3ZDZA

Integrin alphaiib beta3 headpiece and rgd peptide complex
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
455
structure length
455
Chain Sequence
LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords INTEGRIN ALPHA-IIB
publication title Complete Integrin Headpiece Opening in Eight Steps.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system/peptide
total genus 98
structure length 455
sequence length 455
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 3zdzA00
3K71A 4O02A 5FFGA 3VI3A 2VDQA 2VC2A 5E6RA 3ZE1A 3NIFA 3T3MA 4MMZA 4WK2A 4UM9A 4Z7OA 3NIDA 3V4VA 5HDBA 1TYEA 2VDLA 2VDKA 3K72A 4MMXA 3VI4A 3ZE0A 4Z7NA 4G1MA 2VDRA 4NENA 5FFOA 4Z7QA 3NIGA 1M1XA 4WJKA 1U8CA 3T3PA 4WK0A 3ZDXA 4G1EA 3K6SA 2VDMA 4MMYA 3IJEA 3FCSA 3FCUA 2VDPA 3V4PA 5E6UA 3ZE2A 4IRZA 5E6SA 4WK4A 3ZDYA 1JV2A 3ZDZA 2VDOA 4UM8A 2VDNA 1L5GA
chains in the Genus database with same CATH superfamily
5K19A 1QNIA 5I5MA 3JRPA 3OF7A 4CY1A 2VC2A 2PM7B 4GGCA 2J55H 3QHYB 1JTDB 3DWLC 4NC4A 5EMLB 2IWKA 1TYEA 3VI4A 5TEEA 1UOOA 3GFCA 3OTTA 4J0XA 4WK0A 4U1EI 1PBYB 4FA1D 4FA5D 2PBIB 2PM6B 2QC5A 1BPOA 2OVQB 3C5MA 2H9LA 2AGLA 2IUVA 2HKMA 2W18A 5M5RA 3SXTD 3CFVA 2OVPB 5CXBB 2HXCA 4LG9A 1PEVA 3T3MA 3SHFA 2QR5A 5I5JA 2B4EA 4TZ4A 1GP2B 2VDKA 2YB8B 1TYQC 3C99A 4ZOXA 5SXMA 4O1QD 1K8KC 2WQ8A 3OKYB 3EMHA 2IURA 4X63B 4A0AB 3UVOA 1GOGA 2AGWA 3IJEA 5IGQA 2I0SA 3PXWD 5HQGA 1VZ2A 3SWSD 1N6DA 4J84A 5FXYA 4X3EA 1B9YA 5CXBA 2CO0C 2H6KA 1GXRA 3I7OA 2XYIA 3IVMA 3IURA 2UZYB 1I2MB 3OKYA 2AQ5A 3VGZA 5GSAA 5IJ7E 3UVLA 1OMWB 4A0AA 2YNOA 1R5MA 3FCSA 4JSVC 4DNVA 4G56B 1JJUB 5K1CC 3JAMg 3JZHA 1H2ZA 4AMZA 5M5SA 3O4HA 1L5GA 4GQ2P 4QT8A 4O2WA 4GGDA 4ZOZA 5A2Qg 4CI1A 5C86A 1H2XA 4UM9A 3JZNA 3JZGA 4UI9R 2IAAA 1UTCA 4XEIC 3EQ8A 4BP8A 1GOFA 4JHPC 4H5IA 3O4JA 2XDWA 2PM9B 3ZDXA 4J8BA 1GG2B 2Z2NA 1P22A 3V4PA 5FQDA 2AGZA 3OL2B 5E6SA 1UOPA 4WK4A 1O6GA 2HKRA 4PSXB 2VDNA 3SBPA 4BUJC 4RE6A 3KCIA 3EI4B 4L1QD 4FB1D 5HYNB 5E6RA 4Y7RA 5FLXg 3NIFA 3IJ1A 4FA9D 3IIYA 1C9IA 4RE5A 5AJAA 5HE1B 2H9NA 3V7DB 3EU7A 2YBAA 3K27A 3SJLD 4BH6A 1PI6A 1MG2A 4GQ1A 4J81A 1OLZA 2Z2OA 5EMMB 3JB9L 4CI2A 3SBQA 3T3PA 1O6FA 2OIZA 5H1MA 4O9DA 5AFU3 