5M5UA

Clathrin heavy chain n-terminal domain bound to a clathrin-box motif from hepatitis d virus large antigen (clade 1)
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
360
structure length
360
Chain Sequence
ILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAGAEEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis
molecule keywords Clathrin heavy chain 1
publication title Cellular and viral peptides bind multiple sites on the N-terminal domain of clathrin.
pubmed doi rcsb
source organism Bos taurus
total genus 83
structure length 360
sequence length 360
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01394 Clathrin_propel Clathrin propeller repeat
A PF09268 Clathrin-link Clathrin, heavy-chain linker
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.110 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Clathrin heavy-chain terminal domain 5m5uA00
5M5RA 2XZGA 3GD1I 3GC3B 5M5TA 1UTCA 1BPOA 1C9IA 5M5VA 5M5SA 5M5UA 1C9LA 4G55A 5M61A
chains in the Genus database with same CATH superfamily
5M5RA 4ZOVA 3IULA 2B4EA 5AMSA 4J8BA 4ZOYA 1XIPA 4J73A 2YMUA 2CO0C 1N6DA 3V4VA 5FA5B 3JROA 2TRCB 3KRWB 2CE9A 4Y5RD 5B4WA 3IURA 3UVOA 1JOFA 3IUQA 3BG0A 5IGOA 4J8GA 2GC4A 4PSWB 2MTAH 5E6SA 1RI6A 5EMMB 3I8EA 5CXCA 3F3FA 5C86A 3K6SA 4AN1A 5FFGA 3EI2A 2H9MA 5EMLB 2O9KA 1VZ2A 3ORVD 4DNWA 2YNOA 3UKUC 5IT9g 4O2WA 3I7OA 4CI3A 3OW8A 3GC3B 3I7NA 4MK0B 4PBZA 4A09B 2OVRB 4EWRA 5E6RA 1SHYB 3ZE1A 2P9SC 2AGWA 4JD2C 2HU7A 3RN0D 4AMYA 2HESX 2J55H 3MVDK 3EQ7A 1GOGA 2P9KC 5TF2A 1MG2A 1ERJA 5I5MA 3PXTD 3AH8B 2CNXA 4G1MA 4A0AA 1T2XA 1B9XA 3OF7A 1N6EA 3GREA 3GFCA 5HE2B 1YFQA 5CXCB 4MMXA 4NBMA 3ZDZA 3SBQA 3EI2B 4BH6A 1PGUA 1PBYB 3C9CA 2QXVA 4FWWA 3SFZA 4BCDA 3AFCA 3MKSB 4N14A 2XE4A 1N6FA 3FCSA 5EMJB 2AGLA 2G9AA 4UI9R 1VZ3A 2HU8A 3MXXA 3O4GA 1A12A 3CIKB 2J56H 2HYEA 3N0EA 4D6VA 4A0AB 4J87A 4H5JA 1U4CA 2QC5A 5C92A 4OZUA 2JKXA 2VDMA 1VYHC 2VDLA 3DM0A 3ZWLB 1GG2B 4U1EI 2HKRA 4O3TB 3PE7A 2H3XA 4Z8LA 5H1MA 3W15A 2VDRA 3I8CA 