4H5IA

Crystal structure of the guanine nucleotide exchange factor sec12 (p1 form)
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
344
structure length
344
Chain Sequence
MKFVTASYNVGYPAYGAKFLNNDTLLVAGGGGEGNNGIPNKLTVLRVDPTKDTEKEQFHILSEFALEDNDDSPTAIDASKGIILVGCNENSTKITQGKGNKHLRKFKYDKVNDQLEFLTSVDFDASTNADDYTKLVYISREGTVAAIASSKVPAIMRIIDPSDLTEKFEIETRGEVKDLHFSTDGKVVAYITGSSLEVISTVTGSCIARKTDFDKNWSLSKINFIADDTVLIAASLKKGKGIVLTKISIKSGNTSVLRSKQVTNRFKGITSMDVDMKGELAVLASNDNSIALVKLKDLSMSKIFKQAHSFAITEVTISPDSTYVASVSAANTIHIIKLPLNYAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Guanine nucleotide-exchange factor SEC12
publication title The structure of sec12 implicates potassium ion coordination in sar1 activation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport
total genus 83
structure length 344
sequence length 344
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4h5iA00
5AJAA 3DWLC 2CN3A 5EM2B 3W15A 5CXBB 3JZGA 2AH1A 2UZYB 2CO0C 1NEXB 3RMZD 4O3UB 3SCYA 4FHLA 2AGWA 3EI3B 3DM0A 3EI2B 1SHYB 2YNPA 4ZOYA 4G56B 2YNNA 2AGYA 2AH0A 3SBQA 5HE3B 4A08A 4K3JB 2J56H 1PEVA 4J0XA 4GGDA 3UKUC 4L9OA 2Q7QA 5H17A 2GC7A 4XEIC 5FKQA 2PM9A 4J86A 4L3HD 2XL3A 5C9ZB 4NSXA 2H6NA 4PC0A 4QRJA 3UVKA 1K32A 5EAPA 3V5WB 5IGOA 4J0WA 2I0TA 4AOWA 1JMZB 3SWSD 4HDJA 4LGNA 2CN2A 5GSAA 1SQ9A 4CY1A 2P9NC 4Z8LA 3RFGA 2Z2OA 2I0RA 3OKYB 3UVNA 2OIZA 5EMJB 3NVQA 3I2NA 3CFSB 3I7PA 4A0AA 2AQ5A 2GNQA 3I89A 2HXCA 2QXVA 3C99A 3SBRA 1B9XA 3I8EA 5CXCA 3MZKA 1K8KC 3C5MA 2YB8B 4A09A 2HYEA 5IJ8E 2H9NA 5TDHB 4OWRA 4ERZA 4CZVA 2PBIB 4PBYA 4JXMA 4UI9R 4ZOVA 3C9CA 4QT8A 1L0QA 4Y5RD 4LG9A 3L4MD 3I7KA 4MK0B 4J78A 3EG6A 1MG2A 4J87A 1JMXB 3UVMA 1U2VC 2G99A 5EALA 3J81g 3P4FA 1Q47A 2HESX 2YMUA 3EI4B 4H5JA 4EWRA 4FA5D 3B7FA 5AMSA 4J73A 3C75H 4GQ2P 4AEZA 4FAVD 4XYIA 2QC5A 4ES0A 4E54B 3FM0A 4JT6C 1JJUB 1N6DA 4CC9A 2B5NA 5FQDA 3EI1A 4PBZA 2XYIA 5IGQA 4O9DA 3CIKB 4A7JA 3SVWD 1GP2B 3JAMg 4U7AA 5I5IA 4J79A 4GM9A 3KRXB 5HE2B 3PXWD 4CY3A 4A0AB 4IA9A 4X61B 5TF2A 1B9YA 3CFVA 3NVNA 3I7OA 5THAA 5EMMB 4A0BA 4Y7RA 3SHFA 2H9LA 5FA5B 1GOTB 1FWXA 4GM8A 1U4CA 3JZNA 3I8CA 3SJLD 4L3GD 5FXYA 5EMLB 4U1EI 3FGBA 2BBKH 3F3FA 5EAMA 5EARA 4GZ8A 4FB1D 2I0SA 4J77A 2XL2A 3N0DA 2BCJB 3JRPA 5FKTA 3RLMD 1GG2B 3EU7A 4CZYA 3ULEC 2TRCB 3AL8B 1TYQC 2H3XA 4IMMA 1NR0A 3PE7A 4X3EA 3GREA 5TEEA 2P9LC 5H1MA 3JZHA 4CY2A 3F3PA 4PNKB 3IJ0A 4O3TB 2H9PA 2H13A 3PVWB 1PI6A 3PSLA 2IAAA 2P9KC 2P9UC 3UVOA 5CYKA 2O9KA 4JSXC 2HKRA 3K27A 3E0CA 4PXWA 5EM2A 4GMBA 3DSMA 2H14A 3A0FA 3VH0A 2GC4A 3BG0A 5CXBA 2H6KA 3ZWLB 4ZOZA 3MKSB 1TBGA 1GXRA 5EMKB 4GGCA 3EI3A 3DXMC 5FKSA 2J57G 4I79A 2UZXB 3K26A 3UR4A 1SQJA 1XHMA 4O45A 4E5ZA 4A08B 4BH6A 2HJBA 4GM3A 2H9MA 4GQ1A 3MKQA 2MTAH 2CE9A 2AGZA 2IUPA 5I5JA 3RSEC 4CI2A 1A0RB 1S4UX 2H68A 2AGXA 5TEFA 2PM9B 4J8GA 4JSNC 5SXMA 3SXTD 3L4OD 2IURA 4O1QD 4A11A 3OKWA 2G9AA 1N6FA 2B4EA 4BL0A 4J8BA 1PBYB 2B5MA 2IUQA 3J80g 1OMWB 2XU7A 5A2Qg 5IT9g 4J81A 2OVPB 3F3GA 5GXHA 5IJ7E 3SLED 4LG8A 4N14A 1OLZA 3RN0D 4ZN4A 3IIWA 2YNOA 3AFCA 2P9SC 3PVUB 3SFZA 4H5IA 4OZUA 5H14A 3PSCB 4XYHA 3OKTA 2OVRB 5CXCB 3PXSD 4A09B 2IWFA 4FA9D 5AFU3 3ODTA 2CE8A 4PSXB 4A2LA 5GXIA 4FA1D 3IIYA 4ERQA 1QNIA 1MDAH 3RRMC 4CI1A 4ESGA 5HE0B 4D0KA 3BG1A 2HKMA 2OK6A 3N0EA 4CI3A 1PGUA 5HYNB 3EWEA 2HJ4A 3V7DB 2J55H 4E5ZB 1YFQA 2OK4A 3AH8B 4QL1A 2CNXA 5K19A 4J84A 5I5MA 3MZLA 4CI8A 1ERJA 3OL2A 3VGZA 4CY5A 4A11B 5HE1B 3EI4A 3U4YA 3SN6B 4CZXA 4X60B 4JSVC 