2H9MA 2PM9A 4JHNA 1SHYB 4ZOVA 3OL2A 1JV2A 3BG1A 3FM0A 4QL1A 4GMBA 3NVNA 3EI4A 3EQ7A 5B4WA 5M5UA 3BG0A 4BP9A 3IJ0A 1H2YA 3SN6B 2H13A 5M5TA 4Z7QA 2H6QA 5TF2A 3UVMA 4JD2C 3IUQA 3FRXA 1XKSA 3RSEC 4PBYA 1A0RB 4AX4A 2OK6A 2VDMA 5AMSA 3ZE2A 3RLMD 2H14A 5EMKB 4N14A 3I7HA 5FKTA 3O4GA 4D9SA 5CYKB 3ZDZA 4UM8A 2MTAH 5E6UA 5IC7A 2VDQA 4E5ZB 3HFQA 2B5LA 5THAA 4J78A 5IGOA 4QQEA 5TEFA 3KRXB 2XE4A 1RI6A 3I2NA 5EARA 4O3TB 3I8EA 3ODTA 3I7LA 2UZXB 4GQBB 3FGBA 3AFCA 1XIPA 3RMZD 4PNKB 3K6SA 3I8CA 4BL0A 4CZXA 4Y5RD 2B5MA 3FCUA 3JROA 4D0KA 2AH0A 3DXKC 2Z2PA 5CYKA 1MDAH 2AGXA 1VE6A 4K3ID 2OVRB 3RN1D 2VZ3A 5FKQA 4LG8A 4AOWA 5M5VA 4Z8LA 3SBRA 4EWRA 3DSMA 1QFSA 1E8MA 5TDHB 3ULEC 4Z7OA 4FAVD 4ZOYA 4ZN4A 3GC3B 3GREA 2HESX 3P4FA 2YNPA 2IUQA 4I79A 3ORVD 2P9SC 5EMJB 4DNWA 4GZ8A 5HE3B 3L4MD 1M1XA 4L1MA 2GNQA 3IULA 4JXMA 2I0TA 2H3XA 4K3JB 4J79A 4X61B 4BCCA 3IUMA 3N0DA 1A12A 3MZLA 4OZUA 3UKUC 4GGAA 4QAMA 1JOFA 4QRJA 4PC0A 2HJBA 1L0QA 2EIDA 1YFQA 4CC9A 3C75H 3AH8B 2G9AA 3IUNA 2CE8A 3I7PA 3DM0A 4H5JA 5HDBA 4A0BB 3I7KA 3ZE0A 4XYHA 1VYHC 2CE9A 3K26A 3PE7A 4JSPC 2B5NA 4J0WA 3DXMC 2TRCB 5EALA 2H9PA 3IJCA 2H47A 2GC7A 4L3GD 4CY5A 4MK0B 3W15A 4ES0A 2BBKH 3F3PA 2AH1A 4JSNC 5HE0B 3GD1I 3F3GA 4A11B 2P9KC 3N0EA 4AMYA 4X60B 2XL2A 4JT6C 2XZGA 1K32A 4ERZA 5C2VB 4MMZA 3J81g 1NR0A 1QFMA 1GOHA 4A0BA 5FKRA 1C9LA 4GM9A 4J77A 3UVNA 4J86A 5EAPA 2P9IC 3J80g 3EWEA 3OKWA 4R7AB 4FAND 5C2WB 1ERJA 4AEZA 4NBMA 4L3HD 3SMRA 3PSLA 4ERQA 1XHMA 3SLED 3I7NA 1JMXB 5HE2B 1E5TA 1PGUA 4A11A 2VZ1A 4HDJA 3EI1B 3PSCB 1E8NA 1U4CA 5CXCB 3E0CA 1GOTB 1VE7A 4MMXA 1JMZB 3V9FA 2VDRA 3RN0D 4ESGA 2QZPA 3MUOA 2EIBA 2I3SA 3EI2B 1FWXA 1H2WA 1K3IA 4BCBA 3MMYA 2EBSA 3DDUA 5EM2B 3RFGA 2XU7A 4YVDA 3SCYA 3QI0A 2YNNA 4A09B 4GM8A 4D6VA 3OKTA 3EI1A 3IIWA 2H6NA 3PXSD 2P9LC 5CXCA 3SVWD 4E54B 2HYEA 2CO0A 1N6EA 3ZWLB 3RRMC 2I3TA 5H17A 5GXIA 4AN1A 3EI2A 1MG3A 4XYIA 5C92A 3UKRC 2BCJB 2QXVA 2EICA 1VZ3A 1YR2A 3VH0A 3ZDYA 5GXHA 3EI3B 5EM2A 2CN3A 2HU7A 3JPXA 3UVKA 4A09A 3A0FA 1N6FA 4E5ZA 2O9KA 2HU5A 4PSWB 2H68A 3IUJA 2VDLA 4E54A 4PBZA 4U7AA 3EQ9A 3NVXA 4GM3A 4WJKA 3IKOA 3RFHA 4A2LA 4G1EA 4CY2A 4MMYA 1NEXB 2VDPA 3MKQA 4IMMA 1T2XA 3PXTD 4CZYA 3AL9A 4J82A 1Q47A 