1XIPA

Crystal structure of the n-terminal domain of nup159
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
381
structure length
367
Chain Sequence
ASSLKDEVPTETSEDFGFKFLGQKQILPSFNEKLPFASLQNLDISNSKSLFVAASGSKAVVGELQLLRDHITSDSTPLTFKWEKEIPDVIFVCFHGDQVLVSTRNALYSLDLEELSEFRTVTSFEKPVFQLKNVNNTLVILNSVNDLSALDLRTKSTKQLAQNVTSFDVTNSQLAVLLKDRSFQSFAWRNGEMEKQFEFSLPSELEELPVEEYSPLSVTILSPQDFLAVFGNVISETDDEVSYDQKMYIIKHIDGSASFQETFDITPPFGQIVRFPYMYKVTLSGLIEPDANVNVLASSCSSEVSIWDSKQVIEPSQDSERAVLPISEETDKDTNPIGVAVDVVTSGLPLVYILNNEGSLQIVGLFH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleoporin NUP159
publication title The N-Terminal Domain of Nup159 Forms a beta-Propeller that Functions in mRNA Export by Tethering the Helicase Dbp5 to the Nuclear Pore
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transport protein
total genus 79
structure length 367
sequence length 381
ec nomenclature
pdb deposition date 2004-09-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16755 NUP214 Nucleoporin or Nuclear pore complex subunit NUP214=Nup159
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 1xipA00
2XL3A 1TBGA 4HDJA 4GM3A 5C2WB 3NVNA 4J73A 5HQGA 5IT9g 2HESX 3OKYB 1GG2B 3EI1A 4PXWA 4ZOXA 2IUPA 4Z8LA 5EMJB 3EMHA 3SHFA 2P9LC 3BG0A 3IJ1A 5EM2A 3SBQA 4AOWA 3C5MA 3SN6B 4Y5RD 2H6KA 4K3JB 4N14A 3IIYA 5TEFA 3SBRA 3KRXB 4GQ1A 5EALA 3SJLD 4CI3A 2AGZA 2HJ4A 4IMMA 3ODTA 2IWKA 4A0BB 5EARA 3F3PA 2YBAA 4CC9A 4CY5A 4ERZA 2OVPB 4E5ZA 3J80g 4U1EI 4PSWB 2UZYB 3SXTD 4GMBA 3P4FA 2GNQA 3I89A 1A0RB 4PC0A 2XYIA 2AGWA 2IURA 3I7OA 5EAPA 2J56H 3V5WB 4D6VA 2EBSA 4J0WA 4QT8A 5FKTA 2IUQA 3FGBA 3UVMA 3OTTA 4GM9A 2HKMA 4K3ID 1MDAH 5B4WA 2YB8B 2YMUA 3C99A 4CY1A 5HE0B 3EI1B 4G56B 3SBPA 4GGCA 2Z2NA 3UVOA 4D0KA 3FRXA 4GGDA 3OKYA 1PEVA 1RI6A 3PE7A 3I7LA 3RFHA 4CI8A 5AMSA 3SCYA 5FLXg 2Z2OA 3V7DB 3EU7A 4ERYA 4J87A 3UVLA 4XYHA 4L1QD 1JMZB 3VGZA 2IUVA 3PXWD 2CNXA 4IA9A 3MZKA 2P9NC 4LG8A 1VYHC 2MTAH 1JMXB 2YNPA 4A0BA 2BCJB 1S4UX 4MK0B 4X60B 2H6QA 1XKSA 2H68A 2CE8A 2CE9A 4GZ8A 4U7AA 3C75H 4NSXA 5A2Qg 2I3SA 4J8GA 4J84A 4FWWA 1YFQA 2CN3A 3JZGA 3IIWA 4GQBB 5HE1B 3BWSA 1N6FA 1QNIA 4FAND 2HKRA 2P9SC 2PM6B 2AQ5A 3I7KA 5EAMA 3AL9A 4O3UB 5KDOB 5GXIA 2YNNA 4J86A 3J81g 4FA1D 3RLMD 3AH8B 2P9KC 5I5JA 2H9PA 4FAVD 4J81A 3OL2B 2OVQB 3ORVD 3EG6A 4JSPC 2Q7QA 3EI4B 4JXMA 4A0AB 3RSEC 5CXBA 4A09A 5SXMA 1SQ9A 3JPXA 4J82A 4CZVA 2I0SA 1XIPA 1TYQC 3JROA 1Q47A 3JRPA 3E0CA 4R7AB 1SQJA 2QC5A 3DXKC 4ZN4A 5CXCB 5I5MA 3KRWB 3L4OD 5C9ZB 3DSMA 4PBYA 3VH0A 4J0XA 4L9OA 2AH1A 5C2VB 1N6EA 3F3GA 2BBKH 2AGLA 2HYEA 3PVUB 5EMKB 5IJ7E 5GMKn 3SMRA 4A11B 1B9YA 2B5NA 2AGXA 3GREA 1N6DA 4O3TB 4CZYA 3W15A 3L4MD 3MKSB 2IAAA 2UZXB 4ZOYA 3C9CA 4I79A 3IJ0A 4O1QD 1U4CA 1MG2A 4GGAA 4J77A 4O45A 1P22A 4H5JA 5CXBB 4A09B 3GFCA 3A0FA 2G99A 3PVWB 3CFSB 4AEZA 3OKTA 4JD2C 4TZ4A 1NR0A 1R5MA 4OZUA 2I0RA 5H17A 3OL2A 2H9MA 2I0TA 4O9DA 3JAMg 1GP2B 3EI4A 4KFMB 5FXYA 3RFGA 4A0AA 1PGUA 4X63B 3RN1D 1GOTB 2J57G 3RN0D 1K8KC 2TRCB 3DM0A 5TF2A 3I7HA 3OKWA 5HE3B 2H14A 5I5IA 3UKRC 3U4YA 4E54B 5CXCA 3IJCA 3SFZA 3DWLC 3MKQA 3K27A 4L3HD 4OWRA 4CY2A 5AFU3 4JSXC 3SWSD 3JB9L 3ZWLB 3I2NA 3B7FA 3MZLA 4FA5D 4LG9A 4CY3A 3MMYA 4ERQA 4A11A 2PM9A 2J55H 3PSCB 3AL8B 2QXVA 5FA5B 4BUJC 2G9AA 3NVQA 4FHLA 4GM8A 1OLZA 4CI1A 4X61B 1K32A 4QQEA 3JZHA 5K19A 5IC7A 1PBYB 3I8CA 3SVWD 3EI2B 4EWRA 5H1MA 4FB1D 3K26A 3PXSD 3CIKB 2B5LA 2OK6A 3CFVA 4L3GD 4FA4D 3HFQA 4JSVC 2AH0A 5H14A 5IGOA 3NVXA 5HYNB 1XHMA 