5M5UA

Clathrin heavy chain n-terminal domain bound to a clathrin-box motif from hepatitis d virus large antigen (clade 1)
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
360
structure length
360
Chain Sequence
b'ILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAGAEEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Clathrin heavy chain 1
molecule tags Endocytosis
source organism Bos taurus
publication title Cellular and viral peptides bind multiple sites on the N-terminal domain of clathrin.
pubmed doi rcsb
total genus 83
structure length 360
sequence length 360
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01394 Clathrin_propel Clathrin propeller repeat
A PF09268 Clathrin-link Clathrin, heavy-chain linker
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.110 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Clathrin heavy-chain terminal domain 5m5uA00
3GC3B 1BPOA 1UTCA 5M5UA 5M5SA 3GD1I 5M5VA 4G55A 1C9LA 5M5RA 5M61A 2XZGA 1C9IA 5M5TA
chains in the Genus database with same CATH superfamily
4LG8A 3RRMC 2H9NA 4AOWA 1FWXA 5M5UA 5EMJB 4OWRA 3DM0A 3FCSA 3N0EA 4GM9A 2BKLA 4O02A 3FRXA 4FA4D 1UOPA 1UOOA 3O4GA 3SXTD 1QFMA 3B7FA 1PBYB 2W18A 5HQGA 5B4WA 3I7KA 4AEZA 3JROA 3EMHA 1H2YA 1NR0A 1JTDB 2P9LC 2P9KC 1SHYB 5FFGA 4A2LA 3AL8A 1TYEA 4A08A 2B5MA 4CZYA 4J78A 3UVNA 1H2WA 3QI0A 3I7NA 4O45A 4PSXB 1T2XA 1U8CA 4DNWA 2J55H 1SQ9A 5HE2B 4GQ2P 2VDKA 4G56B 4CY2A 5M61A 4CZXA 2OK4A 4PNKB 4A09A 4MMYA 4MK0B 3JZGA 1QFSA 1U4CA 2YB8B 3P4FA 1O6FA 2AGZA 2P9IC 4E54A 3T3PA 1TYQC 5FKSA 4U7AA 3MZKA 4IMMA 2P9PC 1K32A 3VA6A 4A7JA 4Z7QA 2MTAH 3GD1I 2B5LA 3O4JA 4PBYA 1GOFA 5TEFA 4D6VA 4XYIA 3IUNA 3PVWB 1GOGA 3FM0A 4JXMA 5AMSA 2GNQA 2H13A 3ZWLB 4CZVA 3IURA 5IJ7E 5EARA 5IC7A 4J77A 3V7DB 5FA5B 4BL0A 2IAAA 2J57G 3IJCA 2H6NA 2PM6B 2HJBA 2IUVA 4OZUA 4ZOYA 5C2VB 1N6EA 2B4EA 2CO0C 4PSWB 4DNUA 4Y7RA 4J0XA 3IJEA 3SHFA 1B9YA 2P9SC 4AX4A 1A0RB 4WK0A 4BP9A 2H9LA 4PC0A 5C2WB 3EQ7A 3DDUA 1QNIA 2H3XA 2EIDA 4NAAA 4WJKA 1GG2B 