4H5IA

Crystal structure of the guanine nucleotide exchange factor sec12 (p1 form)
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
344
structure length
344
Chain Sequence
MKFVTASYNVGYPAYGAKFLNNDTLLVAGGGGEGNNGIPNKLTVLRVDPTKDTEKEQFHILSEFALEDNDDSPTAIDASKGIILVGCNENSTKITQGKGNKHLRKFKYDKVNDQLEFLTSVDFDASTNADDYTKLVYISREGTVAAIASSKVPAIMRIIDPSDLTEKFEIETRGEVKDLHFSTDGKVVAYITGSSLEVISTVTGSCIARKTDFDKNWSLSKINFIADDTVLIAASLKKGKGIVLTKISIKSGNTSVLRSKQVTNRFKGITSMDVDMKGELAVLASNDNSIALVKLKDLSMSKIFKQAHSFAITEVTISPDSTYVASVSAANTIHIIKLPLNYAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Guanine nucleotide-exchange factor SEC12
publication title The structure of sec12 implicates potassium ion coordination in sar1 activation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 83
structure length 344
sequence length 344
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4h5iA00
3GREA 3RSEC 2HKMA 4L1QD 3NVQA 4J0XA 2I0SA 3SBPA 2B4EA 5JWZA 4PXWA 4XYIA 2H9PA 4L9OA 4QQEA 3EI4A 4A0AA 4I79A 2BCJB 4H5IA 4U1EI 1JMXB 4MK0B 4PBZA 1OMWB 2PM7B 4FA9D 3UVLA 2YB8B 5IT9g 4KFMB 4CY2A 3I8EA 4BUJC 5TF2A 4JT5C 2H6QA 1FWXA 4CI3A 1SHYB 3MZLA 5H17A 4CY3A 3EMHA 4J8GA 3JPXA 4IMMA 3I7LA 2OVPB 3GFCA 2HKRA 3EI1A 1XHMA 4J82A 3RLMD 3BWSA 3F3FA 3FRXA 5FKSA 2IUQA 2H9NA 1N6EA 3SN6B 2P9PC 3UKRC 3OL2A 4Y5RD 5B4WA 4JT6C 2CE9A 3C75H 1GG2B 3PSLA 4U7AA 1MG3A 4GM3A 2P9IC 1U2VC 2MTAH 4FAND 2CO0A 3IKOA 2CN2A 3EI4B 4J78A 2P9LC 2P9NC 5EAMA 1B9YA 4J0WA 3B7FA 2I0RA 3F3GA 4ERZA 2AGZA 2P9SC 2GC4A 3OKWA 2AGLA 2XYIA 4A0BB 2QC5A 1SQ9A 1TBGA 4A09B 4ZOXA 2AGWA 3PXSD 3RN0D 3UVNA 2J57G 4K3JB 2H13A 5C2WB 2Z2OA 2GC7A 5FKQA 3ULEC 2H6KA 3A0FA 2HJBA 2H47A 2Q7QA 1XIPA 4ZOYA 2AQ5A 2CNXA 1P22A 4K3ID 3SJLD 3PVWB 2I3TA 5TEEA 2IUPA 4BL0A 3VH0A 3VGZA 2H6NA 3I2NA 3UVKA 4A08A 5I5IA 2J55H 5AJAA 1NEXB 2OJYA 4N14A 3EG6A 3N0DA 2HXCA 5THAA 5AMSA 3EI3A 3IIWA 2PM9A 5HE0B 4A11A 3IIYA 5EM2A 4CY5A 4JD2C 4GZ8A 1K8KC 4GGCA 3V9FA 2CE8A 4UI9R 3EI2B 2GNQA 5CXCA 3BG0A 5AFU3 2HYEA 4E5ZB 5FXYA 2IUVA 4YVDA 5EMJB 2XL2A 3OKYA 4PNKB 5C9ZB 4L3GD 2H68A 2B5LA 3L4OD 5CYKA 5H14A 3JZGA 5HE2B 3SMRA 4BH6A 3IJ0A 4L3HD 3V7DB 4J86A 4FWWA 2XU7A 4ZN4A 5EMMB 2XL3A 4A08B 5CXBA 1PI6A 3DXMC 4FA5D 4OZUA 3SHFA 2QXVA 3OW8A 4CZYA 1N6FA 3JB9L 3EI3B 3AL8A 4A11B 3UVOA 3SWSD 1N6DA 3NVXA 1PBYB 4JSNC 4ERQA 5FKRA 5FKTA 5TEFA 4J73A 3RRMC 2W18A 3SXTD 5IGQA 4A0AB 3I7KA 3MKQA 5EAPA 3SVWD 4PSXB 1MDAH 2BBKH 4E54A 5HQGA 4GM9A 1JMZB 3K26A 3SLED 4ERYA 3KRWB 2OIZA 5HYNB 2Z2NA 4A2MA 4CZXA 4FA4D 4LGNA 4Y7RA 2YBAA 2IAAA 3I7OA 1OLZA 4O1QD 3I8CA 2PM6B 5FQDA 3JZHA 2B5MA 1QNIA 3EI1B 2AH0A 2Z2PA 4FHLA 4GM8A 3E0CA 4X3EA 1VYHC 3UVMA 3N0EA 5IGOA 2CN3A 3OL2B 3C99A 4JSXC 2J56H 3SCYA 4ESGA 1GP2B 5SXMA 2OK4A 3C5MA 2O9KA 2EBSA 3MXXA 3PXTD 3CIKB 1MG2A 3IJCA 3SBQA 2H9LA 5GMKn 1YFQA 3PSCB 4OWRA 3UR4A 4FB1D 3CFSB 1B9XA 4QT8A 4CI2A 5EMLB 2IWKA 4J79A 4G56B 4GQBB 3DXKC 4R7AB 3F3PA 4GGAA 4FAVD 4PC0A 5C2VB 4IA9A 4LG9A 3DWLC 3U4YA 4J84A 2YNPA 4X63B 3OTTA 1PEVA 1XKSA 4JSVC 5HE1B 4TZ4A 3K27A 5KDOB 5GXHA 4HDJA 4PSWB 4O45A 5I5JA 4CZVA 3JZNA 2UZXB 3PVUB 3HFQA 2OVQB 4FA1D 3RFHA 5EMKB 3DM0A 3L4MD 5TDHB 4XEIC 3SBRA 2B5NA 4EWRA 5GXIA 4XYHA 2TRCB 3IJ1A 4JXMA 4J8BA 4LG8A 2G9AA 2H3XA 2UZYB 3ORVD 4NSXA 2I3SA 3MKSB 3P4FA 2IWFA 3ZWLB 2H14A 1R5MA 5FLXg 1GXRA 4A0BA 1Q47A 4QRJA 2PM9B 1GOTB 4CY1A 3AFCA 4ZOVA 3JAMg 4A09A 5EM2B 4GQ2P 1JJUB 4X60B 2HJ4A 5GSAA 5CXCB 3RFGA 2AGXA 2H9MA 3CFVA 3AL9A 3MZKA 1ERJA 