2XL2A

Wdr5 in complex with an rbbp5 peptide recruited to novel site
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
304
structure length
304
Chain Sequence
VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords WD REPEAT-CONTAINING PROTEIN 5
publication title Characterisation of a Novel Wdr5 Binding Site that Recruits Rbbp5 Through a Conserved Motif and Enhances Methylation of H3K4 by Mll1.
pubmed doi rcsb
source organism Mus musculus
total genus 104
structure length 304
sequence length 304
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2xl2A00
4JSNC 5H14A 2I0RA 2AGYA 3VGZA 3I7OA 2XL3A 4GM8A 4A0BB 3HFQA 3EI1B 2H6NA 2TRCB 4ERZA 4E5ZA 4J0XA 4O3TB 4PSXB 4D0KA 1GXRA 4O3UB 4OZUA 4PXWA 2J55H 1NEXB 4FA1D 3NVQA 4JT6C 4Y7RA 4J0WA 4FWWA 3V9FA 5CXCB 1R5MA 3JPXA 5B4WA 4FAVD 3KRWB 2HKRA 3EG6A 3PVWB 4GM3A 1TYQC 3IKOA 3IJ1A 4CY2A 5EAPA 4QRJA 2AH1A 2HYEA 4G56B 2B4EA 3IJ0A 1PBYB 5EMLB 5C2WB 2HJBA 3B7FA 3EI4A 2OVPB 2H3XA 4ZOVA 4XYIA 1K32A 3VA6A 5HE0B 4IA9A 2O9KA 3RFHA 4PNKB 4J8BA 4CI8A 4Y5RD 4O9DA 5GXHA 3DWLC 4FA9D 4GGCA 2YNOA 4ZOZA 2HKMA 3N0EA 2AGLA 5HE1B 3UVNA 4GZ8A 3KRXB 4A0BA 3EI1A 3UVOA 4CI1A 2CNXA 5EARA 2UZXB 2HJ4A 2P9UC 5EMJB 2Q7QA 1K8KC 2G9AA 3MXXA 5TEEA 3RMZD 5HQGA 3V7DB 5IGQA 5CXBB 1YFQA 4FAND 4CZVA 4BL0A 2PM7B 4JSVC 4QQEA 3UKUC 2H9LA 4FA5D 2W18A 4I79A 4PBYA 2H9PA 4A2LA 3GFCA 4PSWB 3C75H 4U7AA 3ULEC 4ZOYA 1A0RB 3C99A 4A2MA 2Z2NA 1U4CA 5CXCA 3ORVD 4O1QD 3GREA 2IUPA 3JROA 1S4UX 2OK4A 2B5LA 2PM6B 3AH8B 2PM9B 4UI9R 3FM0A 4L3GD 1FWXA 2HXCA 4GQ2P 3EI2B 4K3ID 2IUVA 5HE2B 5IT9g 3OTTA 1B9YA 2CN2A 1Q47A 2J56H 4PBZA 4ZN4A 1NR0A 2AH0A 2P9SC 4HDJA 4KFMB 4A09B 5SXMA 2BCJB 3AFCA 4X63B 3OW8A 2AGZA 2H9NA 3RLMD 5H1MA 3MMYA 3EI3B 2GC7A 3ZWLB 3V5WB 3CFVA 3FRXA 3SFZA 4CZYA 2H6KA 3OL2A 4EWRA 4H5IA 3SMRA 4ES0A 2B5MA 3SBPA 5CXBA 5I5JA 2CO0C 4MK0B 1RI6A 2GC4A 1L0QA 3W15A 1PGUA 2G99A 1JMXB 4IMMA 4J77A 4PC0A 3SBRA 2IAAA 2YB8B 3I7LA 3JZGA 4YVDA 5FKQA 3C5MA 2P9LC 5TEFA 2CE9A 4A0AA 2EBSA 3DXKC 2HESX 5AFU3 2PM9A 4CY3A 1N6EA 3CFSB 3C9CA 4ERQA 2YMUA 2P9KC 2XYIA 3EI2A 3E0CA 4J73A 3UVLA 5EALA 3BG0A 3JZHA 5FKTA 4JD2C 4JSXC 3RSEC 3K27A 2I0TA 2Z2OA 3EMHA 4A09A 4QT8A 5EMMB 3JRPA 1JJUB 4LGNA 2OVQB 5EAMA 3SXTD 4OWRA 1GG2B 2YNNA 3P4FA 5CYKB 2J57G 3NVXA 3EU7A 1P22A 2P9IC 1MG2A 3EI3A 1JMZB 4GGAA 2I0SA 2OK6A 1OMWB 2OJYA 4LG8A 3SJLD 5GXIA 5C2VB 4AEZA 3SVWD 4FHLA 3OKWA 4A08B 5FA5B 4BH6A 3ODTA 1OLZA 3UVKA 4CY1A 4CC9A 5GSAA 3MZLA 4BUJC 3FGBA 5EM2B 1U2VC 4J78A 3RN0D 3UKRC 3I89A 2CN3A 2H68A 3F3PA 4X3EA 1GP2B 5THAA 1SQ9A 1JOFA 3AL8B 3SBQA 2BBKH 5AMSA 5AJAA 2QXVA 4GGDA 5JWZA 4ESGA 2YNPA 3I7PA 4LG9A 4FB1D 1MDAH 3JB9L 5H17A 2B5NA 5HYNB 4L1QD 4JSPC 2I3SA 1N6DA 4XEIC 2H9MA 3BG1A 3PVUB 2GNQA 4J79A 3DSMA 4J81A 4QL1A 5CYKA 4TZ4A 3SWSD 3RRMC 3J81g 4GMBA 3I7KA 3PXSD 3RN1D 3I7HA 3I8EA 3MKQA 3L4OD 3OKYB 2Z2PA 2IURA 3MZKA 4FA4D 2IWFA 2P9NC 4E54B 4A08A 4XYHA 3MKSB 2OIZA 3A0FA 3SCYA 4ZOXA 3VH0A 3PXWD 3PSLA 1PI6A 4JXMA 5EM2A 4A11B 3L4MD 3F3GA 5TF2A 3N0DA 4X61B 3DM0A 4JT5C 4U1EI 4H5JA 4CI3A 3U4YA 5IGOA 4D6VA 3NVNA 2H47A 4CZXA 2IUQA 5K19A 4J84A 3DXMC 3AL8A 3SHFA 5IJ8E 2AGXA 5I5MA 5KDOB 1ERJA 5FLXg 3K26A 2IWKA 3UVMA 4L3HD 4O45A 4GQBB 1XHMA 2PBIB 5EMKB 2AGWA 5IJ7E 1XIPA 4L9OA 5HE3B 4X60B 4ERYA 4AOWA 4Z8LA 4E5ZB 3CIKB 3OKTA 1VYHC 3I8CA 5FXYA 2YBAA 1TBGA 4J86A 3I2NA 5C9ZB 2AQ5A 4J82A 4A7JA 3OL2B 3OKYA 2H13A 5TDHB 4CY5A 2CE8A 1B9XA 2H6QA 4E54A 5FQDA 2XL2A 2OVRB 1SHYB 2UZYB 3F3FA 4GQ1A 4K3JB 1MG3A 1PEVA 5FKSA 3JZNA 3BWSA 3SN6B 1XKSA 4CI2A 2CO0A 2H14A 4J87A 4J8GA 4A11A 2I3TA 3AL9A 5K1CC 1QNIA 4A0AB 1N6FA 2XU7A 1GOTB 3EWEA 3RFGA 2P9PC 5I5IA 3EI4B 2QC5A 3J80g 3IJCA 1SQJA 3PE7A 3SLED 4GM9A 5A2Qg 4N14A 3PSCB 5FKRA 3UR4A 3IIYA 5GMKn 3JAMg 4R7AB 3I7NA 5IC7A 4NSXA 3IIWA 3PXTD 2MTAH
