3ZDZA

Integrin alphaiib beta3 headpiece and rgd peptide complex
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
455
structure length
455
Chain Sequence
LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion/immune system/peptide
molecule keywords INTEGRIN ALPHA-IIB
publication title Complete Integrin Headpiece Opening in Eight Steps.
pubmed doi rcsb
source organism Homo sapiens
total genus 98
structure length 455
sequence length 455
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 3zdzA00
4Z7QA 3K71A 1TYEA 5FFOA 2VDMA 5E6SA 3ZDYA 2VDKA 3IJEA 4WK0A 2VDRA 4WK4A 3ZDZA 4NENA 5E6UA 4WJKA 4Z7NA 3T3PA 3FCSA 5FFGA 3NIGA 1U8CA 3ZE1A 4IRZA 2VC2A 3T3MA 2VDLA 4WK2A 5HDBA 1M1XA 3FCUA 4MMYA 3ZE2A 4MMXA 4MMZA 2VDOA 3ZE0A 4UM9A 4Z7OA 4G1MA 5E6RA 4G1EA 4O02A 2VDPA 3VI4A 4UM8A 2VDNA 3K6SA 1JV2A 3NIFA 3V4VA 3K72A 3ZDXA 3V4PA 3VI3A 3NIDA 1L5GA 2VDQA
chains in the Genus database with same CATH superfamily
2PM9B 2H3XA 4RE6A 4J0WA 3MUNA 2WQ8A 2AGWA 3AL9A 3BG1A 3C75H 2HU5A 1Q47A 3EI1B 5E6UA 2EICA 5I5IA 2H9NA 2VDLA 1M1XA 2H6NA 2OVQB 3IUNA 5EAMA 3V9FA 4JSXC 2CO0C 5H14A 4JHPC 3IUMA 2PM7B 4J84A 3C5MA 4BP8A 4A0BB 3I8CA 4QT8A 3JAMg 4J73A 4QRJA 3IJEA 4FA4D 3HFQA 3T3PA 3FCSA 4QL1A 1U8CA 2OK4A 3MXXA 4J78A 4A0AB 4Z8LA 3E0CA 1A12A 4FA1D 3NVNA 2OJYA 2H14A 3IULA 3BG0A 4JSVC 1P22A 2CN3A 2AGYA 4A09B 4EWRA 4D0KA 1N6DA 4GGCA 2W18A 4X3EA 2CO0A 4JXMA 5TDHB 2QXVA 4IA9A 4O1QD 5EARA 2P9SC 1XHMA 5GSAA 3PXSD 2TRCB 1OLZA 2BCJB 1QFSA 2Z2PA 3ODTA 5FKSA 2VDRA 4U1EI 3OW8A 4MK0B 3JZHA 2YNNA 4NENA 4E5ZB 3VH0A 3NIGA 4CY5A 2JKXA 3MKQA 3PXWD 5HYNB 3UVNA 4QAMA 4J81A 2AH0A 2VDOA 3A0FA 3SFZA 3IUJA 4CY2A 4AEZA 4DNVA 3EU7A 4CI1A 2HKMA 5HQGA 1JV2A 1GXRA 2YBAA 5FKRA 5SXMA 1SQ9A 2HJBA 3O4JA 3EI2B 2B5NA 4AX4A 5I5MA 3K71A 1GP2B 4JHNA 5JWZA 4BCDA 3N0DA 4ERYA 3MUOA 4WK4A 4X61B 5K19A 3ULEC 4PNKB 3RFGA 5M5TA 5M5UA 4ZOXA 2J55H 4WK2A 2G99A 1B9XA 4AN0A 1PBYB 3JPXA 1K3IA 5E6RA 5FKQA 2IURA 1YR2A 4XYIA 5I5JA 2VDNA 2AGLA 3RSEC 4A2LA 3RN0D 4A11B 2Z2NA 2AGZA 3QI0A 1SQJA 3VI3A 1ERJA 4DNUA 3IKOA 2EIEA 4CZXA 1TYEA 3JZGA 2VZ1A 5M5VA 4NBMA 4PXWA 3EI3B 2VDKA 5EMKB 3BWSA 4WJKA 1I2MB 4BP9A 4I79A 4JT5C 4H5JA 2I3TA 2VZ3A 1K32A 