5M5UA

Clathrin heavy chain n-terminal domain bound to a clathrin-box motif from hepatitis d virus large antigen (clade 1)
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
360
structure length
360
Chain Sequence
ILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAGAEEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Clathrin heavy chain 1
publication title Cellular and viral peptides bind multiple sites on the N-terminal domain of clathrin.
pubmed doi rcsb
source organism Bos taurus
molecule tags Endocytosis
total genus 83
structure length 360
sequence length 360
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01394 Clathrin_propel Clathrin propeller repeat
A PF09268 Clathrin-link Clathrin, heavy-chain linker
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.110 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Clathrin heavy-chain terminal domain 5m5uA00
5M5VA 5M5RA 2XZGA 1BPOA 3GD1I 4G55A 3GC3B 5M5SA 1UTCA 5M5TA 5M5UA 5M61A 1C9IA 1C9LA
chains in the Genus database with same CATH superfamily
2VDMA 3JRPA 3ZDZA 5EMMB 4ZOYA 1N6FA 4QQEA 2OJYA 4AN1A 3EU7A 5FKQA 2HJBA 3PVUB 4GGCA 3JZHA 1MDAH 1JMZB 4NSXA 3JPXA 3NIFA 4Y7RA 5AMSA 4TZ4A 4A7JA 3ZE1A 2GNQA 4J82A 3N0DA 2P9NC 1JV2A 4N14A 3T3MA 1YFQA 4O1QD 5THAA 3IIWA 3N0EA 4PBYA 2OVRB 3IUMA 4MK0B 3OKTA 3SBPA 2W18A 4ZN4A 4CI3A 1L0QA 3V9FA 2YMUA 4YVDA 4QAMA 2HXCA 3ODTA 1K8KC 3OTTA 1UTCA 4J8BA 2QC5A 1PI6A 1VYHC 2AGXA 4DNWA 2XZGA 2CO0A 2YB8B 4JSVC 1H2WA 2H9PA 5EMKB 1FWXA 5C2WB 4JXMA 3VI3A 4O2WA 1O6FA 3EI1B 5GSAA 4DNVA 1C9LA 3EG6A 2PBIB 4E54B 5CYKB 2OK6A 3C9CA 1A12A 4X63B 4E54A 4FB1D 4GGAA 1U8CA 4GQBB 4L1QD 5SXMA 2Q7QA 5CYKA 4EWRA 1L5GA 4O3TB 1QFMA 3C99A 1JJUB 2PM9B 3JZGA 3IVMA 4JSNC 4PC0A 1VZ3A 3BG0A 2PM9A 2VDNA 1PGUA 2YNPA 2CE9A 2EICA 2QZPA 4G55A 2AGWA 3J80g 4GM3A 4NENA 2P9UC 4G56B 4XYIA 4ZOZA 5TF2A 4RE5A 1VE7A 4FA5D 4L9OA 1M1XA 3OKWA 3GFCA 2EIDA 4D9SA 5C92A 4BCDA 5M5UA 1R5MA 3IJ0A 5FXYA 4L3HD 3IJEA 4PNKB 2O9KA 4J77A 4J8GA 1TBGA 2H47A 1H2ZA 