3I7PA 4J79A 2IWFA 3V9FA 4QRJA 1MG3A 5EMMB 2XU7A 4XEIC 2Z2PA 3JZNA 4CI2A 4YVDA 5CYKB 1ERJA 2P9PC 3BG1A 4BL0A 4JSNC 4ZOVA 1JOFA 3FM0A 4A08A 4JT5C 5THAA 1PI6A 4E54A 2P9UC 5IJ8E 1SHYB 3N0DA 1OMWB 2I3TA 3N0EA 2PM9B 4ZOZA 4A2MA 3I8EA 2H6NA 3RRMC 2PM7B 4FA9D 3EI3B 4A7JA 3OW8A 2OJYA 2H9NA 2OIZA 3AL8A 3UR4A 5FKQA 3PSLA 5FKSA 2H9LA 2B5MA 2B4EA 4PSXB 1U2VC 1GXRA 4J8BA 1NEXB 2OVRB 3ULEC 4BH6A 4Y7RA 3UKUC 2YNOA 1FWXA 5IGQA 3RMZD 3EI2A 5EM2B 5JWZA 4J78A 2HXCA 4QL1A 3UVNA 5GSAA 5TEEA 5TDHB 3DXMC 4A08B 1L0QA 4ES0A 4UI9R 5AJAA 2CO0A 5FKRA 4LGNA 5FQDA 5HE2B 3VA6A 1B9XA 2XL2A 2AGYA 3SLED 2CN2A 5CYKA 3F3FA 3AFCA 3MXXA 2O9KA 4GQ2P 4E5ZB 1JJUB 4XYIA 4ESGA 5GXHA 5K1CC 2OK4A 2GC4A 2GC7A 3UVKA 4A2LA 2CO0C 2W18A 2P9IC 4H5IA 4JT6C 2HJBA 2H3XA 2H13A 2H47A 2PBIB 5EMLB 4PNKB 4CZXA 3EI3A 3PXTD 3I7NA 4X3EA 4PBZA 3EWEA 3IKOA
chains in the Genus database with same CATH superfamily
2XL3A 1TBGA 4HDJA 4GM3A 4D9SA 5C2WB 3VI4A 4NENA 1GOFA 3NVNA 4J73A 5HQGA 2VDNA 5IT9g 2HESX 3OKYB 1GG2B 3EI1A 4PXWA 4ZOXA 3ZE1A 2IUPA 4Z8LA 5EMJB 3EMHA 3SHFA 2P9LC 3BG0A 3IJ1A 5EM2A 3SBQA 5E6SA 4AOWA 3C5MA 3SN6B 4WK0A 4Y5RD 2H6KA 4K3JB 4N14A 3IIYA 5TEFA 3IJEA 1T2XA 3SBRA 3KRXB 4GQ1A 5EALA 3SJLD 4CI3A 2AGZA 2HJ4A 4IMMA 3O4HA 4QAMA 3ODTA 2IWKA 4A0BB 5EARA 3F3PA 2YBAA 4CC9A 4CY5A 4ERZA 4AN1A 2OVPB 3GC3B 4E5ZA 3J80g 4U1EI 4UM9A 4PSWB 2UZYB 3SXTD 3EQ8A 4GMBA 3P4FA 2GNQA 4G1EA 3I89A 1A0RB 4PC0A 2XYIA 2AGWA 2IURA 3I7OA 5EAPA 1JV2A 2J56H 3V5WB 4D6VA 4RE6A 2EBSA 4J0WA 4QT8A 5FKTA 2IUQA 1C9LA 2VZ3A 3FGBA 3UVMA 5M5TA 4AX4A 3OTTA 4GM9A 2HKMA 4K3ID 1MDAH 5B4WA 2YB8B 2YMUA 3C99A 4CY1A 3V4PA 5HE0B 3EI1B 4G56B 3SBPA 4GGCA 2Z2NA 3O4IA 3T3MA 3UVOA 4BCBA 1QFMA 3NIGA 4D0KA 3FRXA 3IURA 4GGDA 3OKYA 5HDBA 4Z7OA 1PEVA 1RI6A 1JTDB 3PE7A 3I7LA 3RFHA 3GD1I 4CI8A 3IUQA 5AMSA 3SCYA 5FLXg 2Z2OA 3V7DB 3EU7A 4ERYA 1A12A 4J87A 3UVLA 4XYHA 4L1QD 1JMZB 3VGZA 2IUVA 3PXWD 5M5VA 2CNXA 4IA9A 3K72A 3MZKA 2P9NC 1H2ZA 4LG8A 1VYHC 2MTAH 3O4JA 1JMXB 2YNPA 4A0BA 3K6SA 3ZDZA 4G1MA 2BCJB 1I2MB 1S4UX 4MK0B 3QI0A 4X60B 2H6QA 4L1MA 2VDMA 1XKSA 2H68A 2CE8A 2CE9A 4GZ8A 4U7AA 3C75H 4NSXA 5A2Qg 2I3SA 4J8GA 4J84A 4FWWA 1H2YA 5C92A 1YFQA 2CN3A 4WJKA 1UOQA 3JZGA 3IIWA 3IULA 4GQBB 3IVMA 5HE1B 3BWSA 1N6FA 1QNIA 4FAND 2HKRA 2P9SC 2PM6B 2AQ5A 3ZE0A 3I7KA 3K71A 5EAMA 3AL9A 1UOOA 4O3UB 5KDOB 5GXIA 2YNNA 4J86A 3J81g 3MUOA 4FA1D 2XZGA 3RLMD 3AH8B 2P9KC 5I5JA 2H9PA 4FAVD 1VE6A 4J81A 3OL2B 2OVQB 3ORVD 3IUMA 3EG6A 4JSPC 2Q7QA 3EI4B 4JXMA 4A0AB 3RSEC 5CXBA 4A09A 5SXMA 3T3PA 3KCIA 1SQ9A 3JPXA 4O2WA 4J82A 4CZVA 2I0SA 1XIPA 1TYQC 3JROA 1Q47A 3JRPA 3E0CA 3IUJA 4R7AB 1SQJA 2QC5A 3DXKC 4ZN4A 5CXCB 5I5MA 3KRWB 2JKXA 3L4OD 5C9ZB 3DSMA 4PBYA 4AMZA 3VH0A 1C9IA 4J0XA 4L9OA 2AH1A 5C2VB 1N6EA 3F3GA 2BBKH 2AGLA 2VDRA 2HYEA 4MMZA 3PVUB 5EMKB 5IJ7E 5GMKn 3SMRA 4A11B 1B9YA 2B5NA 2AGXA 1UOPA 1GOHA 2EIDA 3GREA 1N6DA 3MUNA 4O3TB 4CZYA 3W15A 3L4MD 3MKSB 5M5RA 3EQ9A 2IAAA 2UZXB 4ZOYA 3C9CA 3NIFA 4I79A 3IJ0A 1O6GA 4O1QD 1U4CA 1MG2A 4GGAA 1E5TA 4J77A 4O45A 1P22A 4H5JA 5CXBB 4A09B 3GFCA 3A0FA 2G99A 3PVWB 3CFSB 4AEZA 3OKTA 4JD2C 2VZ1A 4TZ4A 1NR0A 1R5MA 4OZUA 3VI3A 2I0RA 5H17A 3OL2A 2H9MA 2I0TA 4O9DA 3JAMg 1GP2B 3EI4A 3QHYB 4KFMB 5FXYA 3RFGA 4A0AA 1PGUA 4JHNA 3ZE2A 4X63B 4JHPC 3RN1D 1GOTB 2J57G 3RN0D 1K8KC 2TRCB 2BKLA 3DM0A 5TF2A 3I7HA 3OKWA 5HE3B 2EIBA 4Z7NA 2H14A 5I5IA 3UKRC 3U4YA 4E54B 5CXCA 3OF7A 1VZ3A 1K3IA 3IJCA 3SFZA 3DWLC 3MKQA 3K27A 4L3HD 4OWRA 2XE4A 4NAAA 4MMXA 4CY2A 5AFU3 4JSXC 4RE5A 