2P9KC 3OKYB 1S4UX 5A2Qg 5HE3B 5CYKB 3PE7A 1L0QA 1U4CA 1SQJA 3J81g 3I7HA 4GMBA 2YNNA 4JSPC 5K1CC 4O3TB 4A7JA 4CC9A 3OKTA 4J87A 4CI1A 1PGUA 2AGYA 5IJ8E 4J77A 5CXBB 3FM0A 2AH1A 4O3UB 1K32A 4A2LA 3SFZA 3ODTA 4PBYA 5K19A 4Z8LA 3KRXB 2OVRB 4ES0A 3JRPA 3AL8B 3EWEA 4AEZA 3FGBA 3VA6A 3AH8B 2P9UC 2PBIB 2OK6A 3V5WB 4X61B 2G99A 3EI2A 5H1MA 4GQ1A 1RI6A 1JOFA 4D0KA 3I7NA 4E5ZA 4E54B 4D6VA 4H5JA 4AOWA 4GGDA 2YNOA 3UKUC 3C9CA 3W15A 3BG1A 3I7PA 2CO0C 3RN1D 2IURA 5EARA 4ZOZA 4O9DA 3JROA 3NVNA 1A0RB 1NR0A 5IJ7E 4QL1A 3DSMA 3I89A 3PXWD 4J81A 3J80g 3MMYA 5EALA 5IC7A 5FA5B 2HESX 1TYQC 4CI8A 5I5MA 3EU7A 3RMZD 2I0TA 2YMUA
chains in the Genus database with same CATH superfamily
4L1MA 4DNWA 3GREA 3V4PA 3RSEC 2HKMA 2EICA 4L1QD 3NVQA 4J0XA 2I0SA 3SBPA 2B4EA 5JWZA 4PXWA 1E8NA 4RE6A 4XYIA 2H9PA 4L9OA 3IUNA 4QQEA 3EI4A 4A0AA 4I79A 2BCJB 4H5IA 3O4IA 1O6GA 4U1EI 1L5GA 1JMXB 4MK0B 4PBZA 1OMWB 2PM7B 3EQ9A 4FA9D 3UVLA 2YB8B 5IT9g 4KFMB 4CY2A 3I8EA 4BUJC 5TF2A 4JT5C 2H6QA 1FWXA 2VDQA 1SHYB 3MZLA 5H17A 4CI3A 4CY3A 3EMHA 4J8GA 3JPXA 4IMMA 1QFSA 3I7LA 2OVPB 3EQ7A 3GFCA 2HKRA 5HDBA 3EI1A 1XHMA 4J82A 3RLMD 3BWSA 3F3FA 3FRXA 5FKSA 2IUQA 2H9NA 1N6EA 1YR2A 3SN6B 2P9PC 3UKRC 4O02A 3OL2A 3FCUA 4Y5RD 5B4WA 1VE7A 4JT6C 1T2XA 2CE9A 3DDUA 5E6UA 3C75H 1GG2B 3PSLA 4U7AA 1MG3A 1JTDB 4GM3A 2P9IC 1U2VC 2MTAH 4FAND 1K3IA 2CO0A 1H2XA 3IKOA 2CN2A 3EI4B 4J78A 2P9LC 2P9NC 5EAMA 4Z7QA 1B9YA 4J0WA 2WQ8A 3B7FA 5M61A 5M5VA 2I0RA 3F3GA 4ERZA 2AGZA 2P9SC 3FCSA 2GC4A 3OKWA 4BP9A 2AGLA 2XYIA 2QR5A 4A0BB 2QC5A 1SQ9A 2XE4A 1TBGA 4A09B 4ZOXA 2AGWA 3PXSD 3RN0D 3UVNA 2J57G 4K3JB 2H13A 4BCDA 5C2WB 2Z2OA 2GC7A 4Z7OA 5FKQA 3ULEC 2H6KA 3A0FA 2HJBA 2H47A 2Q7QA 2VDOA 1XIPA 4BCBA 2VZ3A 3NIFA 4ZOYA 2AQ5A 1A12A 2CNXA 1P22A 3T3MA 4K3ID 3SJLD 3IURA 4MMYA 4RE5A 1UTCA 3PVWB 2I3TA 5TEEA 2IUPA 4BL0A 3MVDK 3VH0A 3VGZA 2H6NA 3I2NA 3UVKA 1VZ3A 4NC4A 4A08A 5I5IA 2J55H 5AJAA 1NEXB 2OJYA 4N14A 3EG6A 3N0DA 2HXCA 5THAA 5AMSA 3EI3A 5FFGA 3IIWA 2PM9A 5HE0B 4A11A 3NIGA 3IIYA 2QZPA 2VDNA 4WK2A 5EM2A 4CY5A 4JD2C 1JV2A 1K8KC 4GGCA 4GZ8A 2CE8A 3V9FA 4UI9R 3EI2B 2GNQA 5CXCA 3BG0A 4WK4A 5AFU3 1H2YA 2HYEA 4E5ZB 5FXYA 2IUVA 4YVDA 5EMJB 2XL2A 3OKYA 4PNKB 5C9ZB 4L3GD 3IUMA 2JKXA 2H68A 2B5LA 3L4OD 5CYKA 5H14A 4AN0A 4MMXA 3JZGA 5HE2B 3SMRA 4BH6A 3IJ0A 4L3HD 3V7DB 3GC3B 4J86A 4FWWA 4JHNA 2XU7A 4ZN4A 5EMMB 2XL3A 4AX4A 5CXBA 4BP8A 1PI6A 3DXMC 4D9SA 4FA5D 4A08B 4OZUA 3SHFA 2QXVA 4BCCA 3OW8A 4NENA 1N6FA 4CZYA 3K6SA 1U8CA 3JB9L 1C9IA 3EI3B 3AL8A 4A11B 4DNUA 3UVOA 3SWSD 3ZE0A 1N6DA 3NVXA 1PBYB 4JSNC 4ERQA 5FKRA 3VI3A 3ZE1A 1GOGA 5FKTA 5TEFA 4J73A 3RRMC 2W18A 3SXTD 2VDLA 3ZDXA 3I7KA 3MKQA 4JHPC 5EAPA 5IGQA 3SVWD 4PSXB 1MDAH 2BBKH 4E54A 5HQGA 4GM9A 1JMZB 3K26A 3SLED 4ERYA 1UOPA 3KRWB 1E5TA 2OIZA 5HYNB 4NBMA 4Z7NA 2Z2NA 2VDPA 4A2MA 3OF7A 4CZXA 1TYEA 4FA4D 4LGNA 2VC2A 3GD1I 4Y7RA 2YBAA 2HU8A 2IAAA 1OLZA 3I7OA 4O1QD 4UM9A 4DNVA 3I8CA 2PM6B 5FQDA 3JZHA 2B5MA 1QNIA 3EI1B 3IJEA 2AH0A 2Z2PA 5C86A 4FHLA 4GM8A 3E0CA 4X3EA 1VYHC 2VDMA 4G55A 3UVMA 4G1MA 3N0EA 5IGOA 2CN3A 3OL2B 3C99A 1E8MA 2J56H 4JSXC 1H2ZA 3IUJA 3SCYA 4ESGA 1GP2B 5SXMA 2VDKA 5M5RA 3MUNA 2OK4A 3T3PA 3C5MA 2O9KA 2EBSA 1UOOA 3MXXA 3PXTD 4A0AB 3CIKB 1MG2A 3IJCA 3SBQA 2H9LA 5GMKn 1YFQA 3PSCB 4OWRA 3UR4A 4FB1D 3CFSB 1B9XA 4QT8A 4CI2A 1H2WA 5EMLB 2IWKA 4J79A 4G56B 4GQBB 3DXKC 4R7AB 3F3PA 4GGAA 4FAVD 4PC0A 4AMYA 5C2VB 1I2MB 4IA9A 4LG9A 3DWLC 3U4YA 4J84A 2YNPA 4X63B 3OTTA 5M5TA 1O6FA 