3ZDZA

Integrin alphaiib beta3 headpiece and rgd peptide complex
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
455
structure length
455
Chain Sequence
LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Complete Integrin Headpiece Opening in Eight Steps.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system/peptide
molecule keywords INTEGRIN ALPHA-IIB
total genus 98
structure length 455
sequence length 455
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 3zdzA00
4WK2A 4G1MA 3ZDXA 2VDLA 4Z7NA 5E6UA 3FCUA 4Z7QA 1U8CA 3ZDZA 3FCSA 3NIDA 5FFGA 3T3PA 1L5GA 4Z7OA 3ZE0A 4IRZA 5E6SA 2VDPA 3IJEA 4MMXA 2VDOA 4O02A 3NIFA 4NENA 4MMYA 3ZDYA 4G1EA 3ZE1A 2VDKA 2VDNA 4MMZA 4UM8A 4WJKA 4WK4A 5FFOA 2VC2A 3V4VA 3VI4A 2VDRA 3K6SA 2VDQA 3NIGA 4WK0A 3K71A 5HDBA 1M1XA 3T3MA 2VDMA 3V4PA 5E6RA 3K72A 3VI3A 1TYEA 4UM9A 1JV2A 3ZE2A
chains in the Genus database with same CATH superfamily
1OLZA 3IIWA 3JPXA 4QAMA 5IJ8E 1GOFA 5EAMA 1YFQA 2P9IC 4JSVC 4ZOXA 5HE3B 4BCBA 1QNIA 3DSMA 4QT8A 2YMUA 3FRXA 5AJAA 5I5IA 3RN1D 1L0QA 5IGQA 3RFHA 2YNOA 2AH0A 2IURA 1VZ2A 5HDBA 2IUQA 3EQ9A 3NVNA 2J56H 5E6RA 1SQ9A 2EBSA 4CI1A 4JT6C 1UOOA 4XYHA 4Z7QA 2XE4A 3FGBA 3MKQA 4MK0B 4A08A 4GM3A 3DXKC 1N6DA 1XHMA 3MUOA 4O3UB 4XYIA 3NIFA 4JHNA 3I7NA 1GOGA 3SXTD 4FA9D 4ZN4A 4GQ1A 3PE7A 5M5TA 3KRWB 5EAPA 3RSEC 3ZWLB 4J0WA 1R5MA 4AOWA 4DNWA 2AGWA 4CI8A 2VDLA 4AN0A 4X3EA 2QZPA 1PI6A 4I79A 4AN1A 4KFMB 1SHYB 2I3TA 4CY1A 3EG6A 2P9LC 3F3FA 1E8MA 3OKYB 1UTCA 2AGYA 2VDKA 3I89A 5C86A 4PBYA 2H9MA 2VDQA 1ERJA 4WK0A 2I0SA 1YR2A 3T3MA 3OL2B 3L4MD 4IA9A 3K72A 4DNUA 2UZXB 4NC4A 3IUJA 4LG9A 5E6UA 5FKTA 4J8BA 4A7JA 5A2Qg 2IAAA 4LG8A 1A12A 1N6FA 3OKYA 2BKLA 3IIYA 1JJUB 3UVMA 4K3ID 1NEXB 4X63B 2IWFA 4PSWB 3RN0D 2H9PA 2YNPA 3C99A 2OIZA 3J80g 2VC2A 3VI4A 4K3JB 3SBPA 5TEFA 4ZOVA 2HESX 3EI4B 4L3GD 2XYIA 3UVOA 3ZDXA 3FM0A 5GSAA 3V5WB 5HE0B 3NIDA 1UOQA 3BG0A 3OKTA 5FXYA 2Z2PA 3EI2B 1H2ZA 3IKOA 3B7FA 2I3SA 4G56B 5I5JA 3V7DB 4A2MA 4CZVA 1JMXB 3JZHA 4PC0A 3OL2A 3EI4A 4ERYA 2HU7A 2BCJB 4AEZA 3IJCA 2VDMA 4H5JA 5H1MA 3RLMD 2B4EA 4D9SA 3I7KA 3NVQA 2H9LA 3IUMA 3C9CA 3JZGA 3MZLA 4NSXA 3OTTA 1JTDB 3PXTD 5EALA 4PSXB 3IURA 3CFVA 