3SWSD 4AMYA 3ZWLB 3JB9L 2EICA 1TYEA 3I2NA 2HU5A 4DNVA 2EIEA 3B7FA 3MZLA 4FA5D 4LG9A 4CY3A 3MMYA 4ERQA 4A11A 1VE7A 2PM9A 2J55H 3PSCB 3AL8B 2QXVA 5FA5B 4BUJC 2G9AA 3NVQA 4FHLA 2VDPA 4GM8A 1OLZA 5M5SA 4CI1A 4X61B 2WQ8A 3EQ7A 1K32A 4QQEA 3JZHA 2VDOA 4AN0A 1QFSA 5K19A 5IC7A 5M5UA 5FFGA 1PBYB 3ZDYA 3I8CA 3SVWD 3EI2B 3ZDXA 4EWRA 1GOGA 5H1MA 4NBMA 4FB1D 1H2XA 3K26A 3PXSD 3CIKB 4IRZA 2B5LA 2OK6A 3CFVA 4L3GD 4FA4D 3HFQA 4JSVC 2AH0A 5H14A 5IGOA 3NVXA 5HYNB 1XHMA 1YR2A 3I7PA 3O4GA 2IWFA 4J79A 3V9FA 4QRJA 1MG3A 5EMMB 2XU7A 2HU8A 2Z2PA 3FCUA 2XDWA 4G55A 4XEIC 5FFOA 2VC2A 3JZNA 4CI2A 1VZ2A 4YVDA 4DNUA 2QR5A 5CYKB 1ERJA 2P9PC 3BG1A 4BL0A 4JSNC 4ZOVA 1JOFA 3FM0A 4A08A 4JT5C 3FCSA 5C86A 2VDQA 5THAA 1PI6A 4E54A 2P9UC 5IJ8E 1SHYB 3N0DA 1OMWB 2I3TA 3N0EA 2PM9B 3V4VA 4O02A 4ZOZA 4A2MA 2HU7A 3I8EA 2H6NA 3RRMC 2PM7B 4WK4A 4NC4A 4FA9D 3EI3B 4A7JA 3OW8A 2OJYA 2H9NA 1O6FA 2OIZA 3AL8A 1E8NA 3UR4A 5FKQA 3PSLA 5FKSA 4BP8A 2H9LA 1U8CA 2B5MA 2B4EA 4PSXB 1U2VC 4BCCA 4Z7QA 1GXRA 4J8BA 1NEXB 1BPOA 2OVRB 3NIDA 3ULEC 3MVDK 4BH6A 4MMYA 4Y7RA 3UKUC 2YNOA 1FWXA 4UM8A 5IGQA 3RMZD 3EI2A 2VDLA 5EM2B 5JWZA 4J78A 2HXCA 4QL1A 1E8MA 3UVNA 5GSAA 5TEEA 5TDHB 3DXMC 4A08B 1L0QA 1M1XA 4ES0A 4UI9R 5AJAA 2CO0A 5FKRA 4LGNA 5FQDA 5HE2B 3VA6A 4WK2A 1B9XA 2XL2A 2AGYA 4DNWA 2QZPA 3SLED 2CN2A 5CYKA 3F3FA 1H2WA 3DDUA 1UTCA 3AFCA 3MXXA 1L5GA 2O9KA 4GQ2P 5M61A 1JJUB 4XYIA 5E6RA 4ESGA 4E5ZB 5GXHA 5K1CC 2VDKA 2OK4A 2GC4A 2GC7A 3UVKA 4A2LA 2CO0C 4BP9A 2W18A 2P9IC 3IUNA 4H5IA 4JT6C 2HJBA 2H3XA 2H13A 2H47A 2PBIB 5EMLB 4PNKB 4CZXA 5E6UA 3EI3A 3PXTD 3I7NA 4BCDA 4X3EA 4PBZA 3EWEA 3IKOA
chains in the Genus database with same CATH topology
2XL3A 1TBGA 4HDJA 4GM3A 5C2WB 3NVNA 4J73A 5HQGA 5IT9g 2HESX 3OKYB 1GG2B 3EI1A 4PXWA 4ZOXA 2IUPA 4Z8LA 5EMJB 3EMHA 3SHFA 2P9LC 3BG0A 3IJ1A 5EM2A 3SBQA 4AOWA 3C5MA 3SN6B 4Y5RD 2H6KA 4K3JB 4N14A 3IIYA 5TEFA 3SBRA 3KRXB 4GQ1A 5EALA 3SJLD 4CI3A 2AGZA 2HJ4A 4IMMA 3ODTA 2IWKA 4A0BB 5EARA 3F3PA 2YBAA 4CC9A 4CY5A 4ERZA 2OVPB 4E5ZA 3J80g 4U1EI 4PSWB 2UZYB 3SXTD 4GMBA 3P4FA 2GNQA 3I89A 1A0RB 4PC0A 2XYIA 2AGWA 2IURA 3I7OA 5EAPA 2J56H 3V5WB 4D6VA 2EBSA 4J0WA 4QT8A 5FKTA 2IUQA 3FGBA 3UVMA 3OTTA 4GM9A 2HKMA 4K3ID 1MDAH 5B4WA 2YB8B 2YMUA 3C99A 4CY1A 5HE0B 3EI1B 4G56B 3SBPA 4GGCA 2Z2NA 3UVOA 4D0KA 3FRXA 4GGDA 3OKYA 1PEVA 1RI6A 3PE7A 3I7LA 3RFHA 4CI8A 5AMSA 3SCYA 5FLXg 2Z2OA 3V7DB 3EU7A 4ERYA 4J87A 3UVLA 4XYHA 4L1QD 1JMZB 3VGZA 2IUVA 3PXWD 2CNXA 4IA9A 3MZKA 2P9NC 4LG8A 1VYHC 2MTAH 1JMXB 2YNPA 4A0BA 2BCJB 1S4UX 4MK0B 4X60B 2H6QA 1XKSA 2H68A 2CE8A 2CE9A 4GZ8A 4U7AA 3C75H 4NSXA 5A2Qg 2I3SA 4J8GA 4J84A 4FWWA 1YFQA 2CN3A 3JZGA 3IIWA 4GQBB 5HE1B 3BWSA 1N6FA 1QNIA 4FAND 2HKRA 2P9SC 2PM6B 2AQ5A 3I7KA 5EAMA 3AL9A 4O3UB 5KDOB 5GXIA 2YNNA 4J86A 3J81g 4FA1D 3RLMD 3AH8B 2P9KC 5I5JA 2H9PA 4FAVD 4J81A 3OL2B 2OVQB 3ORVD 3EG6A 4JSPC 2Q7QA 3EI4B 4JXMA 4A0AB 3RSEC 5CXBA 4A09A 5SXMA 1SQ9A 3JPXA 4J82A 4CZVA 2I0SA 1XIPA 1TYQC 3JROA 1Q47A 3JRPA 3E0CA 4R7AB 1SQJA 2QC5A 3DXKC 4ZN4A 5CXCB 5I5MA 3KRWB 3L4OD 5C9ZB 3DSMA 4PBYA 3VH0A 4J0XA 4L9OA 2AH1A 5C2VB 1N6EA 3F3GA 2BBKH 2AGLA 2HYEA 3PVUB 5EMKB 5IJ7E 5GMKn 3SMRA 4A11B 1B9YA 2B5NA 2AGXA 3GREA 1N6DA 4O3TB 4CZYA 3W15A 3L4MD 3MKSB 2IAAA 2UZXB 4ZOYA 3C9CA 4I79A 3IJ0A 4O1QD 1U4CA 1MG2A 4GGAA 4J77A 4O45A 1P22A 4H5JA 5CXBB 4A09B 3GFCA 3A0FA 2G99A 3PVWB 3CFSB 4AEZA 3OKTA 4JD2C 4TZ4A 1NR0A 1R5MA 4OZUA 2I0RA 5H17A 3OL2A 2H9MA 2I0TA 4O9DA 3JAMg 1GP2B 3EI4A 4KFMB 5FXYA 3RFGA 4A0AA 