2XL2A

Wdr5 in complex with an rbbp5 peptide recruited to novel site
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
304
structure length
304
Chain Sequence
VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD REPEAT-CONTAINING PROTEIN 5
publication title Characterisation of a Novel Wdr5 Binding Site that Recruits Rbbp5 Through a Conserved Motif and Enhances Methylation of H3K4 by Mll1.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 104
structure length 304
sequence length 304
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2xl2A00
2IUPA 4BUJC 2CNXA 3DSMA 2P9SC 4LGNA 3IJCA 4GGAA 4A2LA 3B7FA 2B4EA 4PSXB 4Y5RD 3SBQA 5AFU3 5EALA 3CIKB 4XEIC 3UVOA 4BL0A 2H13A 3V7DB 4H5JA 2HJ4A 2IUVA 3OKYB 2J56H 1GG2B 5B4WA 2HKMA 1GOTB 5FA5B 3SVWD 2YBAA 3PXSD 4J84A 4QL1A 4PC0A 5FKQA 2H6KA 4XYIA 3PXWD 5CXBB 4FA1D 2B5LA 3I7NA 3EI4B 5CYKA 2CE9A 5IT9g 3RRMC 4CY3A 3I7HA 4J77A 4LG9A 3EWEA 5K19A 3W15A 2H47A 5FLXg 3F3PA 4TZ4A 4GQ1A 1JJUB 3VA6A 2XU7A 3I7OA 4QQEA 1OLZA 2HJBA 4J81A 5H14A 2PM7B 5FQDA 4FA4D 4CY2A 3SFZA 4ESGA 3P4FA 3IJ0A 3DM0A 3KRXB 4PSWB 4CZYA 2XL3A 2P9KC 3GFCA 2P9NC 4O45A 3AH8B 4GZ8A 5K1CC 4J8GA 2I0RA 4PBZA 2OVPB 4J8BA 4OWRA 3VGZA 1N6DA 2H68A 2H6NA 4H5IA 4A7JA 3CFVA 2GNQA 2O9KA 4JSVC 1YFQA 3F3GA 5CYKB 4BH6A 5HE3B 3AFCA 3OKYA 4JT6C 5C9ZB 3I7LA 4FWWA 4Z8LA 3PSCB 3OW8A 2AGYA 1MG2A 1B9YA 5TEEA 2CO0C 3UKRC 3UVKA 4GGCA 4CI1A 4FHLA 4J87A 3VH0A 4J73A 4A0BA 5CXBA 5HQGA 4GQBB 5EMLB 3RN0D 3I89A 4O3TB 4JSPC 3NVNA 4CZVA 2H9PA 4LG8A 3N0DA 5GSAA 3I7PA 5H17A 1TYQC 4I79A 4CI3A 1JOFA 1PGUA 4ES0A 1PBYB 4AOWA 3IIWA 4CY1A 3JZGA 1VYHC 3IKOA 4JSXC 3JZHA 3UKUC 2OK4A 4MK0B 2XYIA 1MDAH 3GREA 3KRWB 2B5NA 5HE0B 3EG6A 4IMMA 2CN2A 3A0FA 3RSEC 3NVXA 3BG1A 4CY5A 1OMWB 3JB9L 3N0EA 1L0QA 2J55H 4D6VA 3JZNA 2UZXB 5GMKn 5HYNB 4IA9A 2GC4A 4N14A 4GM9A 4A0AA 4J78A 4A0BB 4UI9R 4FA5D 4AEZA 2GC7A 3OTTA 3IJ1A 1GXRA 4ZOZA 4ERZA 1PI6A 3EI1A 3SBPA 2AGWA 2AH0A 2PM6B 1PEVA 5EMMB 4GMBA 5TEFA 2IUQA 5HE2B 3JRPA 2PM9B 1N6EA 1U2VC 3CFSB 2Q7QA 5EAPA 2XL2A 3MMYA 5EMJB 2OK6A 4QRJA 5KDOB 4A2MA 3EU7A 5SXMA 3ORVD 3MZKA 2YB8B 4D0KA 2H14A 2YNPA 2OIZA 2QXVA 4CI8A 3SCYA 1N6FA 2TRCB 2CO0A 3K27A 2CE8A 2IWFA 2B5MA 3SBRA 5GXHA 4A11B 3AL8A 1JMXB 3SJLD 1QNIA 3MKQA 1Q47A 4A0AB 3HFQA 3F3FA 3UVNA 3ZWLB 3I8EA 4CZXA 3JAMg 3ODTA 5FKRA 1K8KC 5TDHB 3EI1B 2P9UC 5IC7A 2EBSA 3C75H 1GP2B 4J0XA 1MG3A 1NEXB 4O9DA 2P9LC 3V5WB 3K26A 3SLED 3SN6B 4FA9D 2AGZA 4U1EI 4FAND 3C9CA 4K3JB 3FGBA 2I0SA 3C5MA 4GGDA 4Y7RA 4CC9A 3UVLA 5TF2A 3EI2B 4E5ZA 4A09A 2PBIB 2AQ5A 2PM9A 1JMZB 5EMKB 3L4MD 4J0WA 4QT8A 5EM2A 1XHMA 3EI3B 4OZUA 2P9IC 3AL8B 2AH1A 4JSNC 4JT5C 4GM8A 3BG0A 3OKWA 3EMHA 5I5JA 3U4YA 2P9PC 4J82A 1SQJA 1SHYB 4ERYA 1FWXA 3PVUB 3BWSA 4EWRA 4L3HD 3I7KA 4ZN4A 2BCJB 4A11A 3J81g 4PNKB 2MTAH 3UR4A 2IAAA 4ERQA 3OL2B 3PE7A 5C2WB 3MXXA 2OJYA 2OVQB 1K32A 2Z2PA 2Z2OA 3AL9A 4E5ZB 4A09B 3FM0A 4R7AB 1XIPA 5CXCB 2YNNA 2W18A 5JWZA 4A08B 2H3XA 2YMUA 3PVWB 5GXIA 3IIYA 5EM2B 2G9AA 2I3TA 4JD2C 2HYEA 5IJ7E 2CN3A 3I8CA 2H6QA 4ZOYA 5THAA 3EI2A 2H9LA 4CI2A 3PXTD 4X3EA 2Z2NA 3JROA 5I5MA 5C2VB 2OVRB 3JPXA 4J79A 3RFHA 4NSXA 2H9NA 5EAMA 3UVMA 4GQ2P 5EARA 3SMRA 3EI3A 4FB1D 5IJ8E 1NR0A 5FKSA 3J80g 4L1QD 2BBKH 2HXCA 3NVQA 4X63B 2HESX 3DXKC 3ULEC 5H1MA 4E54A 1B9XA 4GM3A 3DXMC 3RLMD 3FRXA 3E0CA 1P22A 3SHFA 1A0RB 2G99A 4L3GD 2H9MA 4O1QD 5HE1B 4XYHA 3V9FA 2UZYB 2IWKA 4L9OA 5AMSA 4X61B 4HDJA 4ZOXA 3OL2A 3I2NA 2QC5A 2YNOA 4PBYA 3RFGA 1ERJA 2AGLA 1RI6A 5AJAA 3MZLA 4X60B 1U4CA 4K3ID 4PXWA 3MKSB 5FKTA 3RN1D 2J57G 3OKTA 3C99A 5CXCA 3DWLC 4A08A 2AGXA 1S4UX 3RMZD 4O3UB 3L4OD 4J86A 1TBGA 2HKRA 4FAVD 3EI4A 3PSLA 1SQ9A 3SXTD 2I0TA 4ZOVA 4U7AA 4KFMB 1XKSA 5A2Qg 2IURA 3SWSD 4G56B 2I3SA 1R5MA 4E54B 5FXYA 4YVDA 5IGOA 5I5IA 4JXMA 5IGQA
