3ZDZA

Integrin alphaiib beta3 headpiece and rgd peptide complex
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
455
structure length
455
Chain Sequence
b'LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVVK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords INTEGRIN ALPHA-IIB
publication title Complete Integrin Headpiece Opening in Eight Steps.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system/peptide
total genus 98
structure length 455
sequence length 455
chains with identical sequence C
ec nomenclature
pdb deposition date 2012-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 3zdzA00
4O02A 1JV2A 5FFGA 4UM9A 3NIFA 3K6SA 1U8CA 3V4VA 2VDQA 2VDKA 5HDBA 3K72A 3ZE0A 3T3PA 1L5GA 4MMZA 1M1XA 3K71A 3ZE2A 3ZDXA 3T3MA 3FCSA 4UM8A 5FFOA 3IJEA 4WK2A 5E6UA 2VC2A 4NENA 4G1EA 5E6RA 5E6SA 2VDRA 3VI4A 2VDMA 4WK4A 3ZE1A 4MMXA 2VDNA 2VDLA 4Z7NA 4G1MA 3V4PA 4Z7QA 2VDOA 4MMYA 4WJKA 3ZDZA 3FCUA 3NIDA 4IRZA 3VI3A 3ZDYA 3NIGA 1TYEA 4WK0A 4Z7OA 2VDPA
chains in the Genus database with same CATH superfamily
5EMLB 3OKYB 4IMMA 5IJ8E 2QXVA 4L9OA 2CO0A 5CYKB 2I3TA 2HJBA 3SMRA 4GM8A 4A11B 3PXSD 3JROA 4D0KA 2XL2A 2OK6A 3ZDZA 3ZDYA 4GGCA 4A0AA 1B9XA 4BCCA 1A0RB 2HESX 1QNIA 2O9KA 5EMJB 4J84A 1JMXB 1U8CA 3NVQA 3EI3B 5EAPA 1XHMA 4ES0A 4A08A 1GXRA 3OKWA 1L5GA 1N6EA 3IVMA 1PBYB 2GNQA 5M5SA 5SXMA 3SXTD 5CXBA 2CO0C 5E6SA 3EI4A 5GXHA 1OLZA 5FLXg 4BP8A 2J55H 3SBPA 2B5LA 5HE3B 4O02A 4J79A 1JOFA 3RFHA 1GP2B 1MDAH 3GFCA 2AH1A 2W18A 2G9AA 2HYEA 4PNKB 3O4IA 1K3IA 4ESGA 4J82A 2BKLA 4Z8LA 3I7OA 2H47A 4JD2C 4UI9R 4D9SA 4J77A 3E0CA 3SBRA 3ZWLB 5FXYA 3EI1B 3GREA 2OJYA 3I7NA 3V4PA 3MUNA 3UKUC 3GD1I 5IGOA 2HU7A 1PGUA 2HU5A 3OW8A 4Z7OA 4CC9A 2IURA 5FKQA 1TBGA 5I5JA 2QR5A 3JZNA 4LG8A 4GGAA 1UOPA 2Z2OA 5GSAA 4O9DA 3OKYA 3PVUB 4XEIC 3PXWD 4BH6A 5CYKA 4AN0A 1YFQA 2Z2NA 3I7PA 2EIDA 3DXMC 4GQ2P 3A0FA 4BP9A 5E6UA 1TYQC 2G99A 4O45A 4BL0A 4CY2A 4A11A 3PVWB 5I5IA 3F3GA 5TEEA 2P9NC 5HE2B 3I8CA 4PBZA 5EMKB 3MKQA 3EQ7A 