1PGUA 4X63B 3RN1D 1GOTB 2J57G 3RN0D 1K8KC 2TRCB 3DM0A 5TF2A 3I7HA 3OKWA 5HE3B 2H14A 5I5IA 3UKRC 3U4YA 4E54B 5CXCA 3IJCA 3SFZA 3DWLC 3MKQA 3K27A 4L3HD 4OWRA 4CY2A 5AFU3 4JSXC 3SWSD 3JB9L 3ZWLB 3I2NA 3B7FA 3MZLA 4FA5D 4LG9A 4CY3A 3MMYA 4ERQA 4A11A 2PM9A 2J55H 3PSCB 3AL8B 2QXVA 5FA5B 4BUJC 2G9AA 3NVQA 4FHLA 4GM8A 1OLZA 4CI1A 4X61B 1K32A 4QQEA 3JZHA 5K19A 5IC7A 1PBYB 3I8CA 3SVWD 3EI2B 4EWRA 5H1MA 4FB1D 3K26A 3PXSD 3CIKB 2B5LA 2OK6A 3CFVA 4L3GD 4FA4D 3HFQA 4JSVC 2AH0A 5H14A 5IGOA 3NVXA 5HYNB 1XHMA 3I7PA 4J79A 2IWFA 3V9FA 4QRJA 1MG3A 5EMMB 2XU7A 4XEIC 2Z2PA 3JZNA 4CI2A 4YVDA 5CYKB 1ERJA 2P9PC 3BG1A 4BL0A 4JSNC 4ZOVA 1JOFA 3FM0A 4A08A 4JT5C 5THAA 1PI6A 4E54A 2P9UC 5IJ8E 1SHYB 3N0DA 1OMWB 2I3TA 3N0EA 2PM9B 4ZOZA 4A2MA 3I8EA 2H6NA 3RRMC 2PM7B 4FA9D 3EI3B 4A7JA 3OW8A 2OJYA 2H9NA 2OIZA 3AL8A 3UR4A 5FKQA 3PSLA 5FKSA 2H9LA 2B5MA 2B4EA 4PSXB 1U2VC 1GXRA 4J8BA 1NEXB 2OVRB 3ULEC 4BH6A 4Y7RA 3UKUC 2YNOA 1FWXA 5IGQA 3RMZD 3EI2A 5EM2B 5JWZA 4J78A 2HXCA 4QL1A 3UVNA 5GSAA 5TEEA 5TDHB 3DXMC 4A08B 1L0QA 4ES0A 4UI9R 5AJAA 2CO0A 5FKRA 4LGNA 5FQDA 5HE2B 3VA6A 1B9XA 2XL2A 2AGYA 3SLED 2CN2A 5CYKA 3F3FA 3AFCA 3MXXA 2O9KA 4GQ2P 4E5ZB 1JJUB 4XYIA 4ESGA 5GXHA 5K1CC 2OK4A 2GC4A 2GC7A 3UVKA 4A2LA 2CO0C 2W18A 2P9IC 4H5IA 4JT6C 2HJBA 2H3XA 2H13A 2H47A 2PBIB 5EMLB 4PNKB 4CZXA 3EI3A 3PXTD 3I7NA 4X3EA 4PBZA 3EWEA 3IKOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XL3 A;  1TBG A;  4HDJ A;  4GM3 A;  5C2W B;  3NVN A;  4J73 A;  5HQG A;  5IT9 g;  2HES X;  3OKY B;  1GG2 B;  3EI1 A;  4PXW A;  4ZOX A;  2IUP A;  4Z8L A;  5EMJ B;  3EMH A;  3SHF A;  2P9L C;  3BG0 A;  3IJ1 A;  5EM2 A;  3SBQ A;  4AOW A;  3C5M A;  3SN6 B;  4Y5R D;  2H6K A;  4K3J B;  4N14 A;  3IIY A;  5TEF A;  3SBR A;  3KRX B;  4GQ1 A;  5EAL A;  3SJL D;  4CI3 A;  2AGZ A;  2HJ4 A;  4IMM A;  3ODT A;  2IWK A;  4A0B B;  5EAR A;  3F3P A;  2YBA A;  4CC9 A;  4CY5 A;  4ERZ A;  2OVP B;  4E5Z A;  3J80 g;  4U1E I;  4PSW B;  2UZY B;  3SXT D;  4GMB A;  3P4F A;  2GNQ A;  3I89 A;  1A0R B;  4PC0 A;  2XYI A;  2AGW A;  2IUR A;  3I7O A;  5EAP A;  2J56 H;  3V5W B;  4D6V A;  2EBS A;  4J0W A;  4QT8 A;  5FKT A;  2IUQ A;  3FGB A;  3UVM A;  3OTT A;  4GM9 A;  2HKM A;  4K3I D;  1MDA H;  5B4W A;  2YB8 B;  2YMU A;  3C99 A;  4CY1 A;  5HE0 B;  3EI1 B;  4G56 B;  3SBP A;  4GGC A;  2Z2N A;  3UVO A;  4D0K A;  3FRX A;  4GGD A;  3OKY A;  1PEV A;  1RI6 A;  3PE7 A;  3I7L A;  3RFH A;  4CI8 A;  5AMS A;  3SCY A;  5FLX g;  2Z2O A;  3V7D B;  3EU7 A;  4ERY A;  4J87 A;  3UVL A;  4XYH A;  4L1Q D;  1JMZ B;  3VGZ A;  2IUV A;  3PXW D;  2CNX A;  4IA9 A;  3MZK A;  2P9N C;  4LG8 A;  1VYH C;  2MTA H;  1JMX B;  2YNP A;  4A0B A;  2BCJ B;  1S4U X;  4MK0 B;  4X60 B;  2H6Q A;  1XKS A;  2H68 A;  2CE8 A;  2CE9 A;  4GZ8 A;  4U7A A;  3C75 H;  4NSX A;  5A2Q g;  2I3S A;  4J8G A;  4J84 A;  4FWW A;  1YFQ A;  2CN3 A;  3JZG A;  3IIW A;  4GQB B;  5HE1 B;  3BWS A;  1N6F A;  1QNI A;  4FAN D;  2HKR A;  2P9S C;  2PM6 B;  2AQ5 A;  3I7K A;  5EAM A;  3AL9 A;  4O3U B;  5KDO B;  5GXI A;  2YNN A;  4J86 A;  3J81 g;  4FA1 D;  3RLM D;  3AH8 B;  2P9K C;  5I5J A;  2H9P A;  4FAV D;  4J81 A;  3OL2 B;  2OVQ B;  3ORV D;  3EG6 A;  4JSP C;  2Q7Q A;  3EI4 B;  4JXM A;  4A0A B;  3RSE C;  5CXB A;  4A09 A;  5SXM A;  1SQ9 A;  3JPX A;  4J82 A;  4CZV A;  2I0S A;  1XIP A;  1TYQ C;  3JRO A;  1Q47 A;  3JRP A;  3E0C A;  4R7A B;  1SQJ A;  2QC5 A;  3DXK C;  4ZN4 A;  5CXC B;  5I5M A;  3KRW B;  3L4O D;  5C9Z B;  3DSM A;  4PBY