4PSWB 3VA6A 4TZ4A 3SMRA 3EI1B 4FWWA 3HFQA 3BWSA 3RFHA 4FAND 3GFCA 4E54A 4QQEA 4L1QD 4YVDA 2P9IC 2I3SA 3EMHA 4KFMB 4ZOXA 5K1CC 3MMYA 3IJCA 3NVXA 4J82A 2H6QA 5JWZA 3OTTA 4BUJC 4ERYA 3I7LA 5KDOB 4A0BB 3PXTD 2CO0A 3IJ1A 1RI6A 2H47A 1XIPA 2AGLA 2P9PC 5C2VB 1XKSA 1JOFA 3EI2A 4R7AB 3KRWB 2PM6B 4JSPC 3I7HA 2PM7B 5B4WA 3SBPA 2IUVA 2B5LA 3JPXA 3DXKC 3JROA 2I3TA 1R5MA 1VYHC 3UVLA 3MXXA 2Z2NA 4JT5C 5C2WB 4FA4D 2OJYA 3FRXA 2W18A 5IC7A 3IKOA 3ORVD 4GQBB 4K3ID 3I7NA 3OL2B 1N6EA 3AL8A 2YBAA 2IWKA 3AL9A 3V9FA 2OVQB 5HQGA 3OW8A 4GGAA 4D6VA 3RN1D 2Z2PA 1MG3A 3JB9L 3OKYA 4A2MA 4JD2C 5FLXg 5GMKn 5CYKB 5FKRA 2EBSA 1P22A 3UKRC 4X63B
chains in the Genus database with same CATH superfamily
5AJAA 3DWLC 1K3IA 2CN3A 5EM2B 3W15A 3KCIA 2QZPA 5CXBB 3JZGA 2AH1A 2UZYB 2VDNA 2HU8A 2CO0C 1NEXB 5C92A 3RMZD 2VZ1A 4O3UB 3SCYA 4FHLA 2AGWA 3EI3B 4O2WA 3DM0A 3EI2B 1SHYB 1H2YA 2YNPA 4AMYA 4DNWA 4G56B 4ZOYA 2YNNA 2AGYA 2AH0A 3SBQA 2EIEA 5HE3B 3QHYB 4A08A 4K3JB 2J56H 1PEVA 4J0XA 1YR2A 4GGDA 3UKUC 4L9OA 2Q7QA 5H17A 2GC7A 4XEIC 5FKQA 2PM9A 4J86A 4L3HD 2XL3A 5C9ZB 4NSXA 1VE7A 2H6NA 4PC0A 4QRJA 3UVKA 1O6FA 2XZGA 1K32A 5EAPA 3V5WB 5IGOA 4J0WA 2I0TA 4AOWA 1JMZB 3SWSD 2QR5A 4HDJA 4WK0A 4LGNA 2CN2A 5GSAA 4BP8A 1SQ9A 3O4GA 4CY1A 2P9NC 2VDRA 4Z8LA 3RFGA 2Z2OA 2I0RA 3OKYB 3UVNA 2OIZA 5EMJB 3NVQA 1U8CA 3I2NA 4O02A 4JHPC 3CFSB 1QFSA 2VDLA 5M5UA 1E5TA 3I7PA 1A12A 4A0AA 2AQ5A 2GNQA 3I89A 2HXCA 2QXVA 3C99A 3ZDXA 2HU5A 3SBRA 5M5TA 1B9XA 3I8EA 3FCUA 5CXCA 3MZKA 1K8KC 4NAAA 3C5MA 2YB8B 4A09A 2HYEA 5IJ8E 4Z7NA 2H9NA 4G1MA 5TDHB 4D9SA 4OWRA 4ERZA 4CZVA 1T2XA 2PBIB 5M5RA 4PBYA 4AX4A 4JXMA 4UI9R 1GOHA 4ZOVA 3C9CA 4QT8A 1L0QA 4Y5RD 4LG9A 3L4MD 3IUJA 3IUNA 3I7KA 4MK0B 3ZE1A 4J78A 3EG6A 1MG2A 1TYEA 1JMXB 4J87A 2G99A 1U2VC 5EALA 3UVMA 3J81g 3ZDYA 5M5VA 3P4FA 1Q47A 2HESX 2YMUA 4QAMA 3EI4B 4H5JA 1JTDB 4EWRA 1C9LA 4FA5D 3B7FA 5AMSA 1QFMA 2JKXA 3C75H 4J73A 2HU7A 4GQ2P 4AEZA 4FAVD 1VZ3A 4XYIA 2QC5A 4ES0A 4E54B 3FM0A 4JT6C 1JJUB 1N6DA 4CC9A 2B5NA 5FQDA 3EI1A 4PBZA 2XYIA 5IGQA 5C86A 4MMXA 4BCCA 4O9DA 3CIKB 4A7JA 3SVWD 1GP2B 1UTCA 4U7AA 5E6RA 3JAMg 5I5IA 4J79A 4GM9A 3KRXB 5HE2B 3PXWD 4CY3A 4A0AB 4IA9A 4X61B 5TF2A 1B9YA 3CFVA 3T3MA 2XDWA 3I7OA 3NVNA 5FFGA 5THAA 5EMMB 4A0BA 4Y7RA 3SHFA 2H9LA 5FA5B 1GOTB 3IVMA 1FWXA 3OF7A 4GM8A 1U4CA 2VDKA 3JZNA 3NIGA 3I8CA 3SJLD 4L3GD 5FXYA 5EMLB 4U1EI 3FGBA 2BBKH 3F3FA 3O4JA 5EAMA 2VDMA 5EARA 4GZ8A 4FB1D 2I0SA 3DDUA 4G55A 4J77A 2XL2A 3N0DA 4NENA 2BCJB 3JRPA 5FKTA 3RLMD 1GG2B 3IUQA 3EU7A 4CZYA 3ULEC 2TRCB 3ZE2A 3AL8B 3NIFA 1TYQC 2H3XA 4IMMA 1NR0A 3PE7A 4X3EA 3GREA 2VDQA 5E6SA 1O6GA 5TEEA 2P9LC 5H1MA 3JZHA 4CY2A 3NIDA 3F3PA 4PNKB 4G1EA 3IJ0A 4O3TB 2H9PA 3K71A 1UOPA 2H13A 3GD1I 3PVWB 2VC2A 1PI6A 3PSLA 2IAAA 2P9KC 2VDOA 2P9UC 3UVOA 4BCDA 5CYKA 2O9KA 4JSXC 2HKRA 3K27A 1UOQA 4Z7QA 3E0CA 4PXWA 5EM2A 3MUOA 4GMBA 3DSMA 2H14A 3A0FA 3VH0A 2GC4A 3BG0A 5CXBA 1GOGA 2H6KA 4NC4A 3T3PA 3ZWLB 4ZOZA 3MKSB 1TBGA 1GXRA 1E8NA 4RE6A 5M5SA 5EMKB 4GGCA 1I2MB 3EI3A 3DXMC 1JV2A 3FCSA 5FKSA 2J57G 4I79A 2UZXB 3K26A 2EICA 3UR4A 1SQJA 1XHMA 4O45A 4RE5A 4E5ZA 4A08B 4BH6A 2HJBA 4GM3A 2H9MA 4GQ1A 3MKQA 2MTAH 2CE9A 2AGZA 2IUPA 5I5JA 3RSEC 4CI2A 1A0RB 3ZDZA 1S4UX 2H68A 2AGXA 5TEFA 4DNVA 2PM9B 4J8GA 4JSNC 5SXMA 3SXTD 4BCBA 2VZ3A 3K72A 3L4OD 2IURA 4O1QD 4A11A 1H2WA 3OKWA 2G9AA 1N6FA 3EQ7A 3O4HA 2B4EA 2WQ8A 4BL0A 4J8BA 1PBYB 1VZ2A 2B5MA 2IUQA 3J80g 1OMWB 2XU7A 4WK2A 5A2Qg 5IT9g 4J81A 2OVPB 5FFOA 2VDPA 