chains in the Genus database with same CATH superfamily
2IUPA 4BUJC 2CNXA 3DSMA 3ZE2A 2P9SC 4WJKA 4LGNA 3IJCA 4GGAA 4A2LA 3B7FA 1VE6A 2B4EA 4PSXB 4Y5RD 3MUOA 3SBQA 5AFU3 5EALA 3CIKB 4XEIC 3UVOA 4BL0A 2H13A 3V7DB 4RE5A 4H5JA 2HJ4A 2IUVA 3OKYB 5C86A 2VDLA 2J56H 1GG2B 3GC3B 2HKMA 5B4WA 1GOTB 5FA5B 3SVWD 1K3IA 2YBAA 3PXSD 5C92A 1C9LA 4J84A 3K6SA 4QL1A 4PC0A 2VDKA 2VZ1A 4BCBA 5FKQA 2H6KA 4XYIA 3EQ8A 3PXWD 4UM8A 5CXBB 3ZE0A 4FA1D 2B5LA 3I7NA 4O02A 3EI4B 5CYKA 2CE9A 3V4VA 5IT9g 3FCUA 3RRMC 4QAMA 4CY3A 3I7HA 4J77A 4LG9A 3EWEA 5K19A 3W15A 2H47A 5FLXg 1H2ZA 3F3PA 4NC4A 4TZ4A 4GQ1A 1JJUB 3VA6A 2XU7A 3I7OA 4QQEA 1OLZA 2HJBA 4Z7OA 4J81A 5H14A 2PM7B 4BCCA 5FQDA 4FA4D 4CY2A 3SFZA 4ESGA 3P4FA 3IJ0A 3DM0A 3KRXB 4PSWB 4CZYA 1U8CA 2XL3A 2P9KC 3GFCA 2P9NC 3AH8B 4GZ8A 4O45A 5K1CC 4L1MA 4J8GA 2I0RA 4PBZA 4RE6A 2OVPB 4J8BA 4OWRA 1UOOA 3ZE1A 3VGZA 1N6DA 2H68A 2H6NA 4H5IA 4A7JA 1M1XA 3CFVA 2GNQA 2O9KA 4JSVC 3V4PA 1YFQA 3F3GA 5CYKB 4BH6A 5HE3B 3AFCA 2QR5A 3OKYA 4JT6C 5C9ZB 3I7LA 4FWWA 4Z8LA 3PSCB 4Z7QA 3OW8A 2AGYA 1MG2A 3IJEA 1B9YA 5TEEA 2CO0C 3UKRC 4DNVA 3UVKA 4GGCA 4CI1A 1GOGA 4FHLA 3VI3A 4J87A 3VH0A 3O4HA 1E8MA 4J73A 4A0BA 5CXBA 4MMZA 5HQGA 4GQBB 5EMLB 1JTDB 2WQ8A 3RN0D 3I89A 4Z7NA 4O3TB 4JSPC 3NVNA 4CZVA 4WK0A 2H9PA 4BP8A 4LG8A 3N0DA 3QI0A 5GSAA 3I7PA 5H17A 1TYQC 4I79A 4CI3A 1JOFA 1PGUA 4ES0A 1PBYB 2VZ3A 4AMZA 4AOWA 3IIWA 3EQ7A 4CY1A 1BPOA 3JZGA 5M5SA 1VYHC 3IKOA 4JSXC 3JZHA 4O2WA 3K71A 3UKUC 2OK4A 2VDOA 3O4GA 1GOFA 2XYIA 1MDAH 4MK0B 3GREA 3KRWB 2B5NA 3QHYB 5HE0B 3EG6A 5E6RA 4IMMA 2CN2A 4JHPC 3A0FA 1YR2A 3RSEC 3NVXA 3BG1A 4CY5A 1OMWB 3JB9L 3N0EA 1E8NA 1L0QA 2J55H 2VDQA 4D6VA 3JZNA 2HU5A 2UZXB 5GMKn 5HYNB 4IA9A 2GC4A 4N14A 4GM9A 3KCIA 4A0AA 4J78A 2VDRA 2XZGA 4A0BB 4UI9R 5M5TA 4D9SA 4AEZA 4FA5D 2GC7A 3OTTA 3IJ1A 1GXRA 3GD1I 5E6UA 4ZOZA 1O6FA 4ERZA 1PI6A 3EI1A 3SBPA 2AGWA 2AH0A 2PM6B 1PEVA 5EMMB 4GMBA 5TEFA 2IUQA 5HE2B 3JRPA 2PM9B 5M61A 1N6EA 1QFMA 2EIDA 1U2VC 3CFSB 2Q7QA 5EAPA 2XL2A 3MMYA 5EMJB 2OK6A 4QRJA 5KDOB 4A2MA 3O4IA 1JV2A 3EU7A 1UOPA 4NAAA 2VDNA 5SXMA 3ORVD 4NBMA 3MZKA 2YB8B 4WK2A 4D0KA 2H14A 2YNPA 1I2MB 2OIZA 2QXVA 4CI8A 3SCYA 1N6FA 2TRCB 2CO0A 4G55A 4AMYA 3K27A 3MUNA 2CE8A 2IWFA 2B5MA 3SBRA 5GXHA 2HU7A 3AL8A 4A11B 1JMXB 3SJLD 1T2XA 3NIGA 1QNIA 3MKQA 1Q47A 4A0AB 3HFQA 3F3FA 1C9IA 3UVNA 3I8EA 3ZDYA 3ZWLB 4CZXA 5M5UA 3JAMg 4IRZA 3ODTA 5FKRA 1K8KC 5TDHB 3EI1B 2P9UC 5IC7A 2XE4A 2EBSA 3C75H 1GP2B 4J0XA 1UTCA 1MG3A 3IVMA 1NEXB 4O9DA 2P9LC 3V5WB 5HDBA 2QZPA 1H2YA 3K26A 3SLED 3SN6B 4FA9D 2AGZA 4U1EI 4FAND 1O6GA 3C9CA 4K3JB 3FGBA 2I0SA 3C5MA 4GGDA 4Y7RA 5E6SA 4CC9A 3UVLA 5TF2A 3EI2B 4E5ZA 4A09A 3IULA 4AN0A 2PBIB 2AQ5A 4DNWA 2PM9A 1JMZB 5EMKB 2BKLA 3L4MD 4J0WA 4MMXA 4QT8A 5EM2A 1XHMA 4AN1A 3EI3B 1H2XA 4OZUA 2P9IC 1QFSA 3AL8B 2AH1A 4JSNC 4JT5C 3NIFA 4GM8A 3BG0A 4BCDA 3OKWA 3T3MA 3EMHA 5I5JA 2HU8A 3U4YA 2P9PC 4J82A 1SQJA 1SHYB 4ERYA 4UM9A 1FWXA 3PVUB 3BWSA 3VI4A 4EWRA 3IUQA 4L3HD 2VDPA 3I7KA 3ZDXA 4ZN4A 2BCJB 1L5GA 4A11A 3J81g 4PNKB 2MTAH 3UR4A 1H2WA 5M5RA 1VE7A 2IAAA 4ERQA 