4ZOZA 1S4UX 1VYHC 3O4IA 4PSXB 3DM0A 4X63B 2H9LA 3OKWA 4AN1A 1YFQA 3KRWB 4A08A 5CYKA 2IAAA 3SLED 1H2XA 3O4GA 2IWKA 2H9MA 2I0SA 1GOHA 3SCYA 3FGBA 1H2WA 3UVLA 2H9PA 3SVWD 1L0QA 1RI6A 5AMSA 1VZ2A 3AL8A 3N0EA 4ES0A 5E6SA 1C9IA 3K27A 2HJ4A 4Y7RA 2OVPB 3DSMA 5C2WB 4CI8A 4OZUA 3T3MA 3MVDK 3GD1I 3DWLC 2H6QA 3VI4A 3F3FA 1UOPA 4JD2C 4PC0A 1E8MA 4X60B 4O3UB 5TEFA 3KCIA 1JJUB 4Z7QA 1XIPA 2G9AA 4BCCA 4L9OA 3ORVD 4LG8A 4J0XA 1TBGA 4U7AA 4FAVD 2CE8A 4J86A 1JOFA 5GXHA 2O9KA 5EMMB 1B9YA 4ZN4A 1XKSA 4K3ID 4LGNA 5IGOA 1TYQC 4MMYA 1U4CA 5EMJB 5IT9g 4FHLA 4R7AB 3C99A 1PEVA 4GM8A 4UM8A 3RN1D 3JRPA 1VZ3A 2P9UC 3J81g 2YMUA 3DXKC 3RRMC 2P9LC 1L5GA 4N14A 5H1MA 4J82A 3L4OD 4XYHA 3OL2A 3U4YA 2P9KC 3OKYA 4JSNC 3ZDZA 2XYIA 4Z7NA 2UZXB 5C92A 2I0TA 3I7HA 4ERQA 4CY1A 2P9NC 2HU8A 1VE7A 5TF2A 3OF7A 4E54A 4CC9A 4BCBA 3SBQA 3NVXA 4K3JB 3IJ1A 3NIDA 2UZYB 5HE0B 3NVQA 3O4HA 5B4WA 4WK0A 2GC7A 4G55A 5EMLB 3IIYA 1K8KC 4CZVA 3K26A 4FB1D 1OMWB 3EI4A 5FFGA 4RE5A 5CXCA 4G56B 4PBYA 3ZE2A 4A7JA 4TZ4A 3JZNA 3V7DB 4G1MA 3K6SA 3PXTD 2B5MA 3NIFA 3OL2B 3OKYB 4J87A 3VGZA 3RFHA 4ESGA 2P9PC 3DXMC 2HESX 3GFCA 4GM9A 4QQEA 3UVKA 1GOGA 5FLXg 5EM2A 5FKTA 4AOWA 1JMXB 4CY3A 3I2NA 5A2Qg 4J77A 4NSXA 4H5IA 3EMHA 2GNQA 2XL2A 3I89A 3JROA 4YVDA 4BH6A 2EIDA 3ZE1A 2Z2OA 3FM0A 4GQ2P 2IUPA 5HDBA 3FCUA 5HE3B 4ZOVA 3MMYA 2CN2A 1QNIA 3EI1A 2EBSA 3UVOA 1PI6A 2BKLA 2GC4A 3GREA 5TEEA 1UOOA 5FQDA 4L1QD 3EQ9A 4GZ8A 2YB8B 1N6EA 2AQ5A 2PM6B 1GOFA 3V5WB 2PBIB 3P4FA 4HDJA 3VA6A 4A2MA 3AFCA 3SXTD 4A0BA 5EAPA 3SBPA 2YNOA 4CZYA 2B4EA 1U2VC 3B7FA 4XEIC 5AJAA 4CI2A 1A0RB 1O6GA 4FA9D 4CI3A 4A0AA 3JB9L 3DDUA 2AH1A 4FA5D 4L3HD 3SWSD 2H47A 2OK6A 2XL3A 3MKSB 4PSWB 4GQBB 4O45A 4A09A 2CE9A 4A08B 5K1CC 2HU7A 5CYKB 3J80g 3UKUC 1SHYB 1N6FA 3EWEA 2QR5A 3EG6A 4GM3A 4Z7OA 4L1MA 4ZOYA 3OTTA 3AL8B 3IUQA 5M5SA 1VE6A 4E5ZA 2I0RA 3F3PA 4O9DA 2IWFA 4D6VA 3EQ7A 3MZKA 4BUJC 2XZGA 3IIWA 2J56H 3KRXB 3PSLA 4IMMA 3SHFA 3ZDYA 3RMZD 5GMKn 3I7PA 1T2XA 3CFVA 5IJ8E 3EI2A 5M5RA 3UVMA 2AGXA 5C2VB 4GQ1A 4J79A 2H13A 3MZLA 1FWXA 4AMZA 1UTCA 3IJ0A 3UKRC 3SJLD 2H6KA 1NR0A 2XDWA 3ZDXA 4FAND 4L3GD 5IC7A 2OIZA 5CXBA 5FA5B 3F3GA 4KFMB 2B5LA 4DNWA 2VDQA 2XU7A 5H17A 1E5TA 5FFOA 4O3TB 