1PEVA 1XKSA 4JSVC 5HE1B 4TZ4A 3K27A 5KDOB 2EIEA 3ZDYA 5GXHA 4HDJA 4PSWB 4O45A 2XZGA 5I5JA 4CZVA 4WK0A 3JZNA 2UZXB 3PVUB 3HFQA 2OVQB 4QAMA 4FA1D 3RFHA 5EMKB 3DM0A 3L4MD 5TDHB 3QHYB 4XEIC 3SBRA 2B5NA 4EWRA 4WJKA 5GXIA 3IVMA 4XYHA 2TRCB 3IJ1A 4JXMA 4J8BA 4LG8A 2G9AA 4O2WA 2VDRA 3IULA 2H3XA 2UZYB 3ORVD 4NSXA 4AMZA 2I3SA 5M5SA 3KCIA 3MKSB 3P4FA 2IWFA 3NIDA 3ZWLB 2H14A 1R5MA 5FLXg 1M1XA 1GXRA 4A0BA 1Q47A 4QRJA 2PM9B 1GOTB 4CY1A 3AFCA 4ZOVA 3JAMg 1VZ2A 4A09A 5EM2B 4GQ2P 2HU7A 1JJUB 3MUOA 2HJ4A 4X60B 5GSAA 2VZ1A 2HU5A 5C92A 5M5UA 5CXCB 1QFMA 3RFGA 3K71A 2AGXA 2H9MA 3CFVA 3AL9A 1VE6A 2EIDA 3MZKA 1ERJA 3V4VA 1GOFA 4MMZA 1UOQA 2P9KC 3O4HA 3OKYB 1S4UX 5A2Qg 5HE3B 3EQ8A 5CYKB 3PE7A 1L0QA 1U4CA 1SQJA 3J81g 3I7HA 4GMBA 2YNNA 4JSPC 5K1CC 4IRZA 4O3TB 4A7JA 3O4JA 4CC9A 2BKLA 3OKTA 4J87A 4CI1A 1PGUA 2AGYA 5IJ8E 4AN1A 2EIBA 4J77A 5CXBB 5E6RA 3FM0A 2AH1A 4O3UB 1K32A 4A2LA 3SFZA 3ODTA 4PBYA 5K19A 4Z8LA 3KRXB 2OVRB 4ES0A 3JRPA 3AL8B 3EWEA 4AEZA 3FGBA 3VA6A 3AH8B 1C9LA 2P9UC 4G1EA 2PBIB 2OK6A 3V5WB 4X61B 1GOHA 2G99A 3EI2A 5H1MA 4GQ1A 3ZE2A 1RI6A 1BPOA 1JOFA 4D0KA 3I7NA 4E5ZA 4E54B 4D6VA 4H5JA 4AOWA 4GGDA 2YNOA 3UKUC 3C9CA 4NAAA 3K72A 3ZDZA 3W15A 3BG1A 3QI0A 3I7PA 2CO0C 3RN1D 2IURA 5EARA 4ZOZA 4O9DA 3JROA 3NVNA 1A0RB 1NR0A 5IJ7E 2XDWA 3O4GA 4QL1A 3VI4A 3DSMA 3I89A 3PXWD 4J81A 5E6SA 3J80g 3MMYA 3IUQA 5EALA 5IC7A 5FFOA 4UM8A 5FA5B 2HESX 1TYQC 4CI8A 5I5MA 3EU7A 3RMZD 2I0TA 2YMUA
chains in the Genus database with same CATH topology
3GREA 3RSEC 2HKMA 4L1QD 3NVQA 4J0XA 2I0SA 3SBPA 2B4EA 5JWZA 4PXWA 4XYIA 2H9PA 4L9OA 4QQEA 3EI4A 4A0AA 4I79A 2BCJB 4H5IA 4U1EI 1JMXB 4MK0B 4PBZA 1OMWB 2PM7B 4FA9D 3UVLA 2YB8B 5IT9g 4KFMB 4CY2A 3I8EA 4BUJC 5TF2A 4JT5C 2H6QA 1FWXA 4CI3A 1SHYB 3MZLA 5H17A 4CY3A 3EMHA 4J8GA 3JPXA 4IMMA 3I7LA 2OVPB 3GFCA 2HKRA 3EI1A 1XHMA 4J82A 3RLMD 3BWSA 3F3FA 3FRXA 5FKSA 2IUQA 2H9NA 1N6EA 3SN6B 2P9PC 3UKRC 3OL2A 4Y5RD 5B4WA 4JT6C 2CE9A 3C75H 1GG2B 3PSLA 4U7AA 1MG3A 4GM3A 2P9IC 1U2VC 2MTAH 4FAND 2CO0A 3IKOA 2CN2A 3EI4B 4J78A 2P9LC 2P9NC 5EAMA 1B9YA 4J0WA 3B7FA 2I0RA 3F3GA 4ERZA 2AGZA 2P9SC 2GC4A 3OKWA 2AGLA 2XYIA 4A0BB 2QC5A 1SQ9A 1TBGA 4A09B 4ZOXA 2AGWA 3PXSD 3RN0D 3UVNA 2J57G 4K3JB 2H13A 5C2WB 2Z2OA 2GC7A 5FKQA 3ULEC 2H6KA 3A0FA 2HJBA 2H47A 2Q7QA 1XIPA 4ZOYA 2AQ5A 2CNXA 1P22A 4K3ID 3SJLD 3PVWB 2I3TA 5TEEA 2IUPA 4BL0A 3VH0A 3VGZA 2H6NA 3I2NA 3UVKA 4A08A 5I5IA 2J55H 5AJAA 1NEXB 2OJYA 4N14A 3EG6A 3N0DA 2HXCA 5THAA 5AMSA 3EI3A 3IIWA 2PM9A 5HE0B 4A11A 3IIYA 5EM2A 4CY5A 4JD2C 4GZ8A 1K8KC 4GGCA 3V9FA 2CE8A 4UI9R 3EI2B 2GNQA 5CXCA 3BG0A 5AFU3 2HYEA 4E5ZB 5FXYA 2IUVA 4YVDA 5EMJB 2XL2A 3OKYA 4PNKB 5C9ZB 4L3GD 2H68A 2B5LA 3L4OD 5CYKA 5H14A 3JZGA 5HE2B 3SMRA 4BH6A 3IJ0A 4L3HD 3V7DB 4J86A 4FWWA 2XU7A 4ZN4A 5EMMB 2XL3A 4A08B 5CXBA 1PI6A 3DXMC 4FA5D 4OZUA 3SHFA 2QXVA 3OW8A 4CZYA 1N6FA 3JB9L 3EI3B 3AL8A 4A11B 3UVOA 3SWSD 1N6DA 3NVXA 1PBYB 4JSNC 4ERQA 5FKRA 5FKTA 5TEFA 4J73A 3RRMC 2W18A 3SXTD 5IGQA 4A0AB 3I7KA 3MKQA 5EAPA 3SVWD 4PSXB 1MDAH 2BBKH 4E54A 5HQGA 4GM9A 1JMZB 3K26A 3SLED 4ERYA 3KRWB 2OIZA 5HYNB 2Z2NA 4A2MA 4CZXA 4FA4D 4LGNA 4Y7RA 2YBAA 2IAAA 3I7OA 1OLZA 4O1QD 3I8CA 2PM6B 5FQDA 3JZHA 2B5MA 1QNIA 3EI1B 2AH0A 2Z2PA 4FHLA 4GM8A 3E0CA 4X3EA 1VYHC 3UVMA 3N0EA 5IGOA 2CN3A 3OL2B 3C99A 4JSXC 2J56H 3SCYA 4ESGA 1GP2B 5SXMA 2OK4A 3C5MA 2O9KA 2EBSA 3MXXA 3PXTD 3CIKB 1MG2A 3IJCA 3SBQA 2H9LA 5GMKn 1YFQA 3PSCB 4OWRA 3UR4A 4FB1D 3CFSB 1B9XA 4QT8A 4CI2A 5EMLB 