3OL2B 3PE7A 5C2WB 3MXXA 3NIDA 2OJYA 2OVQB 3T3PA 1K32A 2Z2PA 2Z2OA 3AL9A 4E5ZB 4A09B 3FM0A 1E5TA 3K72A 4R7AB 1XIPA 5FFGA 5CXCB 2YNNA 2W18A 5JWZA 4A08B 1VZ3A 2H3XA 2YMUA 1GOHA 3PVWB 5GXIA 4AX4A 3IIYA 5EM2B 2G9AA 2I3TA 4JHNA 4JD2C 2HYEA 5IJ7E 2CN3A 3I8CA 2H6QA 4ZOYA 5THAA 3EI2A 2H9LA 4CI2A 3PXTD 4X3EA 2Z2NA 3JROA 5I5MA 5FFOA 5C2VB 2OVRB 3JPXA 3O4JA 4J79A 4MMYA 3RFHA 4NSXA 2H9NA 3IUMA 3IUJA 5EAMA 4GQ2P 5EARA 3UVMA 3SMRA 3EI3A 4FB1D 5IJ8E 1NR0A 2VDMA 5FKSA 3J80g 4L1QD 1TYEA 2BBKH 2HXCA 3FCSA 3NVQA 3DDUA 4X63B 2HESX 3DXKC 3IURA 3ULEC 2EIEA 5H1MA 4E54A 1B9XA 4GM3A 4G1MA 3DXMC 3RLMD 3FRXA 3E0CA 3MVDK 1P22A 3SHFA 1A0RB 2G99A 4L3GD 2H9MA 4O1QD 5HE1B 4XYHA 3V9FA 2UZYB 2IWKA 4L9OA 2EIBA 5AMSA 4X61B 3EQ9A 4HDJA 2VC2A 4ZOXA 4NENA 4BP9A 3IUNA 3OL2A 3I2NA 2QC5A 2YNOA 4PBYA 3RFGA 1ERJA 2AGLA 1RI6A 5AJAA 3MZLA 4X60B 1U4CA 4K3ID 4PXWA 3MKSB 5FKTA 3RN1D 2J57G 3OKTA 3C99A 5CXCA 3DWLC 4A08A 2AGXA 1S4UX 3OF7A 3RMZD 4O3UB 2JKXA 1A12A 3L4OD 4J86A 1TBGA 5M5VA 2HKRA 2XDWA 2EICA 4FAVD 3EI4A 3PSLA 1SQ9A 3SXTD 2I0TA 3ZDZA 4WK4A 4ZOVA 4U7AA 4G1EA 4KFMB 1XKSA 5A2Qg 2IURA 3SWSD 1VZ2A 4G56B 1UOQA 2I3SA 1R5MA 4E54B 5FXYA 4YVDA 5IGOA 5I5IA 4DNUA 4JXMA 5IGQA
chains in the Genus database with same CATH topology
2IUPA 4BUJC 2CNXA 3DSMA 2P9SC 4LGNA 3IJCA 4GGAA 4A2LA 3B7FA 2B4EA 4PSXB 4Y5RD 3SBQA 5AFU3 5EALA 3CIKB 4XEIC 3UVOA 4BL0A 2H13A 3V7DB 4H5JA 2HJ4A 2IUVA 3OKYB 2J56H 1GG2B 5B4WA 2HKMA 1GOTB 5FA5B 3SVWD 2YBAA 3PXSD 4J84A 4QL1A 4PC0A 5FKQA 2H6KA 4XYIA 3PXWD 5CXBB 4FA1D 2B5LA 3I7NA 3EI4B 5CYKA 2CE9A 5IT9g 3RRMC 4CY3A 3I7HA 4J77A 4LG9A 3EWEA 5K19A 3W15A 2H47A 5FLXg 3F3PA 4TZ4A 4GQ1A 1JJUB 3VA6A 2XU7A 3I7OA 4QQEA 1OLZA 2HJBA 4J81A 5H14A 2PM7B 5FQDA 4FA4D 4CY2A 3SFZA 4ESGA 3P4FA 3IJ0A 3DM0A 3KRXB 4PSWB 4CZYA 2XL3A 2P9KC 3GFCA 2P9NC 4O45A 3AH8B 4GZ8A 5K1CC 4J8GA 2I0RA 4PBZA 2OVPB 4J8BA 4OWRA 3VGZA 1N6DA 2H68A 2H6NA 4H5IA 4A7JA 3CFVA 2GNQA 2O9KA 4JSVC 1YFQA 3F3GA 5CYKB 4BH6A 5HE3B 3AFCA 3OKYA 4JT6C 5C9ZB 3I7LA 4FWWA 4Z8LA 3PSCB 3OW8A 2AGYA 1MG2A 1B9YA 5TEEA 2CO0C 3UKRC 3UVKA 4GGCA 4CI1A 4FHLA 4J87A 3VH0A 4J73A 4A0BA 5CXBA 5HQGA 4GQBB 5EMLB 3RN0D 3I89A 4O3TB 4JSPC 3NVNA 4CZVA 2H9PA 4LG8A 3N0DA 5GSAA 3I7PA 5H17A 1TYQC 4I79A 4CI3A 1JOFA 1PGUA 4ES0A 1PBYB 4AOWA 3IIWA 4CY1A 3JZGA 1VYHC 3IKOA 4JSXC 3JZHA 3UKUC 2OK4A 4MK0B 2XYIA 1MDAH 3GREA 3KRWB 2B5NA 5HE0B 3EG6A 4IMMA 2CN2A 3A0FA 3RSEC 3NVXA 3BG1A 4CY5A 1OMWB 3JB9L 3N0EA 1L0QA 2J55H 4D6VA 3JZNA 2UZXB 5GMKn 5HYNB 4IA9A 2GC4A 4N14A 4GM9A 4A0AA 4J78A 4A0BB 4UI9R 4FA5D 4AEZA 2GC7A 3OTTA 3IJ1A 1GXRA 4ZOZA 4ERZA 1PI6A 3EI1A 3SBPA 2AGWA 2AH0A 2PM6B 1PEVA 5EMMB 4GMBA 5TEFA 2IUQA 5HE2B 3JRPA 2PM9B 1N6EA 1U2VC 3CFSB 2Q7QA 5EAPA 2XL2A 3MMYA 5EMJB 2OK6A 4QRJA 5KDOB 4A2MA 3EU7A 5SXMA 3ORVD 3MZKA 2YB8B 4D0KA 2H14A 2YNPA 2OIZA 2QXVA 4CI8A 3SCYA 1N6FA 2TRCB 2CO0A 3K27A 2CE8A 2IWFA 2B5MA 3SBRA 5GXHA 4A11B 3AL8A 1JMXB 3SJLD 1QNIA 3MKQA 1Q47A 4A0AB 3HFQA 3F3FA 3UVNA 3ZWLB 3I8EA 4CZXA 3JAMg 3ODTA 5FKRA 1K8KC 5TDHB 3EI1B 2P9UC 5IC7A 2EBSA 3C75H 1GP2B 4J0XA 1MG3A 1NEXB 4O9DA 2P9LC 3V5WB 3K26A 3SLED 3SN6B 4FA9D 2AGZA 4U1EI 4FAND 3C9CA 4K3JB 3FGBA 2I0SA 3C5MA 4GGDA 4Y7RA 4CC9A 3UVLA 5TF2A 3EI2B 4E5ZA 4A09A 2PBIB 2AQ5A 2PM9A 1JMZB 5EMKB 3L4MD 4J0WA 4QT8A 5EM2A 1XHMA 3EI3B 4OZUA 2P9IC 3AL8B 2AH1A 4JSNC 4JT5C 4GM8A 3BG0A 3OKWA 3EMHA 5I5JA 3U4YA 2P9PC 4J82A 1SQJA 1SHYB 4ERYA 1FWXA 3PVUB 3BWSA 4EWRA 4L3HD 