2IUVA 1MG3A 2VDMA 1MG2A 1UOQA 4O2WA 1QFMA 3OKTA 4A11A 4AMYA 4ERZA 4IRZA 3UR4A 2MTAH 2CNXA 3C9CA 4MMXA 4MMZA 3EI3A 4UM9A 1BPOA 5HE1B 1O6FA 5AFU3 2VDPA 2P9IC 3I7LA 1PGUA 3V4VA 4JT6C 5C86A 2EIBA 5IJ7E 3IJCA 3L4MD 5IGQA 5M61A 1E8NA 1H2YA 3EQ8A 2BBKH 4E54B 4J8GA 2HXCA 4J8BA 2I3SA 1JMZB 2Q7QA 2VC2A 4FWWA 5CXBB 2PM9A 4GMBA 5HE2B 4JSPC 3PVUB 2H68A 3I8EA 3CFSB 5FXYA 4G1EA 4UI9R 3GC3B 4GGAA 2J57G 4OWRA 3K72A 3CIKB 3EI4B 3I7KA 3AH8B 1R5MA 2XE4A 3PSCB 3PE7A 5CXCB 3I7OA 4LG9A 3PVWB 3I7NA 1GOTB 4D9SA 3FRXA 3QHYB 3SBRA 3SMRA 3RLMD 4GGDA 2HYEA 3ZWLB 3W15A 5KDOB 5C9ZB 1GG2B 3ZE0A 2HKRA 5EM2B 2IUQA 4Y5RD 4O02A 1NEXB 5THAA 5GXIA 4NAAA 1H2ZA 1C9LA 4PBZA 2QC5A 1MDAH 3IURA 1JTDB 2QZPA 2OVRB 5EALA 3V4PA 3SN6B 4BL0A 4NC4A 3IVMA 2YNPA
chains in the Genus database with same CATH topology
4Z7QA 3K71A 1TYEA 5FFOA 2VDMA 5E6SA 3ZDYA 2VDKA 3IJEA 4WK0A 2VDRA 4WK4A 3ZDZA 4NENA 5E6UA 4WJKA 4Z7NA 3T3PA 3FCSA 5FFGA 3NIGA 1U8CA 3ZE1A 4IRZA 2VC2A 3T3MA 2VDLA 4WK2A 5HDBA 1M1XA 3FCUA 4MMYA 3ZE2A 4MMXA 4MMZA 2VDOA 3ZE0A 4UM9A 4Z7OA 4G1MA 5E6RA 4G1EA 4O02A 2VDPA 3VI4A 4UM8A 2VDNA 3K6SA 1JV2A 3NIFA 3V4VA 3K72A 3ZDXA 3V4PA 3VI3A 3NIDA 1L5GA 2VDQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Z7Q A;  3K71 A;  1TYE A;  5FFO A;  2VDM A;  5E6S A;  3ZDY A;  2VDK A;  3IJE A;  4WK0 A;  2VDR A;  4WK4 A;  3ZDZ A;  4NEN A;  5E6U A;  4WJK A;  4Z7N A;  3T3P A;  3FCS A;  5FFG A;  3NIG A;  1U8C A;  3ZE1 A;  4IRZ A;  2VC2 A;  3T3M A;  2VDL A;  4WK2 A;  5HDB A;  1M1X A;  3FCU A;  4MMY A;  3ZE2 A;  4MMX A;  4MMZ A;  2VDO A;  3ZE0 A;  4UM9 A;  4Z7O A;  4G1M A;  5E6R A;  4G1E A;  4O02 A;  2VDP A;  3VI4 A;  4UM8 A;  2VDN A;  3K6S A;  1JV2 A;  3NIF A;  3V4V A;  3K72 A;  3ZDX A;  3V4P A;  3VI3 A;  3NID A;  1L5G A;  2VDQ A; 
#chains in the Genus database with same CATH topology
 2PM9 B;  2H3X A;  4RE6 A;  4J0W A;  3MUN A;  2WQ8 A;  2AGW A;  3AL9 A;  3BG1 A;  3C75 H;  2HU5 A;  1Q47 A;  3EI1 B;  5E6U A;  2EIC A;  5I5I A;  2H9N A;  2VDL A;  1M1X A;  2H6N A;  2OVQ B;  3IUN A;  5EAM A;  3V9F A;  4JSX C;  2CO0 C;  5H14 A;  4JHP C;  3IUM A;  2PM7 B;  4J84 A;  3C5M A;  4BP8 A;  4A0B B;  3I8C A;  4QT8 A;  3JAM g;  4J73 