3C75H 4J78A 4MMYA 3JAMg 2B5NA 4AX4A 4A08B 5EARA 5EALA 3I7HA 4GQ1A 1T2XA 3VH0A 3FRXA 3I7LA 5I5MA 2CNXA 5I5IA 4R7AB 4LGNA 1GG2B 5EMJB 1QFSA 1E8MA 3J81g 3EWEA 3I7OA 3O4IA 2H14A 4Y5RD 3NVXA 3SCYA 3CIKB 2VDQA 3K6SA 2AGLA 3O4HA 3FGBA 2MTAH 1B9XA 5AJAA 2XYIA 4QRJA 3AL8B 4XYHA 1MG2A 4CZXA 4FA9D 4A11B 3F3FA 5GXHA 2I0RA 3FCSA 1TYQC 3AL8A 2TRCB 2AQ5A 5M61A 2XDWA 3AH8B 3MKQA 3UR4A 5HE1B 4WK0A 1UOQA 3ZDYA 4FAVD 3B7FA 3AL9A 5IJ8E 4G1MA 4E5ZB 4FWWA 1S4UX 2AGYA 3NVQA 3K72A 4HDJA 2YBAA 4CI2A 2I0TA 3DDUA 3V4PA 3JZNA 2Z2OA 2H3XA 4E5ZA 5EAPA 5FKTA 4FA4D 4PXWA 3VA6A 4AOWA 4ERQA 4H5JA 5I5JA 2Z2PA 4K3JB 3I7KA 4O02A 4JT5C 3HFQA 3UVMA 4GGDA 3IKOA 4OZUA 5FQDA 1GXRA 3MMYA 2G99A 4QT8A 5M5VA 4FAND 3V4VA 3UKUC 1H2XA 2IUVA 3SLED 5FFGA 4ERZA 3SFZA 1U4CA 3QI0A 2JKXA 4X61B 5HQGA 1K32A 3I89A 1PEVA 2UZYB 3DXKC 5FFOA 1BPOA 4O45A 4BP9A 4H5IA 3ZDXA 1GOHA 2BBKH 4L1MA 3EQ8A 4RE6A 5TEEA 2EBSA 4X3EA 2B5MA 3EI1A 4BP8A 4KFMB 4MMZA 4Z7NA 3IIYA 3NIDA 5EMLB 5AFU3 1VE6A 3L4MD 2VC2A 2H6KA 5C2VB 4A09B 3SBRA 2HJ4A 3F3PA 2CO0C 4A09A 5K19A 3MVDK 2HU5A 4LG9A 3P4FA 3EI2B 3ZWLB 2J55H 5B4WA 4CY3A 2HU8A 3EQ7A 5H17A 2UZXB 5IGQA 5CXCB 3BG1A 5GXIA 3OW8A 3EI2A 4ESGA 5H1MA 1A0RB 1VZ2A 5CXCA 2H13A 3OKYB 4D6VA 4NAAA 3VGZA 4IMMA 4AN0A 2XL2A 3ZE0A 3SHFA 1UOOA 2B5LA 4ERYA 3OKYA 2H6QA 3SN6B 4A0AB 4CY5A 4A2LA 4UM9A 4PSWB 1JOFA 5FKRA 1XHMA 3L4OD 4A0AA 2HU7A 2IUQA 2XL3A 3VI4A 3A0FA 1XIPA 4IRZA 2Z2NA 4JSPC 5TEFA 3IUJA 3C5MA 4AMYA 1GOTB 4A08A 4WJKA 4JT6C 3PE7A 2VDRA 2IAAA 3GREA 1NR0A 2OVPB 4IA9A 4CZYA 3KCIA 2AGZA 1K3IA 2EIEA 2OVQB 5CXBB 4CC9A 1H2YA 2AH0A 5FLXg 3E0CA 5IT9g 4ES0A 2OIZA 2CN2A 3SMRA 4CY1A 3DSMA 1TYEA 3IJCA 2H9NA 4NC4A 4BL0A 3UVNA 2CN3A 4FA1D 3O4GA 1I2MB 2HKMA 2IUPA 5FA5B 3V5WB 3EI4B 4A11A 2IURA 2VZ1A 5E6SA 4U1EI 4UI9R 3SXTD 3UVKA 3PSLA 1MG3A 3JROA 3OL2B 1OMWB 4AEZA 3CFVA 1SQJA 5C9ZB 3BWSA 2I3SA 3K26A 4J86A 2I3TA 2J57G 3OL2A 2VDKA 2VDLA 1N6EA 4PBZA 5EM2B 3I7NA 4J0XA 1QNIA 2IWFA 4GQ2P 3SBQA 4CI1A 2VDOA 4O9DA 3EQ9A 3PVWB 5IC7A 3MKSB 5K1CC 5EM2A 1GOFA 3I8EA 5E6RA 