3I7KA 4ZN4A 2BCJB 4A11A 3J81g 4PNKB 2MTAH 3UR4A 2IAAA 4ERQA 3OL2B 3PE7A 5C2WB 3MXXA 2OJYA 2OVQB 1K32A 2Z2PA 2Z2OA 3AL9A 4E5ZB 4A09B 3FM0A 4R7AB 1XIPA 5CXCB 2YNNA 2W18A 5JWZA 4A08B 2H3XA 2YMUA 3PVWB 5GXIA 3IIYA 5EM2B 2G9AA 2I3TA 4JD2C 2HYEA 5IJ7E 2CN3A 3I8CA 2H6QA 4ZOYA 5THAA 3EI2A 2H9LA 4CI2A 3PXTD 4X3EA 2Z2NA 3JROA 5I5MA 5C2VB 2OVRB 3JPXA 4J79A 3RFHA 4NSXA 2H9NA 5EAMA 3UVMA 4GQ2P 5EARA 3SMRA 3EI3A 4FB1D 5IJ8E 1NR0A 5FKSA 3J80g 4L1QD 2BBKH 2HXCA 3NVQA 4X63B 2HESX 3DXKC 3ULEC 5H1MA 4E54A 1B9XA 4GM3A 3DXMC 3RLMD 3FRXA 3E0CA 1P22A 3SHFA 1A0RB 2G99A 4L3GD 2H9MA 4O1QD 5HE1B 4XYHA 3V9FA 2UZYB 2IWKA 4L9OA 5AMSA 4X61B 4HDJA 4ZOXA 3OL2A 3I2NA 2QC5A 2YNOA 4PBYA 3RFGA 1ERJA 2AGLA 1RI6A 5AJAA 3MZLA 4X60B 1U4CA 4K3ID 4PXWA 3MKSB 5FKTA 3RN1D 2J57G 3OKTA 3C99A 5CXCA 3DWLC 4A08A 2AGXA 1S4UX 3RMZD 4O3UB 3L4OD 4J86A 1TBGA 2HKRA 4FAVD 3EI4A 3PSLA 1SQ9A 3SXTD 2I0TA 4ZOVA 4U7AA 4KFMB 1XKSA 5A2Qg 2IURA 3SWSD 4G56B 2I3SA 1R5MA 4E54B 5FXYA 4YVDA 5IGOA 5I5IA 4JXMA 5IGQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IUP A;  4BUJ C;  2CNX A;  3DSM A;  2P9S C;  4LGN A;  3IJC A;  4GGA A;  4A2L A;  3B7F A;  2B4E A;  4PSX B;  4Y5R D;  3SBQ A;  5AFU 3;  5EAL A;  3CIK B;  4XEI C;  3UVO A;  4BL0 A;  2H13 A;  3V7D B;  4H5J A;  2HJ4 A;  2IUV A;  3OKY B;  2J56 H;  1GG2 B;  5B4W A;  2HKM A;  1GOT B;  5FA5 B;  3SVW D;  2YBA A;  3PXS D;  4J84 A;  4QL1 A;  4PC0 A;  5FKQ A;  2H6K A;  4XYI A;  3PXW D;  5CXB B;  4FA1 D;  2B5L A;  3I7N A;  3EI4 B;  5CYK A;  2CE9 A;  5IT9 g;  3RRM C;  4CY3 A;  3I7H A;  4J77 A;  4LG9 A;  3EWE A;  5K19 A;  3W15 A;  2H47 A;  5FLX g;  3F3P A;  4TZ4 A;  4GQ1 A;  1JJU B;  3VA6 A;  2XU7 A;  3I7O A;  4QQE A;  1OLZ A;  2HJB A;  4J81 A;  5H14 A;  2PM7 B;  5FQD A;  4FA4 D;  4CY2 A;  3SFZ A;  4ESG A;  3P4F A;  3IJ0 A;  3DM0 A;  3KRX B;  4PSW B;  4CZY A;  2XL3 A;  2P9K C;  3GFC A;  2P9N C;  4O45 A;  3AH8 B;  4GZ8 A;  5K1C C;  4J8G A;  2I0R A;  4PBZ A;  2OVP B;  4J8B A;  4OWR A;  3VGZ A;  1N6D A;  2H68 A;  2H6N A;  4H5I A;  4A7J A;  3CFV A;  2GNQ A;  2O9K A;  4JSV C;  1YFQ A;  3F3G A;  5CYK B;  4BH6 A;  5HE3 B;  3AFC A;  3OKY A;  4JT6 C;  5C9Z B;  3I7L A;  4FWW A;  4Z8L A;  3PSC B;  3OW8 A;  2AGY A;  1MG2 A;  1B9Y A;  5TEE A;  2CO0 C;  3UKR C;  3UVK A;  4GGC A;  4CI1 A;  4FHL A;  4J87 A;  3VH0 A;  4J73 A;  4A0B A;  5CXB A;  5HQG A;  4GQB B;  5EML B;  3RN0 D;  3I89 A;  4O3T B;  4JSP C;  3NVN A;  4CZV A;  2H9P A;  4LG8 A;  3N0D A;  5GSA A;  3I7P A;  5H17 A;  1TYQ C;  4I79 A;  4CI3 A;  1JOF A;  1PGU A;  4ES0 A;  1PBY B;  4AOW A;  3IIW A;  4CY1 A;  3JZG A;  1VYH C;  3IKO A;  4JSX C;  3JZH A;  3UKU C;  2OK4 A;  4MK0 B;  2XYI A;  1MDA H;  3GRE A;  3KRW B;  2B5N A;  5HE0 B;  3EG6 A;  4IMM A;  2CN2 A;  3A0F A;  3RSE C;  3NVX A;  3BG1 A;  4CY5 A;  1OMW B;  3JB9 L;  3N0E A;  1L0Q A;  2J55 H;  4D6V A;  3JZN A;  2UZX B;  5GMK n;  5HYN B;  4IA9 A;  2GC4 A;  4N14 A;  4GM9 A;  4A0A A;  4J78 A;  4A0B B;  4UI9 R;  4FA5 D;  4AEZ A;  2GC7 A;  3OTT A;  3IJ1 A;  1GXR A;  4ZOZ A;  4ERZ A;  1PI6 A;  3EI1 A;  3SBP A;  2AGW A;  2AH0 A;  2PM6 B;  1PEV A;  5EMM B;  4GMB A;  5TEF A;  2IUQ A;  5HE2 B;  3JRP A;  2PM9 B;  1N6E A;  1U2V C;  3CFS B;  2Q7Q A;  5EAP A;  2XL2 A;  3MMY A;  5EMJ B;  2OK6 A;  4QRJ A;  5KDO B;  4A2M A;  3EU7 A;  5SXM A;  3ORV D;  3MZK A;  2YB8 B;  4D0K A;  2H14 A;  2YNP A;  2OIZ A;  2QXV A;  4CI8 