5FA5B 4NENA 1TBGA 3ZE1A 3V9FA 4FWWA 2HJ4A 4PBZA 5TDHB 3K6SA 3OKWA 3NIGA 2OVPB 1QFSA 1MDAH 4BUJC 1FWXA 3CIKB 1M1XA 1S4UX 5H17A 4J0XA 3IJ0A 2Z2NA 4PXWA 3OF7A 3PSLA 2PBIB 2GC4A 5FKSA 4J82A 2QC5A 2B5NA 1H2XA 3QI0A 4RE6A 2UZYB 4U7AA 5CYKB 5EARA 3I2NA 1U2VC 4N14A 3I8EA 4ZOYA 5M5VA 2G99A 5C92A 2BBKH 5GXIA 5M5SA 4GMBA 1UOPA 3SBQA 2OVQB 2H14A 1RI6A 3K71A 4GM9A 5IGOA 3SWSD 3DWLC 3UVNA 1BPOA 4XEIC 5EMKB 3ZE2A 1QFMA 3IVMA 4IMMA 2XL3A 5CYKA 3RFGA 1U8CA 4O2WA 4ESGA 3C75H 2Z2OA 3ZE0A 5HQGA 3MXXA 5E6SA 5I5MA 2EIBA 1I2MB 2O9KA 2H6KA 2VDOA 3JZNA 2VZ1A 3K27A 1GOHA 2EIDA 3E0CA 5FKRA 2HJBA 5KDOB 3BG1A 3N0DA 2PM6B 5M5RA 2EIEA 4JD2C 2YBAA 4FHLA 1PEVA 2OK4A 3VGZA 3SBRA 2XZGA 3PXWD 4G55A 4E54B 1H2WA 2P9NC 2AGLA 4FA1D 4CI3A 4J79A 3EI1B 1GXRA 4BCCA 3MZKA 3I8CA 2JKXA 3T3PA 1K3IA 1L5GA 3I7HA 4FB1D 5FLXg 2QXVA 3MUNA 5IJ7E 4EWRA 4L3HD 3IUNA 2OK6A 2XU7A 5M5UA 3DDUA 4J84A 4O02A 4A0AB 3I7LA 2W18A 2CE8A 3O4JA 4PNKB 3SHFA 5EMLB 1VE7A 5K1CC 4E54A 2XL2A 4BL0A 4X61B 2MTAH 4UM9A 3EI1A 1O6FA 5EM2A 4CY3A 4GZ8A 4A09B 1O6GA 2J57G 3I7PA 5JWZA 4WK2A 3U4YA 2H68A 3EI2A 4A2LA 3SCYA 3AL8A 4Y7RA 5FFGA 5K19A 4Z7OA 3AFCA 5C9ZB 3F3PA 3DM0A 4J87A 1VZ3A 5FKQA 4J73A 4BH6A 3RRMC 5EM2B 4GGDA 4JT5C 3JROA 4WJKA 3O4HA 3HFQA 5CXBA 4A09A 2HU5A 2Q7QA 5EMJB 2PM7B 2CO0C 4J86A 3K26A 3O4GA 1GP2B 3MVDK 3AL8B 5CXCA 3VI3A 4BP9A 4D0KA 1JV2A 2H13A 3MKSB 4HDJA 4ES0A 3GD1I 4O3TB 4JSNC 1JOFA 1K8KC 4GGCA 2TRCB 4O1QD 1SQJA 2B5MA 3IJEA 2P9PC 4MMXA 1B9YA 1U4CA 1N6EA 2YNNA 4OWRA 3MMYA 4AMZA 5H14A 4ERZA 3UR4A 1MG3A 4FAVD 4NBMA 2AQ5A 1P22A 2J55H 2OJYA 4WK4A 2HXCA 5FFOA 2H6QA 2PM9A 4UI9R 2P9UC 4OZUA 3PSCB 2I0TA 4AMYA 3IJ1A 5EMMB 3FCUA 3GREA 2CO0A 3VA6A 4O45A 1JMZB 3EQ8A 4JSXC 4H5IA 4A0BA 1NR0A 4Z8LA 3IULA 2HU8A 2PM9B 1VE6A 2IUPA 4JSPC 5M61A 3RMZD 1MG2A 5HE1B 2AGXA 3JRPA 3P4FA 4GQ2P 1TYQC 1GG2B 4Y5RD 3KRXB 2IUVA 4JHPC 3SFZA 3OW8A 3UVKA 4GQBB 5B4WA 2HKRA 4CZYA 4Z7NA 5AFU3 4A11B 2AH1A 4AX4A 1C9IA 3FCSA 4CY5A 2H6NA 4ZOZA 3NVXA 4FAND 4YVDA 5C2WB 3J81g 4JXMA 3CFSB 4A08B 3ORVD 4MMYA 3ZDYA 2VDNA 2H47A 1PBYB 2HKMA 3V4VA 3UVLA 1GOTB 3SMRA 3EMHA 3EI3B 4A11A 4R7AB 2AGZA 3A0FA 4O9DA 2GNQA 2P9KC 2QR5A 2VZ3A 4ERQA 4GGAA 5GXHA 3AH8B 1TYEA 2B5LA 