3F3GA 5GXHA 5IJ7E 3SLED 4LG8A 4N14A 1OLZA 3RN0D 4ZN4A 3IIWA 2YNOA 3AFCA 2P9SC 3PVUB 3SFZA 4H5IA 4OZUA 1H2ZA 4MMZA 5H14A 3PSCB 1BPOA 4XYHA 3OKTA 3ZE0A 2OVRB 5CXCB 3PXSD 1VE6A 2EIDA 4UM9A 4A09B 2IWFA 4UM8A 4FA9D 5AFU3 3ODTA 2CE8A 4PSXB 4A2LA 5GXIA 4FA1D 3IIYA 4IRZA 1QNIA 4ERQA 1MDAH 3RRMC 3V4PA 3VI3A 4CI1A 4ESGA 5HE0B 4D0KA 3BG1A 2HKMA 2OK6A 3N0EA 4CI3A 1PGUA 5HYNB 3EWEA 4WK4A 1H2XA 2HJ4A 3V7DB 2J55H 4AN1A 2EIBA 4E5ZB 1YFQA 2OK4A 3AH8B 4QL1A 4DNUA 2CNXA 5K19A 4J84A 4NBMA 3V4VA 5I5MA 3MZLA 4CI8A 1ERJA 3EQ8A 3OL2A 3VGZA 1L5GA 4CY5A 4A11B 3O4IA 5HE1B 3EI4A 3U4YA 3SN6B 4CZXA 4X60B 4JSVC 4PSWB 3VA6A 4TZ4A 3SMRA 4WJKA 3EI1B 3IULA 4FWWA 3HFQA 3BWSA 3RFHA 4FAND 3GFCA 4AMZA 4E54A 4QQEA 4L1QD 4YVDA 5M61A 1E8MA 2P9IC 1GOFA 2I3SA 5HDBA 3EMHA 3QI0A 4KFMB 4ZOXA 5K1CC 3MMYA 4BP9A 3IJCA 3NVXA 4J82A 2H6QA 5JWZA 3OTTA 4BUJC 4ERYA 4Z7OA 3I7LA 5KDOB 4A0BB 3PXTD 2CO0A 3IJ1A 1RI6A 2H47A 1XIPA 4L1MA 2AGLA 2P9PC 5C2VB 1XKSA 4JHNA 1JOFA 3EI2A 4R7AB 3KRWB 2PM6B 3VI4A 4JSPC 3I7HA 2PM7B 1C9IA 5B4WA 3SBPA 2IUVA 3IUMA 2B5LA 3JPXA 3DXKC 3JROA 3EQ9A 2I3TA 1R5MA 1VYHC 3UVLA 3MXXA 2Z2NA 4JT5C 5C2WB 4FA4D 2OJYA 3FRXA 2W18A 5IC7A 3GC3B 3K6SA 3IKOA 3ORVD 4GQBB 4K3ID 3I7NA 4MMYA 3OL2B 1N6EA 3MUNA 3AL8A 2YBAA 3IURA 2IWKA 3AL9A 3IJEA 3V9FA 2BKLA 2OVQB 3MVDK 5HQGA 3OW8A 4GGAA 4D6VA 3RN1D 2XE4A 2Z2PA 1MG3A 3JB9L 3OKYA 4A2MA 4JD2C 5FLXg 5GMKn 4AN0A 1UOOA 5CYKB 5E6UA 5FKRA 1M1XA 2EBSA 1P22A 3UKRC 4X63B
chains in the Genus database with same CATH topology
5AJAA 3DWLC 2CN3A 5EM2B 3W15A 5CXBB 3JZGA 2AH1A 2UZYB 2CO0C 1NEXB 3RMZD 4O3UB 3SCYA 4FHLA 2AGWA 3EI3B 3DM0A 3EI2B 1SHYB 2YNPA 4ZOYA 4G56B 2YNNA 2AGYA 2AH0A 3SBQA 5HE3B 4A08A 4K3JB 2J56H 1PEVA 4J0XA 4GGDA 3UKUC 4L9OA 2Q7QA 5H17A 2GC7A 4XEIC 5FKQA 2PM9A 4J86A 4L3HD 2XL3A 5C9ZB 4NSXA 2H6NA 4PC0A 4QRJA 3UVKA 1K32A 5EAPA 3V5WB 5IGOA 4J0WA 2I0TA 4AOWA 1JMZB 3SWSD 4HDJA 4LGNA 2CN2A 5GSAA 1SQ9A 4CY1A 2P9NC 4Z8LA 3RFGA 2Z2OA 2I0RA 3OKYB 3UVNA 2OIZA 5EMJB 3NVQA 3I2NA 3CFSB 3I7PA 4A0AA 2AQ5A 2GNQA 3I89A 2HXCA 2QXVA 3C99A 3SBRA 1B9XA 3I8EA 5CXCA 3MZKA 1K8KC 3C5MA 2YB8B 4A09A 2HYEA 5IJ8E 2H9NA 5TDHB 4OWRA 4ERZA 4CZVA 2PBIB 4PBYA 4JXMA 4UI9R 4ZOVA 3C9CA 4QT8A 1L0QA 4Y5RD 4LG9A 3L4MD 3I7KA 4MK0B 4J78A 3EG6A 1MG2A 4J87A 1JMXB 3UVMA 1U2VC 2G99A 5EALA 3J81g 3P4FA 1Q47A 2HESX 2YMUA 3EI4B 4H5JA 4EWRA 4FA5D 3B7FA 5AMSA 4J73A 3C75H 4GQ2P 4AEZA 4FAVD 4XYIA 2QC5A 4ES0A 4E54B 3FM0A 4JT6C 1JJUB 1N6DA 4CC9A 2B5NA 5FQDA 3EI1A 4PBZA 2XYIA 5IGQA 4O9DA 3CIKB 4A7JA 3SVWD 1GP2B 3JAMg 4U7AA 5I5IA 4J79A 4GM9A 3KRXB 5HE2B 3PXWD 4CY3A 4A0AB 4IA9A 4X61B 5TF2A 1B9YA 3CFVA 3NVNA 3I7OA 5THAA 5EMMB 4A0BA 4Y7RA 3SHFA 2H9LA 5FA5B 1GOTB 1FWXA 4GM8A 1U4CA 3JZNA 3I8CA 3SJLD 4L3GD 5FXYA 5EMLB 4U1EI 3FGBA 2BBKH 3F3FA 5EAMA 5EARA 4GZ8A 4FB1D 2I0SA 4J77A 2XL2A 3N0DA 2BCJB 3JRPA 5FKTA 3RLMD 1GG2B 3EU7A 4CZYA 3ULEC 2TRCB 3AL8B 1TYQC 2H3XA 4IMMA 1NR0A 3PE7A 4X3EA 3GREA 5TEEA 2P9LC 5H1MA 3JZHA 4CY2A 3F3PA 4PNKB 3IJ0A 4O3TB 2H9PA 2H13A 3PVWB 1PI6A 3PSLA 2IAAA 2P9KC 2P9UC 3UVOA 5CYKA 2O9KA 4JSXC 2HKRA 3K27A 3E0CA 4PXWA 5EM2A 4GMBA 3DSMA 2H14A 3A0FA 3VH0A 2GC4A 3BG0A 5CXBA 2H6KA 3ZWLB 4ZOZA 3MKSB 1TBGA 1GXRA 5EMKB 4GGCA 3EI3A 3DXMC 5FKSA 2J57G 4I79A 2UZXB 3K26A 3UR4A 1SQJA 1XHMA 4O45A 4E5ZA 4A08B 4BH6A 2HJBA 4GM3A 2H9MA 4GQ1A 3MKQA 2MTAH 2CE9A 2AGZA 2IUPA 5I5JA 3RSEC 4CI2A 1A0RB 1S4UX 2H68A 2AGXA 5TEFA 2PM9B 4J8GA 4JSNC 5SXMA 3SXTD 3L4OD 2IURA 4O1QD 4A11A 3OKWA 2G9AA 