A;  3SCY A;  1N6F A;  2TRC B;  2CO0 A;  3K27 A;  2CE8 A;  2IWF A;  2B5M A;  3SBR A;  5GXH A;  4A11 B;  3AL8 A;  1JMX B;  3SJL D;  1QNI A;  3MKQ A;  1Q47 A;  4A0A B;  3HFQ A;  3F3F A;  3UVN A;  3ZWL B;  3I8E A;  4CZX A;  3JAM g;  3ODT A;  5FKR A;  1K8K C;  5TDH B;  3EI1 B;  2P9U C;  5IC7 A;  2EBS A;  3C75 H;  1GP2 B;  4J0X A;  1MG3 A;  1NEX B;  4O9D A;  2P9L C;  3V5W B;  3K26 A;  3SLE D;  3SN6 B;  4FA9 D;  2AGZ A;  4U1E I;  4FAN D;  3C9C A;  4K3J B;  3FGB A;  2I0S A;  3C5M A;  4GGD A;  4Y7R A;  4CC9 A;  3UVL A;  5TF2 A;  3EI2 B;  4E5Z A;  4A09 A;  2PBI B;  2AQ5 A;  2PM9 A;  1JMZ B;  5EMK B;  3L4M D;  4J0W A;  4QT8 A;  5EM2 A;  1XHM A;  3EI3 B;  4OZU A;  2P9I C;  3AL8 B;  2AH1 A;  4JSN C;  4JT5 C;  4GM8 A;  3BG0 A;  3OKW A;  3EMH A;  5I5J A;  3U4Y A;  2P9P C;  4J82 A;  1SQJ A;  1SHY B;  4ERY A;  1FWX A;  3PVU B;  3BWS A;  4EWR A;  4L3H D;  3I7K A;  4ZN4 A;  2BCJ B;  4A11 A;  3J81 g;  4PNK B;  2MTA H;  3UR4 A;  2IAA A;  4ERQ A;  3OL2 B;  3PE7 A;  5C2W B;  3MXX A;  2OJY A;  2OVQ B;  1K32 A;  2Z2P A;  2Z2O A;  3AL9 A;  4E5Z B;  4A09 B;  3FM0 A;  4R7A B;  1XIP A;  5CXC B;  2YNN A;  2W18 A;  5JWZ A;  4A08 B;  2H3X A;  2YMU A;  3PVW B;  5GXI A;  3IIY A;  5EM2 B;  2G9A A;  2I3T A;  4JD2 C;  2HYE A;  5IJ7 E;  2CN3 A;  3I8C A;  2H6Q A;  4ZOY A;  5THA A;  3EI2 A;  2H9L A;  4CI2 A;  3PXT D;  4X3E A;  2Z2N A;  3JRO A;  5I5M A;  5C2V B;  2OVR B;  3JPX A;  4J79 A;  3RFH A;  4NSX A;  2H9N A;  5EAM A;  3UVM A;  4GQ2 P;  5EAR A;  3SMR A;  3EI3 A;  4FB1 D;  5IJ8 E;  1NR0 A;  5FKS A;  3J80 g;  4L1Q D;  2BBK H;  2HXC A;  3NVQ A;  4X63 B;  2HES X;  3DXK C;  3ULE C;  5H1M A;  4E54 A;  1B9X A;  4GM3 A;  3DXM C;  3RLM D;  3FRX A;  3E0C A;  1P22 A;  3SHF A;  1A0R B;  2G99 A;  4L3G D;  2H9M A;  4O1Q D;  5HE1 B;  4XYH A;  3V9F A;  2UZY B;  2IWK A;  4L9O A;  5AMS A;  4X61 B;  4HDJ A;  4ZOX A;  3OL2 A;  3I2N A;  2QC5 A;  2YNO A;  4PBY A;  3RFG A;  1ERJ A;  2AGL A;  1RI6 A;  5AJA A;  3MZL A;  4X60 B;  1U4C A;  4K3I D;  4PXW A;  3MKS B;  5FKT A;  3RN1 D;  2J57 G;  3OKT A;  3C99 A;  5CXC A;  3DWL C;  4A08 A;  2AGX A;  1S4U X;  3RMZ D;  4O3U B;  3L4O D;  4J86 A;  1TBG A;  2HKR A;  4FAV D;  3EI4 A;  3PSL A;  1SQ9 A;  3SXT D;  2I0T A;  4ZOV A;  4U7A A;  4KFM B;  1XKS A;  5A2Q g;  2IUR A;  3SWS D;  4G56 B;  2I3S A;  1R5M A;  4E54 B;  5FXY A;  4YVD A;  5IGO A;  5I5I A;  4JXM A;  5IGQ A; 
#chains in the Genus database with same CATH topology
 2IUP A;  4BUJ C;  2CNX A;  3DSM A;  3ZE2 A;  2P9S C;  4WJK A;  4LGN A;  3IJC A;  4GGA A;  4A2L A;  3B7F A;  1VE6 A;  2B4E A;  4PSX B;  4Y5R D;  3MUO A;  3SBQ A;  5AFU 3;  5EAL A;  3CIK B;  4XEI C;  3UVO A;  4BL0 A;  2H13 A;  3V7D B;  4RE5 A;  4H5J A;  2HJ4 A;  2IUV A;  3OKY B;  5C86 A;  2VDL A;  2J56 H;  1GG2 B;  3GC3 B;  2HKM A;  5B4W A;  1GOT B;  5FA5 B;  3SVW D;  1K3I A;  2YBA A;  3PXS D;  5C92 A;  1C9L A;  4J84 A;  3K6S A;  4QL1 A;  4PC0 A;  2VDK A;  2VZ1 A;  4BCB A;  5FKQ A;  2H6K A;  4XYI A;  3EQ8 A;  3PXW D;  4UM8 A;  5CXB B;  3ZE0 A;  4FA1 D;  2B5L A;  3I7N A;  4O02 A;  3EI4 B;  5CYK A;  2CE9 A;  3V4V A;  5IT9 g;  3FCU A;  3RRM C;  4QAM A;  4CY3 A;  3I7H A;  4J77 A;  4LG9 A;  3EWE A;  5K19 A;  3W15 A;  2H47 A;  5FLX g;  1H2Z A;  3F3P A;  4NC4 A;  4TZ4 A;  4GQ1 A;  1JJU B;  3VA6 A;  2XU7 A;  3I7O A;  4QQE A;  1OLZ A;  2HJB A;  4Z7O A;  4J81 A;  5H14 A;  2PM7 B;  4BCC A;  