3U4YA 4DNVA 3NIGA 5EARA 4OZUA 4TZ4A 2OVQB 4CI1A 2H6NA 5FFGA 1U2VC 2GC7A 5GMKn 3K6SA 3SCYA 1ERJA 3IUJA 3EI3A 3RFGA 4CI8A 5EALA 1XIPA 4O2WA 4CZYA 3DM0A 5AFU3 4ZOYA 1GOHA 3MZLA 5M5RA 4JT5C 5IGQA 3EI2B 1NEXB 4CI3A 3NVNA 3CFSB 2PM6B 4Z7NA 4JSPC 2H9NA 3BG1A 2YNNA 3FM0A 4GM9A 3OTTA 1JJUB 2VDPA 3IJ1A 3AL9A 2YNOA 1XKSA 2HJ4A 3SWSD 4JSXC 3JZGA 3KRXB 1H2YA 4J0XA 2H6KA 3V4VA 2H6QA 5HDBA 5M5VA 5H14A 1R5MA 2H9PA 3QI0A 2OVPB 4D6VA 3C99A 4WK4A 3EI1A 3OF7A 2H68A 1T2XA 3RSEC 5M5UA 3UVLA 3KRWB 4CY5A 3IJ0A 4LGNA 1SQJA 1O6FA 2PM9B 4Y7RA 4GGDA 1VYHC 1E5TA 1QFSA 3J81g 4NBMA 3UVMA 2I0SA 2JKXA 2CE8A 4J8BA 4ZOXA 3W15A 5FA5B 1M1XA 1VZ3A 3KCIA 4L3GD 4YVDA 3UVOA 3MVDK 1K8KC 2AGWA 3I2NA 4A09B 5E6RA 1RI6A 3SJLD 1GG2B 2TRCB 2IAAA 1A12A 4QL1A 5FQDA 4E5ZB 2WQ8A 3DDUA 2QC5A 4PC0A 3RN1D 2MTAH 4KFMB 3UR4A 3L4OD 3GC3B 1MG2A 3UKRC 4FHLA 3V9FA 3JPXA 3EQ9A 2YBAA 2IWKA 3C5MA 2OVRB 3VH0A 2HU8A 5FKRA 3T3PA 2VZ3A 4J8GA 4MMZA 5H17A 5C92A 3RLMD 3K71A 1PEVA 1E8MA 3FCSA 3K27A 2EICA 3EI2A 2P9PC 3BWSA 5AJAA 4JHNA 2P9KC 2YNPA 1N6FA 4FA9D 3NIDA 4J87A 4IRZA 3ORVD 2OIZA 2H14A 1UOOA 3SVWD 5FKTA 2H13A 5C9ZB 5HE0B 3MZKA 4ERZA 3IJCA 2VDKA 3EQ8A 5EM2B 4CY1A 4GZ8A 2P9SC 4PXWA 4LG9A 2IUVA 3I7HA 3ZE1A 4G1EA 3IUMA 2VDRA 2AGYA 2GC4A 2IUQA 2PM7B 3DXKC 1MG3A 5HE1B 5M5TA 5JWZA 2PBIB 4XYHA 4L1QD 3C75H 3HFQA 4L1MA 2PM9A 3MXXA 3EG6A 4J73A 4PBYA 1SHYB 1H2XA 4QRJA 4ERQA 4AMZA 3DWLC 2BCJB 4O3UB 5A2Qg 3NIFA 4CI2A 3ODTA 3JRPA 1GOGA 4AMYA 2IUPA 4PSXB 2H9LA 2I0RA 4FB1D 1I2MB 2H3XA 4U7AA 5EMMB 3N0DA 1JMZB 4EWRA 4A09A 2VDLA 3MUOA 4QQEA 3JZHA 2UZYB 2VZ1A 1GOTB 4L3HD 3I7LA 2AQ5A 4E5ZA 3OL2B 5CXCB 2EIBA 3IUQA 2AGLA 3IKOA 4FAND 2OK4A 5K1CC 3RRMC 4K3ID 2CN2A 3SBQA 4AOWA 5I5MA 4NSXA 3PXTD 2I3SA 3I8EA 4AX4A 3FGBA 4E54B 2AGZA 3EWEA 5TF2A 4GQ1A 4WK2A 3OKTA 4BCBA 4A0BB 1C9IA 2XZGA 4MMYA 5EAMA 2XDWA 5GXIA 4DNUA 4OWRA 3BG0A 4JXMA 4O1QD 4WK0A 4AN1A 3ULEC 1JV2A 3V5WB 3AH8B 4X60B 4FA5D 3QHYB 4DNWA 4X3EA 3V7DB 2QZPA 3K72A 1E8NA 4G55A 1FWXA 1UOQA 5EM2A 3O4HA 2P9LC 1C9LA 4FWWA 2UZXB 