2Q7Q A;  4J0X A;  1MDA H;  5TEF A;  4CI8 A;  5GSA A;  2HXC A;  2PM6 B;  2AH1 A;  3EU7 A;  4YVD A;  3OL2 B;  4X60 B;  4ZOY A;  5EMJ B;  3AL9 A;  3OL2 A;  4O1Q D;  4L3G D;  5I5I A;  3AH8 B;  3DWL C;  4O3T B;  3J80 g;  1SQ9 A;  5GXH A;  3MKQ A;  3SN6 B;  4Y7R A;  2YMU A;  3PXS D;  4GZ8 A;  5K19 A;  5GMK n;  3I7P A;  2CNX A;  3L4M D;  3E0C A;  2OVQ B;  2OK6 A;  5FKS A;  2EBS A;  3DXK C;  1SQJ A;  4JSV C;  4J77 A;  3BWS A;  3MKS B;  3C99 A;  4NSX A;  2J57 G;  4UI9 R;  3FGB A;  5JWZ A;  2HES X;  2XL2 A;  4D6V A;  3EI3 A;  4CY1 A;  3IJ0 A;  1U4C A;  4GQB B;  1JJU B;  4AOW A;  4CZX A;  4BUJ C;  2IUR A;  2XL3 A;  1K32 A;  3K27 A;  3PVU B;  1R5M A;  3F3F A;  5IJ7 E;  2YB8 B;  2OJY A;  3SMR A;  4A0A B;  3MMY A;  4ERQ A;  4LG9 A;  3ORV D;  4A0A A;  5EAR A;  3JRP A;  3RMZ D;  5B4W A;  2OIZ A;  1PBY B;  3OKY B;  5AFU 3;  1GOT B;  2PM9 A;  3C5M A;  2H9N A;  3OKY A;  1N6F A;  1B9Y A;  3PXW D;  3ZWL B;  2I3T A;  3NVX A;  5C2W B;  3DXM C;  3CFS B;  2P9U C;  4CC9 A;  4JD2 C;  5H1M A;  4FHL A;  4J8B A;  4PC0 A;  5CYK B;  4ZOZ A;  5FKQ A;  1P22 A;  4G56 B;  4JSP C;  2HYE A;  2YNP A;  3SWS D;  3PXT D;  4CI3 A;  4GM9 A;  3SBR A;  2J55 H;  3I7L A;  4GM3 A;  1U2V C;  3FM0 A;  3SBQ A;  4GMB A;  2YNN A;  2CE9 A;  1N6D A;  2QXV A;  4K3I D;  4FAN D;  2YBA A;  5FXY A;  1Q47 A;  3JZG A;  5AMS A;  4U1E I;  1JMX B;  4FB1 D;  2B5M A;  2XYI A;  2HKR A;  3RLM D;  3IJC A;  4KFM B;  4ZOV A;  2Z2N A;  5C2V B;  4IMM A;  4HDJ A;  5TEE A;  2AGL A;  4E54 B;  4N14 A;  2CO0 A;  1TYQ C;  2H14 A;  4A08 B;  4O9D A;  3I7O A;  3UVO A;  5HYN B;  4A08 A;  4A7J A;  3CFV A;  3AL8 B;  5IJ8 E;  3I8C A;  3AL8 A;  2AGY A;  1NR0 A;  2GC7 A;  4PNK B;  3PSC B;  3SVW D;  1VYH C;  5HE3 B;  5CXC B;  4GGD A;  2W18 A;  5CXC A;  2MTA H;  3UVM A;  3EI2 B;  3EI2 A;  3RSE C;  2P9S C;  3SCY A;  2BCJ B;  3UKR C;  3C9C A;  3JB9 L;  3NVN A;  1MG3 A;  3IIW A;  4J8G A;  2P9I C;  5TDH B;  4QT8 A;  4CY2 A;  2H13 A;  5IGQ A;  4OWR A;  3EI3 B;  4QQE A;  3JPX A;  5EAM A;  2AGW A;  4FA5 D;  2AQ5 A;  2CN2 A;  3EMH A;  5H14 A;  1GP2 B;  1N6E A;  3UVN A;  3V5W B;  3U4Y A;  4ERY A;  2H68 A;  4BH6 A;  4FA4 D;  4A11 A;  3F3G A;  4J73 A;  2IWF A;  3NVQ A;  2AGX A;  3W15 A;  4PSX B;  3F3P A;  2PM9 B;  5AJA A;  3OW8 A;  1NEX B;  3I7H A;  4CZY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...