2IWKA 4J79A 4G56B 4GQBB 3DXKC 4R7AB 3F3PA 4GGAA 4FAVD 4PC0A 5C2VB 4IA9A 4LG9A 3DWLC 3U4YA 4J84A 2YNPA 4X63B 3OTTA 1PEVA 1XKSA 4JSVC 5HE1B 4TZ4A 3K27A 5KDOB 5GXHA 4HDJA 4PSWB 4O45A 5I5JA 4CZVA 3JZNA 2UZXB 3PVUB 3HFQA 2OVQB 4FA1D 3RFHA 5EMKB 3DM0A 3L4MD 5TDHB 4XEIC 3SBRA 2B5NA 4EWRA 5GXIA 4XYHA 2TRCB 3IJ1A 4JXMA 4J8BA 4LG8A 2G9AA 2H3XA 2UZYB 3ORVD 4NSXA 2I3SA 3MKSB 3P4FA 2IWFA 3ZWLB 2H14A 1R5MA 5FLXg 1GXRA 4A0BA 1Q47A 4QRJA 2PM9B 1GOTB 4CY1A 3AFCA 4ZOVA 3JAMg 4A09A 5EM2B 4GQ2P 1JJUB 4X60B 2HJ4A 5GSAA 5CXCB 3RFGA 2AGXA 2H9MA 3CFVA 3AL9A 3MZKA 1ERJA 2P9KC 3OKYB 1S4UX 5A2Qg 5HE3B 5CYKB 3PE7A 1L0QA 1U4CA 1SQJA 3J81g 3I7HA 4GMBA 2YNNA 4JSPC 5K1CC 4O3TB 4A7JA 4CC9A 3OKTA 4J87A 4CI1A 1PGUA 2AGYA 5IJ8E 4J77A 5CXBB 3FM0A 2AH1A 4O3UB 1K32A 4A2LA 3SFZA 3ODTA 4PBYA 5K19A 4Z8LA 3KRXB 2OVRB 4ES0A 3JRPA 3AL8B 3EWEA 4AEZA 3FGBA 3VA6A 3AH8B 2P9UC 2PBIB 2OK6A 3V5WB 4X61B 2G99A 3EI2A 5H1MA 4GQ1A 1RI6A 1JOFA 4D0KA 3I7NA 4E5ZA 4E54B 4D6VA 4H5JA 4AOWA 4GGDA 2YNOA 3UKUC 3C9CA 3W15A 3BG1A 3I7PA 2CO0C 3RN1D 2IURA 5EARA 4ZOZA 4O9DA 3JROA 3NVNA 1A0RB 1NR0A 5IJ7E 4QL1A 3DSMA 3I89A 3PXWD 4J81A 3J80g 3MMYA 5EALA 5IC7A 5FA5B 2HESX 1TYQC 4CI8A 5I5MA 3EU7A 3RMZD 2I0TA 2YMUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GRE A;  3RSE C;  2HKM A;  4L1Q D;  3NVQ A;  4J0X A;  2I0S A;  3SBP A;  2B4E A;  5JWZ A;  4PXW A;  4XYI A;  2H9P A;  4L9O A;  4QQE A;  3EI4 A;  4A0A A;  4I79 A;  2BCJ B;  4H5I A;  4U1E I;  1JMX B;  4MK0 B;  4PBZ A;  1OMW B;  2PM7 B;  4FA9 D;  3UVL A;  2YB8 B;  5IT9 g;  4KFM B;  4CY2 A;  3I8E A;  4BUJ C;  5TF2 A;  4JT5 C;  2H6Q A;  1FWX A;  4CI3 A;  1SHY B;  3MZL A;  5H17 A;  4CY3 A;  3EMH A;  4J8G A;  3JPX A;  4IMM A;  3I7L A;  2OVP B;  3GFC A;  2HKR A;  3EI1 A;  1XHM A;  4J82 A;  3RLM D;  3BWS A;  3F3F A;  3FRX A;  5FKS A;  2IUQ A;  2H9N A;  1N6E A;  3SN6 B;  2P9P C;  3UKR C;  3OL2 A;  4Y5R D;  5B4W A;  4JT6 C;  2CE9 A;  3C75 H;  1GG2 B;  3PSL A;  4U7A A;  1MG3 A;  4GM3 A;  2P9I C;  1U2V C;  2MTA H;  4FAN D;  2CO0 A;  3IKO A;  2CN2 A;  3EI4 B;  4J78 A;  2P9L C;  2P9N C;  5EAM A;  1B9Y A;  4J0W A;  3B7F A;  2I0R A;  3F3G A;  4ERZ A;  2AGZ A;  2P9S C;  2GC4 A;  3OKW A;  2AGL A;  2XYI A;  4A0B B;  2QC5 A;  1SQ9 A;  1TBG A;  4A09 B;  4ZOX A;  2AGW A;  3PXS D;  3RN0 D;  3UVN A;  2J57 G;  4K3J B;  2H13 A;  5C2W B;  2Z2O A;  2GC7 A;  5FKQ A;  3ULE C;  2H6K A;  3A0F A;  2HJB A;  2H47 A;  2Q7Q A;  1XIP A;  4ZOY A;  2AQ5 A;  2CNX A;  1P22 A;  4K3I D;  3SJL D;  3PVW B;  2I3T A;  5TEE A;  2IUP A;  4BL0 A;  3VH0 A;  3VGZ A;  2H6N A;  3I2N A;  3UVK A;  4A08 A;  5I5I A;  2J55 H;  5AJA A;  1NEX B;  2OJY A;  4N14 A;  3EG6 A;  3N0D A;  2HXC A;  5THA A;  5AMS A;  3EI3 A;  3IIW A;  2PM9 A;  5HE0 B;  4A11 A;  3IIY A;  5EM2 A;  4CY5 A;  4JD2 C;  4GZ8 A;  1K8K C;  4GGC A;  3V9F A;  2CE8 A;  4UI9 R;  3EI2 B;  2GNQ A;  5CXC A;  3BG0 A;  5AFU 3;  2HYE A;  4E5Z B;  5FXY A;  2IUV A;  4YVD A;  5EMJ B;  2XL2 A;  3OKY A;  4PNK B;  5C9Z B;  4L3G D;  2H68 A;  2B5L A;  3L4O D;  5CYK A;  5H14 A;  3JZG A;  5HE2 B;  3SMR A;  4BH6 A;  3IJ0 A;  4L3H D;  3V7D B;  4J86 A;  4FWW A;  2XU7 A;  4ZN4 A;  5EMM B;  2XL3 A;  4A08 B;  5CXB A;  1PI6 A;  3DXM C;  4FA5 D;  4OZU A;  3SHF A;  2QXV A;  3OW8 A;  4CZY A;  1N6F A;  3JB9 L;  3EI3 B;  3AL8 A;  4A11 B;  3UVO A;  3SWS D;  1N6D A;  3NVX A;  1PBY B;  4JSN C;  4ERQ A;  5FKR A;  5FKT A;  5TEF A;  4J73 A;  3RRM C;  2W18 A;  3SXT