1XIPA

Crystal structure of the n-terminal domain of nup159
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
381
structure length
367
Chain Sequence
b'ASSLKDEVPTETSEDFGFKFLGQKQILPSFNEKLPFASLQNLDISNSKSLFVAASGSKAVVGELQLLRDHITSDSTPLTFKWEKEIPDVIFVCFHGDQVLVSTRNALYSLDLEELSEFRTVTSFEKPVFQLKNVNNTLVILNSVNDLSALDLRTKSTKQLAQNVTSFDVTNSQLAVLLKDRSFQSFAWRNGEMEKQFEFSLPSELEELPVEEYSPLSVTILSPQDFLAVFGNVISETDDEVSYDQKMYIIKHIDGSASFQETFDITPPFGQIVRFPYMYKVTLSGLIEPDANVNVLASSCSSEVSIWDSKQVIEPSQDSERAVLPISEETDKDTNPIGVAVDVVTSGLPLVYILNNEGSLQIVGLFH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoporin NUP159
publication title The N-Terminal Domain of Nup159 Forms a beta-Propeller that Functions in mRNA Export by Tethering the Helicase Dbp5 to the Nuclear Pore
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transport protein
total genus 79
structure length 367
sequence length 381
ec nomenclature
pdb deposition date 2004-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16755 NUP214 Nucleoporin or Nuclear pore complex subunit NUP214=Nup159
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 1xipA00
3C99A 5A2Qg 1NR0A 4IA9A 2OVPB 2H6QA 2H9PA 4FA4D 3PSLA 4MK0B 4N14A 3UVKA 3DM0A 3I7KA 4U1EI 4J84A 3PXWD 3UVMA 1MDAH 5EM2B 3PXTD 3NVNA 2G99A 3V5WB 3I8EA 4JSNC 5EAMA 3NVQA 3MKSB 3JZGA 1TYQC 1VYHC 4J0WA 2OVQB 4E5ZA 3I7HA 5I5MA 4ERZA 4GQ1A 3PXSD 2H47A 3F3PA 2IURA 4D0KA 5K19A 2OJYA 1MG3A 3JZNA 3DXMC 5CYKB 4JSVC 1L0QA 4U7AA 5EALA 4CZYA 3RN1D 5FA5B 4PBZA 2PM9B 2IWKA 4GZ8A 3J81g 3EI1A 4O9DA 5IJ8E 1TBGA 4QT8A 3A0FA 2AGXA 3RMZD 1A0RB 4K3ID 4X60B 3CFSB 3OL2A 3RFGA 4GM3A 2HYEA 1SQJA 2CE9A 2CN2A 3I7LA 4GMBA 2HESX 2J55H 3ORVD 4GGDA 4A2MA 2AH0A 4J8GA 5HE3B 4A11B 1N6FA 1YFQA 5EMLB 4FWWA 3W15A 5HYNB 5TDHB 4JT6C 5CYKA 2PBIB 3KRWB 4ESGA 4CI8A 3EG6A 4GGAA 2PM9A 4Y7RA 4A09B 4Z8LA 4O1QD 3PE7A 1JJUB 4XEIC 2IUVA 3SWSD 4CZXA 4FA5D 4A08A 4QQEA 1P22A 1N6DA 2I0RA 2QXVA 3JZHA 4FA1D 2I3SA 1K32A 3IIWA 4J0XA 3RRMC 5TEFA 3EU7A 5JWZA 3SXTD 5IT9g 2TRCB 3MXXA 5EMKB 4X3EA 4J81A 4ES0A 4CI1A 3C9CA 3SHFA 3SJLD 2H13A 4LGNA 1QNIA 2YBAA 2H14A 3IJCA 3DXKC 5TF2A 3BWSA 5HQGA 5H14A 3EI2B 2AGWA 2B5LA 4E5ZB 4O3TB 1OMWB 3OKWA 4CC9A 4CY5A 3RSEC 4J8BA 2UZYB 5TEEA 4GQ2P 2CO0C 3AFCA 3V9FA 4J87A 4JSXC 3MZLA 2EBSA 4AOWA 5AMSA 3EI4B 1JOFA 4CY3A 4GM9A 2W18A 2P9SC 5HE1B 5C9ZB 2G9AA 4PC0A 5GXIA 3EI1B 2I3TA 1B9XA 2PM6B 2OK6A 3C5MA 1SQ9A 3EI2A 3MMYA 3NVXA 4A0AA 3IKOA 2O9KA 3OL2B 5FLXg 3JPXA 3GFCA 1OLZA 2CNXA 4J79A 3P4FA 2AGZA 4PSXB 4LG8A 2B5MA 4L9OA 4LG9A 2I0TA 4ZOVA 4BUJC 4H5IA 3KRXB 1GXRA 3EI4A 5K1CC 4FAVD 5GSAA 3AL9A 4ZOZA 3OW8A 1B9YA 2IUPA 3EWEA 3HFQA 3I2NA 3RFHA 3VH0A 2GC7A 1Q47A 4L3GD 4PSWB 2P9LC 1GP2B 2IUQA 4A08B 4AEZA 3VGZA 3AL8A 3F3GA 4E54B 4O3UB 4D6VA 4CZVA 5IGQA 2AQ5A 1SHYB 4XYHA 2OIZA 3CFVA 3ODTA 4ZOXA 3UVLA 1GOTB 4IMMA 2YNPA 4PXWA 4BL0A 4JXMA 4XYIA 5FKSA 2HKRA 3DSMA 3PVUB 3RLMD 3RN0D 3UKUC 4A0BA 2XL3A 5CXBA 5B4WA 4E54A 3I89A 2I0SA 3L4OD 5AJAA 3UR4A 1PGUA 3I7NA 5KDOB 3VA6A 2BBKH 1RI6A 4J78A 4ZOYA 3MZKA 4EWRA 4A2LA 3IIYA 2H9MA 4GM8A 2YNNA 1N6EA 1U4CA 3UVOA 2HKMA 3SFZA 4J73A 4CI2A 4UI9R 5GMKn 1K8KC 5H17A 5THAA 2GC4A 4A0AB 2IWFA 3OKYB 5EARA 4FA9D 1PEVA 2BCJB 2AGLA 2H3XA 5IC7A 3FM0A 2P9KC 2Z2PA 3SLED 2H6KA 5EMMB 4FB1D 2PM7B 3OTTA 4R7AB 4A7JA 4NSXA 1NEXB 3I7PA 1XKSA 2IAAA 4JSPC 3K27A 3OKYA 5CXCB 4X61B 3ZWLB 4I79A 3IJ1A 4Y5RD 3MKQA 3J80g 3JRPA 3AL8B 4ZN4A 4GQBB 4L1QD 2YMUA 2CO0A 4G56B 2HJBA 2Z2OA 2QC5A 5FKQA 5FKRA 2OVRB 