1N6FA 2B4EA 4BL0A 4J8BA 1PBYB 2B5MA 2IUQA 3J80g 1OMWB 2XU7A 5A2Qg 5IT9g 4J81A 2OVPB 3F3GA 5GXHA 5IJ7E 3SLED 4LG8A 4N14A 1OLZA 3RN0D 4ZN4A 3IIWA 2YNOA 3AFCA 2P9SC 3PVUB 3SFZA 4H5IA 4OZUA 5H14A 3PSCB 4XYHA 3OKTA 2OVRB 5CXCB 3PXSD 4A09B 2IWFA 4FA9D 5AFU3 3ODTA 2CE8A 4PSXB 4A2LA 5GXIA 4FA1D 3IIYA 4ERQA 1QNIA 1MDAH 3RRMC 4CI1A 4ESGA 5HE0B 4D0KA 3BG1A 2HKMA 2OK6A 3N0EA 4CI3A 1PGUA 5HYNB 3EWEA 2HJ4A 3V7DB 2J55H 4E5ZB 1YFQA 2OK4A 3AH8B 4QL1A 2CNXA 5K19A 4J84A 5I5MA 3MZLA 4CI8A 1ERJA 3OL2A 3VGZA 4CY5A 4A11B 5HE1B 3EI4A 3U4YA 3SN6B 4CZXA 4X60B 4JSVC 4PSWB 3VA6A 4TZ4A 3SMRA 3EI1B 4FWWA 3HFQA 3BWSA 3RFHA 4FAND 3GFCA 4E54A 4QQEA 4L1QD 4YVDA 2P9IC 2I3SA 3EMHA 4KFMB 4ZOXA 5K1CC 3MMYA 3IJCA 3NVXA 4J82A 2H6QA 5JWZA 3OTTA 4BUJC 4ERYA 3I7LA 5KDOB 4A0BB 3PXTD 2CO0A 3IJ1A 1RI6A 2H47A 1XIPA 2AGLA 2P9PC 5C2VB 1XKSA 1JOFA 3EI2A 4R7AB 3KRWB 2PM6B 4JSPC 3I7HA 2PM7B 5B4WA 3SBPA 2IUVA 2B5LA 3JPXA 3DXKC 3JROA 2I3TA 1R5MA 1VYHC 3UVLA 3MXXA 2Z2NA 4JT5C 5C2WB 4FA4D 2OJYA 3FRXA 2W18A 5IC7A 3IKOA 3ORVD 4GQBB 4K3ID 3I7NA 3OL2B 1N6EA 3AL8A 2YBAA 2IWKA 3AL9A 3V9FA 2OVQB 5HQGA 3OW8A 4GGAA 4D6VA 3RN1D 2Z2PA 1MG3A 3JB9L 3OKYA 4A2MA 4JD2C 5FLXg 5GMKn 5CYKB 5FKRA 2EBSA 1P22A 3UKRC 4X63B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AJA A;  3DWL C;  2CN3 A;  5EM2 B;  3W15 A;  5CXB B;  3JZG A;  2AH1 A;  2UZY B;  2CO0 C;  1NEX B;  3RMZ D;  4O3U B;  3SCY A;  4FHL A;  2AGW A;  3EI3 B;  3DM0 A;  3EI2 B;  1SHY B;  2YNP A;  4ZOY A;  4G56 B;  2YNN A;  2AGY A;  2AH0 A;  3SBQ A;  5HE3 B;  4A08 A;  4K3J B;  2J56 H;  1PEV A;  4J0X A;  4GGD A;  3UKU C;  4L9O A;  2Q7Q A;  5H17 A;  2GC7 A;  4XEI C;  5FKQ A;  2PM9 A;  4J86 A;  4L3H D;  2XL3 A;  5C9Z B;  4NSX A;  2H6N A;  4PC0 A;  4QRJ A;  3UVK A;  1K32 A;  5EAP A;  3V5W B;  5IGO A;  4J0W A;  2I0T A;  4AOW A;  1JMZ B;  3SWS D;  4HDJ A;  4LGN A;  2CN2 A;  5GSA A;  1SQ9 A;  4CY1 A;  2P9N C;  4Z8L A;  3RFG A;  2Z2O A;  2I0R A;  3OKY B;  3UVN A;  2OIZ A;  5EMJ B;  3NVQ A;  3I2N A;  3CFS B;  3I7P A;  4A0A A;  2AQ5 A;  2GNQ A;  3I89 A;  2HXC A;  2QXV A;  3C99 A;  3SBR A;  1B9X A;  3I8E A;  5CXC A;  3MZK A;  1K8K C;  3C5M A;  2YB8 B;  4A09 A;  2HYE A;  5IJ8 E;  2H9N A;  5TDH B;  4OWR A;  4ERZ A;  4CZV A;  2PBI B;  4PBY A;  4JXM A;  4UI9 R;  4ZOV A;  3C9C A;  4QT8 A;  1L0Q A;  4Y5R D;  4LG9 A;  3L4M D;  3I7K A;  4MK0 B;  4J78 A;  3EG6 A;  1MG2 A;  4J87 A;  1JMX B;  3UVM A;  1U2V C;  2G99 A;  5EAL A;  3J81 g;  3P4F A;  1Q47 A;  2HES X;  2YMU A;  3EI4 B;  4H5J A;  4EWR A;  4FA5 D;  3B7F A;  5AMS A;  4J73 A;  3C75 H;  4GQ2 P;  4AEZ A;  4FAV D;  4XYI A;  2QC5 A;  4ES0 A;  4E54 B;  3FM0 A;  4JT6 C;  1JJU B;  1N6D A;  4CC9 A;  2B5N A;  5FQD A;  3EI1 A;  4PBZ A;  2XYI A;  5IGQ A;  4O9D A;  3CIK B;  4A7J A;  3SVW D;  1GP2 B;  3JAM g;  4U7A A;  5I5I A;  4J79 A;  4GM9 A;  3KRX B;  5HE2 B;  3PXW D;  4CY3 A;  4A0A B;  4IA9 A;  4X61 B;  5TF2 A;  1B9Y A;  3CFV A;  3NVN A;  3I7O A;  5THA A;  5EMM B;  4A0B A;  4Y7R A;  3SHF A;  2H9L A;  5FA5 B;  1GOT B;  1FWX A;  4GM8 A;  1U4C A;  3JZN A;  3I8C A;  3SJL D;  4L3G D;  5FXY A;  5EML B;  4U1E I;  3FGB A;  2BBK H;  3F3F A;  5EAM A;  5EAR A;  4GZ8 A;  4FB1 D;  2I0S A;  4J77 A;  2XL2 A;  3N0D A;  2BCJ B;  3JRP A;  5FKT A;  3RLM D;  1GG2 B;  3EU7 A;  4CZY A;  3ULE C;  2TRC B;  3AL8 B;  1TYQ C;  2H3X A;  4IMM A;  1NR0 A;  3PE7 A;  4X3E A;  3GRE A;  5TEE A;  2P9L C;  5H1M A;  3JZH A;  4CY2 A;  3F3P