1GP2B 4JD2C 1B9YA 4Z8LA 3W15A 1O6GA 1JTDB 3KRXB 3RMZD 3GC3B 3ORVD 2GC7A 3QHYB 3I7PA 5M5TA 3K71A 4BH6A 5IJ7E 4A2MA 4GM8A 2OK4A 4K3ID 3RFGA 2B4EA 2HESX 3KRWB 4I79A 2GC4A 1PBYB 3UKRC 4XEIC 5EAMA 4JHNA 2H6NA 3MUNA 2XU7A 5A2Qg 5KDOB 1SQ9A 2XE4A 3RSEC 3T3PA 1RI6A 1E8NA 4G1EA 4A0BB 3IUNA 2IWKA 4Z7QA 3FCUA 3MZLA 2P9IC 3UVLA 3OF7A 5HYNB 3ZE2A 4A0BA 4D0KA 5HE0B 3JB9L 1UOPA 4JHPC 2H68A 4QL1A 3RLMD 4CZVA 2HKRA 4UM8A 3EI3B 4BCCA 3DXMC 3PXTD 5HDBA 2P9PC 4MMXA 3DM0A 5HE3B 3DWLC 3I8CA 4J81A 4BCBA 3EI3A 4BUJC 2J56H 4J0WA 1P22A 4JSXC 4ZOXA 5TDHB 2P9SC 2YNNA 3PXWD 1Q47A 1N6DA 1NEXB 2QXVA 4ZOVA 1XKSA 3K27A 4FHLA 1C9IA 1OLZA 5FKSA 3IURA 1JMXB 4J79A 4WK4A 4O3UB 3MXXA 2G9AA 4WK2A 2H9MA 1E5TA 3IULA 2QR5A 4GZ8A 3MZKA 2EIBA 4CI8A 1SHYB 2P9KC 4J73A 4X60B 4GMBA 3RRMC 3U4YA 3CFSB 3I2NA 2P9LC 2VZ3A 3O4JA 5M5RA 2PM7B 4OWRA 5HE2B 3ULEC 3NVNA 5C86A 3MUOA 4AMZA 3GD1I 2H9LA 2VDPA 4L3GD 3F3GA 3RN1D 4DNUA 3SVWD 2BCJB 3PSCB 1GOGA 4PSXB 4U7AA 5CXBA 5H14A 4LG8A 5GMKn 3AFCA 2I0SA 2HYEA 3SJLD 4J84A 3RN0D 1U2VC 3SWSD 3FM0A 4Z7OA 2WQ8A 3IJ1A 1YR2A 3EI4A 5E6UA 1ERJA 4NBMA 2CE8A 2YNOA 3RFHA 4GM9A 3IUQA 4J87A 5JWZA 2PM6B 4CY2A 2BKLA 3EMHA 3V7DB 5IGOA 5M5SA 3PXSD 3UVOA 3NIGA 2AH1A
chains in the Genus database with same CATH topology
5M5VA 5M5RA 2XZGA 1BPOA 3GD1I 4G55A 3GC3B 5M5SA 1UTCA 5M5TA 5M5UA 5M61A 1C9IA 1C9LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M5V A;  5M5R A;  2XZG A;  1BPO A;  3GD1 I;  4G55 A;  3GC3 B;  5M5S A;  1UTC A;  5M5T A;  5M5U A;  5M61 A;  1C9I A;  1C9L A; 
#chains in the Genus database with same CATH topology
 2VDM A;  3JRP A;  3ZDZ A;  5EMM B;  4ZOY A;  1N6F A;  4QQE A;  2OJY A;  4AN1 A;  3EU7 A;  5FKQ A;  2HJB A;  3PVU B;  4GGC A;  3JZH A;  1MDA H;  1JMZ B;  4NSX A;  3JPX A;  3NIF A;  4Y7R A;  5AMS A;  4TZ4 A;  4A7J A;  3ZE1 A;  2GNQ A;  4J82 A;  3N0D A;  2P9N C;  1JV2 A;  4N14 A;  3T3M A;  1YFQ A;  4O1Q D;  5THA A;  3IIW A;  3N0E A;  4PBY A;  2OVR B;  3IUM A;  4MK0 B;  3OKT A;  3SBP A;  2W18 A;  4ZN4 A;  4CI3 