D;  5IGQ A;  4A0A B;  3I7K A;  3MKQ A;  5EAP A;  3SVW D;  4PSX B;  1MDA H;  2BBK H;  4E54 A;  5HQG A;  4GM9 A;  1JMZ B;  3K26 A;  3SLE D;  4ERY A;  3KRW B;  2OIZ A;  5HYN B;  2Z2N A;  4A2M A;  4CZX A;  4FA4 D;  4LGN A;  4Y7R A;  2YBA A;  2IAA A;  3I7O A;  1OLZ A;  4O1Q D;  3I8C A;  2PM6 B;  5FQD A;  3JZH A;  2B5M A;  1QNI A;  3EI1 B;  2AH0 A;  2Z2P A;  4FHL A;  4GM8 A;  3E0C A;  4X3E A;  1VYH C;  3UVM A;  3N0E A;  5IGO A;  2CN3 A;  3OL2 B;  3C99 A;  4JSX C;  2J56 H;  3SCY A;  4ESG A;  1GP2 B;  5SXM A;  2OK4 A;  3C5M A;  2O9K A;  2EBS A;  3MXX A;  3PXT D;  3CIK B;  1MG2 A;  3IJC A;  3SBQ A;  2H9L A;  5GMK n;  1YFQ A;  3PSC B;  4OWR A;  3UR4 A;  4FB1 D;  3CFS B;  1B9X A;  4QT8 A;  4CI2 A;  5EML B;  2IWK A;  4J79 A;  4G56 B;  4GQB B;  3DXK C;  4R7A B;  3F3P A;  4GGA A;  4FAV D;  4PC0 A;  5C2V B;  4IA9 A;  4LG9 A;  3DWL C;  3U4Y A;  4J84 A;  2YNP A;  4X63 B;  3OTT A;  1PEV A;  1XKS A;  4JSV C;  5HE1 B;  4TZ4 A;  3K27 A;  5KDO B;  5GXH A;  4HDJ A;  4PSW B;  4O45 A;  5I5J A;  4CZV A;  3JZN A;  2UZX B;  3PVU B;  3HFQ A;  2OVQ B;  4FA1 D;  3RFH A;  5EMK B;  3DM0 A;  3L4M D;  5TDH B;  4XEI C;  3SBR A;  2B5N A;  4EWR A;  5GXI A;  4XYH A;  2TRC B;  3IJ1 A;  4JXM A;  4J8B A;  4LG8 A;  2G9A A;  2H3X A;  2UZY B;  3ORV D;  4NSX A;  2I3S A;  3MKS B;  3P4F A;  2IWF A;  3ZWL B;  2H14 A;  1R5M A;  5FLX g;  1GXR A;  4A0B A;  1Q47 A;  4QRJ A;  2PM9 B;  1GOT B;  4CY1 A;  3AFC A;  4ZOV A;  3JAM g;  4A09 A;  5EM2 B;  4GQ2 P;  1JJU B;  4X60 B;  2HJ4 A;  5GSA A;  5CXC B;  3RFG A;  2AGX A;  2H9M A;  3CFV A;  3AL9 A;  3MZK A;  1ERJ A;  2P9K C;  3OKY B;  1S4U X;  5A2Q g;  5HE3 B;  5CYK B;  3PE7 A;  1L0Q A;  1U4C A;  1SQJ A;  3J81 g;  3I7H A;  4GMB A;  2YNN A;  4JSP C;  5K1C C;  4O3T B;  4A7J A;  4CC9 A;  3OKT A;  4J87 A;  4CI1 A;  1PGU A;  2AGY A;  5IJ8 E;  4J77 A;  5CXB B;  3FM0 A;  2AH1 A;  4O3U B;  1K32 A;  4A2L A;  3SFZ A;  3ODT A;  4PBY A;  5K19 A;  4Z8L A;  3KRX B;  2OVR B;  4ES0 A;  3JRP A;  3AL8 B;  3EWE A;  4AEZ A;  3FGB A;  3VA6 A;  3AH8 B;  2P9U C;  2PBI B;  2OK6 A;  3V5W B;  4X61 B;  2G99 A;  3EI2 A;  5H1M A;  4GQ1 A;  1RI6 A;  1JOF A;  4D0K A;  3I7N A;  4E5Z A;  4E54 B;  4D6V A;  4H5J A;  4AOW A;  4GGD A;  2YNO A;  3UKU C;  3C9C A;  3W15 A;  3BG1 A;  3I7P A;  2CO0 C;  3RN1 D;  2IUR A;  5EAR A;  4ZOZ A;  4O9D A;  3JRO A;  3NVN A;  1A0R B;  1NR0 A;  5IJ7 E;  4QL1 A;  3DSM A;  3I89 A;  3PXW D;  4J81 A;  3J80 g;  3MMY A;  5EAL A;  5IC7 A;  5FA5 B;  2HES X;  1TYQ C;  4CI8 A;  5I5M A;  3EU7 A;  3RMZ D;  2I0T A;  2YMU A; 
#chains in the Genus database with same CATH topology
 4L1M A;  4DNW A;  3GRE A;  3V4P A;  3RSE C;  2HKM A;  2EIC A;  4L1Q D;  3NVQ A;  4J0X A;  2I0S A;  3SBP A;  2B4E A;  5JWZ A;  4PXW A;  1E8N A;  4RE6 A;  4XYI A;  2H9P A;  4L9O A;  3IUN A;  4QQE A;  3EI4 A;  4A0A A;  4I79 A;  2BCJ B;  4H5I A;  3O4I A;  1O6G A;  4U1E I;  1L5G A;  1JMX B;  4MK0 B;  4PBZ A;  1OMW B;  2PM7 B;  3EQ9 A;  4FA9 D;  3UVL A;  2YB8 B;  5IT9 g;  4KFM B;  4CY2 A;  3I8E A;  4BUJ C;  5TF2 A;  4JT5 C;  2H6Q A;  1FWX A;  2VDQ A;  1SHY B;  3MZL A;  5H17 A;  4CI3 A;  4CY3 A;  3EMH A;  4J8G A;  3JPX A;  4IMM A;  1QFS A;  3I7L A;  2OVP B;  3EQ7 A;  3GFC A;  2HKR A;  5HDB A;  3EI1 A;  1XHM A;  4J82 A;  3RLM D;  3BWS A;  3F3F A;  3FRX A;  5FKS A;  2IUQ A;  2H9N A;  1N6E A;  1YR2 A;  3SN6 B;  2P9P C;  3UKR C;  4O02 A;  3OL2 A;  3FCU A;  4Y5R D;  5B4W A;  