A;  3VH0 A;  4J0X A;  4L9O A;  2AH1 A;  5C2V B;  1N6E A;  3F3G A;  2BBK H;  2AGL A;  2HYE A;  3PVU B;  5EMK B;  5IJ7 E;  5GMK n;  3SMR A;  4A11 B;  1B9Y A;  2B5N A;  2AGX A;  3GRE A;  1N6D A;  4O3T B;  4CZY A;  3W15 A;  3L4M D;  3MKS B;  2IAA A;  2UZX B;  4ZOY A;  3C9C A;  4I79 A;  3IJ0 A;  4O1Q D;  1U4C A;  1MG2 A;  4GGA A;  4J77 A;  4O45 A;  1P22 A;  4H5J A;  5CXB B;  4A09 B;  3GFC A;  3A0F A;  2G99 A;  3PVW B;  3CFS B;  4AEZ A;  3OKT A;  4JD2 C;  4TZ4 A;  1NR0 A;  1R5M A;  4OZU A;  2I0R A;  5H17 A;  3OL2 A;  2H9M A;  2I0T A;  4O9D A;  3JAM g;  1GP2 B;  3EI4 A;  4KFM B;  5FXY A;  3RFG A;  4A0A A;  1PGU A;  4X63 B;  3RN1 D;  1GOT B;  2J57 G;  3RN0 D;  1K8K C;  2TRC B;  3DM0 A;  5TF2 A;  3I7H A;  3OKW A;  5HE3 B;  2H14 A;  5I5I A;  3UKR C;  3U4Y A;  4E54 B;  5CXC A;  3IJC A;  3SFZ A;  3DWL C;  3MKQ A;  3K27 A;  4L3H D;  4OWR A;  4CY2 A;  5AFU 3;  4JSX C;  3SWS D;  3JB9 L;  3ZWL B;  3I2N A;  3B7F A;  3MZL A;  4FA5 D;  4LG9 A;  4CY3 A;  3MMY A;  4ERQ A;  4A11 A;  2PM9 A;  2J55 H;  3PSC B;  3AL8 B;  2QXV A;  5FA5 B;  4BUJ C;  2G9A A;  3NVQ A;  4FHL A;  4GM8 A;  1OLZ A;  4CI1 A;  4X61 B;  1K32 A;  4QQE A;  3JZH A;  5K19 A;  5IC7 A;  1PBY B;  3I8C A;  3SVW D;  3EI2 B;  4EWR A;  5H1M A;  4FB1 D;  3K26 A;  3PXS D;  3CIK B;  2B5L A;  2OK6 A;  3CFV A;  4L3G D;  4FA4 D;  3HFQ A;  4JSV C;  2AH0 A;  5H14 A;  5IGO A;  3NVX A;  5HYN B;  1XHM A;  3I7P A;  4J79 A;  2IWF A;  3V9F A;  4QRJ A;  1MG3 A;  5EMM B;  2XU7 A;  4XEI C;  2Z2P A;  3JZN A;  4CI2 A;  4YVD A;  5CYK B;  1ERJ A;  2P9P C;  3BG1 A;  4BL0 A;  4JSN C;  4ZOV A;  1JOF A;  3FM0 A;  4A08 A;  4JT5 C;  5THA A;  1PI6 A;  4E54 A;  2P9U C;  5IJ8 E;  1SHY B;  3N0D A;  1OMW B;  2I3T A;  3N0E A;  2PM9 B;  4ZOZ A;  4A2M A;  3I8E A;  2H6N A;  3RRM C;  2PM7 B;  4FA9 D;  3EI3 B;  4A7J A;  3OW8 A;  2OJY A;  2H9N A;  2OIZ A;  3AL8 A;  3UR4 A;  5FKQ A;  3PSL A;  5FKS A;  2H9L A;  2B5M A;  2B4E A;  4PSX B;  1U2V C;  1GXR A;  4J8B A;  1NEX B;  2OVR B;  3ULE C;  4BH6 A;  4Y7R A;  3UKU C;  2YNO A;  1FWX A;  5IGQ A;  3RMZ D;  3EI2 A;  5EM2 B;  5JWZ A;  4J78 A;  2HXC A;  4QL1 A;  3UVN A;  5GSA A;  5TEE A;  5TDH B;  3DXM C;  4A08 B;  1L0Q A;  4ES0 A;  4UI9 R;  5AJA A;  2CO0 A;  5FKR A;  4LGN A;  5FQD A;  5HE2 B;  3VA6 A;  1B9X A;  2XL2 A;  2AGY A;  3SLE D;  2CN2 A;  5CYK A;  3F3F A;  3AFC A;  3MXX A;  2O9K A;  4GQ2 P;  4E5Z B;  1JJU B;  4XYI A;  4ESG A;  5GXH A;  5K1C C;  2OK4 A;  2GC4 A;  2GC7 A;  3UVK A;  4A2L A;  2CO0 C;  2W18 A;  2P9I C;  4H5I A;  4JT6 C;  2HJB A;  2H3X A;  2H13 A;  2H47 A;  2PBI B;  5EML B;  4PNK B;  4CZX A;  3EI3 A;  3PXT D;  3I7N A;  4X3E A;  4PBZ A;  3EWE A;  3IKO A; 
#chains in the Genus database with same CATH topology
 2XL3 A;  1TBG A;  4HDJ A;  4GM3 A;  4D9S A;  5C2W B;  3VI4 A;  4NEN A;  1GOF A;  3NVN A;  4J73 A;  5HQG A;  2VDN A;  5IT9 g;  2HES X;  3OKY B;  1GG2 B;  3EI1 A;  4PXW A;  4ZOX A;  3ZE1 A;  2IUP A;  4Z8L A;  5EMJ B;  3EMH A;  3SHF A;  2P9L C;  3BG0 A;  3IJ1 A;  5EM2 A;  3SBQ A;  5E6S A;  4AOW A;  3C5M A;  3SN6 B;  4WK0 A;  4Y5R D;  2H6K A;  4K3J B;  4N14 A;  3IIY A;  5TEF A;  3IJE A;  1T2X A;  3SBR A;  3KRX B;  4GQ1 A;  5EAL A;  3SJL D;  4CI3 A;  2AGZ A;  2HJ4 A;  4IMM A;  3O4H A;  4QAM A;  3ODT A;  2IWK A;  4A0B B;  5EAR A;  3F3P A;  2YBA A;  4CC9 A;  4CY5 A;  4ERZ A;  4AN1 A;  2OVP B;  3GC3 B;  4E5Z A;  3J80 g;  4U1E I;  4UM9 A;  4PSW B;  2UZY B;  3SXT D;  3EQ8 A;  4GMB A;  3P4F