A;  4PNK B;  3IJ0 A;  4O3T B;  2H9P A;  2H13 A;  3PVW B;  1PI6 A;  3PSL A;  2IAA A;  2P9K C;  2P9U C;  3UVO A;  5CYK A;  2O9K A;  4JSX C;  2HKR A;  3K27 A;  3E0C A;  4PXW A;  5EM2 A;  4GMB A;  3DSM A;  2H14 A;  3A0F A;  3VH0 A;  2GC4 A;  3BG0 A;  5CXB A;  2H6K A;  3ZWL B;  4ZOZ A;  3MKS B;  1TBG A;  1GXR A;  5EMK B;  4GGC A;  3EI3 A;  3DXM C;  5FKS A;  2J57 G;  4I79 A;  2UZX B;  3K26 A;  3UR4 A;  1SQJ A;  1XHM A;  4O45 A;  4E5Z A;  4A08 B;  4BH6 A;  2HJB A;  4GM3 A;  2H9M A;  4GQ1 A;  3MKQ A;  2MTA H;  2CE9 A;  2AGZ A;  2IUP A;  5I5J A;  3RSE C;  4CI2 A;  1A0R B;  1S4U X;  2H68 A;  2AGX A;  5TEF A;  2PM9 B;  4J8G A;  4JSN C;  5SXM A;  3SXT D;  3L4O D;  2IUR A;  4O1Q D;  4A11 A;  3OKW A;  2G9A A;  1N6F A;  2B4E A;  4BL0 A;  4J8B A;  1PBY B;  2B5M A;  2IUQ A;  3J80 g;  1OMW B;  2XU7 A;  5A2Q g;  5IT9 g;  4J81 A;  2OVP B;  3F3G A;  5GXH A;  5IJ7 E;  3SLE D;  4LG8 A;  4N14 A;  1OLZ A;  3RN0 D;  4ZN4 A;  3IIW A;  2YNO A;  3AFC A;  2P9S C;  3PVU B;  3SFZ A;  4H5I A;  4OZU A;  5H14 A;  3PSC B;  4XYH A;  3OKT A;  2OVR B;  5CXC B;  3PXS D;  4A09 B;  2IWF A;  4FA9 D;  5AFU 3;  3ODT A;  2CE8 A;  4PSX B;  4A2L A;  5GXI A;  4FA1 D;  3IIY A;  4ERQ A;  1QNI A;  1MDA H;  3RRM C;  4CI1 A;  4ESG A;  5HE0 B;  4D0K A;  3BG1 A;  2HKM A;  2OK6 A;  3N0E A;  4CI3 A;  1PGU A;  5HYN B;  3EWE A;  2HJ4 A;  3V7D B;  2J55 H;  4E5Z B;  1YFQ A;  2OK4 A;  3AH8 B;  4QL1 A;  2CNX A;  5K19 A;  4J84 A;  5I5M A;  3MZL A;  4CI8 A;  1ERJ A;  3OL2 A;  3VGZ A;  4CY5 A;  4A11 B;  5HE1 B;  3EI4 A;  3U4Y A;  3SN6 B;  4CZX A;  4X60 B;  4JSV C;  4PSW B;  3VA6 A;  4TZ4 A;  3SMR A;  3EI1 B;  4FWW A;  3HFQ A;  3BWS A;  3RFH A;  4FAN D;  3GFC A;  4E54 A;  4QQE A;  4L1Q D;  4YVD A;  2P9I C;  2I3S A;  3EMH A;  4KFM B;  4ZOX A;  5K1C C;  3MMY A;  3IJC A;  3NVX A;  4J82 A;  2H6Q A;  5JWZ A;  3OTT A;  4BUJ C;  4ERY A;  3I7L A;  5KDO B;  4A0B B;  3PXT D;  2CO0 A;  3IJ1 A;  1RI6 A;  2H47 A;  1XIP A;  2AGL A;  2P9P C;  5C2V B;  1XKS A;  1JOF A;  3EI2 A;  4R7A B;  3KRW B;  2PM6 B;  4JSP C;  3I7H A;  2PM7 B;  5B4W A;  3SBP A;  2IUV A;  2B5L A;  3JPX A;  3DXK C;  3JRO A;  2I3T A;  1R5M A;  1VYH C;  3UVL A;  3MXX A;  2Z2N A;  4JT5 C;  5C2W B;  4FA4 D;  2OJY A;  3FRX A;  2W18 A;  5IC7 A;  3IKO A;  3ORV D;  4GQB B;  4K3I D;  3I7N A;  3OL2 B;  1N6E A;  3AL8 A;  2YBA A;  2IWK A;  3AL9 A;  3V9F A;  2OVQ B;  5HQG A;  3OW8 A;  4GGA A;  4D6V A;  3RN1 D;  2Z2P A;  1MG3 A;  3JB9 L;  3OKY A;  4A2M A;  4JD2 C;  5FLX g;  5GMK n;  5CYK B;  5FKR A;  2EBS A;  1P22 A;  3UKR C;  4X63 B; 
#chains in the Genus database with same CATH topology
 5AJA A;  3DWL C;  1K3I A;  2CN3 A;  5EM2 B;  3W15 A;  3KCI A;  2QZP A;  5CXB B;  3JZG A;  2AH1 A;  2UZY B;  2VDN A;  2HU8 A;  2CO0 C;  1NEX B;  5C92 A;  3RMZ D;  2VZ1 A;  4O3U B;  3SCY A;  4FHL A;  2AGW A;  3EI3 B;  4O2W A;  3DM0 A;  3EI2 B;  1SHY B;  1H2Y A;  2YNP A;  4AMY A;  4DNW A;  4G56 B;  4ZOY A;  2YNN A;  2AGY A;  2AH0 A;  3SBQ A;  2EIE A;  5HE3 B;  3QHY B;  4A08 A;  4K3J B;  2J56 H;  1PEV A;  4J0X A;  1YR2 A;  4GGD A;  3UKU C;  4L9O A;  2Q7Q A;  5H17 A;  2GC7 A;  4XEI C;  5FKQ A;  2PM9 A;  4J86 A;  4L3H D;  2XL3 A;  5C9Z B;  4NSX A;  1VE7 A;  2H6N A;  4PC0 A;  4QRJ A;  3UVK A;  1O6F A;  2XZG A;  1K32 A;  5EAP A;  3V5W B;  5IGO A;  4J0W A;  2I0T A;  4AOW A;  1JMZ B;  3SWS D;  2QR5 A;  4HDJ A;  4WK0 A;  4LGN A;  2CN2 A;  5GSA A;  4BP8 A;  1SQ9 A;  3O4G