3ZDZA

Integrin alphaiib beta3 headpiece and rgd peptide complex
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
455
structure length
455
Chain Sequence
LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Complete Integrin Headpiece Opening in Eight Steps.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system/peptide
molecule keywords INTEGRIN ALPHA-IIB
total genus 98
structure length 455
sequence length 455
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 3zdzA00
2VDLA 4WJKA 3V4VA 4G1MA 1JV2A 4WK0A 3K71A 4IRZA 5E6RA 2VDQA 3T3MA 4Z7QA 3FCUA 3NIGA 2VC2A 3NIFA 4MMXA 2VDPA 4NENA 3ZE1A 4Z7OA 2VDOA 3K72A 4UM9A 3ZE2A 4WK2A 2VDNA 4Z7NA 3V4PA 3ZDYA 3ZDXA 3FCSA 1U8CA 2VDMA 2VDRA 3ZE0A 4MMYA 5FFOA 2VDKA 3VI3A 1M1XA 5E6UA 3T3PA 4G1EA 5FFGA 3NIDA 1TYEA 3ZDZA 5E6SA 4MMZA 4O02A 4WK4A 3K6SA 3IJEA 4UM8A 5HDBA 3VI4A 1L5GA
chains in the Genus database with same CATH superfamily
5EMLB 5HE3B 2I0RA 3RLMD 2H3XA 2GNQA 4O3UB 3K71A 3C5MA 1T2XA 2PM6B 3IUNA 2PBIB 4FA4D 2BCJB 3FM0A 5TF2A 4JD2C 3C75H 3O4IA 2HESX 2XYIA 2OK4A 3I7LA 4E54B 1TBGA 5K1CC 1YR2A 3OKWA 3PE7A 5FFOA 3EI2B 1SQ9A 2H13A 4R7AB 2OVQB 1GOGA 3ZDZA 2WQ8A 2XE4A 2YNOA 3IJEA 3PXSD 5HDBA 1L5GA 4Z8LA 4A0BA 2HJ4A 4A0BB 2PM9B 4AN1A 5IT9g 4Y7RA 3EMHA 3EI4A 2YNPA 3T3MA 5M61A 2B4EA 3NIFA 3UVNA 2H9LA 3RFHA 4FA1D 3C9CA 4J8BA 3K27A 4J77A 4AOWA 2J55H 3CFSB 4LG9A 4D9SA 2OK6A 1GXRA 5K19A 2H47A 5H1MA 3MZLA 2AGZA 3QI0A 2IAAA 4O9DA 3DXKC 1BPOA 2HU8A 4A0AB 3DM0A 3MKQA 3I2NA 1N6EA 3PXTD 4J0XA 5C2WB 5M5VA 4G55A 5I5IA 4JSPC 4E5ZB 4A09A 1UOPA 3HFQA 1B9YA 2H6QA 4GM3A 3UKRC 4QAMA 5FA5B 4CY5A 2BKLA 3FRXA 3K26A 1A0RB 5TEEA 2XL2A 4FHLA 1ERJA 3L4MD 3UVMA 4O3TB 2VDMA 1VYHC 4LGNA 3I8CA 4G1EA 4J81A 3EWEA 5C2VB 2HJBA 1GOTB 2YBAA 1GP2B 2AH0A 4XEIC 5IGQA 4QQEA 5THAA 4ES0A 3SWSD 1OMWB 3AL8A 3I89A 5IC7A 5IGOA 5FKRA 3PXWD 4ZOXA 5M5SA 4N14A 3IUJA 3NIGA 1H2XA 3GFCA 1MDAH 1JMZB 5GXIA 3I7PA 4RE5A 2HYEA 3OKTA 4FB1D 3KCIA 4CI2A 2VDKA 2VZ1A 3JAMg 3KRXB 4X63B 5FKQA 2QC5A 3V4VA 4CZYA 3L4OD 3UVLA 4AMZA 3MMYA 4IMMA 1SQJA 1VE7A 4UI9R 4L3GD 4IRZA 5FKTA 1P22A 4A08B 3CIKB 3O4HA 4Z7QA 5IJ8E 4J8GA 5A2Qg 2QZPA 5EAMA 3PSLA 2VDNA 5M5TA 4ZOVA 1E5TA 1C9LA 