4OZUA 3BG0A 4K3JB 2Z2NA 4O45A 1MG2A 2H9NA 2P9UC 2P9PC 4KFMB 3EI3A 2XU7A 2AH1A 3GREA 3DWLC 5CXCA 3I7OA 3AH8B 3JAMg 3OKTA 4A0BB 3F3FA 4J86A 4OWRA 5CXBB 2YNOA 2CE8A 4TZ4A 1XHMA 5EM2A 4X63B 3V7DB 3N0EA 5AFU3 5FKTA 2Q7QA 2H6NA 2P9IC 3JROA 5SXMA 2AGYA 3SBPA 4JD2C 3BG1A 1JMXB 2XYIA 2H68A 2XL2A 2HJ4A 5EAPA 3U4YA 5EMJB 3CIKB 3ULEC 4H5JA 3E0CA 2GNQA 4J77A 5HE2B 2OK4A 4GGCA 4QRJA 1JMZB 1R5MA 2J56H 2CN3A 3L4MD 5H1MA 4BH6A 1GG2B 3SCYA 4CY1A 3SBRA 3SBQA 2B5NA 4FHLA 2B4EA 3N0DA 4JT5C 4FAND 3EMHA 2HXCA 3UVNA 5GXHA 1PBYB 4HDJA 3I8CA 1S4UX 4ERQA 5HE0B 2J57G 4A11A 4J82A 4CI3A 5FQDA 4QL1A 1U2VC 2P9NC 3B7FA 3JB9L 1XIPA 5IGOA 3UKRC 4L3HD 4A09A 5C2WB 1FWXA 2H9LA 3SMRA 5FXYA 1ERJA 3PSCB 2MTAH 5I5IA 4CY2A 4ERYA 5I5JA 3PVWB 4YVDA 2UZXB 3SN6B 3C75H 4PNKB 3FRXA 3EI3B 5IJ7E 3SVWD 3IJ0A 1PI6A 2YB8B 3FGBA 5C2VB 4PBYA 3K26A
chains in the Genus database with same CATH superfamily
3C99A 5A2Qg 5E6SA 1NR0A 4IA9A 2OVPB 2H6QA 2H9PA 4FA4D 3PSLA 4MK0B 4N14A 3IUMA 3UVKA 3DM0A 3I7KA 4U1EI 4J84A 3PXWD 3UVMA 1MDAH 2JKXA 5EM2B 3PXTD 3NVNA 4WJKA 2G99A 5M61A 3V5WB 4WK0A 3I8EA 4JSNC 5EAMA 3NVQA 3MKSB 3JZGA 1TYQC 1UOPA 1VYHC 4J0WA 2OVQB 4E5ZA 3I7HA 5I5MA 4ERZA 4GQ1A 3PXSD 2H47A 3F3PA 2IURA 2XDWA 4D0KA 5K19A 2OJYA 1MG3A 3JZNA 3DXMC 5CYKB 4JSVC 1L0QA 3IULA 4U7AA 5EALA 4CZYA 3RN1D 3EQ7A 5FA5B 4PBZA 2PM9B 2IWKA 4GZ8A 3J81g 3EI1A 4O9DA 5IJ8E 1TBGA 4G55A 4QT8A 3A0FA 2AGXA 3RMZD 1A0RB 2VDPA 4K3ID 4AN1A 4X60B 3CFSB 3OL2A 3RFGA 4GM3A 2HYEA 1SQJA 2EICA 2CE9A 2CN2A 3I7LA 4GMBA 4MMXA 2HESX 2J55H 3ORVD 4GGDA 4A2MA 2AH0A 4J8GA 5FFGA 5HE3B 4A11B 1N6FA 1YFQA 5EMLB 5M5UA 4FWWA 3W15A 4BCBA 5TDHB 4JT6C 5HYNB 5CYKA 2PBIB 3KRWB 4ESGA 4CI8A 3EG6A 4GGAA 2PM9A 4Y7RA 2HU8A 4A09B 4Z8LA 4O1QD 3PE7A 1JJUB 4XEIC 1H2YA 2IUVA 2HU5A 3SWSD 4CZXA 1H2ZA 5C86A 4FA5D 4A08A 3IUQA 4QQEA 3V4VA 1P22A 1N6DA 2I0RA 3ZE2A 2QXVA 3O4IA 3JZHA 4FA1D 2I3SA 1GOHA 1K32A 3IIWA 4J0XA 2VDLA 3RRMC 5TEFA 4BP8A 3EU7A 5JWZA 3SXTD 5IT9g 2TRCB 3MXXA 3QHYB 5EMKB 4X3EA 2VDOA 4J81A 1M1XA 4BCCA 4ES0A 4CI1A 3C9CA 2VDRA 3SHFA 3SJLD 1T2XA 3T3PA 2H13A 4LGNA 1QNIA 2YBAA 2H14A 3IJCA 3DXKC 5TF2A 4RE5A 3BWSA 5HQGA 3MUNA 5H14A 4Z7OA 3EI2B 2AGWA 2B5LA 4UM8A 4E5ZB 1VZ3A 4O3TB 1OMWB 3OKWA 4CC9A 4CY5A 1JTDB 3RSEC 4J8BA 2UZYB 1GOFA 5TEEA 4GQ2P 2CO0C 3AFCA 3V9FA 4J87A 4MMZA 4JSXC 3MZLA 2EBSA 4AOWA 1H2WA 5AMSA 4O2WA 3EI4B 1JOFA 4CY3A 4GM9A 2W18A 2P9SC 3IVMA 5HE1B 5C9ZB 2G9AA 4DNUA 4PC0A 5GXIA 3EI1B 1VE7A 2I3TA 1B9XA 2PM6B 3KCIA 2OK6A 3C5MA 1SQ9A 3EI2A 3MMYA 3NVXA 4A0AA 3IKOA 2O9KA 3OL2B 5FLXg 3JPXA 3GFCA 1OLZA 2VDNA 2CNXA 4J79A 3P4FA 4G1MA 2AGZA 4PSXB 4LG8A 1E5TA 3O4GA 2B5MA 4L9OA 4LG9A 2I0TA 2VDKA 4ZOVA 4BUJC 4H5IA 3KRXB 1GXRA 3EI4A 3ZDXA 3T3MA 5K1CC 4FAVD 5GSAA 3AL9A 4IRZA 4ZOZA 3K6SA 3OW8A 1B9YA 2IUPA 5C92A 3EWEA 3HFQA 3I2NA 3RFHA 3VH0A 2EIBA 2GC7A 1Q47A 4L3GD 4WK4A 4PSWB 2P9LC 3V4PA 1GP2B 2VC2A 1C9LA 2IUQA 4A08B 4AEZA 5FFOA 3VGZA 3AL8A 3F3GA 4E54B 4O3UB 4D6VA 4CZVA 5IGQA 2AQ5A 3FCSA 4AN0A 1SHYB 3NIDA 4XYHA 3EQ8A 2OIZA 3IURA 3CFVA 4D9SA 1C9IA 3ODTA 4ZOXA 3UVLA 1GOTB 4IMMA 2YNPA 3ZDYA 5M5SA 4PXWA 4BL0A 4JXMA 4XYIA 5FKSA 2HKRA 3DSMA 3PVUB 3FCUA 3RLMD 3RN0D 3UKUC 4A0BA 2XL3A 5CXBA 4AX4A 4JHPC 5B4WA 4E54A 3I89A 4Z7QA 1JV2A 3MVDK 2I0SA 3L4OD 5AJAA 3UR4A 1PGUA 3I7NA 5KDOB 5M5VA 4L1MA 3VA6A 1RI6A 2BBKH 4J78A 4ZOYA 3K72A 1BPOA 3MZKA 4EWRA 4A2LA 3IIYA 2H9MA 4GM8A 2YNNA 1N6EA 1U4CA 3UVOA 3IJEA 2HKMA 3SFZA 4AMYA 4J73A 2BKLA 2HU7A 4CI2A 4UI9R 5GMKn 1K8KC 5H17A 5THAA 3OF7A 2GC4A 