A;  4QRJ A;  3IJE A;  4FA4 D;  3HFQ A;  3T3P A;  3FCS A;  4QL1 A;  1U8C A;  2OK4 A;  3MXX A;  4J78 A;  4A0A B;  4Z8L A;  3E0C A;  1A12 A;  4FA1 D;  3NVN A;  2OJY A;  2H14 A;  3IUL A;  3BG0 A;  4JSV C;  1P22 A;  2CN3 A;  2AGY A;  4A09 B;  4EWR A;  4D0K A;  1N6D A;  4GGC A;  2W18 A;  4X3E A;  2CO0 A;  4JXM A;  5TDH B;  2QXV A;  4IA9 A;  4O1Q D;  5EAR A;  2P9S C;  1XHM A;  5GSA A;  3PXS D;  2TRC B;  1OLZ A;  2BCJ B;  1QFS A;  2Z2P A;  3ODT A;  5FKS A;  2VDR A;  4U1E I;  3OW8 A;  4MK0 B;  3JZH A;  2YNN A;  4NEN A;  4E5Z B;  3VH0 A;  3NIG A;  4CY5 A;  2JKX A;  3MKQ A;  3PXW D;  5HYN B;  3UVN A;  4QAM A;  4J81 A;  2AH0 A;  2VDO A;  3A0F A;  3SFZ A;  3IUJ A;  4CY2 A;  4AEZ A;  4DNV A;  3EU7 A;  4CI1 A;  2HKM A;  5HQG A;  1JV2 A;  1GXR A;  2YBA A;  5FKR A;  5SXM A;  1SQ9 A;  2HJB A;  3O4J A;  3EI2 B;  2B5N A;  4AX4 A;  5I5M A;  3K71 A;  1GP2 B;  4JHN A;  5JWZ A;  4BCD A;  3N0D A;  4ERY A;  3MUO A;  4WK4 A;  4X61 B;  5K19 A;  3ULE C;  4PNK B;  3RFG A;  5M5T A;  5M5U A;  4ZOX A;  2J55 H;  4WK2 A;  2G99 A;  1B9X A;  4AN0 A;  1PBY B;  3JPX A;  1K3I A;  5E6R A;  5FKQ A;  2IUR A;  1YR2 A;  4XYI A;  5I5J A;  2VDN A;  2AGL A;  3RSE C;  4A2L A;  3RN0 D;  4A11 B;  2Z2N A;  2AGZ A;  3QI0 A;  1SQJ A;  3VI3 A;  1ERJ A;  4DNU A;  3IKO A;  2EIE A;  4CZX A;  1TYE A;  3JZG A;  2VZ1 A;  5M5V A;  4NBM A;  4PXW A;  3EI3 B;  2VDK A;  5EMK B;  3BWS A;  4WJK A;  1I2M B;  4BP9 A;  4I79 A;  4JT5 C;  4H5J A;  2I3T A;  2VZ3 A;  1K32 A;  4ZOZ A;  1S4U X;  1VYH C;  3O4I A;  4PSX B;  3DM0 A;  4X63 B;  2H9L A;  3OKW A;  4AN1 A;  1YFQ A;  3KRW B;  4A08 A;  5CYK A;  2IAA A;  3SLE D;  1H2X A;  3O4G A;  2IWK A;  2H9M A;  2I0S A;  1GOH A;  3SCY A;  3FGB A;  1H2W A;  3UVL A;  2H9P A;  3SVW D;  1L0Q A;  1RI6 A;  5AMS A;  1VZ2 A;  3AL8 A;  3N0E A;  4ES0 A;  5E6S A;  1C9I A;  3K27 A;  2HJ4 A;  4Y7R A;  2OVP B;  3DSM A;  5C2W B;  4CI8 A;  4OZU A;  3T3M A;  3MVD K;  3GD1 I;  3DWL C;  2H6Q A;  3VI4 A;  3F3F A;  1UOP A;  4JD2 C;  4PC0 A;  1E8M A;  4X60 B;  4O3U B;  5TEF A;  3KCI A;  1JJU B;  4Z7Q A;  1XIP A;  2G9A A;  4BCC A;  4L9O A;  3ORV D;  4LG8 A;  4J0X A;  1TBG A;  4U7A A;  4FAV D;  2CE8 A;  4J86 