1VE7 A;  4JT6 C;  1T2X A;  2CE9 A;  3DDU A;  5E6U A;  3C75 H;  1GG2 B;  3PSL A;  4U7A A;  1MG3 A;  1JTD B;  4GM3 A;  2P9I C;  1U2V C;  2MTA H;  4FAN D;  1K3I A;  2CO0 A;  1H2X A;  3IKO A;  2CN2 A;  3EI4 B;  4J78 A;  2P9L C;  2P9N C;  5EAM A;  4Z7Q A;  1B9Y A;  4J0W A;  2WQ8 A;  3B7F A;  5M61 A;  5M5V A;  2I0R A;  3F3G A;  4ERZ A;  2AGZ A;  2P9S C;  3FCS A;  2GC4 A;  3OKW A;  4BP9 A;  2AGL A;  2XYI A;  2QR5 A;  4A0B B;  2QC5 A;  1SQ9 A;  2XE4 A;  1TBG A;  4A09 B;  4ZOX A;  2AGW A;  3PXS D;  3RN0 D;  3UVN A;  2J57 G;  4K3J B;  2H13 A;  4BCD A;  5C2W B;  2Z2O A;  2GC7 A;  4Z7O A;  5FKQ A;  3ULE C;  2H6K A;  3A0F A;  2HJB A;  2H47 A;  2Q7Q A;  2VDO A;  1XIP A;  4BCB A;  2VZ3 A;  3NIF A;  4ZOY A;  2AQ5 A;  1A12 A;  2CNX A;  1P22 A;  3T3M A;  4K3I D;  3SJL D;  3IUR A;  4MMY A;  4RE5 A;  1UTC A;  3PVW B;  2I3T A;  5TEE A;  2IUP A;  4BL0 A;  3MVD K;  3VH0 A;  3VGZ A;  2H6N A;  3I2N A;  3UVK A;  1VZ3 A;  4NC4 A;  4A08 A;  5I5I A;  2J55 H;  5AJA A;  1NEX B;  2OJY A;  4N14 A;  3EG6 A;  3N0D A;  2HXC A;  5THA A;  5AMS A;  3EI3 A;  5FFG A;  3IIW A;  2PM9 A;  5HE0 B;  4A11 A;  3NIG A;  3IIY A;  2QZP A;  2VDN A;  4WK2 A;  5EM2 A;  4CY5 A;  4JD2 C;  1JV2 A;  1K8K C;  4GGC A;  4GZ8 A;  2CE8 A;  3V9F A;  4UI9 R;  3EI2 B;  2GNQ A;  5CXC A;  3BG0 A;  4WK4 A;  5AFU 3;  1H2Y A;  2HYE A;  4E5Z B;  5FXY A;  2IUV A;  4YVD A;  5EMJ B;  2XL2 A;  3OKY A;  4PNK B;  5C9Z B;  4L3G D;  3IUM A;  2JKX A;  2H68 A;  2B5L A;  3L4O D;  5CYK A;  5H14 A;  4AN0 A;  4MMX A;  3JZG A;  5HE2 B;  3SMR A;  4BH6 A;  3IJ0 A;  4L3H D;  3V7D B;  3GC3 B;  4J86 A;  4FWW A;  4JHN A;  2XU7 A;  4ZN4 A;  5EMM B;  2XL3 A;  4AX4 A;  5CXB A;  4BP8 A;  1PI6 A;  3DXM C;  4D9S A;  4FA5 D;  4A08 B;  4OZU A;  3SHF A;  2QXV A;  4BCC A;  3OW8 A;  4NEN A;  1N6F A;  4CZY A;  3K6S A;  1U8C A;  3JB9 L;  1C9I A;  3EI3 B;  3AL8 A;  4A11 B;  4DNU A;  3UVO A;  3SWS D;  3ZE0 A;  1N6D A;  3NVX A;  1PBY B;  4JSN C;  4ERQ A;  5FKR A;  3VI3 A;  3ZE1 A;  1GOG A;  5FKT A;  5TEF A;  4J73 A;  3RRM C;  2W18 A;  3SXT D;  2VDL A;  3ZDX A;  3I7K A;  3MKQ A;  4JHP C;  5EAP A;  5IGQ A;  3SVW D;  4PSX B;  1MDA H;  2BBK H;  4E54 A;  5HQG A;  4GM9 A;  1JMZ B;  3K26 A;  3SLE D;  4ERY A;  1UOP A;  3KRW B;  1E5T A;  2OIZ A;  5HYN B;  4NBM A;  4Z7N A;  2Z2N A;  2VDP A;  4A2M A;  3OF7 A;  4CZX A;  1TYE A;  4FA4 D;  4LGN A;  2VC2 A;  3GD1 I;  4Y7R A;  2YBA A;  2HU8 A;  2IAA A;  1OLZ A;  3I7O A;  4O1Q D;  4UM9 A;  4DNV A;  3I8C A;  2PM6 B;  5FQD A;  3JZH A;  2B5M A;  1QNI A;  3EI1 B;  3IJE A;  2AH0 A;  2Z2P A;  5C86 A;  4FHL A;  4GM8 A;  3E0C A;  4X3E A;  1VYH C;  2VDM A;  4G55 A;  3UVM A;  4G1M A;  3N0E A;  5IGO A;  2CN3 A;  3OL2 B;  3C99 A;  1E8M A;  2J56 H;  4JSX C;  1H2Z A;  3IUJ A;  3SCY A;  4ESG A;  1GP2 B;  5SXM A;  2VDK A;  5M5R A;  3MUN A;  2OK4 A;  3T3P A;  3C5M A;  2O9K A;  2EBS A;  1UOO A;  3MXX A;  3PXT D;  4A0A B;  3CIK B;  1MG2 A;  3IJC A;  3SBQ A;  2H9L A;  5GMK n;  1YFQ A;  3PSC B;  4OWR A;  3UR4 A;  4FB1 D;  3CFS B;  1B9X A;  4QT8 A;  4CI2 A;  1H2W A;  5EML B;  2IWK A;  4J79 A;  4G56 B;  4GQB B;  3DXK C;  4R7A B;  3F3P A;  4GGA A;  4FAV D;  4PC0 A;  4AMY A;  5C2V B;  1I2M B;  4IA9 A;  4LG9 A;  3DWL C;  3U4Y A;  4J84 A;  2YNP A;  4X63 B;  3OTT A;  5M5T A;  1O6F A;  1PEV A;  1XKS A;  4JSV C;  5HE1 B;  4TZ4 A;  3K27 A;  5KDO B;  2EIE A;  3ZDY A;  5GXH A;  4HDJ A;  4PSW B;  4O45 A;  2XZG A;  5I5J