4FA1D 4Z8LA 2IUPA 4IRZA 3RFGA 4ERQA 1N6FA 4A0BA 4RE5A 1K3IA 2AH1A 3KRXB 5HE1B 3V4VA 4DNVA 3JAMg 2PM7B 3K27A 4PBZA 1VYHC 3RSEC 3OKWA 1M1XA 4G1EA 3AL8B 3NVQA 4JD2C 2I0TA 3J80g 5M5TA 3C9CA 3CFVA 4X61B 4AMYA 2Z2PA 2HU7A 4JSVC 2H9MA 4X60B 2YNPA 2O9KA 3MZLA 4BCCA 5I5IA 3EI2A 2HU8A 5HYNB 4ZOXA 2AH0A 1N6DA 4ZOZA 3J81g 3EQ9A 4O3TB 3OKYA 3HFQA 1UTCA 4LGNA 5M5SA 5SXMA 4JT6C 1XKSA 5C92A 3EI4A 1NEXB 4ZN4A 5K19A 3BG1A 2VDPA 4PXWA 2VDRA 4ERYA 2PM9A 5FKQA 3EI1A 4BH6A 1H2XA 2TRCB 4U1EI 4GQ1A 5IGQA 2GC7A 4J86A 1MDAH 2EICA 1U2VC 3EI3B 2IWKA 5FFOA 5FKRA 3JZHA 4A11A 2OVRB 5FKTA 2OIZA 5HE3B 4ZOVA 4L1QD 2AGWA 2UZYB 3MKQA 5CXCB 3EWEA 5H1MA 5HE0B 2VC2A 3U4YA 4TZ4A 3DXKC 1GP2B 1C9IA 2HXCA 4NENA 4L1MA 4NBMA 4AMZA 3PXTD 3SBRA 5THAA 5A2Qg 1OMWB 4G55A 3JPXA 3SVWD 2HKMA 1L5GA 2HU5A 3IVMA 3RMZD 3E0CA 3EQ8A 3I8CA 5H14A 1S4UX 3SCYA 4A08B 4H5JA 3SLED 4WK4A 4L3HD 4E5ZA 1PI6A 2IURA 1GOTB 2AGYA 3UR4A 4FHLA 3O4IA 5EM2B 3JRPA 2G99A 3K26A 3SJLD 5IJ8E 3QHYB 2IWFA 2J56H 3PSCB 5M5VA 1R5MA 3FGBA 3KRWB 2Z2OA 5EMKB 3F3FA 4MMXA 2CN3A 2GC4A 3MMYA 2VDQA 3GREA 3VH0A 3UVMA 3O4HA 3GC3B 3BWSA 2QXVA 4UM8A 4JHNA 3C99A 4GQBB 2Q7QA 3I7OA 1XIPA 4K3JB 2H6KA 4L9OA 5CXBB 3SWSD 3A0FA 1JMXB 4YVDA 1E5TA 2VZ3A 3ODTA 1OLZA 1YR2A 4A0AB 3CFSB 1P22A 5TF2A 3RN1D 5GSAA 1GOHA 2VDOA 3EU7A 3K71A 3ZDXA 4JSXC 4NSXA 2EIEA 1JV2A 1E8MA 4ESGA 3NVXA 5I5JA 4GGAA 1VE6A 5FLXg 5M5RA 3IUMA 3ZE1A 1L0QA 3EI2B 5E6SA 3PSLA 4J8GA 2EBSA 2AGXA 1VZ2A 4HDJA 3PVUB 3OTTA 3OF7A 3UKUC 5GXHA 2XE4A 4R7AB 1A12A 2HJ4A 3MUNA 2Z2NA 3OKTA 2CE9A 5IT9g 5H17A 4KFMB 3BG0A 3C75H 3MKSB 2H47A 3ZDYA 3OL2B 4A0BB 1VZ3A 4GZ8A 3EI3A 1YFQA 4L3GD 4WK2A 2AGLA 4D9SA 5FQDA 4CY5A 2CO0A 2XU7A 2H6QA 1O6GA 2PBIB 4GMBA 2OJYA 2YBAA 2JKXA 3F3PA 3OW8A 2P9NC 2BBKH 4CY1A 5C9ZB 2H68A 3W15A 4CI2A 4JHPC 2VZ1A 3UVLA 4BP8A 3N0DA 4CI1A 3UVOA 2G9AA 4BUJC 3SBPA 4E5ZB 4J87A 4FA9D 2YNOA 3VI4A 4J79A 4QT8A 5EM2A 1BPOA 4Z7OA 4X63B 3I8EA 1PEVA 4GGCA 2H9PA 4LG9A 2VDNA 3ORVD 3IIYA 3SN6B 1H2ZA 2AQ5A 1VE7A 4UI9R 3I7LA 3SMRA 4XYHA 3FCUA 1JOFA 3K72A 