chains in the Genus database with same CATH superfamily
1UOPA 4JSNC 5H14A 2I0RA 2AGYA 3VGZA 3I7OA 4AN1A 3K71A 2XL3A 4GM8A 4A0BB 3HFQA 3EI1B 2H6NA 1VE7A 2TRCB 3IUMA 2VDOA 1U8CA 5HDBA 4ERZA 4E5ZA 4J0XA 4O3TB 4PSXB 4D0KA 1JTDB 1GXRA 3NIFA 4L1MA 4O3UB 4DNUA 4OZUA 4WK2A 4G1EA 4PXWA 2J55H 1NEXB 4FA1D 2VZ3A 4O2WA 5E6RA 3NVQA 4JT6C 4Y7RA 4J0WA 3O4IA 1L5GA 3MVDK 4FWWA 3NIGA 3V9FA 5CXCB 1R5MA 3JPXA 5B4WA 4FAVD 3KRWB 3VI4A 1H2YA 2HKRA 3EG6A 3PVWB 4GM3A 1TYQC 3IKOA 3IJ1A 4CY2A 2VC2A 5EAPA 4QRJA 4Z7QA 2AH1A 2HYEA 4G56B 4NENA 3K72A 2B4EA 3IJ0A 1PBYB 5EMLB 5C2WB 2HJBA 3B7FA 4DNVA 3EI4A 4JHPC 3ZDYA 2OVPB 1H2XA 2H3XA 4ZOVA 3IURA 3IUNA 4IRZA 5FFGA 4XYIA 1K32A 3VA6A 3IULA 5HE0B 4D9SA 4IA9A 2O9KA 3RFHA 4PNKB 4J8BA 4CI8A 4Y5RD 4O9DA 5GXHA 3DWLC 4FA9D 4GGCA 2YNOA 4ZOZA 2HKMA 3IUQA 3N0EA 2AGLA 5HE1B 4WK0A 5M5VA 4WK4A 3UVNA 4GZ8A 3KRXB 4A0BA 1T2XA 4O02A 1K3IA 3EI1A 3UVOA 4CI1A 1UTCA 2CNXA 5EARA 2UZXB 2HJ4A 2P9UC 3MUNA 5EMJB 2Q7QA 4BP9A 1K8KC 2G9AA 3MXXA 5TEEA 3RMZD 5HQGA 3V7DB 5IGQA 5CXBB 5M5TA 1YFQA 4FAND 4CZVA 4BL0A 2VDRA 2PM7B 4JSVC 4QQEA 3UKUC 1UOQA 2H9LA 5E6SA 4FA5D 2W18A 4I79A 4PBYA 2H9PA 4A2LA 2VDLA 3GFCA 4PSWB 3C75H 4U7AA 1O6FA 1H2ZA 3ULEC 4ZOYA 1A0RB 3C99A 4A2MA 2Z2NA 1U4CA 5CXCA 3ORVD 4O1QD 3GREA 2IUPA 3JROA 3EQ7A 1S4UX 2OK4A 2XDWA 2B5LA 2PM6B 3MUOA 3AH8B 2PM9B 4UI9R 2VDKA 3FM0A 4L3GD 1FWXA 2HXCA 4GQ2P 3EI2B 4K3ID 2IUVA 5HE2B 5IT9g 3OTTA 1QFMA 1B9YA 4RE5A 2CN2A 4AMZA 1TYEA 1Q47A 2J56H 4PBZA 4ZN4A 5M61A 1E5TA 5M5RA 3T3PA 2EIDA 1NR0A 2AH0A 2P9SC 2QR5A 4HDJA 3EQ8A 4KFMB 4BCDA 4A09B 4BCBA 1GOHA 5SXMA 2BCJB 2HU7A 3AFCA 4UM8A 2BKLA 4X63B 3OW8A 2AGZA 3O4GA 2H9NA 3RLMD 5H1MA 3MMYA 3EI3B 2GC7A 3ZWLB 4MMXA 3V5WB 3CFVA 3FRXA 3SFZA 4CZYA 1GOGA 2H6KA 3OL2A 4EWRA 4H5IA 3SMRA 4ES0A 2B5MA 3SBPA 5CXBA 5I5JA 2CO0C 1E8NA 2VDMA 4MK0B 4NBMA 1RI6A 4G1MA 2GC4A 1L0QA 3W15A 1PGUA 2G99A 1JMXB 4IMMA 4J77A 4PC0A 3SBRA 2IAAA 2YB8B 1A12A 3I7LA 3JZGA 4YVDA 5FKQA 3C5MA 2P9LC 2XZGA 4BCCA 5TEFA 2CE9A 2EIEA 4AX4A 4A0AA 5M5SA 5M5UA 2EBSA 3DXKC 1VZ2A 2HESX 5AFU3 2PM9A 4CY3A 1N6EA 3CFSB 3C9CA 3IVMA 4ERQA 2YMUA 2P9KC 2XYIA 3EI2A 3E0CA 4J73A 3UVLA 5EALA 3BG0A 3JZHA 1VE6A 4JD2C 5FKTA 4JSXC 3RSEC 3V4PA 1JV2A 3K27A 2I0TA 2Z2OA 3EMHA 4A09A 4QT8A 5EMMB 3JRPA 1JJUB 4LGNA 2OVQB 5EAMA 3T3MA 3SXTD 4OWRA 1GG2B 2YNNA 3P4FA 5CYKB 3O4JA 3IUJA 2J57G 4G55A 4JHNA 3NVXA 3EU7A 1P22A 2P9IC 1MG2A 1YR2A 3EI3A 1JMZB 4GGAA 2I0SA 2OK6A 1OMWB 2OJYA 2EICA 2VDQA 4LG8A 3SJLD 4RE6A 5GXIA 5C2VB 4AEZA 3SVWD 4FHLA 3OKWA 4A08B 5FA5B 4BH6A 3ODTA 1OLZA 3UVKA 4CY1A 2JKXA 2HU5A 4CC9A 5GSAA 1C9LA 3MZLA 4BUJC 3FGBA 4WJKA 5EM2B 4BP8A 1U2VC 3K6SA 4J78A 3RN0D 4NAAA 2HU8A 3UKRC 3I89A 2CN3A 2H68A 3F3PA 4X3EA 1GP2B 5THAA 1SQ9A 3EQ9A 3GC3B 1JOFA 3QI0A 3AL8B 3SBQA 2BBKH 5AMSA 5AJAA 2QXVA 4AMYA 4GGDA 3ZDXA 5JWZA 4ESGA 3ZE1A 2YNPA 3I7PA 4LG9A 4FB1D 1MDAH 3JB9L 5H17A 2B5NA 5HYNB 4JSPC 4L1QD 2I3SA 1N6DA 4XEIC 2H9MA 4NC4A 3BG1A 3PVUB 1E8MA 2GNQA 4J79A 3DSMA 3KCIA 4J81A 4QL1A 5CYKA 4TZ4A 3SWSD 3RRMC 3J81g 4GMBA 3I7KA 3PXSD 3RN1D 3I7HA 3I8EA 3MKQA 