2P9NC 2GC4A 2IWKA 5FXYA 2VDRA 1JJUB 3V7DB 3OL2B 5E6UA 3IKOA 1XIPA 4L1MA 2HKMA 1U2VC 4CY3A 2HXCA 4PBZA 3MUOA 3SFZA 2P9LC 4WK0A 4U1EI 4CZXA 3V9FA 2YMUA 5HE2B 5SXMA 3PSCB 2YB8B 3F3GA 4GM8A 3EI1B 2B5LA 3EQ9A 4ERQA 5AMSA 3AL8B 2PM7B 2BBKH 2Z2NA 2O9KA 5HE1B 3UKUC 1GOFA 3UR4A 3EI3A 4J86A 1OLZA 3IURA 2EIEA 3JPXA 5E6SA 1PI6A 4JT5C 5M5RA 4G56B 3ORVD 2CO0A 5GSAA 3GD1I 3JB9L 4JSNC 3JZNA 4BH6A 1YFQA 3I8EA 2XDWA 5I5JA 2XZGA 3GREA 3JRPA 2VZ3A 2VDOA 2I0TA 5EAPA 2OJYA 3P4FA 3J80g 5CXCB 5CXCA 4TZ4A 3ZE0A 3IJ1A 2YNNA 3EG6A 3DXMC 5CYKB 4JSXC 4MMZA 4O02A 2AGYA 3SBQA 4BL0A 1UOOA 4GQ2P 4DNUA 1H2ZA 3SJLD 3CFVA 1QFMA 3IUMA 1GG2B 4GQ1A 4J84A 1B9XA 4QL1A 2H9NA 3SBPA 1FWXA 5CXBA 3U4YA 1XHMA 2CE9A 3EQ7A 5FLXg 4AMYA 4JSVC 2QR5A 3FCSA 4FA9D 4X3EA 1U8CA 5FQDA 5GXHA 5JWZA 4LG8A 4GM9A 2OVRB 4OWRA 5C9ZB 4BCCA 5HYNB 3RRMC 2AGXA 4A2MA 2HU7A 4WJKA 4I79A 4NAAA 4YVDA 3EI2A 2H68A 1XKSA 1NR0A 4GQBB 2G9AA 3SBRA 5EM2B 3PVWB 3RFGA 4XYHA 2J57G 2PM9A 2CN3A 4E5ZA 4WK2A 2IUPA 2EBSA 3OKYA 5HQGA 3OKYB 4GMBA 1H2YA 3C99A 3MKSB 3EU7A 2AGWA 4JT6C 1H2WA 5AFU3 3BG0A 5EMMB 4J78A 5AJAA 2IWFA 4A11A 1K8KC 4GZ8A 4A2LA 5FKSA 1MG3A 5C86A 4Y5RD 2HKRA 5H17A 4GGCA 2CNXA 1NEXB 2H14A 2OVPB 4EWRA 1O6GA 4ZN4A 3RN1D 4ERZA 5EALA 3DSMA 3F3PA 3V4PA 2Q7QA 3BG1A 3B7FA 3IUQA 2TRCB 2Z2PA 2EIDA 1VZ2A 3RSEC 5FFGA 3N0EA 1QNIA 3O4GA 5CXBB 2AQ5A 4L3HD 1R5MA 2H6KA 3E0CA 3AL9A 4AN0A 1PGUA 3SMRA 2XL3A 3DDUA 1VE6A 4ERYA 4K3JB 3ULEC 4JHNA 2EIBA 4BP9A 4NENA 4CI8A 2CN2A 4CI1A 3A0FA 3IVMA 4A08A 4QRJA 4ESGA 3IIWA 4DNVA 4H5IA 3GC3B 1MG2A 4H5JA 3IIYA 2B5NA 4NBMA 1M1XA 1C9IA 5EMKB 3JZHA 4PC0A 4BCBA 1JOFA 2P9SC 4ZOZA 3MZKA 4A09B 2JKXA 4J82A 3EI4B 3VI4A 4J79A 2VDLA 4PSXB 3NVQA 4X60B 3VA6A 2H6NA 3OW8A 3F3FA 2W18A 2G99A 3MUNA 1K3IA 3UVOA 3IJCA 2VDPA 3AH8B 4RE6A 4UM9A 3BWSA 4Z7NA 1E8MA 1RI6A 1O6FA 2CO0C 1GOHA 4O45A 4A0AA 3JZGA 4O1QD 4JXMA 4GGDA 1VZ3A 2OIZA 4UM8A 4OZUA 3I7HA 4XYIA 4CI3A 3N0DA 2XU7A 3FGBA 2HU5A 4PBYA 4G1MA 5EARA 3RN0D 1JV2A 2P9UC 5TEFA 3JROA 4J73A 5E6RA 4J87A 3VH0A 2IUQA 2VC2A 4FAVD 4BP8A 4JHPC 3K72A 3KRWB 2IUVA 4PSWB 2QXVA 3PVUB 3ZDXA 2P9IC 1E8NA 2UZXB 3W15A 3J81g 5I5MA 4MMYA 1N6DA 5HE0B 3SVWD 3ODTA 3I7OA 3V5WB 3SN6B 4BUJC 5M5UA 