A;  1L0Q A;  3V9F A;  2YMU A;  4YVD A;  4QAM A;  2HXC A;  3ODT A;  1K8K C;  3OTT A;  1UTC A;  4J8B A;  2QC5 A;  1PI6 A;  1VYH C;  2AGX A;  4DNW A;  2XZG A;  2CO0 A;  2YB8 B;  4JSV C;  1H2W A;  2H9P A;  5EMK B;  1FWX A;  5C2W B;  4JXM A;  3VI3 A;  4O2W A;  1O6F A;  3EI1 B;  5GSA A;  4DNV A;  1C9L A;  3EG6 A;  2PBI B;  4E54 B;  5CYK B;  2OK6 A;  3C9C A;  1A12 A;  4X63 B;  4E54 A;  4FB1 D;  4GGA A;  1U8C A;  4GQB B;  4L1Q D;  5SXM A;  2Q7Q A;  5CYK A;  4EWR A;  1L5G A;  4O3T B;  1QFM A;  3C99 A;  1JJU B;  2PM9 B;  3JZG A;  3IVM A;  4JSN C;  4PC0 A;  1VZ3 A;  3BG0 A;  2PM9 A;  2VDN A;  1PGU A;  2YNP A;  2CE9 A;  2EIC A;  2QZP A;  4G55 A;  2AGW A;  3J80 g;  4GM3 A;  4NEN A;  2P9U C;  4G56 B;  4XYI A;  4ZOZ A;  5TF2 A;  4RE5 A;  1VE7 A;  4FA5 D;  4L9O A;  1M1X A;  3OKW A;  3GFC A;  2EID A;  4D9S A;  5C92 A;  4BCD A;  5M5U A;  1R5M A;  3IJ0 A;  5FXY A;  4L3H D;  3IJE A;  4PNK B;  2O9K A;  4J77 A;  4J8G A;  1TBG A;  2H47 A;  1H2Z A;  3C75 H;  4J78 A;  4MMY A;  3JAM g;  2B5N A;  4AX4 A;  4A08 B;  5EAR A;  5EAL A;  3I7H A;  4GQ1 A;  1T2X A;  3VH0 A;  3FRX A;  3I7L A;  5I5M A;  2CNX A;  5I5I A;  4R7A B;  4LGN A;  1GG2 B;  5EMJ B;  1QFS A;  1E8M A;  3J81 g;  3EWE A;  3I7O A;  3O4I A;  2H14 A;  4Y5R D;  3NVX A;  3SCY A;  3CIK B;  2VDQ A;  3K6S A;  2AGL A;  3O4H A;  3FGB A;  2MTA H;  1B9X A;  5AJA A;  2XYI A;  4QRJ A;  3AL8 B;  4XYH A;  1MG2 A;  4CZX A;  4FA9 D;  4A11 B;  3F3F A;  5GXH A;  2I0R A;  3FCS A;  1TYQ C;  3AL8 A;  2TRC B;  2AQ5 A;  5M61 A;  2XDW A;  3AH8 B;  3MKQ A;  3UR4 A;  5HE1 B;  4WK0 A;  1UOQ A;  3ZDY A;  4FAV D;  3B7F A;  3AL9 A;  5IJ8 E;  4G1M A;  4E5Z B;  4FWW A;  1S4U X;  2AGY A;  3NVQ A;  3K72 A;  4HDJ A;  2YBA A;  4CI2 A;  2I0T A;  3DDU A;  3V4P A;  3JZN A;  2Z2O A;  2H3X A;  4E5Z A;  5EAP A;  5FKT A;  4FA4 D;  4PXW A;  3VA6 A;  4AOW A;  4ERQ A;  4H5J A;  5I5J A;  2Z2P A;  4K3J B;  3I7K A;  4O02 A;  4JT5 C;  3HFQ A;  3UVM A;  4GGD A;  3IKO A;  4OZU A;  5FQD A;  1GXR A;  3MMY A;  2G99 A;  4QT8 