4FHLA 2VDOA 5EAMA 3EI3A 4ERYA 4O02A 2CNXA 4FA4D 4CI8A 3ZE1A 4AN0A 2HJ4A 3CFSB 3SFZA 3U4YA 3K72A 1SQ9A 1S4UX 1TBGA 2EIEA 3BWSA 4G1MA 4J73A 4NENA 4NSXA 2XL3A 3NIGA 4LGNA 1U8CA 1SQJA 4J8GA 4O3UB 2CN2A 5FKSA 5KDOB 2JKXA 5IJ8E 3MXXA 2P9PC 5I5IA 5M61A 1UOQA 2G99A 3PVUB 2HU8A 3V5WB 2BKLA 3K71A 3VI3A 5FFGA 2OK4A 3F3FA 4A08B 2GC4A 4WK2A 4BCDA 4KFMB 4J87A 4O45A 3C9CA 3PVWB 4FWWA 3AL8B 4CI3A 2P9UC 5H14A 1U2VC 3MZKA 5IT9g 4OWRA 1B9XA 3OW8A 2P9NC 4DNUA 5FA5B 4A2MA 4CY3A 4G55A 4PXWA 4A7JA 3EG6A 3I89A 4JT5C 3MVDK 4CZVA 4A08A 4NAAA 2IUPA 3KRWB 2AGYA 2Q7QA 2IWFA 3NIDA 5C9ZB 3V4VA 3VA6A 3NVQA 5GMKn 3L4OD 3MUNA 4Z7NA 2YMUA 3AL8A 3CIKB 4IA9A 5FFOA 4L9OA 2J57G 3O4IA 4JSXC 5JWZA 3B7FA 3MKSB 4IRZA 2J56H 2OJYA 2I0RA 3UR4A
chains in the Genus database with same CATH topology
3K71A 4O02A 5FFGA 3VI3A 2VDQA 2VC2A 5E6RA 3ZE1A 3NIFA 3T3MA 4MMZA 4WK2A 4UM9A 4Z7OA 3NIDA 3V4VA 5HDBA 1TYEA 2VDLA 2VDKA 3K72A 4MMXA 3VI4A 3ZE0A 4Z7NA 4G1MA 2VDRA 4NENA 5FFOA 4Z7QA 3NIGA 1M1XA 4WJKA 1U8CA 3T3PA 4WK0A 3ZDXA 4G1EA 3K6SA 2VDMA 4MMYA 3IJEA 3FCSA 3FCUA 2VDPA 3V4PA 5E6UA 3ZE2A 4IRZA 5E6SA 4WK4A 3ZDYA 1JV2A 3ZDZA 2VDOA 4UM8A 2VDNA 1L5GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K71 A;  4O02 A;  5FFG A;  3VI3 A;  2VDQ A;  2VC2 A;  5E6R A;  3ZE1 A;  3NIF A;  3T3M A;  4MMZ A;  4WK2 A;  4UM9 A;  4Z7O A;  3NID A;  3V4V A;  5HDB A;  1TYE A;  2VDL A;  2VDK A;  3K72 A;  4MMX A;  3VI4 A;  3ZE0 A;  4Z7N A;  4G1M A;  2VDR A;  4NEN A;  5FFO A;  4Z7Q A;  3NIG A;  1M1X A;  4WJK A;  1U8C A;  3T3P A;  4WK0 A;  3ZDX A;  4G1E A;  3K6S A;  2VDM A;  4MMY A;  3IJE A;  3FCS A;  3FCU A;  2VDP A;  3V4P A;  5E6U A;  3ZE2 A;  4IRZ A;  5E6S A;  4WK4 A;  3ZDY A;  1JV2 A;  3ZDZ A;  2VDO A;  4UM8 A;  2VDN A;  1L5G A; 
#chains in the Genus database with same CATH topology
 5K19 A;  1QNI A;  5I5M A;  3JRP A;  3OF7 A;  4CY1 A;  2VC2 A;  2PM7 B;  4GGC A;  2J55 H;  3QHY B;  1JTD B;  3DWL C;  4NC4 A;  5EML B;  2IWK A;  1TYE A;  3VI4 A;  5TEE A;  1UOO A;  3GFC A;  3OTT A;  4J0X A;  4WK0 A;  4U1E I;  1PBY B;  4FA1 D;  4FA5 D;  2PBI B;  2PM6 B;  2QC5 A;  1BPO A;  2OVQ B;  3C5M A;  2H9L A;  2AGL A;  2IUV A;  2HKM A;  2W18 