3GC3B 2XDWA 4D6VA 1H2YA 2HYEA 2WQ8A 4E5ZA 4A0BB 4L1MA 4A0AA 2EICA 4FA4D 2YB8B 4NAAA 3KCIA 1B9XA 3N0EA 2CE9A 3PVUB 1K32A 4MMZA 4UM8A 4RE5A 2GC7A 3PXSD 4J78A 1VYHC 3SVWD 4X60B 5FQDA 5SXMA 3EQ7A 3PVWB 4QQEA 5THAA 2IWKA 1PGUA 4J81A 2CN2A 5GMKn 4GM8A 4L1QD 3SJLD 4J77A 3DXMC 1A0RB 1XIPA 3SLED 3VH0A 5CXBB 3EU7A 4TZ4A 5C2VB 2I0RA 3EI3A 3SN6B 3I7OA 4BP8A 3GFCA 3O4IA 5CXCB 4CZXA 1Q47A 1E8NA 2VDRA 4FA5D 3UKUC 2OVRB 5AMSA 5TEEA 4U1EI 5TF2A 4G1MA 4CY2A 3ZDZA 3BWSA 1C9LA 1T2XA 3F3GA 1E5TA 3JAMg 4QRJA 4IRZA 4CI2A 3ODTA 2VDPA 4LGNA 4E5ZB 5IT9g 3AL9A 5HYNB 3C5MA 1XKSA 4G1EA 5HE2B 2P9SC 4DNVA 3QHYB 4QL1A 2H9NA 3JB9L 4CC9A 3UKRC 1OMWB 3L4OD 3W15A 2H3XA 2CNXA 2G9AA 3V4PA 4J8GA 5IC7A 3ULEC 3EWEA 4BCDA 2CN3A 4L9OA 3IUQA
chains in the Genus database with same CATH topology
4WK2A 4G1MA 3ZDXA 2VDLA 4Z7NA 5E6UA 3FCUA 4Z7QA 1U8CA 3ZDZA 3FCSA 3NIDA 5FFGA 3T3PA 1L5GA 4Z7OA 3ZE0A 4IRZA 5E6SA 2VDPA 3IJEA 4MMXA 2VDOA 4O02A 3NIFA 4NENA 4MMYA 3ZDYA 4G1EA 3ZE1A 2VDKA 2VDNA 4MMZA 4UM8A 4WJKA 4WK4A 5FFOA 2VC2A 3V4VA 3VI4A 2VDRA 3K6SA 2VDQA 3NIGA 4WK0A 3K71A 5HDBA 1M1XA 3T3MA 2VDMA 3V4PA 5E6RA 3K72A 3VI3A 1TYEA 4UM9A 1JV2A 3ZE2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WK2 A;  4G1M A;  3ZDX A;  2VDL A;  4Z7N A;  5E6U A;  3FCU A;  4Z7Q A;  1U8C A;  3ZDZ A;  3FCS A;  3NID A;  5FFG A;  3T3P A;  1L5G A;  4Z7O A;  3ZE0 A;  4IRZ A;  5E6S A;  2VDP A;  3IJE A;  4MMX A;  2VDO A;  4O02 A;  3NIF A;  4NEN A;  4MMY A;  3ZDY A;  4G1E A;  3ZE1 A;  2VDK A;  2VDN A;  4MMZ A;  4UM8 A;  4WJK A;  4WK4 A;  5FFO A;  2VC2 A;  3V4V A;  3VI4 A;  2VDR A;  3K6S A;  2VDQ A;  3NIG A;  4WK0 A;  3K71 A;  5HDB A;  1M1X A;  3T3M A;  2VDM A;  3V4P A;  5E6R A;  3K72 A;  3VI3 A;  1TYE A;  4UM9 A;  1JV2 A;  3ZE2 A; 
#chains in the Genus database with same CATH topology
 1OLZ A;  3IIW A;  3JPX A;  4QAM A;  5IJ8 E;  1GOF A;  5EAM A;  1YFQ A;  2P9I C;  4JSV C;  4ZOX A;  5HE3 B;  4BCB A;  1QNI A;  3DSM A;  4QT8 A;  2YMU A;  3FRX A;  5AJA A;  5I5I A;  3RN1 D;  1L0Q A;  5IGQ A;  3RFH A;  2YNO A;  2AH0 A;  2IUR A;  1VZ2 A;  5HDB A;  2IUQ A;  3EQ9 A;  3NVN A;  2J56 H;  5E6R A;  1SQ9 A;  2EBS A;  4CI1 A;  4JT6 C;  1UOO A;  