2QZPA 3L4OD 3OKYB 2Z2PA 1UOOA 3ZE0A 2IURA 3MZKA 4AN0A 4FA4D 2IWFA 2P9NC 5C92A 4E54B 4A08A 4XYHA 3MKSB 2OIZA 3IJEA 3A0FA 5E6UA 3SCYA 1H2WA 1BPOA 4ZOXA 3VH0A 3PXWD 3PSLA 3FCSA 1PI6A 4JXMA 5EM2A 4A11B 3L4MD 1QFSA 3F3GA 5TF2A 3N0DA 4X61B 3DM0A 4JT5C 4U1EI 4H5JA 3GD1I 4CI3A 3U4YA 5IGOA 4D6VA 3O4HA 3NVNA 5C86A 3QHYB 2H47A 4CZXA 3VI3A 2IUQA 2XE4A 5K19A 4J84A 3DXMC 3AL8A 3FCUA 3SHFA 5IJ8E 2AGXA 5I5MA 5KDOB 1ERJA 5FLXg 3K26A 3V4VA 3DDUA 2IWKA 3UVMA 4L3HD 4O45A 4GQBB 1XHMA 2PBIB 5EMKB 2AGWA 5IJ7E 2VZ1A 1XIPA 4L9OA 5HE3B 4X60B 4ERYA 4AOWA 4Z8LA 4E5ZB 3CIKB 3OKTA 1VYHC 3I8CA 5FXYA 2YBAA 4Z7NA 2EIBA 3OF7A 2VDPA 4DNWA 1VZ3A 1TBGA 1M1XA 4J86A 4MMZA 3I2NA 3ZE2A 5C9ZB 2AQ5A 1I2MB 4J82A 4A7JA 3OL2B 2WQ8A 3OKYA 2H13A 5TDHB 4CY5A 2CE8A 1B9XA 2H6QA 4E54A 5FQDA 4Z7OA 2XL2A 2OVRB 1SHYB 2UZYB 3F3FA 2VDNA 4GQ1A 4K3JB 1MG3A 1PEVA 5FKSA 3JZNA 3BWSA 3SN6B 1XKSA 4CI2A 2CO0A 2H14A 4UM9A 4J87A 4J8GA 4A11A 2I3TA 1GOFA 3AL9A 1C9IA 5K1CC 1QNIA 4A0AB 3EWEA 1N6FA 1GOTB 2XU7A 3RFGA 3ZDZA 2P9PC 5I5IA 3EI4B 2QC5A 3J80g 5FFOA 1O6GA 1SQJA 3IJCA 3PE7A 3SLED 4GM9A 5A2Qg 4N14A 3PSCB 5FKRA 3UR4A 3IIYA 5GMKn 3JAMg 4R7AB 3I7NA 5IC7A 4NSXA 4QAMA 4MMYA 3IIWA 3PXTD 2MTAH 3NIDA
chains in the Genus database with same CATH topology
4JSNC 5H14A 2I0RA 2AGYA 3VGZA 3I7OA 2XL3A 4GM8A 4A0BB 3HFQA 3EI1B 2H6NA 2TRCB 4ERZA 4E5ZA 4J0XA 4O3TB 4PSXB 4D0KA 1GXRA 4O3UB 4OZUA 4PXWA 2J55H 1NEXB 4FA1D 3NVQA 4JT6C 4Y7RA 4J0WA 4FWWA 3V9FA 5CXCB 1R5MA 3JPXA 5B4WA 4FAVD 3KRWB 2HKRA 3EG6A 3PVWB 4GM3A 1TYQC 3IKOA 3IJ1A 4CY2A 5EAPA 4QRJA 2AH1A 2HYEA 4G56B 2B4EA 3IJ0A 1PBYB 5EMLB 5C2WB 2HJBA 3B7FA 3EI4A 2OVPB 2H3XA 4ZOVA 4XYIA 1K32A 3VA6A 5HE0B 4IA9A 2O9KA 3RFHA 4PNKB 4J8BA 4CI8A 4Y5RD 4O9DA 5GXHA 3DWLC 4FA9D 4GGCA 2YNOA 4ZOZA 2HKMA 3N0EA 2AGLA 5HE1B 3UVNA 4GZ8A 3KRXB 4A0BA 3EI1A 3UVOA 4CI1A 2CNXA 5EARA 2UZXB 2HJ4A 2P9UC 5EMJB 2Q7QA 1K8KC 2G9AA 3MXXA 5TEEA 3RMZD 5HQGA 3V7DB 5IGQA 5CXBB 1YFQA 4FAND 4CZVA 4BL0A 2PM7B 4JSVC 4QQEA 3UKUC 2H9LA 4FA5D 2W18A 4I79A 4PBYA 2H9PA 4A2LA 3GFCA 4PSWB 3C75H 4U7AA 3ULEC 4ZOYA 1A0RB 3C99A 4A2MA 2Z2NA 1U4CA 5CXCA 3ORVD 4O1QD 3GREA 2IUPA 3JROA 1S4UX 2OK4A 2B5LA 2PM6B 3AH8B 2PM9B 4UI9R 3FM0A 4L3GD 1FWXA 2HXCA 4GQ2P 3EI2B 4K3ID 2IUVA 5HE2B 5IT9g 3OTTA 1B9YA 2CN2A 1Q47A 2J56H 4PBZA 4ZN4A 1NR0A 2AH0A 2P9SC 4HDJA 4KFMB 4A09B 5SXMA 2BCJB 3AFCA 4X63B 3OW8A 2AGZA 2H9NA 3RLMD 5H1MA 3MMYA 3EI3B 2GC7A 3ZWLB 3V5WB 3CFVA 3FRXA 3SFZA 4CZYA 2H6KA 3OL2A 4EWRA 4H5IA 3SMRA 4ES0A 2B5MA 3SBPA 5CXBA 5I5JA 2CO0C 4MK0B 1RI6A 2GC4A 1L0QA 3W15A 1PGUA 2G99A 1JMXB 4IMMA 4J77A 4PC0A 3SBRA 2IAAA 2YB8B 3I7LA 3JZGA 4YVDA 5FKQA 3C5MA 2P9LC 5TEFA 2CE9A 4A0AA 2EBSA 3DXKC 2HESX 5AFU3 2PM9A 4CY3A 1N6EA 3CFSB 3C9CA 4ERQA 2YMUA 2P9KC 2XYIA 3EI2A 3E0CA 4J73A 3UVLA 5EALA 3BG0A 3JZHA 5FKTA 4JD2C 4JSXC 3RSEC 3K27A 2I0TA 2Z2OA 3EMHA 4A09A 4QT8A 5EMMB 3JRPA 1JJUB 4LGNA 2OVQB 5EAMA 3SXTD 4OWRA 1GG2B 2YNNA 3P4FA 5CYKB 2J57G 3NVXA 3EU7A 1P22A 2P9IC 1MG2A 3EI3A 1JMZB 4GGAA 2I0SA 2OK6A 1OMWB 2OJYA 4LG8A 3SJLD 5GXIA 5C2VB 4AEZA 3SVWD 4FHLA 3OKWA 4A08B 5FA5B 4BH6A 3ODTA 1OLZA 3UVKA 4CY1A 4CC9A 5GSAA 3MZLA 4BUJC 3FGBA 5EM2B 1U2VC 4J78A 3RN0D 3UKRC 3I89A 2CN3A 2H68A 3F3PA 4X3EA 1GP2B 5THAA 1SQ9A 1JOFA 3AL8B 3SBQA 2BBKH 5AMSA 5AJAA 2QXVA 4GGDA 5JWZA 4ESGA 2YNPA 3I7PA 4LG9A 4FB1D 1MDAH 3JB9L 5H17A 2B5NA 5HYNB 4L1QD 4JSPC 2I3SA 1N6DA 4XEIC 2H9MA 3BG1A 3PVUB 2GNQA 4J79A 3DSMA 4J81A 