5M5UA 1H2XA 3OTTA 4BL0A 2EIEA 3HFQA 4GGCA 4IA9A 3ZE0A 5TDHB 2B5LA 3MUNA 4GM8A 1E8NA 3I7HA 3ZDYA 2OVPB 4CZVA 2I0TA 2H6KA 2PM6B 2XL2A 3V9FA 4ZOXA 1L0QA 3ZDXA 4JHPC 5I5IA 2HXCA 4MMYA 3CFVA 4BP9A 3I89A 5M5SA 2IUQA 1H2ZA 4WK4A 2H6NA 2XU7A 5FFOA 3V5WB 4ERZA 4AEZA 4D9SA 3EI4A 4A2MA 3K72A 2H9LA 3E0CA 1E8MA 4LG8A 2AH0A 5CXBA 3DWLC 3IUNA 2XL3A 1QFSA 3PVUB 4Z7NA 5A2Qg 2YNPA 5GSAA 3L4OD 2EBSA 4G56B 4GQBB 4IMMA 4ZN4A 2H14A 3BG1A 3SBRA 4DNUA 2H47A 3T3MA 2I3TA 1GOTB 2CN2A 2EIDA 5HDBA 3QI0A 4G1EA 4JSXC 1U8CA 3IUJA 5K19A 3FCUA 2AGZA 1JMXB 1JJUB 1L5GA 3FRXA 3UVMA 3MZKA 1S4UX 4UM9A 4PNKB 3EI4B 4LGNA 5CYKA 5H17A 2H9NA 3A0FA 5THAA 5E6UA 4GQ2P 4OWRA 3B7FA 4JHNA 4TZ4A 5CXBB 3EU7A 4FA4D 3N0DA 2HJBA 4O45A 4GGDA 4GZ8A 2OIZA 2VDNA 3NIGA 4BUJC 5IJ8E 2W18A 4JT6C 4MMZA 4BCBA 4ERYA 1UOPA 3MUOA 4G55A 4XYIA 2CE8A 4NSXA 4IRZA 1GOFA 3I2NA 1Q47A 1GP2B 3JB9L 3JAMg 2VC2A 3NIDA 4J81A 4J82A 1YR2A 3JRPA 2IWFA 3I7LA 4O3UB 3AL8A 3F3PA 5CYKB 5KDOB 4CY1A 4X61B 4J79A 1QNIA 1NR0A 2AH1A 4QL1A 1UOOA 3SHFA 3OKYA 3PVWB 4AN0A 2P9UC 3EI3A 3SCYA 1K8KC 3RN1D 4JSNC 2H6QA 3P4FA 5IJ7E 1JMZB 2I3SA 5SXMA 3SXTD 1U2VC 4RE5A 4H5IA 5JWZA 3RMZD 4Y7RA 4ZOZA 4CY2A 3ODTA 2P9LC 1H2YA 3QHYB 2EICA 4CC9A 3EMHA 1E5TA 4A0BA 2VDOA 3KCIA 3UR4A 4GM9A 3EQ9A 5FKQA 3UKRC 3NVQA 5M5VA 3AL8B 4CI1A 4X60B 2PM9A 3IJCA 2VZ1A 4X63B 3OKYB 3RFHA 3PXSD 3EI1A 5EALA 3EI3B 1QFMA 3C5MA 4PXWA 1I2MB 1MDAH 2AGYA 3AL9A 4WJKA 3VI3A 1C9LA 5AFU3 4LG9A 2H68A 2J57G 3ULEC 1B9YA 3RFGA 4Z7QA 2I0SA 5FKRA 4K3JB 5FKSA 4A11B 3EWEA 3NVXA 3UVKA 4PSXB 1JV2A 3JZGA 5HE3B 3VH0A 1TBGA 2YNNA 1R5MA 5FKTA 4A0BB 4GGAA 5EARA 2BCJB 2Z2OA 3UVLA 2HU5A 4L3GD 4QAMA 2XZGA 5IGQA 2IUVA 2B5MA 1VE6A 3DSMA 1BPOA 2PM9B 3SLED 3OL2A 4ESGA 5FLXg 3CFSB 1JTDB 3V4PA 3EI1B 3IIWA 1UTCA 3RLMD 2WQ8A 2QR5A 4J78A 5EMKB 1GOHA 3OKTA 5EAMA 4DNVA 1TYEA 2EIBA 3T3PA 3SVWD 3IIYA 3SBPA 5K1CC 5TEEA 4BCCA 4A7JA 5HYNB 2VZ3A 4J86A 3BWSA 1A0RB 2PBIB 4PBYA 4CI8A 1M1XA 3FM0A 2Q7QA 4O02A 4RE6A 5GXHA 3UVNA 3PSCB 3NIFA 4NC4A 4L3HD 3IUMA 3MMYA 3SN6B 5EM2A 2IWKA 