A;  4CZV A;  4WK0 A;  3JZN A;  2UZX B;  3PVU B;  3HFQ A;  2OVQ B;  4QAM A;  4FA1 D;  3RFH A;  5EMK B;  3DM0 A;  3L4M D;  5TDH B;  3QHY B;  4XEI C;  3SBR A;  2B5N A;  4EWR A;  4WJK A;  5GXI A;  3IVM A;  4XYH A;  2TRC B;  3IJ1 A;  4JXM A;  4J8B A;  4LG8 A;  2G9A A;  4O2W A;  2VDR A;  3IUL A;  2H3X A;  2UZY B;  3ORV D;  4NSX A;  4AMZ A;  2I3S A;  5M5S A;  3KCI A;  3MKS B;  3P4F A;  2IWF A;  3NID A;  3ZWL B;  2H14 A;  1R5M A;  5FLX g;  1M1X A;  1GXR A;  4A0B A;  1Q47 A;  4QRJ A;  2PM9 B;  1GOT B;  4CY1 A;  3AFC A;  4ZOV A;  3JAM g;  1VZ2 A;  4A09 A;  5EM2 B;  4GQ2 P;  2HU7 A;  1JJU B;  3MUO A;  2HJ4 A;  4X60 B;  5GSA A;  2VZ1 A;  2HU5 A;  5C92 A;  5M5U A;  5CXC B;  1QFM A;  3RFG A;  3K71 A;  2AGX A;  2H9M A;  3CFV A;  3AL9 A;  1VE6 A;  2EID A;  3MZK A;  1ERJ A;  3V4V A;  1GOF A;  4MMZ A;  1UOQ A;  2P9K C;  3O4H A;  3OKY B;  1S4U X;  5A2Q g;  5HE3 B;  3EQ8 A;  5CYK B;  3PE7 A;  1L0Q A;  1U4C A;  1SQJ A;  3J81 g;  3I7H A;  4GMB A;  2YNN A;  4JSP C;  5K1C C;  4IRZ A;  4O3T B;  4A7J A;  3O4J A;  4CC9 A;  2BKL A;  3OKT A;  4J87 A;  4CI1 A;  1PGU A;  2AGY A;  5IJ8 E;  4AN1 A;  2EIB A;  4J77 A;  5CXB B;  5E6R A;  3FM0 A;  2AH1 A;  4O3U B;  1K32 A;  4A2L A;  3SFZ A;  3ODT A;  4PBY A;  5K19 A;  4Z8L A;  3KRX B;  2OVR B;  4ES0 A;  3JRP A;  3AL8 B;  3EWE A;  4AEZ A;  3FGB A;  3VA6 A;  3AH8 B;  1C9L A;  2P9U C;  4G1E A;  2PBI B;  2OK6 A;  3V5W B;  4X61 B;  1GOH A;  2G99 A;  3EI2 A;  5H1M A;  4GQ1 A;  3ZE2 A;  1RI6 A;  1BPO A;  1JOF A;  4D0K A;  3I7N A;  4E5Z A;  4E54 B;  4D6V A;  4H5J A;  4AOW A;  4GGD A;  2YNO A;  3UKU C;  3C9C A;  4NAA A;  3K72 A;  3ZDZ A;  3W15 A;  3BG1 A;  3QI0 A;  3I7P A;  2CO0 C;  3RN1 D;  2IUR A;  5EAR A;  4ZOZ A;  4O9D A;  3JRO A;  3NVN A;  1A0R B;  1NR0 A;  5IJ7 E;  2XDW A;  3O4G A;  4QL1 A;  3VI4 A;  3DSM A;  3I89 A;  3PXW D;  4J81 A;  5E6S A;  3J80 g;  3MMY A;  3IUQ A;  5EAL A;  5IC7 A;  5FFO A;  4UM8 A;  5FA5 B;  2HES X;  1TYQ C;  4CI8 A;  5I5M A;  3EU7 A;  3RMZ D;  2I0T A;  2YMU A; 
#chains in the Genus database with same CATH homology
 3GRE A;  3RSE C;  2HKM A;  4L1Q D;  3NVQ A;  4J0X A;  2I0S A;  3SBP A;  2B4E A;  5JWZ A;  4PXW A;  4XYI A;  2H9P A;  4L9O A;  4QQE A;  3EI4 A;  4A0A A;  4I79 A;  2BCJ B;  4H5I A;  4U1E I;  1JMX B;  4MK0 B;  4PBZ A;  1OMW B;  2PM7 B;  4FA9 D;  3UVL A;  2YB8 B;  5IT9 g;  4KFM B;  4CY2 A;  3I8E A;  4BUJ C;  5TF2 A;  4JT5 C;  2H6Q A;  1FWX A;  4CI3 A;  1SHY B;  3MZL A;  5H17 A;  4CY3 A;  3EMH A;  4J8G A;  3JPX A;  4IMM A;  3I7L A;  2OVP B;  3GFC A;  2HKR A;  3EI1 A;  1XHM A;  4J82 A;  3RLM D;  3BWS A;  3F3F A;  3FRX A;  5FKS A;  2IUQ A;  2H9N A;  1N6E A;  3SN6 B;  2P9P C;  3UKR C;  3OL2 A;  4Y5R D;  5B4W A;  4JT6 C;  2CE9 A;  3C75 H;  1GG2 B;  3PSL A;  4U7A A;  1MG3 A;  4GM3 A;  2P9I C;  1U2V C;  2MTA H;  4FAN D;  2CO0 A;  3IKO A;  2CN2 A;  3EI4 B;  4J78 A;  2P9L C;  2P9N C;  5EAM A;  1B9Y A;  4J0W A;  3B7F A;  2I0R A;  3F3G A;  4ERZ A;  2AGZ A;  2P9S C;  2GC4 A;  3OKW A;  2AGL A;  2XYI A;  4A0B B;  2QC5 A;  1SQ9 A;  1TBG A;  4A09 B;  4ZOX A;  2AGW A;  3PXS D;  3RN0 D;  3UVN A;  2J57 G;  4K3J B;  2H13 A;  5C2W B;  2Z2O A;  2GC7 A;  5FKQ A;  3ULE C;  2H6K A;  3A0F A;  2HJB A;  2H47 A;  2Q7Q A;  1XIP A;  4ZOY A;  2AQ5 A;  2CNX A;  1P22 A;  4K3I D;  3SJL D;  3PVW B;  2I3T A;  5TEE A;  2IUP A;  4BL0 A;  3VH0 A;  3VGZ A;  2H6N A;  3I2N A;  3UVK A;  4A08 A;  5I5I A;  2J55 H;  