4A0AB 1O6FA 2IWFA 3OKYB 5E6RA 5EARA 4FA9D 5M5TA 4DNVA 1H2XA 3GD1I 1PEVA 2BCJB 2AGLA 2H3XA 3ZE1A 5IC7A 3FM0A 2P9KC 2Z2PA 4NBMA 3SLED 2H6KA 5EMMB 4FB1D 3DDUA 2PM7B 3OTTA 4R7AB 4A7JA 4NSXA 1O6GA 2EIEA 1NEXB 1A12A 3IUNA 3I7PA 1XKSA 1L5GA 2IAAA 4JSPC 3K27A 3GC3B 4AMZA 3OKYA 5CXCB 4X61B 3ZWLB 4I79A 2VZ3A 1VZ2A 3IJ1A 4Y5RD 3MKQA 3J80g 3JRPA 3AL8B 4ZN4A 4GQBB 4L1QD 2XE4A 2YMUA 2CO0A 4G56B 4NAAA 2HJBA 2Z2OA 2QC5A 5FKQA 5M5RA 2XZGA 5FKRA 2OVRB 4OZUA 4NC4A 3BG0A 4K3JB 5HDBA 2Z2NA 3VI4A 4O45A 1MG2A 2H9NA 5E6UA 1E8MA 3VI3A 2P9UC 2P9PC 1UOQA 3IUJA 2XU7A 3EI3A 4KFMB 2AH1A 1VE6A 3GREA 3DWLC 4DNWA 5CXCA 3I7OA 3AH8B 3JAMg 4O02A 3OKTA 2VDQA 4A0BB 3EQ9A 3QI0A 3F3FA 4J86A 4OWRA 5CXBB 2YNOA 4BCDA 2CE8A 4TZ4A 1UTCA 1XHMA 5EM2A 1E8NA 4X63B 3V7DB 1K3IA 3N0EA 5AFU3 5FKTA 3ZDZA 2Q7QA 2H6NA 2P9IC 3JROA 5SXMA 2AGYA 3SBPA 1QFSA 4JD2C 3O4HA 3BG1A 1JMXB 2XYIA 2H68A 2XL2A 2HJ4A 5EAPA 3U4YA 5EMJB 3CIKB 3ULEC 4WK2A 4H5JA 4NENA 4RE6A 3E0CA 1GOGA 2QZPA 2GNQA 4J77A 4Z7NA 1YR2A 5HE2B 2OK4A 4GGCA 1UOOA 4QRJA 1JMZB 1R5MA 1QFMA 2J56H 2CN3A 3ZE0A 3L4MD 5H1MA 4BH6A 3MUOA 1GG2B 3SCYA 4CY1A 3K71A 2VZ1A 3SBRA 3SBQA 2B5NA 4FHLA 2B4EA 3N0DA 4JT5C 4FAND 3EMHA 2HXCA 3UVNA 4BP9A 5GXHA 1PBYB 4HDJA 2QR5A 2EIDA 4JHNA 3I8CA 1S4UX 4ERQA 5HE0B 1I2MB 2J57G 4MMYA 4J82A 4A11A 4CI3A 3O4JA 5FQDA 1U8CA 4QL1A 1U2VC 2WQ8A 2P9NC 3B7FA 3JB9L 1XIPA 5IGOA 3UKRC 4L3HD 4A09A 5C2WB 1FWXA 2VDMA 2H9LA 3SMRA 4QAMA 5FXYA 3NIFA 1ERJA 3PSCB 4G1EA 3NIGA 2MTAH 5I5IA 4CY2A 4ERYA 5I5JA 3PVWB 4YVDA 2UZXB 3SN6B 3C75H 4PNKB 4UM9A 1TYEA 3FRXA 3EI3B 5IJ7E 3SVWD 3IJ0A 1PI6A 2YB8B 3FGBA 5C2VB 4PBYA 3K26A
chains in the Genus database with same CATH topology
3C99A 5A2Qg 1NR0A 4IA9A 2OVPB 2H6QA 2H9PA 4FA4D 3PSLA 4MK0B 4N14A 3UVKA 3DM0A 3I7KA 4U1EI 4J84A 3PXWD 3UVMA 1MDAH 5EM2B 3PXTD 3NVNA 2G99A 3V5WB 3I8EA 4JSNC 5EAMA 3NVQA 3MKSB 3JZGA 1TYQC 1VYHC 4J0WA 2OVQB 4E5ZA 3I7HA 5I5MA 4ERZA 4GQ1A 3PXSD 2H47A 3F3PA 2IURA 4D0KA 5K19A 2OJYA 1MG3A 3JZNA 3DXMC 5CYKB 4JSVC 1L0QA 4U7AA 5EALA 4CZYA 3RN1D 5FA5B 4PBZA 2PM9B 2IWKA 4GZ8A 3J81g 3EI1A 4O9DA 5IJ8E 1TBGA 4QT8A 3A0FA 2AGXA 3RMZD 1A0RB 4K3ID 4X60B 3CFSB 3OL2A 3RFGA 4GM3A 2HYEA 1SQJA 2CE9A 2CN2A 3I7LA 4GMBA 2HESX 2J55H 3ORVD 4GGDA 4A2MA 2AH0A 4J8GA 5HE3B 4A11B 1N6FA 1YFQA 5EMLB 4FWWA 3W15A 5HYNB 5TDHB 4JT6C 5CYKA 2PBIB 3KRWB 4ESGA 4CI8A 3EG6A 4GGAA 2PM9A 4Y7RA 4A09B 4Z8LA 4O1QD 3PE7A 1JJUB 4XEIC 2IUVA 3SWSD 4CZXA 4FA5D 4A08A 4QQEA 1P22A 1N6DA 2I0RA 2QXVA 3JZHA 4FA1D 2I3SA 1K32A 3IIWA 4J0XA 3RRMC 5TEFA 3EU7A 5JWZA 3SXTD 5IT9g 2TRCB 3MXXA 5EMKB 4X3EA 4J81A 4ES0A 4CI1A 3C9CA 3SHFA 3SJLD 2H13A 4LGNA 1QNIA 2YBAA 2H14A 3IJCA 3DXKC 5TF2A 3BWSA 5HQGA 5H14A 3EI2B 2AGWA 2B5LA 4E5ZB 4O3TB 1OMWB 3OKWA 4CC9A 4CY5A 3RSEC 4J8BA 2UZYB 5TEEA 4GQ2P 2CO0C 3AFCA 3V9FA 4J87A 4JSXC 3MZLA 2EBSA 4AOWA 5AMSA 3EI4B 1JOFA 4CY3A 4GM9A 2W18A 2P9SC 5HE1B 5C9ZB 2G9AA 4PC0A 5GXIA 3EI1B 2I3TA 1B9XA 2PM6B 2OK6A 3C5MA 1SQ9A 3EI2A 3MMYA 3NVXA 4A0AA 3IKOA 2O9KA 3OL2B 5FLXg 3JPXA 3GFCA 1OLZA 2CNXA 4J79A 3P4FA 2AGZA 4PSXB 4LG8A 2B5MA 4L9OA 4LG9A 2I0TA 4ZOVA 4BUJC 4H5IA 3KRXB 1GXRA 3EI4A 5K1CC 4FAVD 5GSAA 3AL9A 4ZOZA 3OW8A 1B9YA 2IUPA 3EWEA 3HFQA 3I2NA 3RFHA 3VH0A 2GC7A 1Q47A 4L3GD 4PSWB 2P9LC 1GP2B 2IUQA 4A08B 4AEZA 3VGZA 3AL8A 3F3GA 4E54B 4O3UB 4D6VA 4CZVA 5IGQA 2AQ5A 1SHYB 4XYHA 2OIZA 3CFVA 3ODTA 4ZOXA 3UVLA 1GOTB 4IMMA 2YNPA 4PXWA 4BL0A 4JXMA 4XYIA 5FKSA 2HKRA 3DSMA 3PVUB 3RLMD 3RN0D 3UKUC 4A0BA 2XL3A 5CXBA 5B4WA 4E54A 3I89A 