4J77A 3SMRA 3IJEA 4D0KA 3OL2B 2QZPA 2I0RA 1K3IA 5M5TA 4E5ZA 3VI4A 4CZXA 2OK4A 4FA1D 4O9DA 3K26A 2P9IC 3DXKC 2OK6A 4XEIC 3IKOA 2OJYA 2OVQB 2HJ4A 4CI2A 2BBKH 3K71A 2IAAA 3NVNA 3DXMC 3V7DB 2B5NA 3VA6A 4FA5D 2P9NC 2Z2PA 4UM8A 2PM7B 2VDQA 4WK2A 5C9ZB 1NEXB 4L1QD 1UOQA 3SJLD 4NENA 3MKQA 1MG3A 1P22A 4QT8A 5M61A 1SQ9A 2H9PA 4J0WA 4A2LA 5EM2B 4U7AA 3JPXA 3KRXB 4FHLA 4XYHA 2YB8B 1OMWB 1TYQC 1OLZA 2YBAA 4KFMB 1PEVA 4GM3A 4L1MA 1SQJA 3JZHA 5C2WB 3RSEC 4PC0A 2BKLA 4YVDA 4E5ZB 2H13A 4BP8A 3IVMA 4JT5C 2HKMA 4WK0A 4X3EA 3RRMC 1XKSA 4L9OA 4FAND 1FWXA 2CO0A 3I7PA 4A11A 3K27A 3VGZA 4J84A 5FXYA 3U4YA 4J0XA 4FAVD 2UZYB 1H2WA 4JSPC 3MZLA 1K32A 1O6FA 2AGXA 3O4HA 4QRJA 4O1QD 1O6GA 4GQ1A 5EAPA 5IC7A 3C75H 3F3GA 4CY5A 2Z2NA 5TEFA 4Z7OA 5AJAA 3L4MD 4A08A 2UZXB 4E54A 2XYIA 4NAAA 2VDKA 3SWSD 4FB1D 3J80g 4CY3A 4AX4A 2CN3A 1C9IA 4HDJA 4QQEA 3ZE2A 1XHMA 5HQGA 2AQ5A 3EG6A 2XDWA 5GXIA 3JZNA 4I79A 3EQ8A 5C2VB 4FA9D 4ES0A 2IUPA 3J81g 5HE1B 4CZYA 3PSLA 2IURA 3FGBA 2GNQA 2P9PC 3IJ0A 3O4IA 4GMBA 2G99A 5H14A 4JXMA 4AOWA 4R7AB 3I7KA 4ERQA 3DDUA 1VE7A 2GC7A 4A08B 4JSVC 4K3ID 5GMKn 1PI6A 3C99A 4E54B 3OKWA 3IJ1A 3PXWD 4AMZA 2VDPA 5I5JA 3GD1I 1GXRA 3O4JA 5FQDA 5HE0B 4A09A
chains in the Genus database with same CATH topology
5M5RA 2XZGA 3GD1I 3GC3B 5M5TA 1UTCA 1BPOA 1C9IA 5M5VA 5M5SA 5M5UA 1C9LA 4G55A 5M61A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M5R A;  2XZG A;  3GD1 I;  3GC3 B;  5M5T A;  1UTC A;  1BPO A;  1C9I A;  5M5V A;  5M5S A;  5M5U A;  1C9L A;  4G55 A;  5M61 A; 
#chains in the Genus database with same CATH topology
 5M5R A;  4ZOV A;  3IUL A;  2B4E A;  5AMS A;  4J8B A;  4ZOY A;  1XIP A;  4J73 A;  2YMU A;  2CO0 C;  1N6D A;  3V4V A;  5FA5 B;  3JRO A;  2TRC B;  3KRW B;  2CE9 A;  4Y5R D;  5B4W A;  3IUR A;  3UVO A;  1JOF A;  3IUQ A;  3BG0 A;  5IGO A;  4J8G A;  2GC4 A;  4PSW B;  2MTA H;  5E6S A;  1RI6 A;  5EMM B;  3I8E A;  5CXC A;  3F3F A;  5C86 A;  3K6S A;  4AN1 A;  5FFG A;  3EI2 A;  2H9M A;  5EML B;  2O9K A;  1VZ2 A;  3ORV D;  