A;  2GNQ A;  4G1E A;  3I89 A;  1A0R B;  4PC0 A;  2XYI A;  2AGW A;  2IUR A;  3I7O A;  5EAP A;  1JV2 A;  2J56 H;  3V5W B;  4D6V A;  4RE6 A;  2EBS A;  4J0W A;  4QT8 A;  5FKT A;  2IUQ A;  1C9L A;  2VZ3 A;  3FGB A;  3UVM A;  5M5T A;  4AX4 A;  3OTT A;  4GM9 A;  2HKM A;  4K3I D;  1MDA H;  5B4W A;  2YB8 B;  2YMU A;  3C99 A;  4CY1 A;  3V4P A;  5HE0 B;  3EI1 B;  4G56 B;  3SBP A;  4GGC A;  2Z2N A;  3O4I A;  3T3M A;  3UVO A;  4BCB A;  1QFM A;  3NIG A;  4D0K A;  3FRX A;  3IUR A;  4GGD A;  3OKY A;  5HDB A;  4Z7O A;  1PEV A;  1RI6 A;  1JTD B;  3PE7 A;  3I7L A;  3RFH A;  3GD1 I;  4CI8 A;  3IUQ A;  5AMS A;  3SCY A;  5FLX g;  2Z2O A;  3V7D B;  3EU7 A;  4ERY A;  1A12 A;  4J87 A;  3UVL A;  4XYH A;  4L1Q D;  1JMZ B;  3VGZ A;  2IUV A;  3PXW D;  5M5V A;  2CNX A;  4IA9 A;  3K72 A;  3MZK A;  2P9N C;  1H2Z A;  4LG8 A;  1VYH C;  2MTA H;  3O4J A;  1JMX B;  2YNP A;  4A0B A;  3K6S A;  3ZDZ A;  4G1M A;  2BCJ B;  1I2M B;  1S4U X;  4MK0 B;  3QI0 A;  4X60 B;  2H6Q A;  4L1M A;  2VDM A;  1XKS A;  2H68 A;  2CE8 A;  2CE9 A;  4GZ8 A;  4U7A A;  3C75 H;  4NSX A;  5A2Q g;  2I3S A;  4J8G A;  4J84 A;  4FWW A;  1H2Y A;  5C92 A;  1YFQ A;  2CN3 A;  4WJK A;  1UOQ A;  3JZG A;  3IIW A;  3IUL A;  4GQB B;  3IVM A;  5HE1 B;  3BWS A;  1N6F A;  1QNI A;  4FAN D;  2HKR A;  2P9S C;  2PM6 B;  2AQ5 A;  3ZE0 A;  3I7K A;  3K71 A;  5EAM A;  3AL9 A;  1UOO A;  4O3U B;  5KDO B;  5GXI A;  2YNN A;  4J86 A;  3J81 g;  3MUO A;  4FA1 D;  2XZG A;  3RLM D;  3AH8 B;  2P9K C;  5I5J A;  2H9P A;  4FAV D;  1VE6 A;  4J81 A;  3OL2 B;  2OVQ B;  3ORV D;  3IUM A;  3EG6 A;  4JSP C;  2Q7Q A;  3EI4 B;  4JXM A;  4A0A B;  3RSE C;  5CXB A;  4A09 A;  5SXM A;  3T3P A;  3KCI A;  1SQ9 A;  3JPX A;  4O2W A;  4J82 A;  4CZV A;  2I0S A;  1XIP A;  1TYQ C;  3JRO A;  1Q47 A;  3JRP A;  3E0C A;  3IUJ A;  4R7A B;  1SQJ A;  2QC5 A;  3DXK C;  4ZN4 A;  5CXC B;  5I5M A;  3KRW B;  2JKX A;  3L4O D;  5C9Z B;  3DSM A;  4PBY A;  4AMZ A;  3VH0 A;  1C9I A;  4J0X A;  4L9O A;  2AH1 A;  5C2V B;  1N6E A;  3F3G A;  2BBK H;  2AGL A;  2VDR A;  2HYE A;  4MMZ A;  3PVU B;  5EMK B;  5IJ7 E;  5GMK n;  3SMR A;  4A11 B;  1B9Y A;  2B5N A;  2AGX A;  1UOP A;  1GOH A;  2EID A;  3GRE A;  1N6D A;  3MUN A;  4O3T B;  4CZY A;  3W15 A;  3L4M D;  3MKS B;  5M5R A;  3EQ9 A;  2IAA A;  2UZX B;  4ZOY A;  3C9C A;  3NIF A;  4I79 A;  3IJ0 A;  1O6G A;  4O1Q D;  1U4C A;  1MG2 A;  4GGA A;  1E5T A;  4J77 A;  4O45 A;  1P22 A;  4H5J A;  5CXB B;  4A09 B;  3GFC A;  3A0F A;  2G99 A;  3PVW B;  3CFS B;  4AEZ A;  3OKT A;  4JD2 C;  2VZ1 A;  4TZ4 A;  1NR0 A;  1R5M A;  4OZU A;  3VI3 A;  2I0R A;  5H17 A;  3OL2 A;  2H9M A;  2I0T A;  4O9D A;  3JAM g;  1GP2 B;  3EI4 A;  3QHY B;  4KFM B;  5FXY A;  3RFG A;  4A0A A;  1PGU A;  4JHN A;  3ZE2 A;  4X63 B;  4JHP C;  3RN1 D;  1GOT B;  2J57 G;  3RN0 D;  1K8K C;  2TRC B;  2BKL A;  3DM0 A;  5TF2 A;  3I7H A;  3OKW A;  5HE3 B;  2EIB A;  4Z7N A;  2H14 A;  5I5I A;  3UKR C;  3U4Y A;  4E54 B;  5CXC A;  3OF7 A;  1VZ3 A;  1K3I A;  3IJC A;  3SFZ A;  3DWL C;  3MKQ A;  3K27 A;  4L3H D;  4OWR A;  2XE4 A;  4NAA A;  4MMX A;  4CY2 A;  5AFU 3;  4JSX C;  4RE5 A;  3SWS D;  4AMY A;  3ZWL B;  3JB9 L;  2EIC A;  1TYE A;  3I2N A;  2HU5 A;  4DNV A;  2EIE A;  3B7F A;  3MZL A;  4FA5 D;  4LG9 A;  4CY3 A;  3MMY A;  4ERQ A;  4A11 A;  1VE7 A;  2PM9 A;  2J55 H;  3PSC B;  3AL8 B;  2QXV A;  5FA5 B;  4BUJ C;  2G9A A;  3NVQ A;  4FHL A;  2VDP A;  4GM8 A;  1OLZ A;  5M5S A;  4CI1 A;  4X61 B;  2WQ8 A;  