4XYH A;  4Z7Q A;  2XE4 A;  3FGB A;  3MKQ A;  4MK0 B;  4A08 A;  4GM3 A;  3DXK C;  1N6D A;  1XHM A;  3MUO A;  4O3U B;  4XYI A;  3NIF A;  4JHN A;  3I7N A;  1GOG A;  3SXT D;  4FA9 D;  4ZN4 A;  4GQ1 A;  3PE7 A;  5M5T A;  3KRW B;  5EAP A;  3RSE C;  3ZWL B;  4J0W A;  1R5M A;  4AOW A;  4DNW A;  2AGW A;  4CI8 A;  2VDL A;  4AN0 A;  4X3E A;  2QZP A;  1PI6 A;  4I79 A;  4AN1 A;  4KFM B;  1SHY B;  2I3T A;  4CY1 A;  3EG6 A;  2P9L C;  3F3F A;  1E8M A;  3OKY B;  1UTC A;  2AGY A;  2VDK A;  3I89 A;  5C86 A;  4PBY A;  2H9M A;  2VDQ A;  1ERJ A;  4WK0 A;  2I0S A;  1YR2 A;  3T3M A;  3OL2 B;  3L4M D;  4IA9 A;  3K72 A;  4DNU A;  2UZX B;  4NC4 A;  3IUJ A;  4LG9 A;  5E6U A;  5FKT A;  4J8B A;  4A7J A;  5A2Q g;  2IAA A;  4LG8 A;  1A12 A;  1N6F A;  3OKY A;  2BKL A;  3IIY A;  1JJU B;  3UVM A;  4K3I D;  1NEX B;  4X63 B;  2IWF A;  4PSW B;  3RN0 D;  2H9P A;  2YNP A;  3C99 A;  2OIZ A;  3J80 g;  2VC2 A;  3VI4 A;  4K3J B;  3SBP A;  5TEF A;  4ZOV A;  2HES X;  3EI4 B;  4L3G D;  2XYI A;  3UVO A;  3ZDX A;  3FM0 A;  5GSA A;  3V5W B;  5HE0 B;  3NID A;  1UOQ A;  3BG0 A;  3OKT A;  5FXY A;  2Z2P A;  3EI2 B;  1H2Z A;  3IKO A;  3B7F A;  2I3S A;  4G56 B;  5I5J A;  3V7D B;  4A2M A;  4CZV A;  1JMX B;  3JZH A;  4PC0 A;  3OL2 A;  3EI4 A;  4ERY A;  2HU7 A;  2BCJ B;  4AEZ A;  3IJC A;  2VDM A;  4H5J A;  5H1M A;  3RLM D;  2B4E A;  4D9S A;  3I7K A;  3NVQ A;  2H9L A;  3IUM A;  3C9C A;  3JZG A;  3MZL A;  4NSX A;  3OTT A;  1JTD B;  3PXT D;  5EAL A;  4PSX B;  3IUR A;  3CFV A;  5FA5 B;  4NEN A;  1TBG A;  3ZE1 A;  3V9F A;  4FWW A;  2HJ4 A;  4PBZ A;  5TDH B;  3K6S A;  3OKW A;  3NIG A;  2OVP B;  1QFS A;  1MDA H;  4BUJ C;  1FWX A;  3CIK B;  1M1X A;  1S4U X;  5H17 A;  4J0X A;  3IJ0 A;  2Z2N A;  4PXW A;  3OF7 A;  3PSL A;  2PBI B;  2GC4 A;  5FKS A;  4J82 A;  2QC5 A;  2B5N A;  1H2X A;  3QI0 A;  4RE6 A;  2UZY B;  4U7A A;  5CYK B;  5EAR A;  3I2N A;  1U2V C;  4N14 A;  3I8E A;  4ZOY A;  5M5V A;  2G99 A;  5C92 A;  2BBK H;  5GXI A;  5M5S A;  4GMB A;  1UOP A;  3SBQ A;  2OVQ B;  2H14 A;  1RI6 A;  3K71 A;  4GM9 A;  5IGO A;  3SWS D;  3DWL C;  3UVN A;  1BPO A;  4XEI C;  5EMK B;  3ZE2 A;  1QFM A;  3IVM A;  4IMM A;  2XL3 A;  5CYK