4DNW A;  2YNO A;  3UKU C;  5IT9 g;  4O2W A;  3I7O A;  4CI3 A;  3OW8 A;  3GC3 B;  3I7N A;  4MK0 B;  4PBZ A;  4A09 B;  2OVR B;  4EWR A;  5E6R A;  1SHY B;  3ZE1 A;  2P9S C;  2AGW A;  4JD2 C;  2HU7 A;  3RN0 D;  4AMY A;  2HES X;  2J55 H;  3MVD K;  3EQ7 A;  1GOG A;  2P9K C;  5TF2 A;  1MG2 A;  1ERJ A;  5I5M A;  3PXT D;  3AH8 B;  2CNX A;  4G1M A;  4A0A A;  1T2X A;  1B9X A;  3OF7 A;  1N6E A;  3GRE A;  3GFC A;  5HE2 B;  1YFQ A;  5CXC B;  4MMX A;  4NBM A;  3ZDZ A;  3SBQ A;  3EI2 B;  4BH6 A;  1PGU A;  1PBY B;  3C9C A;  2QXV A;  4FWW A;  3SFZ A;  4BCD A;  3AFC A;  3MKS B;  4N14 A;  2XE4 A;  1N6F A;  3FCS A;  5EMJ B;  2AGL A;  2G9A A;  4UI9 R;  1VZ3 A;  2HU8 A;  3MXX A;  3O4G A;  1A12 A;  3CIK B;  2J56 H;  2HYE A;  3N0E A;  4D6V A;  4A0A B;  4J87 A;  4H5J A;  1U4C A;  2QC5 A;  5C92 A;  4OZU A;  2JKX A;  2VDM A;  1VYH C;  2VDL A;  3DM0 A;  3ZWL B;  1GG2 B;  4U1E I;  2HKR A;  4O3T B;  3PE7 A;  2H3X A;  4Z8L A;  5H1M A;  3W15 A;  2VDR A;  3I8C A;  5M5U A;  1H2X A;  3OTT A;  4BL0 A;  2EIE A;  3HFQ A;  4GGC A;  4IA9 A;  3ZE0 A;  5TDH B;  2B5L A;  3MUN A;  4GM8 A;  1E8N A;  3I7H A;  3ZDY A;  2OVP B;  4CZV A;  2I0T A;  2H6K A;  2PM6 B;  2XL2 A;  3V9F A;  4ZOX A;  1L0Q A;  3ZDX A;  4JHP C;  5I5I A;  2HXC A;  4MMY A;  3CFV A;  4BP9 A;  3I89 A;  5M5S A;  2IUQ A;  1H2Z A;  4WK4 A;  2H6N A;  2XU7 A;  5FFO A;  3V5W B;  4ERZ A;  4AEZ A;  4D9S A;  3EI4 A;  4A2M A;  3K72 A;  2H9L A;  3E0C A;  1E8M A;  4LG8 A;  2AH0 A;  5CXB A;  3DWL C;  3IUN A;  2XL3 A;  1QFS A;  3PVU B;  4Z7N A;  5A2Q g;  2YNP A;  5GSA A;  3L4O D;  2EBS A;  4G56 B;  4GQB B;  4IMM A;  4ZN4 A;  2H14 A;  3BG1 A;  3SBR A;  4DNU A;  2H47 A;  3T3M A;  2I3T A;  1GOT B;  2CN2 A;  2EID A;  5HDB A;  3QI0 A;  4G1E A;  4JSX C;  1U8C A;  3IUJ A;  5K19 A;  3FCU A;  2AGZ A;  1JMX B;  1JJU B;  1L5G A;  3FRX A;  3UVM A;  3MZK A;  1S4U X;  4UM9 A;  4PNK B;  3EI4 B;  4LGN A;  5CYK A;  5H17 A;  2H9N A;  3A0F A;  5THA A;  5E6U A;  4GQ2 P;  4OWR A;  3B7F A;  4JHN A;  4TZ4 A;  5CXB