4QL1A 5CYKA 4TZ4A 3SWSD 3RRMC 3J81g 4GMBA 3I7KA 3PXSD 3RN1D 3I7HA 3I8EA 3MKQA 3L4OD 3OKYB 2Z2PA 2IURA 3MZKA 4FA4D 2IWFA 2P9NC 4E54B 4A08A 4XYHA 3MKSB 2OIZA 3A0FA 3SCYA 4ZOXA 3VH0A 3PXWD 3PSLA 1PI6A 4JXMA 5EM2A 4A11B 3L4MD 3F3GA 5TF2A 3N0DA 4X61B 3DM0A 4JT5C 4U1EI 4H5JA 4CI3A 3U4YA 5IGOA 4D6VA 3NVNA 2H47A 4CZXA 2IUQA 5K19A 4J84A 3DXMC 3AL8A 3SHFA 5IJ8E 2AGXA 5I5MA 5KDOB 1ERJA 5FLXg 3K26A 2IWKA 3UVMA 4L3HD 4O45A 4GQBB 1XHMA 2PBIB 5EMKB 2AGWA 5IJ7E 1XIPA 4L9OA 5HE3B 4X60B 4ERYA 4AOWA 4Z8LA 4E5ZB 3CIKB 3OKTA 1VYHC 3I8CA 5FXYA 2YBAA 1TBGA 4J86A 3I2NA 5C9ZB 2AQ5A 4J82A 4A7JA 3OL2B 3OKYA 2H13A 5TDHB 4CY5A 2CE8A 1B9XA 2H6QA 4E54A 5FQDA 2XL2A 2OVRB 1SHYB 2UZYB 3F3FA 4GQ1A 4K3JB 1MG3A 1PEVA 5FKSA 3JZNA 3BWSA 3SN6B 1XKSA 4CI2A 2CO0A 2H14A 4J87A 4J8GA 4A11A 2I3TA 3AL9A 5K1CC 1QNIA 4A0AB 1N6FA 2XU7A 1GOTB 3EWEA 3RFGA 2P9PC 5I5IA 3EI4B 2QC5A 3J80g 3IJCA 1SQJA 3PE7A 3SLED 4GM9A 5A2Qg 4N14A 3PSCB 5FKRA 3UR4A 3IIYA 5GMKn 3JAMg 4R7AB 3I7NA 5IC7A 4NSXA 3IIWA 3PXTD 2MTAH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JSN C;  5H14 A;  2I0R A;  2AGY A;  3VGZ A;  3I7O A;  2XL3 A;  4GM8 A;  4A0B B;  3HFQ A;  3EI1 B;  2H6N A;  2TRC B;  4ERZ A;  4E5Z A;  4J0X A;  4O3T B;  4PSX B;  4D0K A;  1GXR A;  4O3U B;  4OZU A;  4PXW A;  2J55 H;  1NEX B;  4FA1 D;  3NVQ A;  4JT6 C;  4Y7R A;  4J0W A;  4FWW A;  3V9F A;  5CXC B;  1R5M A;  3JPX A;  5B4W A;  4FAV D;  3KRW B;  2HKR A;  3EG6 A;  3PVW B;  4GM3 A;  1TYQ C;  3IKO A;  3IJ1 A;  4CY2 A;  5EAP A;  4QRJ A;  2AH1 A;  2HYE A;  4G56 B;  2B4E A;  3IJ0 A;  1PBY B;  5EML B;  5C2W B;  2HJB A;  3B7F A;  3EI4 A;  2OVP B;  2H3X A;  4ZOV A;  4XYI A;  1K32 A;  3VA6 A;  5HE0 B;  4IA9 A;  2O9K A;  3RFH A;  4PNK B;  4J8B A;  4CI8 A;  4Y5R D;  4O9D A;  5GXH A;  3DWL C;  4FA9 D;  4GGC A;  2YNO A;  4ZOZ A;  2HKM A;  3N0E A;  2AGL A;  5HE1 B;  3UVN A;  4GZ8 A;  3KRX B;  4A0B A;  3EI1 A;  3UVO A;  4CI1 A;  2CNX A;  5EAR A;  2UZX B;  2HJ4 A;  2P9U C;  5EMJ B;  2Q7Q A;  1K8K C;  2G9A A;  3MXX A;  5TEE A;  3RMZ D;  5HQG A;  3V7D B;  5IGQ A;  5CXB B;  1YFQ A;  4FAN D;  4CZV A;  4BL0 A;  2PM7 B;  4JSV C;  4QQE A;  3UKU C;  2H9L A;  4FA5 D;  2W18 A;  4I79 A;  4PBY A;  2H9P A;  4A2L A;  3GFC A;  4PSW B;  3C75 H;  4U7A A;  3ULE C;  4ZOY A;  1A0R B;  3C99 A;  4A2M A;  2Z2N A;  1U4C A;  5CXC A;  3ORV D;  4O1Q D;  3GRE A;  2IUP A;  3JRO A;  1S4U X;  2OK4 A;  2B5L A;  2PM6 B;  3AH8 B;  2PM9 B;  4UI9 R;  3FM0 A;  4L3G D;  1FWX A;  2HXC A;  4GQ2 P;  3EI2 B;  4K3I D;  2IUV A;  5HE2 B;  5IT9 g;  3OTT A;  1B9Y A;  2CN2 A;  1Q47 A;  2J56 H;  4PBZ A;  4ZN4 A;  1NR0 A;  2AH0 A;  2P9S C;  4HDJ A;  4KFM B;  4A09 B;  5SXM A;  2BCJ B;  3AFC A;  4X63 B;  3OW8 A;  2AGZ A;  2H9N A;  3RLM D;  5H1M A;  3MMY A;  3EI3 B;  2GC7 A;  3ZWL B;  3V5W B;  3CFV A;  3FRX A;  3SFZ A;  4CZY A;  2H6K A;  3OL2 A;  4EWR A;  4H5I A;  3SMR A;  4ES0 A;  2B5M A;  3SBP A;  5CXB A;  5I5J A;  2CO0 C;  4MK0 B;  1RI6 A;  2GC4 A;  1L0Q A;  3W15 A;  1PGU A;  2G99 A;  1JMX B;  4IMM A;  4J77 A;  4PC0 A;  3SBR A;  2IAA A;  2YB8 B;  3I7L A;  3JZG A;  4YVD A;  5FKQ A;  3C5M A;  2P9L C;  5TEF A;  2CE9 A;  4A0A A;  2EBS A;  3DXK C;  2HES X;  5AFU 3;  2PM9 A;  4CY3 A;  1N6E A;  3CFS B;  3C9C A;  4ERQ A;  2YMU A;  2P9K C;  2XYI A;  3EI2 A;  3E0C A;  4J73 A;  3UVL A;  5EAL A;  3BG0 A;  3JZH A;  5FKT A;  4JD2 C;  4JSX C;  3RSE C;  3K27 A;  