5FQD A;  4FA4 D;  4CY2 A;  3SFZ A;  4ESG A;  3P4F A;  3IJ0 A;  3DM0 A;  3KRX B;  4PSW B;  4CZY A;  1U8C A;  2XL3 A;  2P9K C;  3GFC A;  2P9N C;  3AH8 B;  4GZ8 A;  4O45 A;  5K1C C;  4L1M A;  4J8G A;  2I0R A;  4PBZ A;  4RE6 A;  2OVP B;  4J8B A;  4OWR A;  1UOO A;  3ZE1 A;  3VGZ A;  1N6D A;  2H68 A;  2H6N A;  4H5I A;  4A7J A;  1M1X A;  3CFV A;  2GNQ A;  2O9K A;  4JSV C;  3V4P A;  1YFQ A;  3F3G A;  5CYK B;  4BH6 A;  5HE3 B;  3AFC A;  2QR5 A;  3OKY A;  4JT6 C;  5C9Z B;  3I7L A;  4FWW A;  4Z8L A;  3PSC B;  4Z7Q A;  3OW8 A;  2AGY A;  1MG2 A;  3IJE A;  1B9Y A;  5TEE A;  2CO0 C;  3UKR C;  4DNV A;  3UVK A;  4GGC A;  4CI1 A;  1GOG A;  4FHL A;  3VI3 A;  4J87 A;  3VH0 A;  3O4H A;  1E8M A;  4J73 A;  4A0B A;  5CXB A;  4MMZ A;  5HQG A;  4GQB B;  5EML B;  1JTD B;  2WQ8 A;  3RN0 D;  3I89 A;  4Z7N A;  4O3T B;  4JSP C;  3NVN A;  4CZV A;  4WK0 A;  2H9P A;  4BP8 A;  4LG8 A;  3N0D A;  3QI0 A;  5GSA A;  3I7P A;  5H17 A;  1TYQ C;  4I79 A;  4CI3 A;  1JOF A;  1PGU A;  4ES0 A;  1PBY B;  2VZ3 A;  4AMZ A;  4AOW A;  3IIW A;  3EQ7 A;  4CY1 A;  1BPO A;  3JZG A;  5M5S A;  1VYH C;  3IKO A;  4JSX C;  3JZH A;  4O2W A;  3K71 A;  3UKU C;  2OK4 A;  2VDO A;  3O4G A;  1GOF A;  2XYI A;  1MDA H;  4MK0 B;  3GRE A;  3KRW B;  2B5N A;  3QHY B;  5HE0 B;  3EG6 A;  5E6R A;  4IMM A;  2CN2 A;  4JHP C;  3A0F A;  1YR2 A;  3RSE C;  3NVX A;  3BG1 A;  4CY5 A;  1OMW B;  3JB9 L;  3N0E A;  1E8N A;  1L0Q A;  2J55 H;  2VDQ A;  4D6V A;  3JZN A;  2HU5 A;  2UZX B;  5GMK n;  5HYN B;  4IA9 A;  2GC4 A;  4N14 A;  4GM9 A;  3KCI A;  4A0A A;  4J78 A;  2VDR A;  2XZG A;  4A0B B;  4UI9 R;  5M5T A;  4D9S A;  4AEZ A;  4FA5 D;  2GC7 A;  3OTT A;  3IJ1 A;  1GXR A;  3GD1 I;  5E6U A;  4ZOZ A;  1O6F A;  4ERZ A;  1PI6 A;  3EI1 A;  3SBP A;  2AGW A;  2AH0 A;  2PM6 B;  1PEV A;  5EMM B;  4GMB A;  5TEF A;  2IUQ A;  5HE2 B;  3JRP A;  2PM9 B;  5M61 A;  1N6E A;  1QFM A;  2EID A;  1U2V C;  3CFS B;  2Q7Q A;  5EAP A;  2XL2 A;  3MMY A;  5EMJ B;  2OK6 A;  4QRJ A;  5KDO B;  4A2M A;  3O4I A;  1JV2 A;  3EU7 A;  1UOP A;  4NAA A;  2VDN A;  5SXM A;  3ORV D;  4NBM A;  3MZK A;  2YB8 B;  4WK2 A;  4D0K A;  2H14 A;  2YNP A;  1I2M B;  2OIZ A;  2QXV A;  4CI8 A;  3SCY A;  1N6F A;  2TRC B;  2CO0 A;  4G55 A;  4AMY A;  3K27 A;  3MUN A;  2CE8 A;  2IWF A;  2B5M A;  3SBR A;  5GXH A;  2HU7 A;  3AL8 A;  4A11 B;  1JMX B;  3SJL D;  1T2X A;  3NIG A;  1QNI A;  3MKQ A;  1Q47 A;  4A0A B;  3HFQ A;  3F3F A;  1C9I A;  3UVN A;  3I8E A;  3ZDY A;  3ZWL B;  4CZX A;  5M5U A;  3JAM g;  4IRZ A;  3ODT A;  5FKR A;  1K8K C;  5TDH B;  3EI1 B;  2P9U C;  5IC7 A;  2XE4 A;  2EBS A;  3C75 H;  1GP2 B;  4J0X A;  1UTC A;  1MG3 A;  3IVM A;  1NEX B;  4O9D A;  2P9L C;  3V5W B;  5HDB A;  2QZP A;  1H2Y A;  3K26 A;  3SLE D;  3SN6 B;  4FA9 D;  2AGZ A;  4U1E I;  4FAN D;  1O6G A;  3C9C A;  4K3J B;  3FGB A;  2I0S A;  3C5M A;  4GGD A;  4Y7R A;  5E6S A;  4CC9 A;  3UVL A;  5TF2 A;  3EI2 B;  4E5Z A;  4A09 A;  3IUL A;  4AN0 A;  2PBI B;  2AQ5 A;  4DNW A;  2PM9 A;  1JMZ B;  5EMK B;  2BKL A;  3L4M D;  4J0W A;  4MMX A;  4QT8 A;  5EM2 A;  1XHM A;  4AN1 A;  3EI3 B;  1H2X A;  4OZU A;  2P9I C;  1QFS A;  3AL8 B;  2AH1 A;  4JSN C;  4JT5 C;  3NIF A;  4GM8 A;  3BG0 A;  4BCD A;  3OKW A;  3T3M A;  3EMH A;  5I5J A;  2HU8 A;  3U4Y A;  2P9P C;  4J82 A;  1SQJ A;  1SHY B;  4ERY A;  4UM9 A;  1FWX A;  3PVU B;  3BWS A;  3VI4 A;  4EWR A;  3IUQ A;  4L3H D;  