2I0SA 3L4OD 5AJAA 3UR4A 1PGUA 3I7NA 5KDOB 3VA6A 2BBKH 1RI6A 4J78A 4ZOYA 3MZKA 4EWRA 4A2LA 3IIYA 2H9MA 4GM8A 2YNNA 1N6EA 1U4CA 3UVOA 2HKMA 3SFZA 4J73A 4CI2A 4UI9R 5GMKn 1K8KC 5H17A 5THAA 2GC4A 4A0AB 2IWFA 3OKYB 5EARA 4FA9D 1PEVA 2BCJB 2AGLA 2H3XA 5IC7A 3FM0A 2P9KC 2Z2PA 3SLED 2H6KA 5EMMB 4FB1D 2PM7B 3OTTA 4R7AB 4A7JA 4NSXA 1NEXB 3I7PA 1XKSA 2IAAA 4JSPC 3K27A 3OKYA 5CXCB 4X61B 3ZWLB 4I79A 3IJ1A 4Y5RD 3MKQA 3J80g 3JRPA 3AL8B 4ZN4A 4GQBB 4L1QD 2YMUA 2CO0A 4G56B 2HJBA 2Z2OA 2QC5A 5FKQA 5FKRA 2OVRB 4OZUA 3BG0A 4K3JB 2Z2NA 4O45A 1MG2A 2H9NA 2P9UC 2P9PC 4KFMB 3EI3A 2XU7A 2AH1A 3GREA 3DWLC 5CXCA 3I7OA 3AH8B 3JAMg 3OKTA 4A0BB 3F3FA 4J86A 4OWRA 5CXBB 2YNOA 2CE8A 4TZ4A 1XHMA 5EM2A 4X63B 3V7DB 3N0EA 5AFU3 5FKTA 2Q7QA 2H6NA 2P9IC 3JROA 5SXMA 2AGYA 3SBPA 4JD2C 3BG1A 1JMXB 2XYIA 2H68A 2XL2A 2HJ4A 5EAPA 3U4YA 5EMJB 3CIKB 3ULEC 4H5JA 3E0CA 2GNQA 4J77A 5HE2B 2OK4A 4GGCA 4QRJA 1JMZB 1R5MA 2J56H 2CN3A 3L4MD 5H1MA 4BH6A 1GG2B 3SCYA 4CY1A 3SBRA 3SBQA 2B5NA 4FHLA 2B4EA 3N0DA 4JT5C 4FAND 3EMHA 2HXCA 3UVNA 5GXHA 1PBYB 4HDJA 3I8CA 1S4UX 4ERQA 5HE0B 2J57G 4A11A 4J82A 4CI3A 5FQDA 4QL1A 1U2VC 2P9NC 3B7FA 3JB9L 1XIPA 5IGOA 3UKRC 4L3HD 4A09A 5C2WB 1FWXA 2H9LA 3SMRA 5FXYA 1ERJA 3PSCB 2MTAH 5I5IA 4CY2A 4ERYA 5I5JA 3PVWB 4YVDA 2UZXB 3SN6B 3C75H 4PNKB 3FRXA 3EI3B 5IJ7E 3SVWD 3IJ0A 1PI6A 2YB8B 3FGBA 5C2VB 4PBYA 3K26A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C99 A;  5A2Q g;  1NR0 A;  4IA9 A;  2OVP B;  2H6Q A;  2H9P A;  4FA4 D;  3PSL A;  4MK0 B;  4N14 A;  3UVK A;  3DM0 A;  3I7K A;  4U1E I;  4J84 A;  3PXW D;  3UVM A;  1MDA H;  5EM2 B;  3PXT D;  3NVN A;  2G99 A;  3V5W B;  3I8E A;  4JSN C;  5EAM A;  3NVQ A;  3MKS B;  3JZG A;  1TYQ C;  1VYH C;  4J0W A;  2OVQ B;  4E5Z A;  3I7H A;  5I5M A;  4ERZ A;  4GQ1 A;  3PXS D;  2H47 A;  3F3P A;  2IUR A;  4D0K A;  5K19 A;  2OJY A;  1MG3 A;  3JZN A;  3DXM C;  5CYK B;  4JSV C;  1L0Q A;  4U7A A;  5EAL A;  4CZY A;  3RN1 D;  5FA5 B;  4PBZ A;  2PM9 B;  2IWK A;  4GZ8 A;  3J81 g;  3EI1 A;  4O9D A;  5IJ8 E;  1TBG A;  4QT8 A;  3A0F A;  2AGX A;  3RMZ D;  1A0R B;  4K3I D;  4X60 B;  3CFS B;  3OL2 A;  3RFG A;  4GM3 A;  2HYE A;  1SQJ A;  2CE9 A;  2CN2 A;  3I7L A;  4GMB A;  2HES X;  2J55 H;  3ORV D;  4GGD A;  4A2M A;  2AH0 A;  4J8G A;  5HE3 B;  4A11 B;  1N6F A;  1YFQ A;  5EML B;  4FWW A;  3W15 A;  5HYN B;  5TDH B;  4JT6 C;  5CYK A;  2PBI B;  3KRW B;  4ESG A;  4CI8 A;  3EG6 A;  4GGA A;  2PM9 A;  4Y7R A;  4A09 B;  4Z8L A;  4O1Q D;  3PE7 A;  1JJU B;  4XEI C;  2IUV A;  3SWS D;  4CZX A;  4FA5 D;  4A08 A;  4QQE A;  1P22 A;  1N6D A;  2I0R A;  2QXV A;  3JZH A;  4FA1 D;  2I3S A;  1K32 A;  3IIW A;  4J0X A;  3RRM C;  5TEF A;  3EU7 A;  5JWZ A;  3SXT D;  5IT9 g;  2TRC B;  3MXX A;  5EMK B;  4X3E A;  4J81 A;  4ES0 A;  4CI1 A;  3C9C A;  3SHF A;  3SJL D;  2H13 A;  4LGN A;  1QNI A;  2YBA A;  2H14 A;  3IJC A;  3DXK C;  5TF2 A;  3BWS A;  5HQG A;  5H14 A;  3EI2 B;  2AGW A;  2B5L A;  4E5Z B;  4O3T B;  1OMW B;  3OKW A;  4CC9 A;  4CY5 A;  3RSE C;  4J8B A;  2UZY B;  5TEE A;  4GQ2 P;  2CO0 C;  3AFC A;  3V9F A;  4J87 A;  4JSX C;  3MZL A;  2EBS A;  4AOW A;  5AMS A;  3EI4 B;  1JOF A;  4CY3 A;  4GM9 A;  2W18 A;  2P9S C;  5HE1 B;  5C9Z B;  2G9A A;  4PC0 A;  5GXI A;  3EI1 B;  2I3T A;  1B9X A;  2PM6 B;  2OK6 A;  3C5M A;  1SQ9 A;  3EI2 A;  3MMY A;  3NVX A;  4A0A A;  3IKO A;  2O9K A;  3OL2 B;  5FLX g;  3JPX A;  3GFC A;  1OLZ A;  2CNX A;  4J79 A;  3P4F A;  2AGZ A;  4PSX B;  4LG8 A;  2B5M