A;  5M5V A;  4FAN D;  3V4V A;  3UKU C;  1H2X A;  2IUV A;  3SLE D;  5FFG A;  4ERZ A;  3SFZ A;  1U4C A;  3QI0 A;  2JKX A;  4X61 B;  5HQG A;  1K32 A;  3I89 A;  1PEV A;  2UZY B;  3DXK C;  5FFO A;  1BPO A;  4O45 A;  4BP9 A;  4H5I A;  3ZDX A;  1GOH A;  2BBK H;  4L1M A;  3EQ8 A;  4RE6 A;  5TEE A;  2EBS A;  4X3E A;  2B5M A;  3EI1 A;  4BP8 A;  4KFM B;  4MMZ A;  4Z7N A;  3IIY A;  3NID A;  5EML B;  5AFU 3;  1VE6 A;  3L4M D;  2VC2 A;  2H6K A;  5C2V B;  4A09 B;  3SBR A;  2HJ4 A;  3F3P A;  2CO0 C;  4A09 A;  5K19 A;  3MVD K;  2HU5 A;  4LG9 A;  3P4F A;  3EI2 B;  3ZWL B;  2J55 H;  5B4W A;  4CY3 A;  2HU8 A;  3EQ7 A;  5H17 A;  2UZX B;  5IGQ A;  5CXC B;  3BG1 A;  5GXI A;  3OW8 A;  3EI2 A;  4ESG A;  5H1M A;  1A0R B;  1VZ2 A;  5CXC A;  2H13 A;  3OKY B;  4D6V A;  4NAA A;  3VGZ A;  4IMM A;  4AN0 A;  2XL2 A;  3ZE0 A;  3SHF A;  1UOO A;  2B5L A;  4ERY A;  3OKY A;  2H6Q A;  3SN6 B;  4A0A B;  4CY5 A;  4A2L A;  4UM9 A;  4PSW B;  1JOF A;  5FKR A;  1XHM A;  3L4O D;  4A0A A;  2HU7 A;  2IUQ A;  2XL3 A;  3VI4 A;  3A0F A;  1XIP A;  4IRZ A;  2Z2N A;  4JSP C;  5TEF A;  3IUJ A;  3C5M A;  4AMY A;  1GOT B;  4A08 A;  4WJK A;  4JT6 C;  3PE7 A;  2VDR A;  2IAA A;  3GRE A;  1NR0 A;  2OVP B;  4IA9 A;  4CZY A;  3KCI A;  2AGZ A;  1K3I A;  2EIE A;  2OVQ B;  5CXB B;  4CC9 A;  1H2Y A;  2AH0 A;  5FLX g;  3E0C A;  5IT9 g;  4ES0 A;  2OIZ A;  2CN2 A;  3SMR A;  4CY1 A;  3DSM A;  1TYE A;  3IJC A;  2H9N A;  4NC4 A;  4BL0 A;  3UVN A;  2CN3 A;  4FA1 D;  3O4G A;  1I2M B;  2HKM A;  2IUP A;  5FA5 B;  3V5W B;  3EI4 B;  4A11 A;  2IUR A;  2VZ1 A;  5E6S A;  4U1E I;  4UI9 R;  3SXT D;  3UVK A;  3PSL A;  1MG3 A;  3JRO A;  3OL2 B;  1OMW B;  4AEZ A;  3CFV A;  1SQJ A;  5C9Z B;  3BWS A;  2I3S A;  3K26 A;  4J86 A;  2I3T A;  2J57 G;  3OL2 A;  2VDK A;  2VDL A;  1N6E A;  4PBZ A;  5EM2 B;  3I7N A;  4J0X A;  1QNI A;  2IWF A;  4GQ2 P;  3SBQ A;  4CI1 A;  2VDO A;  4O9D A;  3EQ9 A;  3PVW B;  5IC7 A;  3MKS B;  5K1C C;  5EM2 A;  1GOF A;  3I8E A;  5E6R A;  1GP2 B;  4JD2 C;  1B9Y A;  