2I0T A;  2Z2O A;  3EMH A;  4A09 A;  4QT8 A;  5EMM B;  3JRP A;  1JJU B;  4LGN A;  2OVQ B;  5EAM A;  3SXT D;  4OWR A;  1GG2 B;  2YNN A;  3P4F A;  5CYK B;  2J57 G;  3NVX A;  3EU7 A;  1P22 A;  2P9I C;  1MG2 A;  3EI3 A;  1JMZ B;  4GGA A;  2I0S A;  2OK6 A;  1OMW B;  2OJY A;  4LG8 A;  3SJL D;  5GXI A;  5C2V B;  4AEZ A;  3SVW D;  4FHL A;  3OKW A;  4A08 B;  5FA5 B;  4BH6 A;  3ODT A;  1OLZ A;  3UVK A;  4CY1 A;  4CC9 A;  5GSA A;  3MZL A;  4BUJ C;  3FGB A;  5EM2 B;  1U2V C;  4J78 A;  3RN0 D;  3UKR C;  3I89 A;  2CN3 A;  2H68 A;  3F3P A;  4X3E A;  1GP2 B;  5THA A;  1SQ9 A;  1JOF A;  3AL8 B;  3SBQ A;  2BBK H;  5AMS A;  5AJA A;  2QXV A;  4GGD A;  5JWZ A;  4ESG A;  2YNP A;  3I7P A;  4LG9 A;  4FB1 D;  1MDA H;  3JB9 L;  5H17 A;  2B5N A;  5HYN B;  4L1Q D;  4JSP C;  2I3S A;  1N6D A;  4XEI C;  2H9M A;  3BG1 A;  3PVU B;  2GNQ A;  4J79 A;  3DSM A;  4J81 A;  4QL1 A;  5CYK A;  4TZ4 A;  3SWS D;  3RRM C;  3J81 g;  4GMB A;  3I7K A;  3PXS D;  3RN1 D;  3I7H A;  3I8E A;  3MKQ A;  3L4O D;  3OKY B;  2Z2P A;  2IUR A;  3MZK A;  4FA4 D;  2IWF A;  2P9N C;  4E54 B;  4A08 A;  4XYH A;  3MKS B;  2OIZ A;  3A0F A;  3SCY A;  4ZOX A;  3VH0 A;  3PXW D;  3PSL A;  1PI6 A;  4JXM A;  5EM2 A;  4A11 B;  3L4M D;  3F3G A;  5TF2 A;  3N0D A;  4X61 B;  3DM0 A;  4JT5 C;  4U1E I;  4H5J A;  4CI3 A;  3U4Y A;  5IGO A;  4D6V A;  3NVN A;  2H47 A;  4CZX A;  2IUQ A;  5K19 A;  4J84 A;  3DXM C;  3AL8 A;  3SHF A;  5IJ8 E;  2AGX A;  5I5M A;  5KDO B;  1ERJ A;  5FLX g;  3K26 A;  2IWK A;  3UVM A;  4L3H D;  4O45 A;  4GQB B;  1XHM A;  2PBI B;  5EMK B;  2AGW A;  5IJ7 E;  1XIP A;  4L9O A;  5HE3 B;  4X60 B;  4ERY A;  4AOW A;  4Z8L A;  4E5Z B;  3CIK B;  3OKT A;  1VYH C;  3I8C A;  5FXY A;  2YBA A;  1TBG A;  4J86 A;  3I2N A;  5C9Z B;  2AQ5 A;  4J82 A;  4A7J A;  3OL2 B;  3OKY A;  2H13 A;  5TDH B;  4CY5 A;  2CE8 A;  1B9X A;  2H6Q A;  4E54 A;  5FQD A;  2XL2 A;  2OVR B;  1SHY B;  2UZY B;  3F3F A;  4GQ1 A;  4K3J B;  1MG3 A;  1PEV A;  5FKS A;  3JZN A;  3BWS A;  3SN6 B;  1XKS A;  4CI2 A;  2CO0 A;  2H14 A;  4J87 A;  4J8G A;  4A11 A;  2I3T A;  3AL9 A;  5K1C C;  1QNI A;  4A0A B;  1N6F A;  2XU7 A;  1GOT B;  3EWE A;  3RFG A;  2P9P C;  5I5I A;  3EI4 B;  2QC5 A;  3J80 g;  3IJC A;  1SQJ A;  3PE7 A;  3SLE D;  4GM9 A;  5A2Q g;  4N14 A;  3PSC B;  5FKR A;  3UR4 A;  3IIY A;  5GMK n;  3JAM g;  4R7A B;  3I7N A;  5IC7 A;  4NSX A;  3IIW A;  3PXT D;  2MTA H; 
#chains in the Genus database with same CATH topology
 1UOP A;  4JSN C;  5H14 A;  2I0R A;  2AGY A;  3VGZ A;  3I7O A;  4AN1 A;  3K71 A;  2XL3 A;  4GM8 A;  4A0B B;  3HFQ A;  3EI1 B;  2H6N A;  1VE7 A;  2TRC B;  3IUM A;  2VDO A;  1U8C A;  5HDB A;  4ERZ A;  4E5Z A;  4J0X A;  4O3T B;  4PSX B;  4D0K A;  1JTD B;  1GXR A;  3NIF A;  4L1M A;  4O3U B;  4DNU A;  4OZU A;  4WK2 A;  4G1E A;  4PXW A;  2J55 H;  1NEX B;  4FA1 D;  2VZ3 A;  4O2W A;  5E6R A;  3NVQ A;  4JT6 C;  4Y7R A;  4J0W A;  3O4I A;  1L5G A;  3MVD K;  4FWW A;  3NIG A;  3V9F A;  5CXC B;  1R5M A;  3JPX A;  5B4W A;  4FAV D;  3KRW B;  3VI4 A;  1H2Y A;  2HKR A;  3EG6 A;  3PVW B;  4GM3 A;  1TYQ C;  3IKO A;  3IJ1 A;  4CY2 A;  2VC2 A;  5EAP A;  4QRJ A;  4Z7Q A;  2AH1 A;  2HYE A;  4G56 B;  4NEN A;  3K72 A;  2B4E A;  3IJ0 A;  1PBY B;  5EML B;  5C2W B;  2HJB A;  3B7F A;  4DNV A;  3EI4 A;  4JHP C;  3ZDY A;  2OVP B;  1H2X A;  2H3X A;  4ZOV A;  3IUR A;  3IUN A;  4IRZ A;  5FFG A;  4XYI A;  1K32 