A;  3RFG A;  1U8C A;  4O2W A;  4ESG A;  3C75 H;  2Z2O A;  3ZE0 A;  5HQG A;  3MXX A;  5E6S A;  5I5M A;  2EIB A;  1I2M B;  2O9K A;  2H6K A;  2VDO A;  3JZN A;  2VZ1 A;  3K27 A;  1GOH A;  2EID A;  3E0C A;  5FKR A;  2HJB A;  5KDO B;  3BG1 A;  3N0D A;  2PM6 B;  5M5R A;  2EIE A;  4JD2 C;  2YBA A;  4FHL A;  1PEV A;  2OK4 A;  3VGZ A;  3SBR A;  2XZG A;  3PXW D;  4G55 A;  4E54 B;  1H2W A;  2P9N C;  2AGL A;  4FA1 D;  4CI3 A;  4J79 A;  3EI1 B;  1GXR A;  4BCC A;  3MZK A;  3I8C A;  2JKX A;  3T3P A;  1K3I A;  1L5G A;  3I7H A;  4FB1 D;  5FLX g;  2QXV A;  3MUN A;  5IJ7 E;  4EWR A;  4L3H D;  3IUN A;  2OK6 A;  2XU7 A;  5M5U A;  3DDU A;  4J84 A;  4O02 A;  4A0A B;  3I7L A;  2W18 A;  2CE8 A;  3O4J A;  4PNK B;  3SHF A;  5EML B;  1VE7 A;  5K1C C;  4E54 A;  2XL2 A;  4BL0 A;  4X61 B;  2MTA H;  4UM9 A;  3EI1 A;  1O6F A;  5EM2 A;  4CY3 A;  4GZ8 A;  4A09 B;  1O6G A;  2J57 G;  3I7P A;  5JWZ A;  4WK2 A;  3U4Y A;  2H68 A;  3EI2 A;  4A2L A;  3SCY A;  3AL8 A;  4Y7R A;  5FFG A;  5K19 A;  4Z7O A;  3AFC A;  5C9Z B;  3F3P A;  3DM0 A;  4J87 A;  1VZ3 A;  5FKQ A;  4J73 A;  4BH6 A;  3RRM C;  5EM2 B;  4GGD A;  4JT5 C;  3JRO A;  4WJK A;  3O4H A;  3HFQ A;  5CXB A;  4A09 A;  2HU5 A;  2Q7Q A;  5EMJ B;  2PM7 B;  2CO0 C;  4J86 A;  3K26 A;  3O4G A;  1GP2 B;  3MVD K;  3AL8 B;  5CXC A;  3VI3 A;  4BP9 A;  4D0K A;  1JV2 A;  2H13 A;  3MKS B;  4HDJ A;  4ES0 A;  3GD1 I;  4O3T B;  4JSN C;  1JOF A;  1K8K C;  4GGC A;  2TRC B;  4O1Q D;  1SQJ A;  2B5M A;  3IJE A;  2P9P C;  4MMX A;  1B9Y A;  1U4C A;  1N6E A;  2YNN A;  4OWR A;  3MMY A;  4AMZ A;  5H14 A;  4ERZ A;  3UR4 A;  1MG3 A;  4FAV D;  4NBM A;  2AQ5 A;  1P22 A;  2J55 H;  2OJY A;  4WK4 A;  2HXC A;  5FFO A;  2H6Q A;  2PM9 A;  4UI9 R;  2P9U C;  4OZU A;  3PSC B;  2I0T A;  4AMY A;  3IJ1 A;  5EMM B;  3FCU A;  3GRE A;  2CO0 A;  3VA6 A;  4O45 A;  1JMZ B;  3EQ8 A;  4JSX C;  4H5I A;  4A0B A;  1NR0 A;  4Z8L A;  3IUL A;  2HU8 A;  2PM9 B;  1VE6 A;  2IUP A;  4JSP C;  5M61 A;  3RMZ D;  1MG2 A;  5HE1 B;  2AGX A;  3JRP A;  3P4F A;  4GQ2 P;  1TYQ C;  1GG2 B;  4Y5R D;  3KRX B;  2IUV A;  4JHP C;  3SFZ A;  3OW8 A;  3UVK A;  4GQB B;  5B4W A;  2HKR A;  4CZY A;  4Z7N A;  5AFU 3;  