A;  4CY1 A;  2P9N C;  2VDR A;  4Z8L A;  3RFG A;  2Z2O A;  2I0R A;  3OKY B;  3UVN A;  2OIZ A;  5EMJ B;  3NVQ A;  1U8C A;  3I2N A;  4O02 A;  4JHP C;  3CFS B;  1QFS A;  2VDL A;  5M5U A;  1E5T A;  3I7P A;  1A12 A;  4A0A A;  2AQ5 A;  2GNQ A;  3I89 A;  2HXC A;  2QXV A;  3C99 A;  3ZDX A;  2HU5 A;  3SBR A;  5M5T A;  1B9X A;  3I8E A;  3FCU A;  5CXC A;  3MZK A;  1K8K C;  4NAA A;  3C5M A;  2YB8 B;  4A09 A;  2HYE A;  5IJ8 E;  4Z7N A;  2H9N A;  4G1M A;  5TDH B;  4D9S A;  4OWR A;  4ERZ A;  4CZV A;  1T2X A;  2PBI B;  5M5R A;  4PBY A;  4AX4 A;  4JXM A;  4UI9 R;  1GOH A;  4ZOV A;  3C9C A;  4QT8 A;  1L0Q A;  4Y5R D;  4LG9 A;  3L4M D;  3IUJ A;  3IUN A;  3I7K A;  4MK0 B;  3ZE1 A;  4J78 A;  3EG6 A;  1MG2 A;  1TYE A;  1JMX B;  4J87 A;  2G99 A;  1U2V C;  5EAL A;  3UVM A;  3J81 g;  3ZDY A;  5M5V A;  3P4F A;  1Q47 A;  2HES X;  2YMU A;  4QAM A;  3EI4 B;  4H5J A;  1JTD B;  4EWR A;  1C9L A;  4FA5 D;  3B7F A;  5AMS A;  1QFM A;  2JKX A;  3C75 H;  4J73 A;  2HU7 A;  4GQ2 P;  4AEZ A;  4FAV D;  1VZ3 A;  4XYI A;  2QC5 A;  4ES0 A;  4E54 B;  3FM0 A;  4JT6 C;  1JJU B;  1N6D A;  4CC9 A;  2B5N A;  5FQD A;  3EI1 A;  4PBZ A;  2XYI A;  5IGQ A;  5C86 A;  4MMX A;  4BCC A;  4O9D A;  3CIK B;  4A7J A;  3SVW D;  1GP2 B;  1UTC A;  4U7A A;  5E6R A;  3JAM g;  5I5I A;  4J79 A;  4GM9 A;  3KRX B;  5HE2 B;  3PXW D;  4CY3 A;  4A0A B;  4IA9 A;  4X61 B;  5TF2 A;  1B9Y A;  3CFV A;  3T3M A;  2XDW A;  3I7O A;  3NVN A;  5FFG A;  5THA A;  5EMM B;  4A0B A;  4Y7R A;  3SHF A;  2H9L A;  5FA5 B;  1GOT B;  3IVM A;  1FWX A;  3OF7 A;  4GM8 A;  1U4C A;  2VDK A;  3JZN A;  3NIG A;  3I8C A;  3SJL D;  4L3G D;  5FXY A;  5EML B;  4U1E I;  3FGB A;  2BBK H;  3F3F A;  3O4J A;  5EAM A;  2VDM A;  5EAR A;  4GZ8 A;  4FB1 D;  2I0S A;  3DDU A;  4G55 A;  4J77 A;  2XL2 A;  3N0D A;  4NEN A;  2BCJ B;  3JRP A;  5FKT A;  3RLM D;  1GG2 B;  3IUQ A;  3EU7 A;  4CZY A;  3ULE C;  2TRC B;  3ZE2 A;  3AL8 B;  3NIF A;  1TYQ C;  2H3X A;  4IMM A;  1NR0 A;  3PE7 A;  4X3E A;  3GRE A;  2VDQ A;  5E6S A;  1O6G A;  5TEE A;  2P9L C;  5H1M A;  3JZH A;  4CY2 A;  3NID A;  3F3P A;  4PNK B;  4G1E A;  3IJ0 A;  4O3T B;  2H9P A;  3K71 A;  1UOP A;  2H13 A;  3GD1 I;  3PVW B;  2VC2 A;  1PI6 A;  3PSL A;  2IAA A;  2P9K C;  2VDO A;  2P9U C;  3UVO A;  4BCD A;  5CYK A;  2O9K A;  4JSX C;  2HKR A;  3K27 A;  1UOQ A;  4Z7Q A;  3E0C A;  4PXW A;  5EM2 A;  3MUO A;  4GMB A;  3DSM A;  2H14 A;  3A0F A;  3VH0 A;  2GC4 A;  3BG0 A;  5CXB A;  1GOG A;  2H6K A;  4NC4 A;  3T3P A;  3ZWL B;  4ZOZ A;  3MKS B;  1TBG A;  1GXR A;  1E8N A;  4RE6 A;  5M5S A;  5EMK B;  4GGC A;  1I2M B;  3EI3 A;  3DXM C;  1JV2 A;  3FCS A;  5FKS A;  2J57 G;  4I79 A;  2UZX B;  3K26 A;  2EIC A;  3UR4 A;  1SQJ A;  1XHM A;  4O45 A;  4RE5 A;  4E5Z A;  4A08 B;  4BH6 A;  2HJB A;  4GM3 A;  2H9M A;  4GQ1 A;  3MKQ A;  2MTA H;  2CE9 A;  2AGZ A;  2IUP A;  5I5J A;  3RSE C;  4CI2 A;  1A0R B;  3ZDZ A;  1S4U X;  2H68 A;  2AGX A;  5TEF A;  4DNV A;  2PM9 B;  4J8G A;  4JSN C;  5SXM A;  3SXT D;  4BCB A;  2VZ3 A;  3K72 A;  3L4O D;  2IUR A;  4O1Q D;  4A11 A;  1H2W A;  3OKW A;  2G9A A;  1N6F A;  3EQ7 A;  3O4H A;  2B4E A;  2WQ8 A;  4BL0 A;  4J8B A;  1PBY B;  1VZ2 A;  2B5M A;  2IUQ A;  3J80 g;  1OMW B;  2XU7 A;  4WK2 A;  5A2Q g;  5IT9 g;  4J81 A;  2OVP B;  5FFO A;  2VDP A;  3F3G A;  5GXH A;  5IJ7 E;  3SLE D;  4LG8 A;  4N14 A;  1OLZ A;  3RN0 D;  4ZN4 A;  3IIW A;  2YNO A;  3AFC A;  2P9S C;  3PVU B;  3SFZ A;  