A;  4L9O A;  4LG9 A;  2I0T A;  4ZOV A;  4BUJ C;  4H5I A;  3KRX B;  1GXR A;  3EI4 A;  5K1C C;  4FAV D;  5GSA A;  3AL9 A;  4ZOZ A;  3OW8 A;  1B9Y A;  2IUP A;  3EWE A;  3HFQ A;  3I2N A;  3RFH A;  3VH0 A;  2GC7 A;  1Q47 A;  4L3G D;  4PSW B;  2P9L C;  1GP2 B;  2IUQ A;  4A08 B;  4AEZ A;  3VGZ A;  3AL8 A;  3F3G A;  4E54 B;  4O3U B;  4D6V A;  4CZV A;  5IGQ A;  2AQ5 A;  1SHY B;  4XYH A;  2OIZ A;  3CFV A;  3ODT A;  4ZOX A;  3UVL A;  1GOT B;  4IMM A;  2YNP A;  4PXW A;  4BL0 A;  4JXM A;  4XYI A;  5FKS A;  2HKR A;  3DSM A;  3PVU B;  3RLM D;  3RN0 D;  3UKU C;  4A0B A;  2XL3 A;  5CXB A;  5B4W A;  4E54 A;  3I89 A;  2I0S A;  3L4O D;  5AJA A;  3UR4 A;  1PGU A;  3I7N A;  5KDO B;  3VA6 A;  2BBK H;  1RI6 A;  4J78 A;  4ZOY A;  3MZK A;  4EWR A;  4A2L A;  3IIY A;  2H9M A;  4GM8 A;  2YNN A;  1N6E A;  1U4C A;  3UVO A;  2HKM A;  3SFZ A;  4J73 A;  4CI2 A;  4UI9 R;  5GMK n;  1K8K C;  5H17 A;  5THA A;  2GC4 A;  4A0A B;  2IWF A;  3OKY B;  5EAR A;  4FA9 D;  1PEV A;  2BCJ B;  2AGL A;  2H3X A;  5IC7 A;  3FM0 A;  2P9K C;  2Z2P A;  3SLE D;  2H6K A;  5EMM B;  4FB1 D;  2PM7 B;  3OTT A;  4R7A B;  4A7J A;  4NSX A;  1NEX B;  3I7P A;  1XKS A;  2IAA A;  4JSP C;  3K27 A;  3OKY A;  5CXC B;  4X61 B;  3ZWL B;  4I79 A;  3IJ1 A;  4Y5R D;  3MKQ A;  3J80 g;  3JRP A;  3AL8 B;  4ZN4 A;  4GQB B;  4L1Q D;  2YMU A;  2CO0 A;  4G56 B;  2HJB A;  2Z2O A;  2QC5 A;  5FKQ A;  5FKR A;  2OVR B;  4OZU A;  3BG0 A;  4K3J B;  2Z2N A;  4O45 A;  1MG2 A;  2H9N A;  2P9U C;  2P9P C;  4KFM B;  3EI3 A;  2XU7 A;  2AH1 A;  3GRE A;  3DWL C;  5CXC A;  3I7O A;  3AH8 B;  3JAM g;  3OKT A;  4A0B B;  3F3F A;  4J86 A;  4OWR A;  5CXB B;  2YNO A;  2CE8 A;  4TZ4 A;  1XHM A;  5EM2 A;  4X63 B;  3V7D B;  3N0E A;  5AFU 3;  5FKT A;  2Q7Q A;  2H6N A;  2P9I C;  3JRO A;  5SXM A;  2AGY A;  3SBP A;  4JD2 C;  3BG1 A;  1JMX B;  2XYI A;  2H68 A;  2XL2 A;  2HJ4 A;  5EAP A;  3U4Y A;  5EMJ B;  3CIK B;  3ULE C;  4H5J A;  3E0C A;  2GNQ A;  4J77 A;  5HE2 B;  2OK4 A;  4GGC A;  4QRJ A;  1JMZ B;  1R5M A;  2J56 H;  2CN3 A;  3L4M D;  5H1M A;  4BH6 A;  1GG2 B;  3SCY A;  4CY1 A;  3SBR A;  3SBQ A;  2B5N A;  4FHL A;  2B4E A;  3N0D A;  4JT5 C;  4FAN D;  3EMH A;  2HXC A;  3UVN A;  5GXH A;  1PBY B;  4HDJ A;  3I8C A;  1S4U X;  4ERQ A;  5HE0 B;  2J57 G;  4A11 A;  4J82 A;  4CI3 A;  5FQD A;  4QL1 A;  1U2V C;  2P9N C;  3B7F A;  3JB9 L;  1XIP A;  5IGO A;  3UKR C;  4L3H D;  4A09 A;  5C2W B;  1FWX A;  2H9L A;  3SMR A;  5FXY A;  1ERJ A;  3PSC B;  2MTA H;  5I5I A;  4CY2 A;  4ERY A;  5I5J A;  3PVW B;  4YVD A;  2UZX B;  3SN6 B;  3C75 H;  4PNK B;  3FRX A;  3EI3 B;  5IJ7 E;  3SVW D;  3IJ0 A;  1PI6 A;  2YB8 B;  3FGB A;  5C2V B;  4PBY A;  3K26 A; 
#chains in the Genus database with same CATH topology
 3C99 A;  5A2Q g;  5E6S A;  1NR0 A;  4IA9 A;  2OVP B;  2H6Q A;  2H9P A;  4FA4 D;  3PSL A;  4MK0 B;  4N14 A;  3IUM A;  3UVK A;  3DM0 A;  3I7K A;  4U1E I;  4J84 A;  3PXW D;  3UVM A;  1MDA H;  2JKX A;  5EM2 B;  3PXT D;  3NVN A;  4WJK A;  2G99 A;  5M61 A;  3V5W B;  4WK0 A;  3I8E A;  4JSN C;  5EAM A;  3NVQ A;  3MKS B;  3JZG A;  1TYQ C;  1UOP A;  1VYH C;  4J0W A;  2OVQ B;  4E5Z A;  3I7H A;  5I5M A;  4ERZ A;  4GQ1 A;  3PXS D;  2H47 A;  3F3P A;  2IUR A;  2XDW A;  4D0K A;  5K19 A;  2OJY A;  1MG3 A;  3JZN A;  3DXM C;  5CYK B;  4JSV C;  1L0Q A;  3IUL A;  4U7A A;  5EAL A;  4CZY A;  3RN1 D;  3EQ7 A;  5FA5 B;  4PBZ A;  2PM9 B;  2IWK A;  4GZ8 A;  3J81 g;  3EI1 A;  4O9D A;  5IJ8 E;  1TBG A;  4G55 