4A11 B;  2AH1 A;  4AX4 A;  1C9I A;  3FCS A;  4CY5 A;  2H6N A;  4ZOZ A;  3NVX A;  4FAN D;  4YVD A;  5C2W B;  3J81 g;  4JXM A;  3CFS B;  4A08 B;  3ORV D;  4MMY A;  3ZDY A;  2VDN A;  2H47 A;  1PBY B;  2HKM A;  3V4V A;  3UVL A;  1GOT B;  3SMR A;  3EMH A;  3EI3 B;  4A11 A;  4R7A B;  2AGZ A;  3A0F A;  4O9D A;  2GNQ A;  2P9K C;  2QR5 A;  2VZ3 A;  4ERQ A;  4GGA A;  5GXH A;  3AH8 B;  1TYE A;  2B5L A;  3GC3 B;  2XDW A;  4D6V A;  1H2Y A;  2HYE A;  2WQ8 A;  4E5Z A;  4A0B B;  4L1M A;  4A0A A;  2EIC A;  4FA4 D;  2YB8 B;  4NAA A;  3KCI A;  1B9X A;  3N0E A;  2CE9 A;  3PVU B;  1K32 A;  4MMZ A;  4UM8 A;  4RE5 A;  2GC7 A;  3PXS D;  4J78 A;  1VYH C;  3SVW D;  4X60 B;  5FQD A;  5SXM A;  3EQ7 A;  3PVW B;  4QQE A;  5THA A;  2IWK A;  1PGU A;  4J81 A;  2CN2 A;  5GMK n;  4GM8 A;  4L1Q D;  3SJL D;  4J77 A;  3DXM C;  1A0R B;  1XIP A;  3SLE D;  3VH0 A;  5CXB B;  3EU7 A;  4TZ4 A;  5C2V B;  2I0R A;  3EI3 A;  3SN6 B;  3I7O A;  4BP8 A;  3GFC A;  3O4I A;  5CXC B;  4CZX A;  1Q47 A;  1E8N A;  2VDR A;  4FA5 D;  3UKU C;  2OVR B;  5AMS A;  5TEE A;  4U1E I;  5TF2 A;  4G1M A;  4CY2 A;  3ZDZ A;  3BWS A;  1C9L A;  1T2X A;  3F3G A;  1E5T A;  3JAM g;  4QRJ A;  4IRZ A;  4CI2 A;  3ODT A;  2VDP A;  4LGN A;  4E5Z B;  5IT9 g;  3AL9 A;  5HYN B;  3C5M A;  1XKS A;  4G1E A;  5HE2 B;  2P9S C;  4DNV A;  3QHY B;  4QL1 A;  2H9N A;  3JB9 L;  4CC9 A;  3UKR C;  1OMW B;  3L4O D;  3W15 A;  2H3X A;  2CNX A;  2G9A A;  3V4P A;  4J8G A;  5IC7 A;  3ULE C;  3EWE A;  4BCD A;  2CN3 A;  4L9O A;  3IUQ A; 
#chains in the Genus database with same CATH homology
 4WK2 A;  4G1M A;  3ZDX A;  2VDL A;  4Z7N A;  5E6U A;  3FCU A;  4Z7Q A;  1U8C A;  3ZDZ A;  3FCS A;  3NID A;  5FFG A;  3T3P A;  1L5G A;  4Z7O A;  3ZE0 A;  4IRZ A;  5E6S A;  2VDP A;  3IJE A;  4MMX A;  2VDO A;  4O02 A;  3NIF A;  4NEN A;  4MMY A;  3ZDY A;  4G1E A;  3ZE1 A;  2VDK A;  2VDN A;  4MMZ A;  4UM8 A;  4WJK A;  4WK4 A;  5FFO A;  2VC2 A;  3V4V A;  3VI4 A;  2VDR A;  3K6S A;  2VDQ A;  3NIG A;  4WK0 A;  3K71 A;  5HDB A;  1M1X A;  3T3M A;  2VDM A;  3V4P A;  5E6R A;  3K72 A;  3VI3 A;  1TYE A;  4UM9 A;  1JV2 A;  3ZE2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...