4FWWA 2CN2A 2UZXB 2P9UC 4JSPC 2HKRA 5EALA 3JZNA 3V4PA 3V9FA 2VDLA 4J73A 4I79A 5HDBA 3SFZA 3VGZA 3IJ0A 4N14A 3AL9A 3L4MD 3UKRC 3MVDK 5AFU3 4O3UB 3L4OD 5JWZA 3NVNA 1I2MB 3I89A 2B5NA 4J81A 5E6UA 4CI8A 2CNXA 2EIBA 3PXWD 3AFCA 4A2MA 1PGUA 1JMZB 1ERJA 3PE7A 4RE6A 3V5WB 3PXSD 3DWLC 4QRJA 4FA5D 2I3TA 5GXIA 4CI3A 4GGDA 4A11B 2QC5A 3IUQA 5TEEA 3KCIA 1Q47A 1RI6A 4ERZA 2XDWA 4FB1D 3I7HA 1MG2A 2WQ8A 1C9LA 2XYIA 3DXMC 2HYEA 2I3SA 4MMZA 2XL2A 5FXYA 5IGOA 5E6RA 3IULA 4XEIC 3IUJA 3NIGA 2CE8A 5EMMB 3SBQA 4BCBA 4J82A 3IKOA 2YNNA 3GFCA 4AN1A 3EG6A 1XHMA 2I0SA 4JT5C 4Z7NA 1JJUB 2BCJB 2XZGA 4UM9A 5TDHB 4FAND 4A09B 3C5MA 3EI4B 3F3GA 4GM3A 5GMKn 3RN0D 4G1MA 3OL2A 2YMUA 5CYKA 5C86A 4QQEA 2VDMA 5CYKB 4IA9A 5EAMA 3UVKA 1E8NA 4QAMA 2XL3A 5CXBA 3RFHA 3NIFA 3IJ1A 5KDOB 1MG3A 3ZDZA 4O9DA 2HESX 1B9XA 4J8BA 2I0RA 3VI3A 2QR5A 3K6SA 4A0AA 4GM8A 3ZE0A 4BCDA 3RLMD 4AN0A 4CY3A 2OVQB 2IUQA 3I7PA 3IIWA 3ULEC 3T3MA 3I2NA 2QZPA 5CXCA 4ES0A 3MUOA 3NIDA 3JB9L 4J0WA 4QL1A 5EAPA 4X3EA 4J84A 3OKYB 1K8KC 3AH8B 3CIKB 4O1QD 1TBGA 4H5IA 5EMLB 2H14A 3MXXA 5AJAA 4EWRA 4E54B 4D0KA 2OVPB 4Y5RD 3ZE2A 1SQJA 5I5MA 4NC4A 4FAVD 3DSMA 4O2WA 4K3ID 4CC9A 2PM9B 3EI1B 2OK6A 4JSNC 5K1CC 1GXRA 1UOQA
chains in the Genus database with same CATH topology
3GC3B 1BPOA 1UTCA 5M5UA 5M5SA 3GD1I 5M5VA 4G55A 1C9LA 5M5RA 5M61A 2XZGA 1C9IA 5M5TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GC3 B;  1BPO A;  1UTC A;  5M5U A;  5M5S A;  3GD1 I;  5M5V A;  4G55 A;  1C9L A;  5M5R A;  5M61 A;  2XZG A;  1C9I A;  5M5T A; 
#chains in the Genus database with same CATH topology
 4LG8 A;  3RRM C;  2H9N A;  4AOW A;  1FWX A;  5M5U A;  5EMJ B;  4OWR A;  3DM0 A;  3FCS A;  3N0E A;  4GM9 A;  2BKL A;  4O02 A;  3FRX A;  4FA4 D;  1UOP A;  1UOO A;  3O4G A;  3SXT D;  1QFM A;  3B7F A;  1PBY B;  2W18 A;  5HQG A;  5B4W A;  3I7K A;  4AEZ A;  3JRO A;  3EMH A;  1H2Y A;  1NR0 A;  1JTD B;  2P9L C;  2P9K C;  1SHY B;  5FFG A;  4A2L A;  3AL8 A;  1TYE A;  4A08 A;  2B5M A;  4CZY A;  4J78 A;  3UVN A;  1H2W