3EQ7 A;  1K32 A;  4QQE A;  3JZH A;  2VDO A;  4AN0 A;  1QFS A;  5K19 A;  5IC7 A;  5M5U A;  5FFG A;  1PBY B;  3ZDY A;  3I8C A;  3SVW D;  3EI2 B;  3ZDX A;  4EWR A;  1GOG A;  5H1M A;  4NBM A;  4FB1 D;  1H2X A;  3K26 A;  3PXS D;  3CIK B;  4IRZ A;  2B5L A;  2OK6 A;  3CFV A;  4L3G D;  4FA4 D;  3HFQ A;  4JSV C;  2AH0 A;  5H14 A;  5IGO A;  3NVX A;  5HYN B;  1XHM A;  1YR2 A;  3I7P A;  3O4G A;  2IWF A;  4J79 A;  3V9F A;  4QRJ A;  1MG3 A;  5EMM B;  2XU7 A;  2HU8 A;  2Z2P A;  3FCU A;  2XDW A;  4G55 A;  4XEI C;  5FFO A;  2VC2 A;  3JZN A;  4CI2 A;  1VZ2 A;  4YVD A;  4DNU A;  2QR5 A;  5CYK B;  1ERJ A;  2P9P C;  3BG1 A;  4BL0 A;  4JSN C;  4ZOV A;  1JOF A;  3FM0 A;  4A08 A;  4JT5 C;  3FCS A;  5C86 A;  2VDQ A;  5THA A;  1PI6 A;  4E54 A;  2P9U C;  5IJ8 E;  1SHY B;  3N0D A;  1OMW B;  2I3T A;  3N0E A;  2PM9 B;  3V4V A;  4O02 A;  4ZOZ A;  4A2M A;  2HU7 A;  3I8E A;  2H6N A;  3RRM C;  2PM7 B;  4WK4 A;  4NC4 A;  4FA9 D;  3EI3 B;  4A7J A;  3OW8 A;  2OJY A;  2H9N A;  1O6F A;  2OIZ A;  3AL8 A;  1E8N A;  3UR4 A;  5FKQ A;  3PSL A;  5FKS A;  4BP8 A;  2H9L A;  1U8C A;  2B5M A;  2B4E A;  4PSX B;  1U2V C;  4BCC A;  4Z7Q A;  1GXR A;  4J8B A;  1NEX B;  1BPO A;  2OVR B;  3NID A;  3ULE C;  3MVD K;  4BH6 A;  4MMY A;  4Y7R A;  3UKU C;  2YNO A;  1FWX A;  4UM8 A;  5IGQ A;  3RMZ D;  3EI2 A;  2VDL A;  5EM2 B;  5JWZ A;  4J78 A;  2HXC A;  4QL1 A;  1E8M A;  3UVN A;  5GSA A;  5TEE A;  5TDH B;  3DXM C;  4A08 B;  1L0Q A;  1M1X A;  4ES0 A;  4UI9 R;  5AJA A;  2CO0 A;  5FKR A;  4LGN A;  5FQD A;  5HE2 B;  3VA6 A;  4WK2 A;  1B9X A;  2XL2 A;  2AGY A;  4DNW A;  2QZP A;  3SLE D;  2CN2 A;  5CYK A;  3F3F A;  1H2W A;  3DDU A;  1UTC A;  3AFC A;  3MXX A;  1L5G A;  2O9K A;  4GQ2 P;  5M61 A;  1JJU B;  4XYI A;  5E6R A;  4ESG A;  4E5Z B;  5GXH A;  5K1C C;  2VDK A;  2OK4 A;  2GC4 A;  2GC7 A;  3UVK A;  4A2L A;  2CO0 C;  4BP9 A;  2W18 A;  2P9I C;  3IUN A;  4H5I A;  4JT6 C;  2HJB A;  2H3X A;  2H13 A;  2H47 A;  2PBI B;  5EML B;  4PNK B;  4CZX A;  5E6U A;  3EI3 A;  3PXT D;  3I7N A;  4BCD A;  4X3E A;  4PBZ A;  3EWE A;  3IKO A; 
#chains in the Genus database with same CATH homology
 2XL3 A;  1TBG A;  4HDJ A;  4GM3 A;  5C2W B;  3NVN A;  4J73 A;  5HQG A;  5IT9 g;  2HES X;  3OKY B;  1GG2 B;  3EI1 A;  4PXW A;  4ZOX A;  2IUP A;  4Z8L A;  5EMJ B;  3EMH A;  3SHF A;  2P9L C;  3BG0 A;  3IJ1 A;  5EM2 A;  3SBQ A;  4AOW A;  3C5M A;  3SN6 B;  4Y5R D;  2H6K A;  4K3J B;  4N14 A;  3IIY A;  5TEF A;  3SBR A;  3KRX B;  4GQ1 A;  5EAL A;  3SJL D;  4CI3 A;  2AGZ A;  2HJ4 A;  4IMM A;  3ODT A;  2IWK A;  4A0B B;  5EAR A;  3F3P A;  2YBA A;  4CC9 A;  4CY5 A;  4ERZ A;  2OVP B;  4E5Z A;  3J80 g;  4U1E I;  4PSW B;  2UZY B;  3SXT D;  4GMB A;  3P4F A;  2GNQ A;  3I89 A;  1A0R B;  4PC0 A;  2XYI A;  2AGW A;  2IUR A;  3I7O A;  5EAP A;  2J56 H;  3V5W B;  4D6V A;  2EBS A;  4J0W A;  4QT8 A;  5FKT A;  2IUQ A;  3FGB A;  3UVM A;  3OTT A;  4GM9 A;  2HKM A;  4K3I D;  1MDA H;  5B4W A;  2YB8 B;  2YMU A;  3C99 A;  4CY1 A;  5HE0 B;  3EI1 B;  4G56 B;  3SBP A;  4GGC A;  2Z2N A;  3UVO A;  4D0K A;  3FRX A;  4GGD A;  3OKY A;  1PEV A;  1RI6 A;  3PE7 A;  3I7L A;  3RFH A;  4CI8 A;  5AMS A;  3SCY A;  5FLX g;  2Z2O A;  3V7D B;  3EU7 A;  4ERY A;  4J87 A;  3UVL A;  4XYH A;  4L1Q D;  1JMZ B;  3VGZ A;  2IUV A;  3PXW D;  2CNX A;  4IA9 A;  3MZK A;  2P9N C;  4LG8 A;  1VYH C;  2MTA H;  1JMX B;  2YNP A;  4A0B A;  2BCJ B;  1S4U X;  4MK0 B;  4X60 B;  2H6Q A;  1XKS A;  2H68 A;  2CE8 A;  