5AJA A;  1NEX B;  2OJY A;  4N14 A;  3EG6 A;  3N0D A;  2HXC A;  5THA A;  5AMS A;  3EI3 A;  3IIW A;  2PM9 A;  5HE0 B;  4A11 A;  3IIY A;  5EM2 A;  4CY5 A;  4JD2 C;  4GZ8 A;  1K8K C;  4GGC A;  3V9F A;  2CE8 A;  4UI9 R;  3EI2 B;  2GNQ A;  5CXC A;  3BG0 A;  5AFU 3;  2HYE A;  4E5Z B;  5FXY A;  2IUV A;  4YVD A;  5EMJ B;  2XL2 A;  3OKY A;  4PNK B;  5C9Z B;  4L3G D;  2H68 A;  2B5L A;  3L4O D;  5CYK A;  5H14 A;  3JZG A;  5HE2 B;  3SMR A;  4BH6 A;  3IJ0 A;  4L3H D;  3V7D B;  4J86 A;  4FWW A;  2XU7 A;  4ZN4 A;  5EMM B;  2XL3 A;  4A08 B;  5CXB A;  1PI6 A;  3DXM C;  4FA5 D;  4OZU A;  3SHF A;  2QXV A;  3OW8 A;  4CZY A;  1N6F A;  3JB9 L;  3EI3 B;  3AL8 A;  4A11 B;  3UVO A;  3SWS D;  1N6D A;  3NVX A;  1PBY B;  4JSN C;  4ERQ A;  5FKR A;  5FKT A;  5TEF A;  4J73 A;  3RRM C;  2W18 A;  3SXT D;  5IGQ A;  4A0A B;  3I7K A;  3MKQ A;  5EAP A;  3SVW D;  4PSX B;  1MDA H;  2BBK H;  4E54 A;  5HQG A;  4GM9 A;  1JMZ B;  3K26 A;  3SLE D;  4ERY A;  3KRW B;  2OIZ A;  5HYN B;  2Z2N A;  4A2M A;  4CZX A;  4FA4 D;  4LGN A;  4Y7R A;  2YBA A;  2IAA A;  3I7O A;  1OLZ A;  4O1Q D;  3I8C A;  2PM6 B;  5FQD A;  3JZH A;  2B5M A;  1QNI A;  3EI1 B;  2AH0 A;  2Z2P A;  4FHL A;  4GM8 A;  3E0C A;  4X3E A;  1VYH C;  3UVM A;  3N0E A;  5IGO A;  2CN3 A;  3OL2 B;  3C99 A;  4JSX C;  2J56 H;  3SCY A;  4ESG A;  1GP2 B;  5SXM A;  2OK4 A;  3C5M A;  2O9K A;  2EBS A;  3MXX A;  3PXT D;  3CIK B;  1MG2 A;  3IJC A;  3SBQ A;  2H9L A;  5GMK n;  1YFQ A;  3PSC B;  4OWR A;  3UR4 A;  4FB1 D;  3CFS B;  1B9X A;  4QT8 A;  4CI2 A;  5EML B;  2IWK A;  4J79 A;  4G56 B;  4GQB B;  3DXK C;  4R7A B;  3F3P A;  4GGA A;  4FAV D;  4PC0 A;  5C2V B;  4IA9 A;  4LG9 A;  3DWL C;  3U4Y A;  4J84 A;  2YNP A;  4X63 B;  3OTT A;  1PEV A;  1XKS A;  4JSV C;  5HE1 B;  4TZ4 A;  3K27 A;  5KDO B;  5GXH A;  4HDJ A;  4PSW B;  4O45 A;  5I5J A;  4CZV A;  3JZN A;  2UZX B;  3PVU B;  3HFQ A;  2OVQ B;  4FA1 D;  3RFH A;  5EMK B;  3DM0 A;  3L4M D;  5TDH B;  4XEI C;  3SBR A;  2B5N A;  4EWR A;  5GXI A;  4XYH A;  2TRC B;  3IJ1 A;  4JXM A;  4J8B A;  4LG8 A;  2G9A A;  2H3X A;  2UZY B;  3ORV D;  4NSX A;  2I3S A;  3MKS B;  3P4F A;  2IWF A;  3ZWL B;  2H14 A;  1R5M A;  5FLX g;  1GXR A;  4A0B A;  1Q47 A;  4QRJ A;  2PM9 B;  1GOT B;  4CY1 A;  3AFC A;  4ZOV A;  3JAM g;  4A09 A;  5EM2 B;  4GQ2 P;  1JJU B;  4X60 B;  2HJ4 A;  5GSA A;  5CXC B;  3RFG A;  2AGX A;  2H9M A;  3CFV A;  3AL9 A;  3MZK A;  1ERJ A;  2P9K C;  3OKY B;  1S4U X;  5A2Q g;  5HE3 B;  5CYK B;  3PE7 A;  1L0Q A;  1U4C A;  1SQJ A;  3J81 g;  3I7H A;  4GMB A;  2YNN A;  4JSP C;  5K1C C;  4O3T B;  4A7J A;  4CC9 A;  3OKT A;  4J87 A;  4CI1 A;  1PGU A;  2AGY A;  5IJ8 E;  4J77 A;  5CXB B;  3FM0 A;  2AH1 A;  4O3U B;  1K32 A;  4A2L A;  3SFZ A;  3ODT A;  4PBY A;  5K19 A;  4Z8L A;  3KRX B;  2OVR B;  4ES0 A;  3JRP A;  3AL8 B;  3EWE A;  4AEZ A;  3FGB A;  3VA6 A;  3AH8 B;  2P9U C;  2PBI B;  2OK6 A;  3V5W B;  4X61 B;  2G99 A;  3EI2 A;  5H1M A;  4GQ1 A;  1RI6 A;  1JOF A;  4D0K A;  3I7N A;  4E5Z A;  4E54 B;  4D6V A;  4H5J A;  4AOW A;  4GGD A;  2YNO A;  3UKU C;  3C9C A;  3W15 A;  3BG1 A;  3I7P A;  2CO0 C;  3RN1 D;  2IUR A;  5EAR A;  4ZOZ A;  4O9D A;  3JRO A;  3NVN A;  1A0R B;  1NR0 A;  5IJ7 E;  4QL1 A;  3DSM A;  3I89 A;  3PXW D;  4J81 A;  3J80 g;  3MMY A;  5EAL A;  5IC7 A;  5FA5 B;  2HES X;  1TYQ C;  4CI8 A;  5I5M A;  3EU7 A;  3RMZ D;  2I0T A;  2YMU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...