4H5I A;  4OZU A;  1H2Z A;  4MMZ A;  5H14 A;  3PSC B;  1BPO A;  4XYH A;  3OKT A;  3ZE0 A;  2OVR B;  5CXC B;  3PXS D;  1VE6 A;  2EID A;  4UM9 A;  4A09 B;  2IWF A;  4UM8 A;  4FA9 D;  5AFU 3;  3ODT A;  2CE8 A;  4PSX B;  4A2L A;  5GXI A;  4FA1 D;  3IIY A;  4IRZ A;  1QNI A;  4ERQ A;  1MDA H;  3RRM C;  3V4P A;  3VI3 A;  4CI1 A;  4ESG A;  5HE0 B;  4D0K A;  3BG1 A;  2HKM A;  2OK6 A;  3N0E A;  4CI3 A;  1PGU A;  5HYN B;  3EWE A;  4WK4 A;  1H2X A;  2HJ4 A;  3V7D B;  2J55 H;  4AN1 A;  2EIB A;  4E5Z B;  1YFQ A;  2OK4 A;  3AH8 B;  4QL1 A;  4DNU A;  2CNX A;  5K19 A;  4J84 A;  4NBM A;  3V4V A;  5I5M A;  3MZL A;  4CI8 A;  1ERJ A;  3EQ8 A;  3OL2 A;  3VGZ A;  1L5G A;  4CY5 A;  4A11 B;  3O4I A;  5HE1 B;  3EI4 A;  3U4Y A;  3SN6 B;  4CZX A;  4X60 B;  4JSV C;  4PSW B;  3VA6 A;  4TZ4 A;  3SMR A;  4WJK A;  3EI1 B;  3IUL A;  4FWW A;  3HFQ A;  3BWS A;  3RFH A;  4FAN D;  3GFC A;  4AMZ A;  4E54 A;  4QQE A;  4L1Q D;  4YVD A;  5M61 A;  1E8M A;  2P9I C;  1GOF A;  2I3S A;  5HDB A;  3EMH A;  3QI0 A;  4KFM B;  4ZOX A;  5K1C C;  3MMY A;  4BP9 A;  3IJC A;  3NVX A;  4J82 A;  2H6Q A;  5JWZ A;  3OTT A;  4BUJ C;  4ERY A;  4Z7O A;  3I7L A;  5KDO B;  4A0B B;  3PXT D;  2CO0 A;  3IJ1 A;  1RI6 A;  2H47 A;  1XIP A;  4L1M A;  2AGL A;  2P9P C;  5C2V B;  1XKS A;  4JHN A;  1JOF A;  3EI2 A;  4R7A B;  3KRW B;  2PM6 B;  3VI4 A;  4JSP C;  3I7H A;  2PM7 B;  1C9I A;  5B4W A;  3SBP A;  2IUV A;  3IUM A;  2B5L A;  3JPX A;  3DXK C;  3JRO A;  3EQ9 A;  2I3T A;  1R5M A;  1VYH C;  3UVL A;  3MXX A;  2Z2N A;  4JT5 C;  5C2W B;  4FA4 D;  2OJY A;  3FRX A;  2W18 A;  5IC7 A;  3GC3 B;  3K6S A;  3IKO A;  3ORV D;  4GQB B;  4K3I D;  3I7N A;  4MMY A;  3OL2 B;  1N6E A;  3MUN A;  3AL8 A;  2YBA A;  3IUR A;  2IWK A;  3AL9 A;  3IJE A;  3V9F A;  2BKL A;  2OVQ B;  3MVD K;  5HQG A;  3OW8 A;  4GGA A;  4D6V A;  3RN1 D;  2XE4 A;  2Z2P A;  1MG3 A;  3JB9 L;  3OKY A;  4A2M A;  4JD2 C;  5FLX g;  5GMK n;  4AN0 A;  1UOO A;  5CYK B;  5E6U A;  5FKR A;  1M1X A;  2EBS A;  1P22 A;  3UKR C;  4X63 B; 
#chains in the Genus database with same CATH homology
 5AJA A;  3DWL C;  2CN3 A;  5EM2 B;  3W15 A;  5CXB B;  3JZG A;  2AH1 A;  2UZY B;  2CO0 C;  1NEX B;  3RMZ D;  4O3U B;  3SCY A;  4FHL A;  2AGW A;  3EI3 B;  3DM0 A;  3EI2 B;  1SHY B;  2YNP A;  4ZOY A;  4G56 B;  2YNN A;  2AGY A;  2AH0 A;  3SBQ A;  5HE3 B;  4A08 A;  4K3J B;  2J56 H;  1PEV A;  4J0X A;  4GGD A;  3UKU C;  4L9O A;  2Q7Q A;  5H17 A;  2GC7 A;  4XEI C;  5FKQ A;  2PM9 A;  4J86 A;  4L3H D;  2XL3 A;  5C9Z B;  4NSX A;  2H6N A;  4PC0 A;  4QRJ A;  3UVK A;  1K32 A;  5EAP A;  3V5W B;  5IGO A;  4J0W A;  2I0T A;  4AOW A;  1JMZ B;  3SWS D;  4HDJ A;  4LGN A;  2CN2 A;  5GSA A;  1SQ9 A;  4CY1 A;  2P9N C;  4Z8L A;  3RFG A;  2Z2O A;  2I0R A;  3OKY B;  3UVN A;  2OIZ A;  5EMJ B;  3NVQ A;  3I2N A;  3CFS B;  3I7P A;  4A0A A;  2AQ5 A;  2GNQ A;  3I89 A;  2HXC A;  2QXV A;  3C99 A;  3SBR A;  1B9X A;  3I8E A;  5CXC A;  3MZK A;  1K8K C;  3C5M A;  2YB8 B;  4A09 A;  2HYE A;  5IJ8 E;  2H9N A;  5TDH B;  4OWR A;  4ERZ A;  4CZV A;  2PBI B;  4PBY A;  4JXM A;  4UI9 R;  4ZOV A;  3C9C A;  4QT8 A;  1L0Q A;  4Y5R D;  4LG9 A;  3L4M D;  3I7K A;  4MK0 B;  4J78 A;  3EG6 A;  1MG2 A;  4J87 A;  1JMX B;  3UVM A;  1U2V C;  2G99 A;  5EAL A;  3J81 g;  3P4F A;  1Q47 A;  2HES X;  2YMU A;  3EI4 B;  4H5J A;  4EWR A;  4FA5 D;  3B7F A;  5AMS A;  4J73 A;  3C75 H;  4GQ2 P;  4AEZ A;  4FAV D;  4XYI A;  2QC5 A;  4ES0 A;  