A;  3VA6 A;  3IUL A;  5HE0 B;  4D9S A;  4IA9 A;  2O9K A;  3RFH A;  4PNK B;  4J8B A;  4CI8 A;  4Y5R D;  4O9D A;  5GXH A;  3DWL C;  4FA9 D;  4GGC A;  2YNO A;  4ZOZ A;  2HKM A;  3IUQ A;  3N0E A;  2AGL A;  5HE1 B;  4WK0 A;  5M5V A;  4WK4 A;  3UVN A;  4GZ8 A;  3KRX B;  4A0B A;  1T2X A;  4O02 A;  1K3I A;  3EI1 A;  3UVO A;  4CI1 A;  1UTC A;  2CNX A;  5EAR A;  2UZX B;  2HJ4 A;  2P9U C;  3MUN A;  5EMJ B;  2Q7Q A;  4BP9 A;  1K8K C;  2G9A A;  3MXX A;  5TEE A;  3RMZ D;  5HQG A;  3V7D B;  5IGQ A;  5CXB B;  5M5T A;  1YFQ A;  4FAN D;  4CZV A;  4BL0 A;  2VDR A;  2PM7 B;  4JSV C;  4QQE A;  3UKU C;  1UOQ A;  2H9L A;  5E6S A;  4FA5 D;  2W18 A;  4I79 A;  4PBY A;  2H9P A;  4A2L A;  2VDL A;  3GFC A;  4PSW B;  3C75 H;  4U7A A;  1O6F A;  1H2Z A;  3ULE C;  4ZOY A;  1A0R B;  3C99 A;  4A2M A;  2Z2N A;  1U4C A;  5CXC A;  3ORV D;  4O1Q D;  3GRE A;  2IUP A;  3JRO A;  3EQ7 A;  1S4U X;  2OK4 A;  2XDW A;  2B5L A;  2PM6 B;  3MUO A;  3AH8 B;  2PM9 B;  4UI9 R;  2VDK A;  3FM0 A;  4L3G D;  1FWX A;  2HXC A;  4GQ2 P;  3EI2 B;  4K3I D;  2IUV A;  5HE2 B;  5IT9 g;  3OTT A;  1QFM A;  1B9Y A;  4RE5 A;  2CN2 A;  4AMZ A;  1TYE A;  1Q47 A;  2J56 H;  4PBZ A;  4ZN4 A;  5M61 A;  1E5T A;  5M5R A;  3T3P A;  2EID A;  1NR0 A;  2AH0 A;  2P9S C;  2QR5 A;  4HDJ A;  3EQ8 A;  4KFM B;  4BCD A;  4A09 B;  4BCB A;  1GOH A;  5SXM A;  2BCJ B;  2HU7 A;  3AFC A;  4UM8 A;  2BKL A;  4X63 B;  3OW8 A;  2AGZ A;  3O4G A;  2H9N A;  3RLM D;  5H1M A;  3MMY A;  3EI3 B;  2GC7 A;  3ZWL B;  4MMX A;  3V5W B;  3CFV A;  3FRX A;  3SFZ A;  4CZY A;  1GOG A;  2H6K A;  3OL2 A;  4EWR A;  4H5I A;  3SMR A;  4ES0 A;  2B5M A;  3SBP A;  5CXB A;  5I5J A;  2CO0 C;  1E8N A;  2VDM A;  4MK0 B;  4NBM A;  1RI6 A;  4G1M A;  2GC4 A;  1L0Q A;  3W15 A;  1PGU A;  2G99 A;  1JMX B;  4IMM A;  4J77 A;  4PC0 A;  3SBR A;  2IAA A;  2YB8 B;  1A12 A;  3I7L A;  3JZG A;  4YVD A;  5FKQ A;  3C5M A;  2P9L C;  2XZG A;  4BCC A;  5TEF A;  2CE9 A;  2EIE A;  4AX4 A;  4A0A A;  5M5S A;  5M5U A;  2EBS A;  3DXK C;  1VZ2 A;  2HES X;  5AFU 3;  2PM9 A;  4CY3 A;  1N6E A;  3CFS B;  3C9C A;  3IVM A;  4ERQ A;  2YMU A;  2P9K C;  2XYI A;  3EI2 A;  3E0C A;  4J73 A;  3UVL A;  5EAL A;  3BG0 A;  3JZH A;  1VE6 A;  4JD2 C;  5FKT A;  4JSX C;  3RSE C;  3V4P A;  1JV2 A;  3K27 A;  2I0T A;  2Z2O A;  3EMH A;  4A09 A;  4QT8 A;  5EMM B;  3JRP A;  1JJU B;  4LGN A;  2OVQ B;  5EAM A;  3T3M A;  3SXT D;  4OWR A;  1GG2 B;  2YNN A;  3P4F A;  5CYK B;  3O4J A;  3IUJ A;  2J57 G;  4G55 A;  4JHN A;  3NVX A;  3EU7 A;  1P22 A;  2P9I C;  1MG2 A;  1YR2 A;  3EI3 A;  1JMZ B;  4GGA A;  2I0S A;  2OK6 A;  1OMW B;  2OJY A;  2EIC A;  2VDQ A;  4LG8 A;  3SJL D;  4RE6 A;  5GXI A;  5C2V B;  4AEZ A;  3SVW D;  4FHL A;  3OKW A;  4A08 B;  5FA5 B;  4BH6 A;  3ODT A;  1OLZ A;  3UVK A;  4CY1 A;  2JKX A;  2HU5 A;  4CC9 A;  5GSA A;  1C9L A;  3MZL A;  4BUJ C;  3FGB A;  4WJK A;  5EM2 B;  4BP8 A;  1U2V C;  3K6S A;  4J78 A;  3RN0 D;  4NAA A;  2HU8 A;  3UKR C;  3I89 A;  2CN3 A;  2H68 A;  3F3P A;  4X3E A;  1GP2 B;  5THA A;  1SQ9 A;  3EQ9 A;  3GC3 B;  1JOF A;  3QI0 A;  3AL8 B;  3SBQ A;  2BBK H;  5AMS A;  5AJA A;  2QXV A;  4AMY A;  4GGD A;  3ZDX A;  5JWZ A;  4ESG A;  3ZE1 A;  2YNP A;  3I7P A;  4LG9 A;  4FB1 D;  1MDA H;  3JB9 L;  5H17 A;  2B5N A;  5HYN B;  4JSP C;  4L1Q D;  2I3S A;  1N6D A;  4XEI C;  2H9M A;  4NC4 A;  3BG1 A;  3PVU B;  1E8M A;  2GNQ A;  4J79 A;  3DSM A;  