2VDP A;  3I7K A;  3ZDX A;  4ZN4 A;  2BCJ B;  1L5G A;  4A11 A;  3J81 g;  4PNK B;  2MTA H;  3UR4 A;  1H2W A;  5M5R A;  1VE7 A;  2IAA A;  4ERQ A;  3OL2 B;  3PE7 A;  5C2W B;  3MXX A;  3NID A;  2OJY A;  2OVQ B;  3T3P A;  1K32 A;  2Z2P A;  2Z2O A;  3AL9 A;  4E5Z B;  4A09 B;  3FM0 A;  1E5T A;  3K72 A;  4R7A B;  1XIP A;  5FFG A;  5CXC B;  2YNN A;  2W18 A;  5JWZ A;  4A08 B;  1VZ3 A;  2H3X A;  2YMU A;  1GOH A;  3PVW B;  5GXI A;  4AX4 A;  3IIY A;  5EM2 B;  2G9A A;  2I3T A;  4JHN A;  4JD2 C;  2HYE A;  5IJ7 E;  2CN3 A;  3I8C A;  2H6Q A;  4ZOY A;  5THA A;  3EI2 A;  2H9L A;  4CI2 A;  3PXT D;  4X3E A;  2Z2N A;  3JRO A;  5I5M A;  5FFO A;  5C2V B;  2OVR B;  3JPX A;  3O4J A;  4J79 A;  4MMY A;  3RFH A;  4NSX A;  2H9N A;  3IUM A;  3IUJ A;  5EAM A;  4GQ2 P;  5EAR A;  3UVM A;  3SMR A;  3EI3 A;  4FB1 D;  5IJ8 E;  1NR0 A;  2VDM A;  5FKS A;  3J80 g;  4L1Q D;  1TYE A;  2BBK H;  2HXC A;  3FCS A;  3NVQ A;  3DDU A;  4X63 B;  2HES X;  3DXK C;  3IUR A;  3ULE C;  2EIE A;  5H1M A;  4E54 A;  1B9X A;  4GM3 A;  4G1M A;  3DXM C;  3RLM D;  3FRX A;  3E0C A;  3MVD K;  1P22 A;  3SHF A;  1A0R B;  2G99 A;  4L3G D;  2H9M A;  4O1Q D;  5HE1 B;  4XYH A;  3V9F A;  2UZY B;  2IWK A;  4L9O A;  2EIB A;  5AMS A;  4X61 B;  3EQ9 A;  4HDJ A;  2VC2 A;  4ZOX A;  4NEN A;  4BP9 A;  3IUN A;  3OL2 A;  3I2N A;  2QC5 A;  2YNO A;  4PBY A;  3RFG A;  1ERJ A;  2AGL A;  1RI6 A;  5AJA A;  3MZL A;  4X60 B;  1U4C A;  4K3I D;  4PXW A;  3MKS B;  5FKT A;  3RN1 D;  2J57 G;  3OKT A;  3C99 A;  5CXC A;  3DWL C;  4A08 A;  2AGX A;  1S4U X;  3OF7 A;  3RMZ D;  4O3U B;  2JKX A;  1A12 A;  3L4O D;  4J86 A;  1TBG A;  5M5V A;  2HKR A;  2XDW A;  2EIC A;  4FAV D;  3EI4 A;  3PSL A;  1SQ9 A;  3SXT D;  2I0T A;  3ZDZ A;  4WK4 A;  4ZOV A;  4U7A A;  4G1E A;  4KFM B;  1XKS A;  5A2Q g;  2IUR A;  3SWS D;  1VZ2 A;  4G56 B;  1UOQ A;  2I3S A;  1R5M A;  4E54 B;  5FXY A;  4YVD A;  5IGO A;  5I5I A;  4DNU A;  4JXM A;  5IGQ A; 
#chains in the Genus database with same CATH homology
 2IUP A;  4BUJ C;  2CNX A;  3DSM A;  2P9S C;  4LGN A;  3IJC A;  4GGA A;  4A2L A;  3B7F A;  2B4E A;  4PSX B;  4Y5R D;  3SBQ A;  5AFU 3;  5EAL A;  3CIK B;  4XEI C;  3UVO A;  4BL0 A;  2H13 A;  3V7D B;  4H5J A;  2HJ4 A;  2IUV A;  3OKY B;  2J56 H;  1GG2 B;  5B4W A;  2HKM A;  1GOT B;  5FA5 B;  3SVW D;  2YBA A;  3PXS D;  4J84 A;  4QL1 A;  4PC0 A;  5FKQ A;  2H6K A;  4XYI A;  3PXW D;  5CXB B;  4FA1 D;  2B5L A;  3I7N A;  3EI4 B;  5CYK A;  2CE9 A;  5IT9 g;  3RRM C;  4CY3 A;  3I7H A;  4J77 A;  4LG9 A;  3EWE A;  5K19 A;  3W15 A;  2H47 A;  5FLX g;  3F3P A;  4TZ4 A;  4GQ1 A;  1JJU B;  3VA6 A;  2XU7 A;  3I7O A;  4QQE A;  1OLZ A;  2HJB A;  4J81 A;  5H14 A;  2PM7 B;  5FQD A;  4FA4 D;  4CY2 A;  3SFZ A;  4ESG A;  3P4F A;  3IJ0 A;  3DM0 A;  3KRX B;  4PSW B;  4CZY A;  2XL3 A;  2P9K C;  3GFC A;  2P9N C;  4O45 A;  3AH8 B;  4GZ8 A;  5K1C C;  4J8G A;  2I0R A;  4PBZ A;  2OVP B;  4J8B A;  4OWR A;  3VGZ A;  1N6D A;  2H68 A;  2H6N A;  4H5I A;  4A7J A;  3CFV A;  2GNQ A;  2O9K A;  4JSV C;  1YFQ A;  3F3G A;  5CYK B;  4BH6 A;  5HE3 B;  3AFC A;  3OKY A;  4JT6 C;  5C9Z B;  3I7L A;  4FWW A;  4Z8L A;  3PSC B;  3OW8 A;  2AGY A;  1MG2 A;  1B9Y A;  5TEE A;  2CO0 C;  3UKR C;  3UVK A;  4GGC A;  4CI1 A;  4FHL A;  4J87 A;  3VH0 A;  4J73 A;  4A0B A;  5CXB A;  5HQG A;  4GQB B;  5EML B;  3RN0 D;  3I89 A;  4O3T B;  4JSP C;  3NVN A;  4CZV A;  2H9P A;  4LG8 