5CYKA 1JMXB 2J56H 4FAND 1UTCA 4QT8A 5EMJB 3FCUA 4L1QD 4FWWA 3IULA 4MMXA 4Z7OA 1UOQA 3ZE2A 4BCDA 4FA5D 5KDOB 3SCYA 4D6VA 4HDJA 2P9KC 4AEZA 4ZOYA 3I7KA 3VI3A 3EQ8A 4IA9A 3I7NA 1QFSA 1PEVA 4K3ID 2P9PC 4L9OA 4CY1A 3NIDA 1TYEA 1TYQC 1S4UX 2GC7A 4DNWA 5C92A 3MXXA 1U4CA 2CE8A 5GMKn 2UZYB 3UVKA 3SXTD 4MK0B 2H9MA 4CZVA 4E54A 1L0QA 4CC9A 3EI1A 2VDQA 4KFMB 2Z2OA 1PBYB 3EI3B 3OF7A 3OL2A 4CY2A 3SLED 3O4JA 3QHYB 2H9PA 4O2WA 3T3PA 4A7JA 4D0KA 3MVDK 1K32A 5H14A 4WK4A 4X61B 2AGLA 4A11B 4J0WA 3VGZA 3SHFA 2I0SA 2AH1A 5TDHB 3ZWLB 2I3SA 4PXWA 3DWLC 4AX4A 4GGAA 3NVNA 1I2MB 4U7AA 3ZE1A 2I3TA 3NVXA 5B4WA 3OTTA 2IURA 5EM2A 4PNKB 3ZDYA 1Q47A 1SHYB 4NSXA 3RMZD 1JTDB 4NC4A 2EICA 3IJ0A 1A12A 5IJ7E 3AFCA 2B5MA 2MTAH 3K6SA 1N6FA
chains in the Genus database with same CATH topology
2VDLA 4WJKA 3V4VA 4G1MA 1JV2A 4WK0A 3K71A 4IRZA 5E6RA 2VDQA 3T3MA 4Z7QA 3FCUA 3NIGA 2VC2A 3NIFA 4MMXA 2VDPA 4NENA 3ZE1A 4Z7OA 2VDOA 3K72A 4UM9A 3ZE2A 4WK2A 2VDNA 4Z7NA 3V4PA 3ZDYA 3ZDXA 3FCSA 1U8CA 2VDMA 2VDRA 3ZE0A 4MMYA 5FFOA 2VDKA 3VI3A 1M1XA 5E6UA 3T3PA 4G1EA 5FFGA 3NIDA 1TYEA 3ZDZA 5E6SA 4MMZA 4O02A 4WK4A 3K6SA 3IJEA 4UM8A 5HDBA 3VI4A 1L5GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VDL A;  4WJK A;  3V4V A;  4G1M A;  1JV2 A;  4WK0 A;  3K71 A;  4IRZ A;  5E6R A;  2VDQ A;  3T3M A;  4Z7Q A;  3FCU A;  3NIG A;  2VC2 A;  3NIF A;  4MMX A;  2VDP A;  4NEN A;  3ZE1 A;  4Z7O A;  2VDO A;  3K72 A;  4UM9 A;  3ZE2 A;  4WK2 A;  2VDN A;  4Z7N A;  3V4P A;  3ZDY A;  3ZDX A;  3FCS A;  1U8C A;  2VDM A;  2VDR A;  3ZE0 A;  4MMY A;  5FFO A;  2VDK A;  3VI3 A;  1M1X A;  5E6U A;  3T3P A;  4G1E A;  5FFG A;  3NID A;  1TYE A;  3ZDZ A;  5E6S A;  4MMZ A;  4O02 A;  4WK4 A;  3K6S A;  3IJE A;  4UM8 A;  5HDB A;  3VI4 A;  1L5G A; 
#chains in the Genus database with same CATH topology
 5EML B;  5HE3 B;  2I0R A;  3RLM D;  2H3X A;  2GNQ A;  4O3U B;  3K71 A;  3C5M A;  1T2X A;  2PM6 B;  3IUN A;  2PBI B;  4FA4 D;  2BCJ B;  3FM0 A;  5TF2 A;  4JD2 C;  3C75 H;  3O4I A;  2HES X;  2XYI A;  2OK4 A;  3I7L A;  4E54 B;  1TBG A;  5K1C C;  1YR2 A;  3OKW A;  3PE7 A;  5FFO A;  3EI2 B;  1SQ9 A;  2H13 A;  4R7A B;  2OVQ B;  1GOG A;  3ZDZ A;  2WQ8 A;  