3KCI A;  4J81 A;  4QL1 A;  5CYK A;  4TZ4 A;  3SWS D;  3RRM C;  3J81 g;  4GMB A;  3I7K A;  3PXS D;  3RN1 D;  3I7H A;  3I8E A;  3MKQ A;  2QZP A;  3L4O D;  3OKY B;  2Z2P A;  1UOO A;  3ZE0 A;  2IUR A;  3MZK A;  4AN0 A;  4FA4 D;  2IWF A;  2P9N C;  5C92 A;  4E54 B;  4A08 A;  4XYH A;  3MKS B;  2OIZ A;  3IJE A;  3A0F A;  5E6U A;  3SCY A;  1H2W A;  1BPO A;  4ZOX A;  3VH0 A;  3PXW D;  3PSL A;  3FCS A;  1PI6 A;  4JXM A;  5EM2 A;  4A11 B;  3L4M D;  1QFS A;  3F3G A;  5TF2 A;  3N0D A;  4X61 B;  3DM0 A;  4JT5 C;  4U1E I;  4H5J A;  3GD1 I;  4CI3 A;  3U4Y A;  5IGO A;  4D6V A;  3O4H A;  3NVN A;  5C86 A;  3QHY B;  2H47 A;  4CZX A;  3VI3 A;  2IUQ A;  2XE4 A;  5K19 A;  4J84 A;  3DXM C;  3AL8 A;  3FCU A;  3SHF A;  5IJ8 E;  2AGX A;  5I5M A;  5KDO B;  1ERJ A;  5FLX g;  3K26 A;  3V4V A;  3DDU A;  2IWK A;  3UVM A;  4L3H D;  4O45 A;  4GQB B;  1XHM A;  2PBI B;  5EMK B;  2AGW A;  5IJ7 E;  2VZ1 A;  1XIP A;  4L9O A;  5HE3 B;  4X60 B;  4ERY A;  4AOW A;  4Z8L A;  4E5Z B;  3CIK B;  3OKT A;  1VYH C;  3I8C A;  5FXY A;  2YBA A;  4Z7N A;  2EIB A;  3OF7 A;  2VDP A;  4DNW A;  1VZ3 A;  1TBG A;  1M1X A;  4J86 A;  4MMZ A;  3I2N A;  3ZE2 A;  5C9Z B;  2AQ5 A;  1I2M B;  4J82 A;  4A7J A;  3OL2 B;  2WQ8 A;  3OKY A;  2H13 A;  5TDH B;  4CY5 A;  2CE8 A;  1B9X A;  2H6Q A;  4E54 A;  5FQD A;  4Z7O A;  2XL2 A;  2OVR B;  1SHY B;  2UZY B;  3F3F A;  2VDN A;  4GQ1 A;  4K3J B;  1MG3 A;  1PEV A;  5FKS A;  3JZN A;  3BWS A;  3SN6 B;  1XKS A;  4CI2 A;  2CO0 A;  2H14 A;  4UM9 A;  4J87 A;  4J8G A;  4A11 A;  2I3T A;  1GOF A;  3AL9 A;  1C9I A;  5K1C C;  1QNI A;  4A0A B;  3EWE A;  1N6F A;  1GOT B;  2XU7 A;  3RFG A;  3ZDZ A;  2P9P C;  5I5I A;  3EI4 B;  2QC5 A;  3J80 g;  5FFO A;  1O6G A;  1SQJ A;  3IJC A;  3PE7 A;  3SLE D;  4GM9 A;  5A2Q g;  4N14 A;  3PSC B;  5FKR A;  3UR4 A;  3IIY A;  5GMK n;  3JAM g;  4R7A B;  3I7N A;  5IC7 A;  4NSX A;  4QAM A;  4MMY A;  3IIW A;  3PXT D;  2MTA H;  3NID A; 
#chains in the Genus database with same CATH homology
 4JSN C;  5H14 A;  2I0R A;  2AGY A;  3VGZ A;  3I7O A;  2XL3 A;  4GM8 A;  4A0B B;  3HFQ A;  3EI1 B;  2H6N A;  2TRC B;  4ERZ A;  4E5Z A;  4J0X A;  4O3T B;  4PSX B;  4D0K A;  1GXR A;  4O3U B;  4OZU A;  4PXW A;  2J55 H;  1NEX B;  4FA1 D;  3NVQ A;  4JT6 C;  4Y7R A;  4J0W A;  4FWW A;  3V9F A;  5CXC B;  1R5M A;  3JPX A;  5B4W A;  4FAV D;  3KRW B;  2HKR A;  3EG6 A;  3PVW B;  4GM3 A;  1TYQ C;  3IKO A;  3IJ1 A;  4CY2 A;  5EAP A;  4QRJ A;  2AH1 A;  2HYE A;  4G56 B;  2B4E A;  3IJ0 A;  1PBY B;  5EML B;  5C2W B;  2HJB A;  3B7F A;  3EI4 A;  2OVP B;  2H3X A;  4ZOV A;  4XYI A;  1K32 A;  3VA6 A;  5HE0 B;  4IA9 A;  2O9K A;  3RFH A;  4PNK B;  4J8B A;  4CI8 A;  4Y5R D;  4O9D A;  5GXH A;  3DWL C;  4FA9 D;  4GGC A;  2YNO A;  4ZOZ A;  2HKM A;  3N0E A;  2AGL A;  5HE1 B;  3UVN A;  4GZ8 A;  3KRX B;  4A0B A;  3EI1 A;  3UVO A;  4CI1 A;  2CNX A;  5EAR A;  2UZX B;  2HJ4 A;  2P9U C;  5EMJ B;  2Q7Q A;  1K8K C;  2G9A A;  3MXX A;  5TEE A;  3RMZ D;  5HQG A;  3V7D B;  5IGQ A;  5CXB B;  1YFQ A;  4FAN D;  4CZV A;  4BL0 A;  2PM7 B;  4JSV C;  4QQE A;  3UKU C;  2H9L A;  4FA5 D;  2W18 A;  4I79 A;  4PBY A;  2H9P A;  4A2L A;  3GFC A;  4PSW B;  3C75 H;  4U7A A;  3ULE C;  4ZOY A;  1A0R B;  3C99 A;  4A2M A;  2Z2N A;  1U4C A;  5CXC A;  3ORV D;  4O1Q D;  3GRE A;  2IUP A;  3JRO A;  1S4U X;  2OK4 A;  2B5L A;  2PM6 B;  3AH8 B;  2PM9 B;  4UI9 R;  3FM0 A;  4L3G