B;  3EU7 A;  4FA4 D;  3N0D A;  2HJB A;  4O45 A;  4GGD A;  4GZ8 A;  2OIZ A;  2VDN A;  3NIG A;  4BUJ C;  5IJ8 E;  2W18 A;  4JT6 C;  4MMZ A;  4BCB A;  4ERY A;  1UOP A;  3MUO A;  4G55 A;  4XYI A;  2CE8 A;  4NSX A;  4IRZ A;  1GOF A;  3I2N A;  1Q47 A;  1GP2 B;  3JB9 L;  3JAM g;  2VC2 A;  3NID A;  4J81 A;  4J82 A;  1YR2 A;  3JRP A;  2IWF A;  3I7L A;  4O3U B;  3AL8 A;  3F3P A;  5CYK B;  5KDO B;  4CY1 A;  4X61 B;  4J79 A;  1QNI A;  1NR0 A;  2AH1 A;  4QL1 A;  1UOO A;  3SHF A;  3OKY A;  3PVW B;  4AN0 A;  2P9U C;  3EI3 A;  3SCY A;  1K8K C;  3RN1 D;  4JSN C;  2H6Q A;  3P4F A;  5IJ7 E;  1JMZ B;  2I3S A;  5SXM A;  3SXT D;  1U2V C;  4RE5 A;  4H5I A;  5JWZ A;  3RMZ D;  4Y7R A;  4ZOZ A;  4CY2 A;  3ODT A;  2P9L C;  1H2Y A;  3QHY B;  2EIC A;  4CC9 A;  3EMH A;  1E5T A;  4A0B A;  2VDO A;  3KCI A;  3UR4 A;  4GM9 A;  3EQ9 A;  5FKQ A;  3UKR C;  3NVQ A;  5M5V A;  3AL8 B;  4CI1 A;  4X60 B;  2PM9 A;  3IJC A;  2VZ1 A;  4X63 B;  3OKY B;  3RFH A;  3PXS D;  3EI1 A;  5EAL A;  3EI3 B;  1QFM A;  3C5M A;  4PXW A;  1I2M B;  1MDA H;  2AGY A;  3AL9 A;  4WJK A;  3VI3 A;  1C9L A;  5AFU 3;  4LG9 A;  2H68 A;  2J57 G;  3ULE C;  1B9Y A;  3RFG A;  4Z7Q A;  2I0S A;  5FKR A;  4K3J B;  5FKS A;  4A11 B;  3EWE A;  3NVX A;  3UVK A;  4PSX B;  1JV2 A;  3JZG A;  5HE3 B;  3VH0 A;  1TBG A;  2YNN A;  1R5M A;  5FKT A;  4A0B B;  4GGA A;  5EAR A;  2BCJ B;  2Z2O A;  3UVL A;  2HU5 A;  4L3G D;  4QAM A;  2XZG A;  5IGQ A;  2IUV A;  2B5M A;  1VE6 A;  3DSM A;  1BPO A;  2PM9 B;  3SLE D;  3OL2 A;  4ESG A;  5FLX g;  3CFS B;  1JTD B;  3V4P A;  3EI1 B;  3IIW A;  1UTC A;  3RLM D;  2WQ8 A;  2QR5 A;  4J78 A;  5EMK B;  1GOH A;  3OKT A;  5EAM A;  4DNV A;  1TYE A;  2EIB A;  3T3P A;  3SVW D;  3IIY A;  3SBP A;  5K1C C;  5TEE A;  4BCC A;  4A7J A;  5HYN B;  2VZ3 A;  4J86 A;  3BWS A;  1A0R B;  2PBI B;  4PBY A;  4CI8 A;  1M1X A;  3FM0 A;  2Q7Q A;  4O02 A;  4RE6 A;  5GXH A;  3UVN A;  3PSC B;  3NIF A;  4NC4 A;  4L3H D;  3IUM A;  3MMY A;  3SN6 B;  5EM2 A;  2IWK A;  4J77 A;  3SMR A;  