3T3MA 5C2VB 4FA1D 4JT6C 1OMWB 2I0TA 1YR2A 3SFZA 1B9YA 3VI4A 3I7KA 4MMXA 4ZN4A 5IJ7E 3IURA 4J81A 4R7AB 4BCDA 3EMHA 2HKMA 2P9UC 3EU7A 3C9CA 4WJKA 3UVNA 1S4UX 5M61A 5TEFA 3J80g 4N14A 5KDOB 4ERYA 5IT9g 4XYIA 3VA6A 1UTCA 4GMBA 4UM9A 3JB9L 2P9IC 1K32A 5HYNB 2B5NA 5H1MA 3L4MD 1N6DA 4K3JB 5AMSA 1H2WA 3ZE2A 2Q7QA 3FRXA 4UM8A 4GM3A 4H5JA 3IULA 2B4EA 2VC2A 3IUNA 4NENA 3PSCB 3CFVA 3AFCA 2VDNA 3PE7A 4NC4A 5THAA 4BUJC 5C86A 4IA9A 4G1MA 2VDOA 3SLED 2XYIA 3MKSB 3AL8B 1PI6A 3OL2A 1L0QA 3CIKB 4U1EI 5CXCA 4CZXA 4I79A 5TDHB 3ZE0A 4JSVC 5C2WB 3ZDXA 4E54A 2H9MA 5FFOA 3IJEA 5HQGA 3I89A 4GQBB 2YB8B 4CZVA 3SHFA 2J57G 3JAMg 4A2MA 4A0BA 4AEZA 4Z7QA 2J56H 4G56B 1JTDB 1NR0A 4X61B 1P22A 3N0EA 4O3TB 4JHPC 4A0AB 3VI3A 1O6GA 4A7JA 4MK0B 2B5MA 2YMUA 4QT8A 4X63B 3PSLA 4ZOZA 3MMYA 4A08B 2CNXA 3RN0D 1SQ9A 3IIWA 1GOFA 2EIEA 5CXBB 4HDJA 4RE6A 3P4FA 3EI4B 2XL3A 5IC7A 4FA4D 2CN3A 2EBSA 3K26A 4JSNC 3VGZA 4NAAA 3O4JA 2Z2PA 1Q47A 3NVXA 1VE6A 3F3PA 5FKSA 4H5IA 4FAVD 2HXCA 4A2LA 3SN6B 3UVKA 2AH0A 4CY3A 1BPOA 2IWFA 4J78A 4PSWB 3F3FA 2CE9A 4J0WA 2VDQA 3DSMA 3IIYA 1QFMA 3B7FA 1U4CA 3RMZD 4ZOVA 2XU7A 5B4WA 1VE7A 2HKRA 2AGXA 1H2ZA 2VDMA 1VZ2A 2BBKH 4QAMA 4J86A 4RE5A 3FCUA 2XE4A 3O4GA 3AL8A 1TYEA 5K19A 4Y5RD
chains in the Genus database with same CATH topology
4O02A 1JV2A 5FFGA 4UM9A 3NIFA 3K6SA 1U8CA 3V4VA 2VDQA 2VDKA 5HDBA 3K72A 3ZE0A 3T3PA 1L5GA 4MMZA 1M1XA 3K71A 3ZE2A 3ZDXA 3T3MA 3FCSA 4UM8A 5FFOA 3IJEA 4WK2A 5E6UA 2VC2A 4NENA 4G1EA 5E6RA 5E6SA 2VDRA 3VI4A 2VDMA 4WK4A 3ZE1A 4MMXA 2VDNA 2VDLA 4Z7NA 4G1MA 3V4PA 4Z7QA 2VDOA 4MMYA 4WJKA 3ZDZA 3FCUA 3NIDA 4IRZA 3VI3A 3ZDYA 3NIGA 1TYEA 4WK0A 4Z7OA 2VDPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O02 A;  1JV2 A;  5FFG A;  4UM9 A;  3NIF A;  3K6S A;  1U8C A;  3V4V A;  2VDQ A;  2VDK A;  5HDB A;  3K72 A;  3ZE0 A;  3T3P A;  1L5G A;  4MMZ A;  1M1X A;  3K71 A;  3ZE2 A;  3ZDX A;  3T3M A;  3FCS A;  4UM8 A;  5FFO A;  3IJE A;  4WK2 A;  5E6U A;  2VC2 A;  4NEN A;  4G1E A;  5E6R A;  5E6S A;  2VDR A;  3VI4 A;  2VDM A;  4WK4 A;  3ZE1 A;  4MMX A;  2VDN A;  2VDL A;  4Z7N A;  4G1M A;  3V4P A;  4Z7Q A;  2VDO A;  4MMY A;  4WJK A;  3ZDZ A;  3FCU A;  3NID A;  4IRZ A;  3VI3 A;  3ZDY A;  3NIG A;  1TYE A;  4WK0 A;  4Z7O A;  2VDP A; 