2CE9 A;  4GZ8 A;  4U7A A;  3C75 H;  4NSX A;  5A2Q g;  2I3S A;  4J8G A;  4J84 A;  4FWW A;  1YFQ A;  2CN3 A;  3JZG A;  3IIW A;  4GQB B;  5HE1 B;  3BWS A;  1N6F A;  1QNI A;  4FAN D;  2HKR A;  2P9S C;  2PM6 B;  2AQ5 A;  3I7K A;  5EAM A;  3AL9 A;  4O3U B;  5KDO B;  5GXI A;  2YNN A;  4J86 A;  3J81 g;  4FA1 D;  3RLM D;  3AH8 B;  2P9K C;  5I5J A;  2H9P A;  4FAV D;  4J81 A;  3OL2 B;  2OVQ B;  3ORV D;  3EG6 A;  4JSP C;  2Q7Q A;  3EI4 B;  4JXM A;  4A0A B;  3RSE C;  5CXB A;  4A09 A;  5SXM A;  1SQ9 A;  3JPX A;  4J82 A;  4CZV A;  2I0S A;  1XIP A;  1TYQ C;  3JRO A;  1Q47 A;  3JRP A;  3E0C A;  4R7A B;  1SQJ A;  2QC5 A;  3DXK C;  4ZN4 A;  5CXC B;  5I5M A;  3KRW B;  3L4O D;  5C9Z B;  3DSM A;  4PBY A;  3VH0 A;  4J0X A;  4L9O A;  2AH1 A;  5C2V B;  1N6E A;  3F3G A;  2BBK H;  2AGL A;  2HYE A;  3PVU B;  5EMK B;  5IJ7 E;  5GMK n;  3SMR A;  4A11 B;  1B9Y A;  2B5N A;  2AGX A;  3GRE A;  1N6D A;  4O3T B;  4CZY A;  3W15 A;  3L4M D;  3MKS B;  2IAA A;  2UZX B;  4ZOY A;  3C9C A;  4I79 A;  3IJ0 A;  4O1Q D;  1U4C A;  1MG2 A;  4GGA A;  4J77 A;  4O45 A;  1P22 A;  4H5J A;  5CXB B;  4A09 B;  3GFC A;  3A0F A;  2G99 A;  3PVW B;  3CFS B;  4AEZ A;  3OKT A;  4JD2 C;  4TZ4 A;  1NR0 A;  1R5M A;  4OZU A;  2I0R A;  5H17 A;  3OL2 A;  2H9M A;  2I0T A;  4O9D A;  3JAM g;  1GP2 B;  3EI4 A;  4KFM B;  5FXY A;  3RFG A;  4A0A A;  1PGU A;  4X63 B;  3RN1 D;  1GOT B;  2J57 G;  3RN0 D;  1K8K C;  2TRC B;  3DM0 A;  5TF2 A;  3I7H A;  3OKW A;  5HE3 B;  2H14 A;  5I5I A;  3UKR C;  3U4Y A;  4E54 B;  5CXC A;  3IJC A;  3SFZ A;  3DWL C;  3MKQ A;  3K27 A;  4L3H D;  4OWR A;  4CY2 A;  5AFU 3;  4JSX C;  3SWS D;  3JB9 L;  3ZWL B;  3I2N A;  3B7F A;  3MZL A;  4FA5 D;  4LG9 A;  4CY3 A;  3MMY A;  4ERQ A;  4A11 A;  2PM9 A;  2J55 H;  3PSC B;  3AL8 B;  2QXV A;  5FA5 B;  4BUJ C;  2G9A A;  3NVQ A;  4FHL A;  4GM8 A;  1OLZ A;  4CI1 A;  4X61 B;  1K32 A;  4QQE A;  3JZH A;  5K19 A;  5IC7 A;  1PBY B;  3I8C A;  3SVW D;  3EI2 B;  4EWR A;  5H1M A;  4FB1 D;  3K26 A;  3PXS D;  3CIK B;  2B5L A;  2OK6 A;  3CFV A;  4L3G D;  4FA4 D;  3HFQ A;  4JSV C;  2AH0 A;  5H14 A;  5IGO A;  3NVX A;  5HYN B;  1XHM A;  3I7P A;  4J79 A;  2IWF A;  3V9F A;  4QRJ A;  1MG3 A;  5EMM B;  2XU7 A;  4XEI C;  2Z2P A;  3JZN A;  4CI2 A;  4YVD A;  5CYK B;  1ERJ A;  2P9P C;  3BG1 A;  4BL0 A;  4JSN C;  4ZOV A;  1JOF A;  3FM0 A;  4A08 A;  4JT5 C;  5THA A;  1PI6 A;  4E54 A;  2P9U C;  5IJ8 E;  1SHY B;  3N0D A;  1OMW B;  2I3T A;  3N0E A;  2PM9 B;  4ZOZ A;  4A2M A;  3I8E A;  2H6N A;  3RRM C;  2PM7 B;  4FA9 D;  3EI3 B;  4A7J A;  3OW8 A;  2OJY A;  2H9N A;  2OIZ A;  3AL8 A;  3UR4 A;  5FKQ A;  3PSL A;  5FKS A;  2H9L A;  2B5M A;  2B4E A;  4PSX B;  1U2V C;  1GXR A;  4J8B A;  1NEX B;  2OVR B;  3ULE C;  4BH6 A;  4Y7R A;  3UKU C;  2YNO A;  1FWX A;  5IGQ A;  3RMZ D;  3EI2 A;  5EM2 B;  5JWZ A;  4J78 A;  2HXC A;  4QL1 A;  3UVN A;  5GSA A;  5TEE A;  5TDH B;  3DXM C;  4A08 B;  1L0Q A;  4ES0 A;  4UI9 R;  5AJA A;  2CO0 A;  5FKR A;  4LGN A;  5FQD A;  5HE2 B;  3VA6 A;  1B9X A;  2XL2 A;  2AGY A;  3SLE D;  2CN2 A;  5CYK A;  3F3F A;  3AFC A;  3MXX A;  2O9K A;  4GQ2 P;  4E5Z B;  1JJU B;  4XYI A;  4ESG A;  5GXH A;  5K1C C;  2OK4 A;  2GC4 A;  2GC7 A;  3UVK A;  4A2L A;  2CO0 C;  2W18 A;  2P9I C;  4H5I A;  4JT6 C;  2HJB A;  2H3X A;  2H13 A;  2H47 A;  2PBI B;  5EML B;  4PNK B;  4CZX A;  3EI3 A;  3PXT D;  3I7N A;  4X3E A;  4PBZ A;  3EWE A;  3IKO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...