4E54 B;  3FM0 A;  4JT6 C;  1JJU B;  1N6D A;  4CC9 A;  2B5N A;  5FQD A;  3EI1 A;  4PBZ A;  2XYI A;  5IGQ A;  4O9D A;  3CIK B;  4A7J A;  3SVW D;  1GP2 B;  3JAM g;  4U7A A;  5I5I A;  4J79 A;  4GM9 A;  3KRX B;  5HE2 B;  3PXW D;  4CY3 A;  4A0A B;  4IA9 A;  4X61 B;  5TF2 A;  1B9Y A;  3CFV A;  3NVN A;  3I7O A;  5THA A;  5EMM B;  4A0B A;  4Y7R A;  3SHF A;  2H9L A;  5FA5 B;  1GOT B;  1FWX A;  4GM8 A;  1U4C A;  3JZN A;  3I8C A;  3SJL D;  4L3G D;  5FXY A;  5EML B;  4U1E I;  3FGB A;  2BBK H;  3F3F A;  5EAM A;  5EAR A;  4GZ8 A;  4FB1 D;  2I0S A;  4J77 A;  2XL2 A;  3N0D A;  2BCJ B;  3JRP A;  5FKT A;  3RLM D;  1GG2 B;  3EU7 A;  4CZY A;  3ULE C;  2TRC B;  3AL8 B;  1TYQ C;  2H3X A;  4IMM A;  1NR0 A;  3PE7 A;  4X3E A;  3GRE A;  5TEE A;  2P9L C;  5H1M A;  3JZH A;  4CY2 A;  3F3P A;  4PNK B;  3IJ0 A;  4O3T B;  2H9P A;  2H13 A;  3PVW B;  1PI6 A;  3PSL A;  2IAA A;  2P9K C;  2P9U C;  3UVO A;  5CYK A;  2O9K A;  4JSX C;  2HKR A;  3K27 A;  3E0C A;  4PXW A;  5EM2 A;  4GMB A;  3DSM A;  2H14 A;  3A0F A;  3VH0 A;  2GC4 A;  3BG0 A;  5CXB A;  2H6K A;  3ZWL B;  4ZOZ A;  3MKS B;  1TBG A;  1GXR A;  5EMK B;  4GGC A;  3EI3 A;  3DXM C;  5FKS A;  2J57 G;  4I79 A;  2UZX B;  3K26 A;  3UR4 A;  1SQJ A;  1XHM A;  4O45 A;  4E5Z A;  4A08 B;  4BH6 A;  2HJB A;  4GM3 A;  2H9M A;  4GQ1 A;  3MKQ A;  2MTA H;  2CE9 A;  2AGZ A;  2IUP A;  5I5J A;  3RSE C;  4CI2 A;  1A0R B;  1S4U X;  2H68 A;  2AGX A;  5TEF A;  2PM9 B;  4J8G A;  4JSN C;  5SXM A;  3SXT D;  3L4O D;  2IUR A;  4O1Q D;  4A11 A;  3OKW A;  2G9A A;  1N6F A;  2B4E A;  4BL0 A;  4J8B A;  1PBY B;  2B5M A;  2IUQ A;  3J80 g;  1OMW B;  2XU7 A;  5A2Q g;  5IT9 g;  4J81 A;  2OVP B;  3F3G A;  5GXH A;  5IJ7 E;  3SLE D;  4LG8 A;  4N14 A;  1OLZ A;  3RN0 D;  4ZN4 A;  3IIW A;  2YNO A;  3AFC A;  2P9S C;  3PVU B;  3SFZ A;  4H5I A;  4OZU A;  5H14 A;  3PSC B;  4XYH A;  3OKT A;  2OVR B;  5CXC B;  3PXS D;  4A09 B;  2IWF A;  4FA9 D;  5AFU 3;  3ODT A;  2CE8 A;  4PSX B;  4A2L A;  5GXI A;  4FA1 D;  3IIY A;  4ERQ A;  1QNI A;  1MDA H;  3RRM C;  4CI1 A;  4ESG A;  5HE0 B;  4D0K A;  3BG1 A;  2HKM A;  2OK6 A;  3N0E A;  4CI3 A;  1PGU A;  5HYN B;  3EWE A;  2HJ4 A;  3V7D B;  2J55 H;  4E5Z B;  1YFQ A;  2OK4 A;  3AH8 B;  4QL1 A;  2CNX A;  5K19 A;  4J84 A;  5I5M A;  3MZL A;  4CI8 A;  1ERJ A;  3OL2 A;  3VGZ A;  4CY5 A;  4A11 B;  5HE1 B;  3EI4 A;  3U4Y A;  3SN6 B;  4CZX A;  4X60 B;  4JSV C;  4PSW B;  3VA6 A;  4TZ4 A;  3SMR A;  3EI1 B;  4FWW A;  3HFQ A;  3BWS A;  3RFH A;  4FAN D;  3GFC A;  4E54 A;  4QQE A;  4L1Q D;  4YVD A;  2P9I C;  2I3S A;  3EMH A;  4KFM B;  4ZOX A;  5K1C C;  3MMY A;  3IJC A;  3NVX A;  4J82 A;  2H6Q A;  5JWZ A;  3OTT A;  4BUJ C;  4ERY A;  3I7L A;  5KDO B;  4A0B B;  3PXT D;  2CO0 A;  3IJ1 A;  1RI6 A;  2H47 A;  1XIP A;  2AGL A;  2P9P C;  5C2V B;  1XKS A;  1JOF A;  3EI2 A;  4R7A B;  3KRW B;  2PM6 B;  4JSP C;  3I7H A;  2PM7 B;  5B4W A;  3SBP A;  2IUV A;  2B5L A;  3JPX A;  3DXK C;  3JRO A;  2I3T A;  1R5M A;  1VYH C;  3UVL A;  3MXX A;  2Z2N A;  4JT5 C;  5C2W B;  4FA4 D;  2OJY A;  3FRX A;  2W18 A;  5IC7 A;  3IKO A;  3ORV D;  4GQB B;  4K3I D;  3I7N A;  3OL2 B;  1N6E A;  3AL8 A;  2YBA A;  2IWK A;  3AL9 A;  3V9F A;  2OVQ B;  5HQG A;  3OW8 A;  4GGA A;  4D6V A;  3RN1 D;  2Z2P A;  1MG3 A;  3JB9 L;  3OKY A;  4A2M A;  4JD2 C;  5FLX g;  5GMK n;  5CYK B;  5FKR A;  2EBS A;  1P22 A;  3UKR C;  4X63 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...