A;  5M5R A;  3SXT D;  3CFV A;  2OVP B;  5CXB B;  2HXC A;  4LG9 A;  1PEV A;  3T3M A;  3SHF A;  2QR5 A;  5I5J A;  2B4E A;  4TZ4 A;  1GP2 B;  2VDK A;  2YB8 B;  1TYQ C;  3C99 A;  4ZOX A;  5SXM A;  4O1Q D;  1K8K C;  2WQ8 A;  3OKY B;  3EMH A;  2IUR A;  4X63 B;  4A0A B;  3UVO A;  1GOG A;  2AGW A;  3IJE A;  5IGQ A;  2I0S A;  3PXW D;  5HQG A;  1VZ2 A;  3SWS D;  1N6D A;  4J84 A;  5FXY A;  4X3E A;  1B9Y A;  5CXB A;  2CO0 C;  2H6K A;  1GXR A;  3I7O A;  2XYI A;  3IVM A;  3IUR A;  2UZY B;  1I2M B;  3OKY A;  2AQ5 A;  3VGZ A;  5GSA A;  5IJ7 E;  3UVL A;  1OMW B;  4A0A A;  2YNO A;  1R5M A;  3FCS A;  4JSV C;  4DNV A;  4G56 B;  1JJU B;  5K1C C;  3JAM g;  3JZH A;  1H2Z A;  4AMZ A;  5M5S A;  3O4H A;  1L5G A;  4GQ2 P;  4QT8 A;  4O2W A;  4GGD A;  4ZOZ A;  5A2Q g;  4CI1 A;  5C86 A;  1H2X A;  4UM9 A;  3JZN A;  3JZG A;  4UI9 R;  2IAA A;  1UTC A;  4XEI C;  3EQ8 A;  4BP8 A;  1GOF A;  4JHP C;  4H5I A;  3O4J A;  2XDW A;  2PM9 B;  3ZDX A;  4J8B A;  1GG2 B;  2Z2N A;  1P22 A;  3V4P A;  5FQD A;  2AGZ A;  3OL2 B;  5E6S A;  1UOP A;  4WK4 A;  1O6G A;  2HKR A;  4PSX B;  2VDN A;  3SBP A;  4BUJ C;  4RE6 A;  3KCI A;  3EI4 B;  4L1Q D;  4FB1 D;  5HYN B;  5E6R A;  4Y7R A;  5FLX g;  3NIF A;  3IJ1 A;  4FA9 D;  3IIY A;  1C9I A;  4RE5 A;  5AJA A;  5HE1 B;  2H9N A;  3V7D B;  3EU7 A;  2YBA A;  3K27 A;  3SJL D;  4BH6 A;  1PI6 A;  1MG2 A;  4GQ1 A;  4J81 A;  1OLZ A;  2Z2O A;  5EMM B;  3JB9 L;  4CI2 A;  3SBQ A;  3T3P A;  1O6F A;  2OIZ A;  5H1M A;  4O9D A;  5AFU 3;  2H9M A;  2PM9 A;  4JHN A;  1SHY B;  4ZOV A;  3OL2 A;  1JV2 A;  3BG1 A;  3FM0 A;  4QL1 A;  4GMB A;  3NVN A;  3EI4 A;  3EQ7 A;  5B4W A;  5M5U A;  3BG0 A;  4BP9 A;  3IJ0 A;  1H2Y A;  3SN6 B;  2H13 A;  5M5T A;  4Z7Q A;  2H6Q A;  5TF2 A;  3UVM A;  4JD2 C;  3IUQ A;  3FRX A;  1XKS A;  3RSE C;  4PBY A;  1A0R B;  4AX4 A;  2OK6 A;  2VDM A;  5AMS A;  3ZE2 A;  3RLM D;  2H14 A;  5EMK B;  4N14 A;  3I7H A;  5FKT A;  3O4G A;  4D9S A;  5CYK B;  3ZDZ A;  4UM8 A;  2MTA H;  5E6U A;  5IC7 A;  2VDQ A;  4E5Z B;  3HFQ A;  2B5L A;  5THA A;  4J78 A;  5IGO A;  4QQE A;  5TEF A;  3KRX B;  2XE4 A;  1RI6 A;  3I2N A;  5EAR A;  4O3T B;  3I8E A;  3ODT A;  3I7L A;  2UZX B;  4GQB