A;  4QT8 A;  3A0F A;  2AGX A;  3RMZ D;  1A0R B;  2VDP A;  4K3I D;  4AN1 A;  4X60 B;  3CFS B;  3OL2 A;  3RFG A;  4GM3 A;  2HYE A;  1SQJ A;  2EIC A;  2CE9 A;  2CN2 A;  3I7L A;  4GMB A;  4MMX A;  2HES X;  2J55 H;  3ORV D;  4GGD A;  4A2M A;  2AH0 A;  4J8G A;  5FFG A;  5HE3 B;  4A11 B;  1N6F A;  1YFQ A;  5EML B;  5M5U A;  4FWW A;  3W15 A;  4BCB A;  5TDH B;  4JT6 C;  5HYN B;  5CYK A;  2PBI B;  3KRW B;  4ESG A;  4CI8 A;  3EG6 A;  4GGA A;  2PM9 A;  4Y7R A;  2HU8 A;  4A09 B;  4Z8L A;  4O1Q D;  3PE7 A;  1JJU B;  4XEI C;  1H2Y A;  2IUV A;  2HU5 A;  3SWS D;  4CZX A;  1H2Z A;  5C86 A;  4FA5 D;  4A08 A;  3IUQ A;  4QQE A;  3V4V A;  1P22 A;  1N6D A;  2I0R A;  3ZE2 A;  2QXV A;  3O4I A;  3JZH A;  4FA1 D;  2I3S A;  1GOH A;  1K32 A;  3IIW A;  4J0X A;  2VDL A;  3RRM C;  5TEF A;  4BP8 A;  3EU7 A;  5JWZ A;  3SXT D;  5IT9 g;  2TRC B;  3MXX A;  3QHY B;  5EMK B;  4X3E A;  2VDO A;  4J81 A;  1M1X A;  4BCC A;  4ES0 A;  4CI1 A;  3C9C A;  2VDR A;  3SHF A;  3SJL D;  1T2X A;  3T3P A;  2H13 A;  4LGN A;  1QNI A;  2YBA A;  2H14 A;  3IJC A;  3DXK C;  5TF2 A;  4RE5 A;  3BWS A;  5HQG A;  3MUN A;  5H14 A;  4Z7O A;  3EI2 B;  2AGW A;  2B5L A;  4UM8 A;  4E5Z B;  1VZ3 A;  4O3T B;  1OMW B;  3OKW A;  4CC9 A;  4CY5 A;  1JTD B;  3RSE C;  4J8B A;  2UZY B;  1GOF A;  5TEE A;  4GQ2 P;  2CO0 C;  3AFC A;  3V9F A;  4J87 A;  4MMZ A;  4JSX C;  3MZL A;  2EBS A;  4AOW A;  1H2W A;  5AMS A;  4O2W A;  3EI4 B;  1JOF A;  4CY3 A;  4GM9 A;  2W18 A;  2P9S C;  3IVM A;  5HE1 B;  5C9Z B;  2G9A A;  4DNU A;  4PC0 A;  5GXI A;  3EI1 B;  1VE7 A;  2I3T A;  1B9X A;  2PM6 B;  3KCI A;  2OK6 A;  3C5M A;  1SQ9 A;  3EI2 A;  3MMY A;  3NVX A;  4A0A A;  3IKO A;  2O9K A;  3OL2 B;  5FLX g;  3JPX A;  3GFC A;  1OLZ A;  2VDN A;  2CNX A;  4J79 A;  3P4F A;  4G1M A;  2AGZ A;  4PSX B;  4LG8 A;  1E5T A;  3O4G A;  2B5M A;  4L9O A;  4LG9 A;  2I0T A;  2VDK A;  4ZOV A;  4BUJ C;  4H5I A;  3KRX B;  1GXR A;  3EI4 A;  3ZDX A;  3T3M A;  5K1C C;  4FAV D;  5GSA A;  3AL9 A;  4IRZ A;  4ZOZ A;  3K6S A;  3OW8 A;  1B9Y A;  2IUP A;  5C92 A;  3EWE A;  3HFQ A;  3I2N A;  3RFH A;  3VH0 A;  2EIB A;  2GC7 A;  1Q47 A;  4L3G D;  4WK4 A;  4PSW B;  2P9L C;  3V4P A;  1GP2 B;  2VC2 A;  1C9L A;  2IUQ A;  4A08 B;  4AEZ A;  5FFO A;  3VGZ A;  3AL8 A;  3F3G A;  4E54 B;  4O3U B;  4D6V A;  4CZV A;  5IGQ A;  2AQ5 A;  3FCS A;  4AN0 A;  1SHY B;  3NID A;  4XYH A;  3EQ8 A;  2OIZ A;  3IUR A;  3CFV A;  4D9S A;  1C9I A;  3ODT A;  4ZOX A;  3UVL A;  1GOT B;  4IMM A;  2YNP A;  3ZDY A;  5M5S A;  4PXW A;  4BL0 A;  4JXM A;  4XYI A;  5FKS A;  2HKR A;  3DSM A;  3PVU B;  3FCU A;  3RLM D;  3RN0 D;  3UKU C;  4A0B A;  2XL3 A;  5CXB A;  4AX4 A;  4JHP C;  5B4W A;  4E54 A;  3I89 A;  4Z7Q A;  1JV2 A;  3MVD K;  2I0S A;  3L4O D;  5AJA A;  3UR4 A;  1PGU A;  3I7N A;  5KDO B;  5M5V A;  4L1M A;  3VA6 A;  1RI6 A;  2BBK H;  4J78 A;  4ZOY A;  3K72 A;  1BPO A;  3MZK A;  4EWR A;  4A2L A;  3IIY A;  2H9M A;  4GM8 A;  2YNN A;  1N6E A;  1U4C A;  3UVO A;  3IJE A;  2HKM A;  3SFZ A;  4AMY A;  4J73 A;  2BKL A;  2HU7 A;  4CI2 A;  4UI9 R;  5GMK n;  1K8K C;  5H17 A;  5THA A;  3OF7 A;  2GC4 A;  4A0A B;  1O6F A;  2IWF A;  3OKY B;  5E6R A;  5EAR A;  4FA9 D;  5M5T A;  4DNV A;  1H2X A;  3GD1 I;  1PEV A;  2BCJ B;  2AGL A;  2H3X A;  3ZE1 A;  5IC7 A;  3FM0 A;  2P9K C;  2Z2P A;  4NBM A;  3SLE D;  2H6K A;  5EMM B;  4FB1 D;  3DDU A;  2PM7 B;  3OTT A;  4R7A B;  4A7J A;  4NSX A;  1O6G A;  2EIE A;  1NEX B;  1A12 A;  3IUN A;  