2XE4 A;  2YNO A;  3IJE A;  3PXS D;  5HDB A;  1L5G A;  4Z8L A;  4A0B A;  2HJ4 A;  4A0B B;  2PM9 B;  4AN1 A;  5IT9 g;  4Y7R A;  3EMH A;  3EI4 A;  2YNP A;  3T3M A;  5M61 A;  2B4E A;  3NIF A;  3UVN A;  2H9L A;  3RFH A;  4FA1 D;  3C9C A;  4J8B A;  3K27 A;  4J77 A;  4AOW A;  2J55 H;  3CFS B;  4LG9 A;  4D9S A;  2OK6 A;  1GXR A;  5K19 A;  2H47 A;  5H1M A;  3MZL A;  2AGZ A;  3QI0 A;  2IAA A;  4O9D A;  3DXK C;  1BPO A;  2HU8 A;  4A0A B;  3DM0 A;  3MKQ A;  3I2N A;  1N6E A;  3PXT D;  4J0X A;  5C2W B;  5M5V A;  4G55 A;  5I5I A;  4JSP C;  4E5Z B;  4A09 A;  1UOP A;  3HFQ A;  1B9Y A;  2H6Q A;  4GM3 A;  3UKR C;  4QAM A;  5FA5 B;  4CY5 A;  2BKL A;  3FRX A;  3K26 A;  1A0R B;  5TEE A;  2XL2 A;  4FHL A;  1ERJ A;  3L4M D;  3UVM A;  4O3T B;  2VDM A;  1VYH C;  4LGN A;  3I8C A;  4G1E A;  4J81 A;  3EWE A;  5C2V B;  2HJB A;  1GOT B;  2YBA A;  1GP2 B;  2AH0 A;  4XEI C;  5IGQ A;  4QQE A;  5THA A;  4ES0 A;  3SWS D;  1OMW B;  3AL8 A;  3I89 A;  5IC7 A;  5IGO A;  5FKR A;  3PXW D;  4ZOX A;  5M5S A;  4N14 A;  3IUJ A;  3NIG A;  1H2X A;  3GFC A;  1MDA H;  1JMZ B;  5GXI A;  3I7P A;  4RE5 A;  2HYE A;  3OKT A;  4FB1 D;  3KCI A;  4CI2 A;  2VDK A;  2VZ1 A;  3JAM g;  3KRX B;  4X63 B;  5FKQ A;  2QC5 A;  3V4V A;  4CZY A;  3L4O D;  3UVL A;  4AMZ A;  3MMY A;  4IMM A;  1SQJ A;  1VE7 A;  4UI9 R;  4L3G D;  4IRZ A;  5FKT A;  1P22 A;  4A08 B;  3CIK B;  3O4H A;  4Z7Q A;  5IJ8 E;  4J8G A;  5A2Q g;  2QZP A;  5EAM A;  3PSL A;  2VDN A;  5M5T A;  4ZOV A;  1E5T A;  1C9L A;  2P9N C;  2GC4 A;  2IWK A;  5FXY A;  2VDR A;  1JJU B;  3V7D B;  3OL2 B;  5E6U A;  3IKO A;  1XIP A;  4L1M A;  2HKM A;  1U2V C;  4CY3 A;  2HXC A;  4PBZ A;  3MUO A;  3SFZ A;  2P9L C;  4WK0 A;  4U1E I;  4CZX A;  3V9F A;  2YMU A;  5HE2 B;  5SXM A;  3PSC B;  2YB8 B;  3F3G A;  4GM8 A;  3EI1 B;  2B5L A;  3EQ9 A;  4ERQ A;  5AMS A;  3AL8 B;  2PM7 B;  2BBK H;  2Z2N A;  2O9K A;  5HE1 B;  3UKU C;  1GOF A;  3UR4 A;  3EI3 A;  4J86 A;  1OLZ A;  3IUR A;  2EIE A;  3JPX A;  5E6S A;  1PI6 A;  4JT5 C;  5M5R A;  4G56 B;  3ORV D;  2CO0 A;  5GSA A;  3GD1 I;  3JB9 L;  4JSN C;  3JZN A;  4BH6 A;  1YFQ A;  3I8E A;  2XDW A;  5I5J A;  2XZG A;  3GRE A;  3JRP A;  2VZ3 