4Z8L A;  3W15 A;  1O6G A;  1JTD B;  3KRX B;  3RMZ D;  3GC3 B;  3ORV D;  2GC7 A;  3QHY B;  3I7P A;  5M5T A;  3K71 A;  4BH6 A;  5IJ7 E;  4A2M A;  4GM8 A;  2OK4 A;  4K3I D;  3RFG A;  2B4E A;  2HES X;  3KRW B;  4I79 A;  2GC4 A;  1PBY B;  3UKR C;  4XEI C;  5EAM A;  4JHN A;  2H6N A;  3MUN A;  2XU7 A;  5A2Q g;  5KDO B;  1SQ9 A;  2XE4 A;  3RSE C;  3T3P A;  1RI6 A;  1E8N A;  4G1E A;  4A0B B;  3IUN A;  2IWK A;  4Z7Q A;  3FCU A;  3MZL A;  2P9I C;  3UVL A;  3OF7 A;  5HYN B;  3ZE2 A;  4A0B A;  4D0K A;  5HE0 B;  3JB9 L;  1UOP A;  4JHP C;  2H68 A;  4QL1 A;  3RLM D;  4CZV A;  2HKR A;  4UM8 A;  3EI3 B;  4BCC A;  3DXM C;  3PXT D;  5HDB A;  2P9P C;  4MMX A;  3DM0 A;  5HE3 B;  3DWL C;  3I8C A;  4J81 A;  4BCB A;  3EI3 A;  4BUJ C;  2J56 H;  4J0W A;  1P22 A;  4JSX C;  4ZOX A;  5TDH B;  2P9S C;  2YNN A;  3PXW D;  1Q47 A;  1N6D A;  1NEX B;  2QXV A;  4ZOV A;  1XKS A;  3K27 A;  4FHL A;  1C9I A;  1OLZ A;  5FKS A;  3IUR A;  1JMX B;  4J79 A;  4WK4 A;  4O3U B;  3MXX A;  2G9A A;  4WK2 A;  2H9M A;  1E5T A;  3IUL A;  2QR5 A;  4GZ8 A;  3MZK A;  2EIB A;  4CI8 A;  1SHY B;  2P9K C;  4J73 A;  4X60 B;  4GMB A;  3RRM C;  3U4Y A;  3CFS B;  3I2N A;  2P9L C;  2VZ3 A;  3O4J A;  5M5R A;  2PM7 B;  4OWR A;  5HE2 B;  3ULE C;  3NVN A;  5C86 A;  3MUO A;  4AMZ A;  3GD1 I;  2H9L A;  2VDP A;  4L3G D;  3F3G A;  3RN1 D;  4DNU A;  3SVW D;  2BCJ B;  3PSC B;  1GOG A;  4PSX B;  4U7A A;  5CXB A;  5H14 A;  4LG8 A;  5GMK n;  3AFC A;  2I0S A;  2HYE A;  3SJL D;  4J84 A;  3RN0 D;  1U2V C;  3SWS D;  3FM0 A;  4Z7O A;  2WQ8 A;  3IJ1 A;  1YR2 A;  3EI4 A;  5E6U A;  1ERJ A;  4NBM A;  2CE8 A;  2YNO A;  3RFH A;  4GM9 A;  3IUQ A;  4J87 A;  5JWZ A;  2PM6 B;  4CY2 A;  2BKL A;  3EMH A;  3V7D B;  5IGO A;  5M5S A;  3PXS D;  3UVO A;  3NIG A;  2AH1 A; 
#chains in the Genus database with same CATH homology
 5M5V A;  5M5R A;  2XZG A;  1BPO A;  3GD1 I;  4G55 A;  3GC3 B;  5M5S A;  1UTC A;  5M5T A;  5M5U A;  5M61 A;  1C9I A;  1C9L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...