3I7P A;  1XKS A;  1L5G A;  2IAA A;  4JSP C;  3K27 A;  3GC3 B;  4AMZ A;  3OKY A;  5CXC B;  4X61 B;  3ZWL B;  4I79 A;  2VZ3 A;  1VZ2 A;  3IJ1 A;  4Y5R D;  3MKQ A;  3J80 g;  3JRP A;  3AL8 B;  4ZN4 A;  4GQB B;  4L1Q D;  2XE4 A;  2YMU A;  2CO0 A;  4G56 B;  4NAA A;  2HJB A;  2Z2O A;  2QC5 A;  5FKQ A;  5M5R A;  2XZG A;  5FKR A;  2OVR B;  4OZU A;  4NC4 A;  3BG0 A;  4K3J B;  5HDB A;  2Z2N A;  3VI4 A;  4O45 A;  1MG2 A;  2H9N A;  5E6U A;  1E8M A;  3VI3 A;  2P9U C;  2P9P C;  1UOQ A;  3IUJ A;  2XU7 A;  3EI3 A;  4KFM B;  2AH1 A;  1VE6 A;  3GRE A;  3DWL C;  4DNW A;  5CXC A;  3I7O A;  3AH8 B;  3JAM g;  4O02 A;  3OKT A;  2VDQ A;  4A0B B;  3EQ9 A;  3QI0 A;  3F3F A;  4J86 A;  4OWR A;  5CXB B;  2YNO A;  4BCD A;  2CE8 A;  4TZ4 A;  1UTC A;  1XHM A;  5EM2 A;  1E8N A;  4X63 B;  3V7D B;  1K3I A;  3N0E A;  5AFU 3;  5FKT A;  3ZDZ A;  2Q7Q A;  2H6N A;  2P9I C;  3JRO A;  5SXM A;  2AGY A;  3SBP A;  1QFS A;  4JD2 C;  3O4H A;  3BG1 A;  1JMX B;  2XYI A;  2H68 A;  2XL2 A;  2HJ4 A;  5EAP A;  3U4Y A;  5EMJ B;  3CIK B;  3ULE C;  4WK2 A;  4H5J A;  4NEN A;  4RE6 A;  3E0C A;  1GOG A;  2QZP A;  2GNQ A;  4J77 A;  4Z7N A;  1YR2 A;  5HE2 B;  2OK4 A;  4GGC A;  1UOO A;  4QRJ A;  1JMZ B;  1R5M A;  1QFM A;  2J56 H;  2CN3 A;  3ZE0 A;  3L4M D;  5H1M A;  4BH6 A;  3MUO A;  1GG2 B;  3SCY A;  4CY1 A;  3K71 A;  2VZ1 A;  3SBR A;  3SBQ A;  2B5N A;  4FHL A;  2B4E A;  3N0D A;  4JT5 C;  4FAN D;  3EMH A;  2HXC A;  3UVN A;  4BP9 A;  5GXH A;  1PBY B;  4HDJ A;  2QR5 A;  2EID A;  4JHN A;  3I8C A;  1S4U X;  4ERQ A;  5HE0 B;  1I2M B;  2J57 G;  4MMY A;  4J82 A;  4A11 A;  4CI3 A;  3O4J A;  5FQD A;  1U8C A;  4QL1 A;  1U2V C;  2WQ8 A;  2P9N C;  3B7F A;  3JB9 L;  1XIP A;  5IGO A;  3UKR C;  4L3H D;  4A09 A;  5C2W B;  1FWX A;  2VDM A;  2H9L A;  3SMR A;  4QAM A;  5FXY A;  3NIF A;  1ERJ A;  3PSC B;  4G1E A;  3NIG A;  2MTA H;  5I5I A;  4CY2 A;  4ERY A;  5I5J A;  3PVW B;  4YVD A;  2UZX B;  3SN6 B;  3C75 H;  4PNK B;  4UM9 A;  1TYE A;  3FRX A;  3EI3 B;  5IJ7 E;  3SVW D;  3IJ0 A;  1PI6 A;  2YB8 B;  3FGB A;  5C2V B;  4PBY A;  3K26 A; 
#chains in the Genus database with same CATH homology
 3C99 A;  5A2Q g;  1NR0 A;  4IA9 A;  2OVP B;  2H6Q A;  2H9P A;  4FA4 D;  3PSL A;  4MK0 B;  4N14 A;  3UVK A;  3DM0 A;  3I7K A;  4U1E I;  4J84 A;  3PXW D;  3UVM A;  1MDA H;  5EM2 B;  3PXT D;  3NVN A;  2G99 A;  3V5W B;  3I8E A;  4JSN C;  5EAM A;  3NVQ A;  3MKS B;  3JZG A;  1TYQ C;  1VYH C;  4J0W A;  2OVQ B;  4E5Z A;  3I7H A;  5I5M A;  4ERZ A;  4GQ1 A;  3PXS D;  2H47 A;  3F3P A;  2IUR A;  4D0K A;  5K19 A;  2OJY A;  1MG3 A;  3JZN A;  3DXM C;  5CYK B;  4JSV C;  1L0Q A;  4U7A A;  5EAL A;  4CZY A;  3RN1 D;  5FA5 B;  4PBZ A;  2PM9 B;  2IWK A;  4GZ8 A;  3J81 g;  3EI1 A;  4O9D A;  5IJ8 E;  1TBG A;  4QT8 A;  3A0F A;  2AGX A;  3RMZ D;  1A0R B;  4K3I D;  4X60 B;  3CFS B;  3OL2 A;  3RFG A;  4GM3 A;  2HYE A;  1SQJ A;  2CE9 A;  2CN2 A;  3I7L A;  4GMB A;  2HES X;  2J55 H;  3ORV D;  4GGD A;  4A2M A;  2AH0 A;  4J8G A;  5HE3 B;  4A11 B;  1N6F A;  1YFQ A;  5EML B;  4FWW A;  3W15 A;  5HYN B;  5TDH B;  4JT6 C;  5CYK A;  2PBI B;  3KRW B;  4ESG A;  4CI8 A;  3EG6 A;  4GGA A;  2PM9 A;  4Y7R A;  4A09 B;  4Z8L A;  4O1Q D;  3PE7 A;  1JJU B;  4XEI C;  2IUV A;  3SWS D;  4CZX A;  4FA5 D;  4A08 A;  4QQE A;  1P22 A;  1N6D A;  2I0R A;  2QXV A;  3JZH A;  4FA1 D;  2I3S A;  1K32 A;  3IIW A;  4J0X A;  3RRM C;  5TEF A;  3EU7 A;  5JWZ A;  3SXT D;  5IT9 g;  2TRC B;  3MXX A;  5EMK B;  