A;  2VDO A;  2I0T A;  5EAP A;  2OJY A;  3P4F A;  3J80 g;  5CXC B;  5CXC A;  4TZ4 A;  3ZE0 A;  3IJ1 A;  2YNN A;  3EG6 A;  3DXM C;  5CYK B;  4JSX C;  4MMZ A;  4O02 A;  2AGY A;  3SBQ A;  4BL0 A;  1UOO A;  4GQ2 P;  4DNU A;  1H2Z A;  3SJL D;  3CFV A;  1QFM A;  3IUM A;  1GG2 B;  4GQ1 A;  4J84 A;  1B9X A;  4QL1 A;  2H9N A;  3SBP A;  1FWX A;  5CXB A;  3U4Y A;  1XHM A;  2CE9 A;  3EQ7 A;  5FLX g;  4AMY A;  4JSV C;  2QR5 A;  3FCS A;  4FA9 D;  4X3E A;  1U8C A;  5FQD A;  5GXH A;  5JWZ A;  4LG8 A;  4GM9 A;  2OVR B;  4OWR A;  5C9Z B;  4BCC A;  5HYN B;  3RRM C;  2AGX A;  4A2M A;  2HU7 A;  4WJK A;  4I79 A;  4NAA A;  4YVD A;  3EI2 A;  2H68 A;  1XKS A;  1NR0 A;  4GQB B;  2G9A A;  3SBR A;  5EM2 B;  3PVW B;  3RFG A;  4XYH A;  2J57 G;  2PM9 A;  2CN3 A;  4E5Z A;  4WK2 A;  2IUP A;  2EBS A;  3OKY A;  5HQG A;  3OKY B;  4GMB A;  1H2Y A;  3C99 A;  3MKS B;  3EU7 A;  2AGW A;  4JT6 C;  1H2W A;  5AFU 3;  3BG0 A;  5EMM B;  4J78 A;  5AJA A;  2IWF A;  4A11 A;  1K8K C;  4GZ8 A;  4A2L A;  5FKS A;  1MG3 A;  5C86 A;  4Y5R D;  2HKR A;  5H17 A;  4GGC A;  2CNX A;  1NEX B;  2H14 A;  2OVP B;  4EWR A;  1O6G A;  4ZN4 A;  3RN1 D;  4ERZ A;  5EAL A;  3DSM A;  3F3P A;  3V4P A;  2Q7Q A;  3BG1 A;  3B7F A;  3IUQ A;  2TRC B;  2Z2P A;  2EID A;  1VZ2 A;  3RSE C;  5FFG A;  3N0E A;  1QNI A;  3O4G A;  5CXB B;  2AQ5 A;  4L3H D;  1R5M A;  2H6K A;  3E0C A;  3AL9 A;  4AN0 A;  1PGU A;  3SMR A;  2XL3 A;  3DDU A;  1VE6 A;  4ERY A;  4K3J B;  3ULE C;  4JHN A;  2EIB A;  4BP9 A;  4NEN A;  4CI8 A;  2CN2 A;  4CI1 A;  3A0F A;  3IVM A;  4A08 A;  4QRJ A;  4ESG A;  3IIW A;  4DNV A;  4H5I A;  3GC3 B;  1MG2 A;  4H5J A;  3IIY A;  2B5N A;  4NBM A;  1M1X A;  1C9I A;  5EMK B;  3JZH A;  4PC0 A;  4BCB A;  1JOF A;  2P9S C;  4ZOZ A;  3MZK A;  4A09 B;  2JKX A;  4J82 A;  3EI4 B;  3VI4 A;  4J79 A;  2VDL A;  4PSX B;  3NVQ A;  4X60 B;  3VA6 A;  2H6N A;  3OW8 A;  3F3F A;  2W18 A;  2G99 A;  3MUN A;  1K3I A;  3UVO A;  3IJC A;  2VDP A;  3AH8 B;  4RE6 A;  4UM9 A;  3BWS A;  4Z7N A;  1E8M A;  1RI6 A;  1O6F A;  2CO0 C;  1GOH A;  4O45 A;  4A0A A;  3JZG A;  4O1Q D;  4JXM A;  4GGD A;  1VZ3 A;  2OIZ A;  4UM8 A;  4OZU A;  3I7H A;  4XYI A;  4CI3 A;  