A;  3N0D A;  5GSA A;  3I7P A;  5H17 A;  1TYQ C;  4I79 A;  4CI3 A;  1JOF A;  1PGU A;  4ES0 A;  1PBY B;  4AOW A;  3IIW A;  4CY1 A;  3JZG A;  1VYH C;  3IKO A;  4JSX C;  3JZH A;  3UKU C;  2OK4 A;  4MK0 B;  2XYI A;  1MDA H;  3GRE A;  3KRW B;  2B5N A;  5HE0 B;  3EG6 A;  4IMM A;  2CN2 A;  3A0F A;  3RSE C;  3NVX A;  3BG1 A;  4CY5 A;  1OMW B;  3JB9 L;  3N0E A;  1L0Q A;  2J55 H;  4D6V A;  3JZN A;  2UZX B;  5GMK n;  5HYN B;  4IA9 A;  2GC4 A;  4N14 A;  4GM9 A;  4A0A A;  4J78 A;  4A0B B;  4UI9 R;  4FA5 D;  4AEZ A;  2GC7 A;  3OTT A;  3IJ1 A;  1GXR A;  4ZOZ A;  4ERZ A;  1PI6 A;  3EI1 A;  3SBP A;  2AGW A;  2AH0 A;  2PM6 B;  1PEV A;  5EMM B;  4GMB A;  5TEF A;  2IUQ A;  5HE2 B;  3JRP A;  2PM9 B;  1N6E A;  1U2V C;  3CFS B;  2Q7Q A;  5EAP A;  2XL2 A;  3MMY A;  5EMJ B;  2OK6 A;  4QRJ A;  5KDO B;  4A2M A;  3EU7 A;  5SXM A;  3ORV D;  3MZK A;  2YB8 B;  4D0K A;  2H14 A;  2YNP A;  2OIZ A;  2QXV A;  4CI8 A;  3SCY A;  1N6F A;  2TRC B;  2CO0 A;  3K27 A;  2CE8 A;  2IWF A;  2B5M A;  3SBR A;  5GXH A;  4A11 B;  3AL8 A;  1JMX B;  3SJL D;  1QNI A;  3MKQ A;  1Q47 A;  4A0A B;  3HFQ A;  3F3F A;  3UVN A;  3ZWL B;  3I8E A;  4CZX A;  3JAM g;  3ODT A;  5FKR A;  1K8K C;  5TDH B;  3EI1 B;  2P9U C;  5IC7 A;  2EBS A;  3C75 H;  1GP2 B;  4J0X A;  1MG3 A;  1NEX B;  4O9D A;  2P9L C;  3V5W B;  3K26 A;  3SLE D;  3SN6 B;  4FA9 D;  2AGZ A;  4U1E I;  4FAN D;  3C9C A;  4K3J B;  3FGB A;  2I0S A;  3C5M A;  4GGD A;  4Y7R A;  4CC9 A;  3UVL A;  5TF2 A;  3EI2 B;  4E5Z A;  4A09 A;  2PBI B;  2AQ5 A;  2PM9 A;  1JMZ B;  5EMK B;  3L4M D;  4J0W A;  4QT8 A;  5EM2 A;  1XHM A;  3EI3 B;  4OZU A;  2P9I C;  3AL8 B;  2AH1 A;  4JSN C;  4JT5 C;  4GM8 A;  3BG0 A;  3OKW A;  3EMH A;  5I5J A;  3U4Y A;  2P9P C;  4J82 A;  1SQJ A;  1SHY B;  4ERY A;  1FWX A;  3PVU B;  3BWS A;  4EWR A;  4L3H D;  3I7K A;  4ZN4 A;  2BCJ B;  4A11 A;  3J81 g;  4PNK B;  2MTA H;  3UR4 A;  2IAA A;  4ERQ A;  3OL2 B;  3PE7 A;  5C2W B;  3MXX A;  2OJY A;  2OVQ B;  1K32 A;  2Z2P A;  2Z2O A;  3AL9 A;  4E5Z B;  4A09 B;  3FM0 A;  4R7A B;  1XIP A;  5CXC B;  2YNN A;  2W18 A;  5JWZ A;  4A08 B;  2H3X A;  2YMU A;  3PVW B;  5GXI A;  3IIY A;  5EM2 B;  2G9A A;  2I3T A;  4JD2 C;  2HYE A;  5IJ7 E;  2CN3 A;  3I8C A;  2H6Q A;  4ZOY A;  5THA A;  3EI2 A;  2H9L A;  4CI2 A;  3PXT D;  4X3E A;  2Z2N A;  3JRO A;  5I5M A;  5C2V B;  2OVR B;  3JPX A;  4J79 A;  3RFH A;  4NSX A;  2H9N A;  5EAM A;  3UVM A;  4GQ2 P;  5EAR A;  3SMR A;  3EI3 A;  4FB1 D;  5IJ8 E;  1NR0 A;  5FKS A;  3J80 g;  4L1Q D;  2BBK H;  2HXC A;  3NVQ A;  4X63 B;  2HES X;  3DXK C;  3ULE C;  5H1M A;  4E54 A;  1B9X A;  4GM3 A;  3DXM C;  3RLM D;  3FRX A;  3E0C A;  1P22 A;  3SHF A;  1A0R B;  2G99 A;  4L3G D;  2H9M A;  4O1Q D;  5HE1 B;  4XYH A;  3V9F A;  2UZY B;  2IWK A;  4L9O A;  5AMS A;  4X61 B;  4HDJ A;  4ZOX A;  3OL2 A;  3I2N A;  2QC5 A;  2YNO A;  4PBY A;  3RFG A;  1ERJ A;  2AGL A;  1RI6 A;  5AJA A;  3MZL A;  4X60 B;  1U4C A;  4K3I D;  4PXW A;  3MKS B;  5FKT A;  3RN1 D;  2J57 G;  3OKT A;  3C99 A;  5CXC A;  3DWL C;  4A08 A;  2AGX A;  1S4U X;  3RMZ D;  4O3U B;  3L4O D;  4J86 A;  1TBG A;  2HKR A;  4FAV D;  3EI4 A;  3PSL A;  1SQ9 A;  3SXT D;  2I0T A;  4ZOV A;  4U7A A;  4KFM B;  1XKS A;  5A2Q g;  2IUR A;  3SWS D;  4G56 B;  2I3S A;  1R5M A;  4E54 B;  5FXY A;  4YVD A;  5IGO A;  5I5I A;  4JXM A;  5IGQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...