3IJE A;  4D0K A;  3OL2 B;  2QZP A;  2I0R A;  1K3I A;  5M5T A;  4E5Z A;  3VI4 A;  4CZX A;  2OK4 A;  4FA1 D;  4O9D A;  3K26 A;  2P9I C;  3DXK C;  2OK6 A;  4XEI C;  3IKO A;  2OJY A;  2OVQ B;  2HJ4 A;  4CI2 A;  2BBK H;  3K71 A;  2IAA A;  3NVN A;  3DXM C;  3V7D B;  2B5N A;  3VA6 A;  4FA5 D;  2P9N C;  2Z2P A;  4UM8 A;  2PM7 B;  2VDQ A;  4WK2 A;  5C9Z B;  1NEX B;  4L1Q D;  1UOQ A;  3SJL D;  4NEN A;  3MKQ A;  1MG3 A;  1P22 A;  4QT8 A;  5M61 A;  1SQ9 A;  2H9P A;  4J0W A;  4A2L A;  5EM2 B;  4U7A A;  3JPX A;  3KRX B;  4FHL A;  4XYH A;  2YB8 B;  1OMW B;  1TYQ C;  1OLZ A;  2YBA A;  4KFM B;  1PEV A;  4GM3 A;  4L1M A;  1SQJ A;  3JZH A;  5C2W B;  3RSE C;  4PC0 A;  2BKL A;  4YVD A;  4E5Z B;  2H13 A;  4BP8 A;  3IVM A;  4JT5 C;  2HKM A;  4WK0 A;  4X3E A;  3RRM C;  1XKS A;  4L9O A;  4FAN D;  1FWX A;  2CO0 A;  3I7P A;  4A11 A;  3K27 A;  3VGZ A;  4J84 A;  5FXY A;  3U4Y A;  4J0X A;  4FAV D;  2UZY B;  1H2W A;  4JSP C;  3MZL A;  1K32 A;  1O6F A;  2AGX A;  3O4H A;  4QRJ A;  4O1Q D;  1O6G A;  4GQ1 A;  5EAP A;  5IC7 A;  3C75 H;  3F3G A;  4CY5 A;  2Z2N A;  5TEF A;  4Z7O A;  5AJA A;  3L4M D;  4A08 A;  2UZX B;  4E54 A;  2XYI A;  4NAA A;  2VDK A;  3SWS D;  4FB1 D;  3J80 g;  4CY3 A;  4AX4 A;  2CN3 A;  1C9I A;  4HDJ A;  4QQE A;  3ZE2 A;  1XHM A;  5HQG A;  2AQ5 A;  3EG6 A;  2XDW A;  5GXI A;  3JZN A;  4I79 A;  3EQ8 A;  5C2V B;  4FA9 D;  4ES0 A;  2IUP A;  3J81 g;  5HE1 B;  4CZY A;  3PSL A;  2IUR A;  3FGB A;  2GNQ A;  2P9P C;  3IJ0 A;  3O4I A;  4GMB A;  2G99 A;  5H14 A;  4JXM A;  4AOW A;  4R7A B;  3I7K A;  4ERQ A;  3DDU A;  1VE7 A;  2GC7 A;  4A08 B;  4JSV C;  4K3I D;  5GMK n;  1PI6 A;  3C99 A;  4E54 B;  3OKW A;  3IJ1 A;  3PXW D;  4AMZ A;  2VDP A;  5I5J A;  3GD1 I;  1GXR A;  3O4J A;  5FQD A;  5HE0 B;  4A09 A; 
#chains in the Genus database with same CATH homology
 5M5R A;  2XZG A;  3GD1 I;  3GC3 B;  5M5T A;  1UTC A;  1BPO A;  1C9I A;  5M5V A;  5M5S A;  5M5U A;  1C9L A;  4G55 A;  5M61 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...