4X3E A;  4J81 A;  4ES0 A;  4CI1 A;  3C9C A;  3SHF A;  3SJL D;  2H13 A;  4LGN A;  1QNI A;  2YBA A;  2H14 A;  3IJC A;  3DXK C;  5TF2 A;  3BWS A;  5HQG A;  5H14 A;  3EI2 B;  2AGW A;  2B5L A;  4E5Z B;  4O3T B;  1OMW B;  3OKW A;  4CC9 A;  4CY5 A;  3RSE C;  4J8B A;  2UZY B;  5TEE A;  4GQ2 P;  2CO0 C;  3AFC A;  3V9F A;  4J87 A;  4JSX C;  3MZL A;  2EBS A;  4AOW A;  5AMS A;  3EI4 B;  1JOF A;  4CY3 A;  4GM9 A;  2W18 A;  2P9S C;  5HE1 B;  5C9Z B;  2G9A A;  4PC0 A;  5GXI A;  3EI1 B;  2I3T A;  1B9X A;  2PM6 B;  2OK6 A;  3C5M A;  1SQ9 A;  3EI2 A;  3MMY A;  3NVX A;  4A0A A;  3IKO A;  2O9K A;  3OL2 B;  5FLX g;  3JPX A;  3GFC A;  1OLZ A;  2CNX A;  4J79 A;  3P4F A;  2AGZ A;  4PSX B;  4LG8 A;  2B5M A;  4L9O A;  4LG9 A;  2I0T A;  4ZOV A;  4BUJ C;  4H5I A;  3KRX B;  1GXR A;  3EI4 A;  5K1C C;  4FAV D;  5GSA A;  3AL9 A;  4ZOZ A;  3OW8 A;  1B9Y A;  2IUP A;  3EWE A;  3HFQ A;  3I2N A;  3RFH A;  3VH0 A;  2GC7 A;  1Q47 A;  4L3G D;  4PSW B;  2P9L C;  1GP2 B;  2IUQ A;  4A08 B;  4AEZ A;  3VGZ A;  3AL8 A;  3F3G A;  4E54 B;  4O3U B;  4D6V A;  4CZV A;  5IGQ A;  2AQ5 A;  1SHY B;  4XYH A;  2OIZ A;  3CFV A;  3ODT A;  4ZOX A;  3UVL A;  1GOT B;  4IMM A;  2YNP A;  4PXW A;  4BL0 A;  4JXM A;  4XYI A;  5FKS A;  2HKR A;  3DSM A;  3PVU B;  3RLM D;  3RN0 D;  3UKU C;  4A0B A;  2XL3 A;  5CXB A;  5B4W A;  4E54 A;  3I89 A;  2I0S A;  3L4O D;  5AJA A;  3UR4 A;  1PGU A;  3I7N A;  5KDO B;  3VA6 A;  2BBK H;  1RI6 A;  4J78 A;  4ZOY A;  3MZK A;  4EWR A;  4A2L A;  3IIY A;  2H9M A;  4GM8 A;  2YNN A;  1N6E A;  1U4C A;  3UVO A;  2HKM A;  3SFZ A;  4J73 A;  4CI2 A;  4UI9 R;  5GMK n;  1K8K C;  5H17 A;  5THA A;  2GC4 A;  4A0A B;  2IWF A;  3OKY B;  5EAR A;  4FA9 D;  1PEV A;  2BCJ B;  2AGL A;  2H3X A;  5IC7 A;  3FM0 A;  2P9K C;  2Z2P A;  3SLE D;  2H6K A;  5EMM B;  4FB1 D;  2PM7 B;  3OTT A;  4R7A B;  4A7J A;  4NSX A;  1NEX B;  3I7P A;  1XKS A;  2IAA A;  4JSP C;  3K27 A;  3OKY A;  5CXC B;  4X61 B;  3ZWL B;  4I79 A;  3IJ1 A;  4Y5R D;  3MKQ A;  3J80 g;  3JRP A;  3AL8 B;  4ZN4 A;  4GQB B;  4L1Q D;  2YMU A;  2CO0 A;  4G56 B;  2HJB A;  2Z2O A;  2QC5 A;  5FKQ A;  5FKR A;  2OVR B;  4OZU A;  3BG0 A;  4K3J B;  2Z2N A;  4O45 A;  1MG2 A;  2H9N A;  2P9U C;  2P9P C;  4KFM B;  3EI3 A;  2XU7 A;  2AH1 A;  3GRE A;  3DWL C;  5CXC A;  3I7O A;  3AH8 B;  3JAM g;  3OKT A;  4A0B B;  3F3F A;  4J86 A;  4OWR A;  5CXB B;  2YNO A;  2CE8 A;  4TZ4 A;  1XHM A;  5EM2 A;  4X63 B;  3V7D B;  3N0E A;  5AFU 3;  5FKT A;  2Q7Q A;  2H6N A;  2P9I C;  3JRO A;  5SXM A;  2AGY A;  3SBP A;  4JD2 C;  3BG1 A;  1JMX B;  2XYI A;  2H68 A;  2XL2 A;  2HJ4 A;  5EAP A;  3U4Y A;  5EMJ B;  3CIK B;  3ULE C;  4H5J A;  3E0C A;  2GNQ A;  4J77 A;  5HE2 B;  2OK4 A;  4GGC A;  4QRJ A;  1JMZ B;  1R5M A;  2J56 H;  2CN3 A;  3L4M D;  5H1M A;  4BH6 A;  1GG2 B;  3SCY A;  4CY1 A;  3SBR A;  3SBQ A;  2B5N A;  4FHL A;  2B4E A;  3N0D A;  4JT5 C;  4FAN D;  3EMH A;  2HXC A;  3UVN A;  5GXH A;  1PBY B;  4HDJ A;  3I8C A;  1S4U X;  4ERQ A;  5HE0 B;  2J57 G;  4A11 A;  4J82 A;  4CI3 A;  5FQD A;  4QL1 A;  1U2V C;  2P9N C;  3B7F A;  3JB9 L;  1XIP A;  5IGO A;  3UKR C;  4L3H D;  4A09 A;  5C2W B;  1FWX A;  2H9L A;  3SMR A;  5FXY A;  1ERJ A;  3PSC B;  2MTA H;  5I5I A;  4CY2 A;  4ERY A;  5I5J A;  3PVW B;  4YVD A;  2UZX B;  3SN6 B;  3C75 H;  4PNK B;  3FRX A;  3EI3 B;  5IJ7 E;  3SVW D;  3IJ0 A;  1PI6 A;  2YB8 B;  3FGB A;  5C2V B;  4PBY A;  3K26 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...