B;  3FGB A;  3AFC A;  1XIP A;  3RMZ D;  4PNK B;  3K6S A;  3I8C A;  4BL0 A;  4CZX A;  4Y5R D;  2B5M A;  3FCU A;  3JRO A;  4D0K A;  2AH0 A;  3DXK C;  2Z2P A;  5CYK A;  1MDA H;  2AGX A;  1VE6 A;  4K3I D;  2OVR B;  3RN1 D;  2VZ3 A;  5FKQ A;  4LG8 A;  4AOW A;  5M5V A;  4Z8L A;  3SBR A;  4EWR A;  3DSM A;  1QFS A;  1E8M A;  5TDH B;  3ULE C;  4Z7O A;  4FAV D;  4ZOY A;  4ZN4 A;  3GC3 B;  3GRE A;  2HES X;  3P4F A;  2YNP A;  2IUQ A;  4I79 A;  3ORV D;  2P9S C;  5EMJ B;  4DNW A;  4GZ8 A;  5HE3 B;  3L4M D;  1M1X A;  4L1M A;  2GNQ A;  3IUL A;  4JXM A;  2I0T A;  2H3X A;  4K3J B;  4J79 A;  4X61 B;  4BCC A;  3IUM A;  3N0D A;  1A12 A;  3MZL A;  4OZU A;  3UKU C;  4GGA A;  4QAM A;  1JOF A;  4QRJ A;  4PC0 A;  2HJB A;  1L0Q A;  2EID A;  1YFQ A;  4CC9 A;  3C75 H;  3AH8 B;  2G9A A;  3IUN A;  2CE8 A;  3I7P A;  3DM0 A;  4H5J A;  5HDB A;  4A0B B;  3I7K A;  3ZE0 A;  4XYH A;  1VYH C;  2CE9 A;  3K26 A;  3PE7 A;  4JSP C;  2B5N A;  4J0W A;  3DXM C;  2TRC B;  5EAL A;  2H9P A;  3IJC A;  2H47 A;  2GC7 A;  4L3G D;  4CY5 A;  4MK0 B;  3W15 A;  4ES0 A;  2BBK H;  3F3P A;  2AH1 A;  4JSN C;  5HE0 B;  3GD1 I;  3F3G A;  4A11 B;  2P9K C;  3N0E A;  4AMY A;  4X60 B;  2XL2 A;  4JT6 C;  2XZG A;  1K32 A;  4ERZ A;  5C2V B;  4MMZ A;  3J81 g;  1NR0 A;  1QFM A;  1GOH A;  4A0B A;  5FKR A;  1C9L A;  4GM9 A;  4J77 A;  3UVN A;  4J86 A;  5EAP A;  2P9I C;  3J80 g;  3EWE A;  3OKW A;  4R7A B;  4FAN D;  5C2W B;  1ERJ A;  4AEZ A;  4NBM A;  4L3H D;  3SMR A;  3PSL A;  4ERQ A;  1XHM A;  3SLE D;  3I7N A;  1JMX B;  5HE2 B;  1E5T A;  1PGU A;  4A11 A;  2VZ1 A;  4HDJ A;  3EI1 B;  3PSC B;  1E8N A;  1U4C A;  5CXC B;  3E0C A;  1GOT B;  1VE7 A;  4MMX A;  1JMZ B;  3V9F A;  2VDR A;  3RN0 D;  4ESG A;  2QZP A;  3MUO A;  2EIB A;  2I3S A;  3EI2 B;  1FWX A;  1H2W A;  1K3I A;  4BCB A;  3MMY A;  2EBS A;  3DDU A;  5EM2 B;  3RFG A;  2XU7 A;  4YVD A;  3SCY A;  3QI0 A;  2YNN A;  4A09 B;  4GM8 A;  4D6V A;  3OKT A;  3EI1 A;  3IIW A;  2H6N A;  3PXS D;  2P9L C;  5CXC A;  3SVW D;  4E54 B;  2HYE A;  2CO0 A;  1N6E A;  3ZWL B;  3RRM C;  2I3T A;  5H17 A;  5GXI A;  4AN1 A;  3EI2 A;  1MG3 A;  4XYI A;  5C92 A;  3UKR C;  2BCJ B;  2QXV A;  2EIC A;  