#chains in the Genus database with same CATH topology
 5EML B;  3OKY B;  4IMM A;  5IJ8 E;  2QXV A;  4L9O A;  2CO0 A;  5CYK B;  2I3T A;  2HJB A;  3SMR A;  4GM8 A;  4A11 B;  3PXS D;  3JRO A;  4D0K A;  2XL2 A;  2OK6 A;  3ZDZ A;  3ZDY A;  4GGC A;  4A0A A;  1B9X A;  4BCC A;  1A0R B;  2HES X;  1QNI A;  2O9K A;  5EMJ B;  4J84 A;  1JMX B;  1U8C A;  3NVQ A;  3EI3 B;  5EAP A;  1XHM A;  4ES0 A;  4A08 A;  1GXR A;  3OKW A;  1L5G A;  1N6E A;  3IVM A;  1PBY B;  2GNQ A;  5M5S A;  5SXM A;  3SXT D;  5CXB A;  2CO0 C;  5E6S A;  3EI4 A;  5GXH A;  1OLZ A;  5FLX g;  4BP8 A;  2J55 H;  3SBP A;  2B5L A;  5HE3 B;  4O02 A;  4J79 A;  1JOF A;  3RFH A;  1GP2 B;  1MDA H;  3GFC A;  2AH1 A;  2W18 A;  2G9A A;  2HYE A;  4PNK B;  3O4I A;  1K3I A;  4ESG A;  4J82 A;  2BKL A;  4Z8L A;  3I7O A;  2H47 A;  4JD2 C;  4UI9 R;  4D9S A;  4J77 A;  3E0C A;  3SBR A;  3ZWL B;  5FXY A;  3EI1 B;  3GRE A;  2OJY A;  3I7N A;  3V4P A;  3MUN A;  3UKU C;  3GD1 I;  5IGO A;  2HU7 A;  1PGU A;  2HU5 A;  3OW8 A;  4Z7O A;  4CC9 A;  2IUR A;  5FKQ A;  1TBG A;  5I5J A;  2QR5 A;  3JZN A;  4LG8 A;  4GGA A;  1UOP A;  2Z2O A;  5GSA A;  4O9D A;  3OKY A;  3PVU B;  4XEI C;  3PXW D;  4BH6 A;  5CYK A;  4AN0 A;  1YFQ A;  2Z2N A;  3I7P A;  2EID A;  3DXM C;  4GQ2 P;  3A0F A;  4BP9 A;  5E6U A;  1TYQ C;  2G99 A;  4O45 A;  4BL0 A;  4CY2 A;  4A11 A;  3PVW B;  5I5I A;  3F3G A;  5TEE A;  2P9N C;  5HE2 B;  3I8C A;  4PBZ A;  5EMK B;  3MKQ A;  3EQ7 A;  3U4Y A;  4DNV A;  3NIG A;  5EAR A;  4OZU A;  4TZ4 A;  2OVQ B;  4CI1 A;  2H6N A;  5FFG A;  1U2V C;  2GC7 A;  5GMK n;  3K6S A;  3SCY A;  1ERJ A;  3IUJ A;  3EI3 A;  3RFG A;  4CI8 A;  5EAL A;  1XIP A;  4O2W A;  4CZY A;  3DM0 A;  5AFU 3;  4ZOY A;  1GOH A;  3MZL A;  5M5R A;  4JT5 C;  5IGQ A;  3EI2 B;  1NEX