A;  1JOF A;  5GXH A;  2O9K A;  5EMM B;  1B9Y A;  4ZN4 A;  1XKS A;  4K3I D;  4LGN A;  5IGO A;  1TYQ C;  4MMY A;  1U4C A;  5EMJ B;  5IT9 g;  4FHL A;  4R7A B;  3C99 A;  1PEV A;  4GM8 A;  4UM8 A;  3RN1 D;  3JRP A;  1VZ3 A;  2P9U C;  3J81 g;  2YMU A;  3DXK C;  3RRM C;  2P9L C;  1L5G A;  4N14 A;  5H1M A;  4J82 A;  3L4O D;  4XYH A;  3OL2 A;  3U4Y A;  2P9K C;  3OKY A;  4JSN C;  3ZDZ A;  2XYI A;  4Z7N A;  2UZX B;  5C92 A;  2I0T A;  3I7H A;  4ERQ A;  4CY1 A;  2P9N C;  2HU8 A;  1VE7 A;  5TF2 A;  3OF7 A;  4E54 A;  4CC9 A;  4BCB A;  3SBQ A;  3NVX A;  4K3J B;  3IJ1 A;  3NID A;  2UZY B;  5HE0 B;  3NVQ A;  3O4H A;  5B4W A;  4WK0 A;  2GC7 A;  4G55 A;  5EML B;  3IIY A;  1K8K C;  4CZV A;  3K26 A;  4FB1 D;  1OMW B;  3EI4 A;  5FFG A;  4RE5 A;  5CXC A;  4G56 B;  4PBY A;  3ZE2 A;  4A7J A;  4TZ4 A;  3JZN A;  3V7D B;  4G1M A;  3K6S A;  3PXT D;  2B5M A;  3NIF A;  3OL2 B;  3OKY B;  4J87 A;  3VGZ A;  3RFH A;  4ESG A;  2P9P C;  3DXM C;  2HES X;  3GFC A;  4GM9 A;  4QQE A;  3UVK A;  1GOG A;  5FLX g;  5EM2 A;  5FKT A;  4AOW A;  1JMX B;  4CY3 A;  3I2N A;  5A2Q g;  4J77 A;  4NSX A;  4H5I A;  3EMH A;  2GNQ A;  2XL2 A;  3I89 A;  3JRO A;  4YVD A;  4BH6 A;  2EID A;  3ZE1 A;  2Z2O A;  3FM0 A;  4GQ2 P;  2IUP A;  5HDB A;  3FCU A;  5HE3 B;  4ZOV A;  3MMY A;  2CN2 A;  1QNI A;  3EI1 A;  2EBS A;  3UVO A;  1PI6 A;  2BKL A;  2GC4 A;  3GRE A;  5TEE A;  1UOO A;  5FQD A;  4L1Q D;  3EQ9 A;  4GZ8 A;  2YB8 B;  1N6E A;  2AQ5 A;  2PM6 B;  1GOF A;  3V5W B;  2PBI B;  3P4F A;  4HDJ A;  3VA6 A;  4A2M A;  3AFC A;  3SXT D;  4A0B A;  5EAP A;  3SBP A;  2YNO A;  4CZY A;  2B4E A;  1U2V C;  3B7F A;  4XEI C;  5AJA A;  4CI2 A;  1A0R B;  1O6G A;  4FA9 D;  4CI3 A;  4A0A A;  3JB9 L;  3DDU A;  2AH1 A;  4FA5 D;  4L3H D;  3SWS D;  2H47 A;  2OK6 A;  2XL3 A;  3MKS B;  4PSW B;  4GQB B;  4O45 A;  4A09 A;  2CE9 A;  4A08 B;  5K1C C;  2HU7 A;  5CYK B;  3J80 g;  3UKU C;  1SHY B;  1N6F A;  3EWE A;  2QR5 A;  3EG6 A;  4GM3 A;  4Z7O A;  4L1M A;  4ZOY A;  3OTT A;  3AL8 B;  3IUQ A;  5M5S A;  1VE6 A;  4E5Z A;  2I0R A;  3F3P A;  4O9D A;  2IWF A;  4D6V A;  3EQ7 A;  3MZK A;  4BUJ C;  2XZG A;  3IIW A;  2J56 H;  3KRX B;  3PSL A;  4IMM A;  3SHF