A;  3QI0 A;  3I7N A;  4O45 A;  4PSX B;  1T2X A;  1U8C A;  4DNW A;  2J55 H;  1SQ9 A;  5HE2 B;  4GQ2 P;  2VDK A;  4G56 B;  4CY2 A;  5M61 A;  4CZX A;  2OK4 A;  4PNK B;  4A09 A;  4MMY A;  4MK0 B;  3JZG A;  1QFS A;  1U4C A;  2YB8 B;  3P4F A;  1O6F A;  2AGZ A;  2P9I C;  4E54 A;  3T3P A;  1TYQ C;  5FKS A;  4U7A A;  3MZK A;  4IMM A;  2P9P C;  1K32 A;  3VA6 A;  4A7J A;  4Z7Q A;  2MTA H;  3GD1 I;  2B5L A;  3O4J A;  4PBY A;  1GOF A;  5TEF A;  4D6V A;  4XYI A;  3IUN A;  3PVW B;  1GOG A;  3FM0 A;  4JXM A;  5AMS A;  2GNQ A;  2H13 A;  3ZWL B;  4CZV A;  3IUR A;  5IJ7 E;  5EAR A;  5IC7 A;  4J77 A;  3V7D B;  5FA5 B;  4BL0 A;  2IAA A;  2J57 G;  3IJC A;  2H6N A;  2PM6 B;  2HJB A;  2IUV A;  4OZU A;  4ZOY A;  5C2V B;  1N6E A;  2B4E A;  2CO0 C;  4PSW B;  4DNU A;  4Y7R A;  4J0X A;  3IJE A;  3SHF A;  1B9Y A;  2P9S C;  4AX4 A;  1A0R B;  4WK0 A;  4BP9 A;  2H9L A;  4PC0 A;  5C2W B;  3EQ7 A;  3DDU A;  1QNI A;  2H3X A;  2EID A;  4NAA A;  4WJK A;  1GG2 B;  4FA1 D;  4Z8L A;  2IUP A;  4IRZ A;  3RFG A;  4ERQ A;  1N6F A;  4A0B A;  4RE5 A;  1K3I A;  2AH1 A;  3KRX B;  5HE1 B;  3V4V A;  4DNV A;  3JAM g;  2PM7 B;  3K27 A;  4PBZ A;  1VYH C;  3RSE C;  3OKW A;  1M1X A;  4G1E A;  3AL8 B;  3NVQ A;  4JD2 C;  2I0T A;  3J80 g;  5M5T A;  3C9C A;  3CFV A;  4X61 B;  4AMY A;  2Z2P A;  2HU7 A;  4JSV C;  2H9M A;  4X60 B;  2YNP A;  2O9K A;  3MZL A;  4BCC A;  5I5I A;  3EI2 A;  2HU8 A;  5HYN B;  4ZOX A;  2AH0 A;  1N6D A;  4ZOZ A;  3J81 g;  3EQ9 A;  4O3T B;  3OKY A;  3HFQ A;  1UTC A;  4LGN A;  5M5S A;  5SXM A;  4JT6 C;  1XKS A;  5C92 A;  3EI4 A;  1NEX B;  4ZN4 A;  5K19 A;  3BG1 A;  2VDP A;  4PXW A;  2VDR A;  4ERY A;  2PM9 A;  5FKQ A;  3EI1 A;  4BH6 A;  1H2X A;  2TRC B;  4U1E I;  4GQ1 A;  5IGQ A;  2GC7 A;  4J86 A;  1MDA H;  2EIC A;  1U2V C;  3EI3 B;  2IWK A;  5FFO A;  5FKR A;  3JZH A;  4A11 A;  2OVR B;  5FKT A;  2OIZ A;  5HE3 B;  4ZOV A;  4L1Q D;  2AGW A;  2UZY B;  3MKQ A;  5CXC B;  3EWE A;  5H1M A;  5HE0 B;  2VC2 A;  3U4Y A;  4TZ4 A;  3DXK C;  1GP2 B;  1C9I