3N0D A;  2XU7 A;  3FGB A;  2HU5 A;  4PBY A;  4G1M A;  5EAR A;  3RN0 D;  1JV2 A;  2P9U C;  5TEF A;  3JRO A;  4J73 A;  5E6R A;  4J87 A;  3VH0 A;  2IUQ A;  2VC2 A;  4FAV D;  4BP8 A;  4JHP C;  3K72 A;  3KRW B;  2IUV A;  4PSW B;  2QXV A;  3PVU B;  3ZDX A;  2P9I C;  1E8N A;  2UZX B;  3W15 A;  3J81 g;  5I5M A;  4MMY A;  1N6D A;  5HE0 B;  3SVW D;  3ODT A;  3I7O A;  3V5W B;  3SN6 B;  4BUJ C;  5M5U A;  5CYK A;  1JMX B;  2J56 H;  4FAN D;  1UTC A;  4QT8 A;  5EMJ B;  3FCU A;  4L1Q D;  4FWW A;  3IUL A;  4MMX A;  4Z7O A;  1UOQ A;  3ZE2 A;  4BCD A;  4FA5 D;  5KDO B;  3SCY A;  4D6V A;  4HDJ A;  2P9K C;  4AEZ A;  4ZOY A;  3I7K A;  3VI3 A;  3EQ8 A;  4IA9 A;  3I7N A;  1QFS A;  1PEV A;  4K3I D;  2P9P C;  4L9O A;  4CY1 A;  3NID A;  1TYE A;  1TYQ C;  1S4U X;  2GC7 A;  4DNW A;  5C92 A;  3MXX A;  1U4C A;  2CE8 A;  5GMK n;  2UZY B;  3UVK A;  3SXT D;  4MK0 B;  2H9M A;  4CZV A;  4E54 A;  1L0Q A;  4CC9 A;  3EI1 A;  2VDQ A;  4KFM B;  2Z2O A;  1PBY B;  3EI3 B;  3OF7 A;  3OL2 A;  4CY2 A;  3SLE D;  3O4J A;  3QHY B;  2H9P A;  4O2W A;  3T3P A;  4A7J A;  4D0K A;  3MVD K;  1K32 A;  5H14 A;  4WK4 A;  4X61 B;  2AGL A;  4A11 B;  4J0W A;  3VGZ A;  3SHF A;  2I0S A;  2AH1 A;  5TDH B;  3ZWL B;  2I3S A;  4PXW A;  3DWL C;  4AX4 A;  4GGA A;  3NVN A;  1I2M B;  4U7A A;  3ZE1 A;  2I3T A;  3NVX A;  5B4W A;  3OTT A;  2IUR A;  5EM2 A;  4PNK B;  3ZDY A;  1Q47 A;  1SHY B;  4NSX A;  3RMZ D;  1JTD B;  4NC4 A;  2EIC A;  3IJ0 A;  1A12 A;  5IJ7 E;  3AFC A;  2B5M A;  2MTA H;  3K6S A;  1N6F A; 
#chains in the Genus database with same CATH homology
 2VDL A;  4WJK A;  3V4V A;  4G1M A;  1JV2 A;  4WK0 A;  3K71 A;  4IRZ A;  5E6R A;  2VDQ A;  3T3M A;  4Z7Q A;  3FCU A;  3NIG A;  2VC2 A;  3NIF A;  4MMX A;  2VDP A;  4NEN A;  3ZE1 A;  4Z7O A;  2VDO A;  3K72 A;  4UM9 A;  3ZE2 A;  4WK2 A;  2VDN A;  4Z7N A;  3V4P A;  3ZDY A;  3ZDX A;  3FCS A;  1U8C A;  2VDM A;  2VDR A;  3ZE0 A;  4MMY A;  5FFO A;  2VDK A;  3VI3 A;  1M1X A;  5E6U A;  3T3P A;  4G1E A;  5FFG A;  3NID A;  1TYE A;  3ZDZ A;  5E6S A;  4MMZ A;  4O02 A;  4WK4 A;  3K6S A;  3IJE A;  4UM8 A;  5HDB A;  3VI4 A;  1L5G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...