A;  3ZDY A;  3RMZ D;  5GMK n;  3I7P A;  1T2X A;  3CFV A;  5IJ8 E;  3EI2 A;  5M5R A;  3UVM A;  2AGX A;  5C2V B;  4GQ1 A;  4J79 A;  2H13 A;  3MZL A;  1FWX A;  4AMZ A;  1UTC A;  3IJ0 A;  3UKR C;  3SJL D;  2H6K A;  1NR0 A;  2XDW A;  3ZDX A;  4FAN D;  4L3G D;  5IC7 A;  2OIZ A;  5CXB A;  5FA5 B;  3F3G A;  4KFM B;  2B5L A;  4DNW A;  2VDQ A;  2XU7 A;  5H17 A;  1E5T A;  5FFO A;  4O3T B;  2IUV A;  1MG3 A;  2VDM A;  1MG2 A;  1UOQ A;  4O2W A;  1QFM A;  3OKT A;  4A11 A;  4AMY A;  4ERZ A;  4IRZ A;  3UR4 A;  2MTA H;  2CNX A;  3C9C A;  4MMX A;  4MMZ A;  3EI3 A;  4UM9 A;  1BPO A;  5HE1 B;  1O6F A;  5AFU 3;  2VDP A;  2P9I C;  3I7L A;  1PGU A;  3V4V A;  4JT6 C;  5C86 A;  2EIB A;  5IJ7 E;  3IJC A;  3L4M D;  5IGQ A;  5M61 A;  1E8N A;  1H2Y A;  3EQ8 A;  2BBK H;  4E54 B;  4J8G A;  2HXC A;  4J8B A;  2I3S A;  1JMZ B;  2Q7Q A;  2VC2 A;  4FWW A;  5CXB B;  2PM9 A;  4GMB A;  5HE2 B;  4JSP C;  3PVU B;  2H68 A;  3I8E A;  3CFS B;  5FXY A;  4G1E A;  4UI9 R;  3GC3 B;  4GGA A;  2J57 G;  4OWR A;  3K72 A;  3CIK B;  3EI4 B;  3I7K A;  3AH8 B;  1R5M A;  2XE4 A;  3PSC B;  3PE7 A;  5CXC B;  3I7O A;  4LG9 A;  3PVW B;  3I7N A;  1GOT B;  4D9S A;  3FRX A;  3QHY B;  3SBR A;  3SMR A;  3RLM D;  4GGD A;  2HYE A;  3ZWL B;  3W15 A;  5KDO B;  5C9Z B;  1GG2 B;  3ZE0 A;  2HKR A;  5EM2 B;  2IUQ A;  4Y5R D;  4O02 A;  1NEX B;  5THA A;  5GXI A;  4NAA A;  1H2Z A;  1C9L A;  4PBZ A;  2QC5 A;  1MDA H;  3IUR A;  1JTD B;  2QZP A;  2OVR B;  5EAL A;  3V4P A;  3SN6 B;  4BL0 A;  4NC4 A;  3IVM A;  2YNP A; 
#chains in the Genus database with same CATH homology
 4Z7Q A;  3K71 A;  1TYE A;  5FFO A;  2VDM A;  5E6S A;  3ZDY A;  2VDK A;  3IJE A;  4WK0 A;  2VDR A;  4WK4 A;  3ZDZ A;  4NEN A;  5E6U A;  4WJK A;  4Z7N A;  3T3P A;  3FCS A;  5FFG A;  3NIG A;  1U8C A;  3ZE1 A;  4IRZ A;  2VC2 A;  3T3M A;  2VDL A;  4WK2 A;  5HDB A;  1M1X A;  3FCU A;  4MMY A;  3ZE2 A;  4MMX A;  4MMZ A;  2VDO A;  3ZE0 A;  4UM9 A;  4Z7O A;  4G1M A;  5E6R A;  4G1E A;  4O02 A;  2VDP A;  3VI4 A;  4UM8 A;  2VDN A;  3K6S A;  1JV2 A;  3NIF A;  3V4V A;  3K72 A;  3ZDX A;  3V4P A;  3VI3 A;  3NID A;  1L5G A;  2VDQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...