A;  2HXC A;  4NEN A;  4L1M A;  4NBM A;  4AMZ A;  3PXT D;  3SBR A;  5THA A;  5A2Q g;  1OMW B;  4G55 A;  3JPX A;  3SVW D;  2HKM A;  1L5G A;  2HU5 A;  3IVM A;  3RMZ D;  3E0C A;  3EQ8 A;  3I8C A;  5H14 A;  1S4U X;  3SCY A;  4A08 B;  4H5J A;  3SLE D;  4WK4 A;  4L3H D;  4E5Z A;  1PI6 A;  2IUR A;  1GOT B;  2AGY A;  3UR4 A;  4FHL A;  3O4I A;  5EM2 B;  3JRP A;  2G99 A;  3K26 A;  3SJL D;  5IJ8 E;  3QHY B;  2IWF A;  2J56 H;  3PSC B;  5M5V A;  1R5M A;  3FGB A;  3KRW B;  2Z2O A;  5EMK B;  3F3F A;  4MMX A;  2CN3 A;  2GC4 A;  3MMY A;  2VDQ A;  3GRE A;  3VH0 A;  3UVM A;  3O4H A;  3GC3 B;  3BWS A;  2QXV A;  4UM8 A;  4JHN A;  3C99 A;  4GQB B;  2Q7Q A;  3I7O A;  1XIP A;  4K3J B;  2H6K A;  4L9O A;  5CXB B;  3SWS D;  3A0F A;  1JMX B;  4YVD A;  1E5T A;  2VZ3 A;  3ODT A;  1OLZ A;  1YR2 A;  4A0A B;  3CFS B;  1P22 A;  5TF2 A;  3RN1 D;  5GSA A;  1GOH A;  2VDO A;  3EU7 A;  3K71 A;  3ZDX A;  4JSX C;  4NSX A;  2EIE A;  1JV2 A;  1E8M A;  4ESG A;  3NVX A;  5I5J A;  4GGA A;  1VE6 A;  5FLX g;  5M5R A;  3IUM A;  3ZE1 A;  1L0Q A;  3EI2 B;  5E6S A;  3PSL A;  4J8G A;  2EBS A;  2AGX A;  1VZ2 A;  4HDJ A;  3PVU B;  3OTT A;  3OF7 A;  3UKU C;  5GXH A;  2XE4 A;  4R7A B;  1A12 A;  2HJ4 A;  3MUN A;  2Z2N A;  3OKT A;  2CE9 A;  5IT9 g;  5H17 A;  4KFM B;  3BG0 A;  3C75 H;  3MKS B;  2H47 A;  3ZDY A;  3OL2 B;  4A0B B;  1VZ3 A;  4GZ8 A;  3EI3 A;  1YFQ A;  4L3G D;  4WK2 A;  2AGL A;  4D9S A;  5FQD A;  4CY5 A;  2CO0 A;  2XU7 A;  2H6Q A;  1O6G A;  2PBI B;  4GMB A;  2OJY A;  2YBA A;  2JKX A;  3F3P A;  3OW8 A;  2P9N C;  2BBK H;  4CY1 A;  5C9Z B;  2H68 A;  3W15 A;  4CI2 A;  4JHP C;  2VZ1 A;  3UVL A;  4BP8 A;  3N0D A;  4CI1 A;  3UVO A;  2G9A A;  4BUJ C;  3SBP A;  4E5Z B;  4J87 A;  4FA9 D;  2YNO A;  3VI4 A;  4J79 A;  4QT8 A;  5EM2 A;  1BPO A;  4Z7O A;  4X63 B;  3I8E A;  1PEV A;  4GGC A;  2H9P A;  4LG9 A;  2VDN A;  3ORV D;  3IIY A;  3SN6 B;  1H2Z A;  2AQ5 A;  1VE7 A;  4UI9 R;  3I7L A;  3SMR A;  4XYH A;  3FCU A;  1JOF A;  3K72 A;  4FWW A;  2CN2 A;  2UZX B;  