1VZ3 A;  1YR2 A;  3VH0 A;  3ZDY A;  5GXH A;  3EI3 B;  5EM2 A;  2CN3 A;  2HU7 A;  3JPX A;  3UVK A;  4A09 A;  3A0F A;  1N6F A;  4E5Z A;  2O9K A;  2HU5 A;  4PSW B;  2H68 A;  3IUJ A;  2VDL A;  4E54 A;  4PBZ A;  4U7A A;  3EQ9 A;  3NVX A;  4GM3 A;  4WJK A;  3IKO A;  3RFH A;  4A2L A;  4G1E A;  4CY2 A;  4MMY A;  1NEX B;  2VDP A;  3MKQ A;  4IMM A;  1T2X A;  3PXT D;  4CZY A;  3AL9 A;  4J82 A;  1Q47 A;  4FHL A;  2VDO A;  5EAM A;  3EI3 A;  4ERY A;  4O02 A;  2CNX A;  4FA4 D;  4CI8 A;  3ZE1 A;  4AN0 A;  2HJ4 A;  3CFS B;  3SFZ A;  3U4Y A;  3K72 A;  1SQ9 A;  1S4U X;  1TBG A;  2EIE A;  3BWS A;  4G1M A;  4J73 A;  4NEN A;  4NSX A;  2XL3 A;  3NIG A;  4LGN A;  1U8C A;  1SQJ A;  4J8G A;  4O3U B;  2CN2 A;  5FKS A;  5KDO B;  2JKX A;  5IJ8 E;  3MXX A;  2P9P C;  5I5I A;  5M61 A;  1UOQ A;  2G99 A;  3PVU B;  2HU8 A;  3V5W B;  2BKL A;  3K71 A;  3VI3 A;  5FFG A;  2OK4 A;  3F3F A;  4A08 B;  2GC4 A;  4WK2 A;  4BCD A;  4KFM B;  4J87 A;  4O45 A;  3C9C A;  3PVW B;  4FWW A;  3AL8 B;  4CI3 A;  2P9U C;  5H14 A;  1U2V C;  3MZK A;  5IT9 g;  4OWR A;  1B9X A;  3OW8 A;  2P9N C;  4DNU A;  5FA5 B;  4A2M A;  4CY3 A;  4G55 A;  4PXW A;  4A7J A;  3EG6 A;  3I89 A;  4JT5 C;  3MVD K;  4CZV A;  4A08 A;  4NAA A;  2IUP A;  3KRW B;  2AGY A;  2Q7Q A;  2IWF A;  3NID A;  5C9Z B;  3V4V A;  3VA6 A;  3NVQ A;  5GMK n;  3L4O D;  3MUN A;  4Z7N A;  2YMU A;  3AL8 A;  3CIK B;  4IA9 A;  5FFO A;  4L9O A;  2J57 G;  3O4I A;  4JSX C;  5JWZ A;  3B7F A;  3MKS B;  4IRZ A;  2J56 H;  2OJY A;  2I0R A;  3UR4 A; 
#chains in the Genus database with same CATH homology
 3K71 A;  4O02 A;  5FFG A;  3VI3 A;  2VDQ A;  2VC2 A;  5E6R A;  3ZE1 A;  3NIF A;  3T3M A;  4MMZ A;  4WK2 A;  4UM9 A;  4Z7O A;  3NID A;  3V4V A;  5HDB A;  1TYE A;  2VDL A;  2VDK A;  3K72 A;  4MMX A;  3VI4 A;  3ZE0 A;  4Z7N A;  4G1M A;  2VDR A;  4NEN A;  5FFO A;  4Z7Q A;  3NIG A;  1M1X A;  4WJK A;  1U8C A;  3T3P A;  4WK0 A;  3ZDX A;  4G1E A;  3K6S A;  2VDM A;  4MMY A;  3IJE A;  3FCS A;  3FCU A;  2VDP A;  3V4P A;  5E6U A;  3ZE2 A;  4IRZ A;  5E6S A;  4WK4 A;  3ZDY A;  1JV2 A;  3ZDZ A;  2VDO A;  4UM8 A;  2VDN A;  1L5G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...