D;  1FWX A;  2HXC A;  4GQ2 P;  3EI2 B;  4K3I D;  2IUV A;  5HE2 B;  5IT9 g;  3OTT A;  1B9Y A;  2CN2 A;  1Q47 A;  2J56 H;  4PBZ A;  4ZN4 A;  1NR0 A;  2AH0 A;  2P9S C;  4HDJ A;  4KFM B;  4A09 B;  5SXM A;  2BCJ B;  3AFC A;  4X63 B;  3OW8 A;  2AGZ A;  2H9N A;  3RLM D;  5H1M A;  3MMY A;  3EI3 B;  2GC7 A;  3ZWL B;  3V5W B;  3CFV A;  3FRX A;  3SFZ A;  4CZY A;  2H6K A;  3OL2 A;  4EWR A;  4H5I A;  3SMR A;  4ES0 A;  2B5M A;  3SBP A;  5CXB A;  5I5J A;  2CO0 C;  4MK0 B;  1RI6 A;  2GC4 A;  1L0Q A;  3W15 A;  1PGU A;  2G99 A;  1JMX B;  4IMM A;  4J77 A;  4PC0 A;  3SBR A;  2IAA A;  2YB8 B;  3I7L A;  3JZG A;  4YVD A;  5FKQ A;  3C5M A;  2P9L C;  5TEF A;  2CE9 A;  4A0A A;  2EBS A;  3DXK C;  2HES X;  5AFU 3;  2PM9 A;  4CY3 A;  1N6E A;  3CFS B;  3C9C A;  4ERQ A;  2YMU A;  2P9K C;  2XYI A;  3EI2 A;  3E0C A;  4J73 A;  3UVL A;  5EAL A;  3BG0 A;  3JZH A;  5FKT A;  4JD2 C;  4JSX C;  3RSE C;  3K27 A;  2I0T A;  2Z2O A;  3EMH A;  4A09 A;  4QT8 A;  5EMM B;  3JRP A;  1JJU B;  4LGN A;  2OVQ B;  5EAM A;  3SXT D;  4OWR A;  1GG2 B;  2YNN A;  3P4F A;  5CYK B;  2J57 G;  3NVX A;  3EU7 A;  1P22 A;  2P9I C;  1MG2 A;  3EI3 A;  1JMZ B;  4GGA A;  2I0S A;  2OK6 A;  1OMW B;  2OJY A;  4LG8 A;  3SJL D;  5GXI A;  5C2V B;  4AEZ A;  3SVW D;  4FHL A;  3OKW A;  4A08 B;  5FA5 B;  4BH6 A;  3ODT A;  1OLZ A;  3UVK A;  4CY1 A;  4CC9 A;  5GSA A;  3MZL A;  4BUJ C;  3FGB A;  5EM2 B;  1U2V C;  4J78 A;  3RN0 D;  3UKR C;  3I89 A;  2CN3 A;  2H68 A;  3F3P A;  4X3E A;  1GP2 B;  5THA A;  1SQ9 A;  1JOF A;  3AL8 B;  3SBQ A;  2BBK H;  5AMS A;  5AJA A;  2QXV A;  4GGD A;  5JWZ A;  4ESG A;  2YNP A;  3I7P A;  4LG9 A;  4FB1 D;  1MDA H;  3JB9 L;  5H17 A;  2B5N A;  5HYN B;  4L1Q D;  4JSP C;  2I3S A;  1N6D A;  4XEI C;  2H9M A;  3BG1 A;  3PVU B;  2GNQ A;  4J79 A;  3DSM A;  4J81 A;  4QL1 A;  5CYK A;  4TZ4 A;  3SWS D;  3RRM C;  3J81 g;  4GMB A;  3I7K A;  3PXS D;  3RN1 D;  3I7H A;  3I8E A;  3MKQ A;  3L4O D;  3OKY B;  2Z2P A;  2IUR A;  3MZK A;  4FA4 D;  2IWF A;  2P9N C;  4E54 B;  4A08 A;  4XYH A;  3MKS B;  2OIZ A;  3A0F A;  3SCY A;  4ZOX A;  3VH0 A;  3PXW D;  3PSL A;  1PI6 A;  4JXM A;  5EM2 A;  4A11 B;  3L4M D;  3F3G A;  5TF2 A;  3N0D A;  4X61 B;  3DM0 A;  4JT5 C;  4U1E I;  4H5J A;  4CI3 A;  3U4Y A;  5IGO A;  4D6V A;  3NVN A;  2H47 A;  4CZX A;  2IUQ A;  5K19 A;  4J84 A;  3DXM C;  3AL8 A;  3SHF A;  5IJ8 E;  2AGX A;  5I5M A;  5KDO B;  1ERJ A;  5FLX g;  3K26 A;  2IWK A;  3UVM A;  4L3H D;  4O45 A;  4GQB B;  1XHM A;  2PBI B;  5EMK B;  2AGW A;  5IJ7 E;  1XIP A;  4L9O A;  5HE3 B;  4X60 B;  4ERY A;  4AOW A;  4Z8L A;  4E5Z B;  3CIK B;  3OKT A;  1VYH C;  3I8C A;  5FXY A;  2YBA A;  1TBG A;  4J86 A;  3I2N A;  5C9Z B;  2AQ5 A;  4J82 A;  4A7J A;  3OL2 B;  3OKY A;  2H13 A;  5TDH B;  4CY5 A;  2CE8 A;  1B9X A;  2H6Q A;  4E54 A;  5FQD A;  2XL2 A;  2OVR B;  1SHY B;  2UZY B;  3F3F A;  4GQ1 A;  4K3J B;  1MG3 A;  1PEV A;  5FKS A;  3JZN A;  3BWS A;  3SN6 B;  1XKS A;  4CI2 A;  2CO0 A;  2H14 A;  4J87 A;  4J8G A;  4A11 A;  2I3T A;  3AL9 A;  5K1C C;  1QNI A;  4A0A B;  1N6F A;  2XU7 A;  1GOT B;  3EWE A;  3RFG A;  2P9P C;  5I5I A;  3EI4 B;  2QC5 A;  3J80 g;  3IJC A;  1SQJ A;  3PE7 A;  3SLE D;  4GM9 A;  5A2Q g;  4N14 A;  3PSC B;  5FKR A;  3UR4 A;  3IIY A;  5GMK n;  3JAM g;  4R7A B;  3I7N A;  5IC7 A;  4NSX A;  3IIW A;  3PXT D;  2MTA H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...