2P9U C;  4JSP C;  2HKR A;  5EAL A;  3JZN A;  3V4P A;  3V9F A;  2VDL A;  4J73 A;  4I79 A;  5HDB A;  3SFZ A;  3VGZ A;  3IJ0 A;  4N14 A;  3AL9 A;  3L4M D;  3UKR C;  3MVD K;  5AFU 3;  4O3U B;  3L4O D;  5JWZ A;  3NVN A;  1I2M B;  3I89 A;  2B5N A;  4J81 A;  5E6U A;  4CI8 A;  2CNX A;  2EIB A;  3PXW D;  3AFC A;  4A2M A;  1PGU A;  1JMZ B;  1ERJ A;  3PE7 A;  4RE6 A;  3V5W B;  3PXS D;  3DWL C;  4QRJ A;  4FA5 D;  2I3T A;  5GXI A;  4CI3 A;  4GGD A;  4A11 B;  2QC5 A;  3IUQ A;  5TEE A;  3KCI A;  1Q47 A;  1RI6 A;  4ERZ A;  2XDW A;  4FB1 D;  3I7H A;  1MG2 A;  2WQ8 A;  1C9L A;  2XYI A;  3DXM C;  2HYE A;  2I3S A;  4MMZ A;  2XL2 A;  5FXY A;  5IGO A;  5E6R A;  3IUL A;  4XEI C;  3IUJ A;  3NIG A;  2CE8 A;  5EMM B;  3SBQ A;  4BCB A;  4J82 A;  3IKO A;  2YNN A;  3GFC A;  4AN1 A;  3EG6 A;  1XHM A;  2I0S A;  4JT5 C;  4Z7N A;  1JJU B;  2BCJ B;  2XZG A;  4UM9 A;  5TDH B;  4FAN D;  4A09 B;  3C5M A;  3EI4 B;  3F3G A;  4GM3 A;  5GMK n;  3RN0 D;  4G1M A;  3OL2 A;  2YMU A;  5CYK A;  5C86 A;  4QQE A;  2VDM A;  5CYK B;  4IA9 A;  5EAM A;  3UVK A;  1E8N A;  4QAM A;  2XL3 A;  5CXB A;  3RFH A;  3NIF A;  3IJ1 A;  5KDO B;  1MG3 A;  3ZDZ A;  4O9D A;  2HES X;  1B9X A;  4J8B A;  2I0R A;  3VI3 A;  2QR5 A;  3K6S A;  4A0A A;  4GM8 A;  3ZE0 A;  4BCD A;  3RLM D;  4AN0 A;  4CY3 A;  2OVQ B;  2IUQ A;  3I7P A;  3IIW A;  3ULE C;  3T3M A;  3I2N A;  2QZP A;  5CXC A;  4ES0 A;  3MUO A;  3NID A;  3JB9 L;  4J0W A;  4QL1 A;  5EAP A;  4X3E A;  4J84 A;  3OKY B;  1K8K C;  3AH8 B;  3CIK B;  4O1Q D;  1TBG A;  4H5I A;  5EML B;  2H14 A;  3MXX A;  5AJA A;  4EWR A;  4E54 B;  4D0K A;  2OVP B;  4Y5R D;  3ZE2 A;  1SQJ A;  5I5M A;  4NC4 A;  4FAV D;  3DSM A;  4O2W A;  4K3I D;  4CC9 A;  2PM9 B;  3EI1 B;  2OK6 A;  4JSN C;  5K1C C;  1GXR A;  1UOQ A; 
#chains in the Genus database with same CATH homology
 3GC3 B;  1BPO A;  1UTC A;  5M5U A;  5M5S A;  3GD1 I;  5M5V A;  4G55 A;  1C9L A;  5M5R A;  5M61 A;  2XZG A;  1C9I A;  5M5T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...