B;  4CI3 A;  3NVN A;  3CFS B;  2PM6 B;  4Z7N A;  4JSP C;  2H9N A;  3BG1 A;  2YNN A;  3FM0 A;  4GM9 A;  3OTT A;  1JJU B;  2VDP A;  3IJ1 A;  3AL9 A;  2YNO A;  1XKS A;  2HJ4 A;  3SWS D;  4JSX C;  3JZG A;  3KRX B;  1H2Y A;  4J0X A;  2H6K A;  3V4V A;  2H6Q A;  5HDB A;  5M5V A;  5H14 A;  1R5M A;  2H9P A;  3QI0 A;  2OVP B;  4D6V A;  3C99 A;  4WK4 A;  3EI1 A;  3OF7 A;  2H68 A;  1T2X A;  3RSE C;  5M5U A;  3UVL A;  3KRW B;  4CY5 A;  3IJ0 A;  4LGN A;  1SQJ A;  1O6F A;  2PM9 B;  4Y7R A;  4GGD A;  1VYH C;  1E5T A;  1QFS A;  3J81 g;  4NBM A;  3UVM A;  2I0S A;  2JKX A;  2CE8 A;  4J8B A;  4ZOX A;  3W15 A;  5FA5 B;  1M1X A;  1VZ3 A;  3KCI A;  4L3G D;  4YVD A;  3UVO A;  3MVD K;  1K8K C;  2AGW A;  3I2N A;  4A09 B;  5E6R A;  1RI6 A;  3SJL D;  1GG2 B;  2TRC B;  2IAA A;  1A12 A;  4QL1 A;  5FQD A;  4E5Z B;  2WQ8 A;  3DDU A;  2QC5 A;  4PC0 A;  3RN1 D;  2MTA H;  4KFM B;  3UR4 A;  3L4O D;  3GC3 B;  1MG2 A;  3UKR C;  4FHL A;  3V9F A;  3JPX A;  3EQ9 A;  2YBA A;  2IWK A;  3C5M A;  2OVR B;  3VH0 A;  2HU8 A;  5FKR A;  3T3P A;  2VZ3 A;  4J8G A;  4MMZ A;  5H17 A;  5C92 A;  3RLM D;  3K71 A;  1PEV A;  1E8M A;  3FCS A;  3K27 A;  2EIC A;  3EI2 A;  2P9P C;  3BWS A;  5AJA A;  4JHN A;  2P9K C;  2YNP A;  1N6F A;  4FA9 D;  3NID A;  4J87 A;  4IRZ A;  3ORV D;  2OIZ A;  2H14 A;  1UOO A;  3SVW D;  5FKT A;  2H13 A;  5C9Z B;  5HE0 B;  3MZK A;  4ERZ A;  3IJC A;  2VDK A;  3EQ8 A;  5EM2 B;  4CY1 A;  4GZ8 A;  2P9S C;  4PXW A;  4LG9 A;  2IUV A;  3I7H A;  3ZE1 A;  4G1E A;  3IUM A;  2VDR A;  2AGY A;  2GC4 A;  2IUQ A;  2PM7 B;  3DXK C;  1MG3 A;  5HE1 B;  5M5T A;  5JWZ A;  2PBI B;  4XYH A;  4L1Q D;  3C75 H;  3HFQ A;  4L1M A;  2PM9 A;  3MXX A;  3EG6 A;  4J73 A;  4PBY A;  1SHY B;  1H2X A;  4QRJ A;  4ERQ A;  4AMZ A;  3DWL C;  2BCJ B;  4O3U B;  5A2Q g;  3NIF A;  4CI2 A;  3ODT A;  3JRP A;  1GOG A;  4AMY A;  2IUP A;  4PSX B;  2H9L A;  2I0R A;  4FB1 D;  1I2M B;  2H3X A;  4U7A A;  5EMM B;  3N0D A;  1JMZ B;  4EWR A;  4A09 A;  2VDL A;  3MUO A;  4QQE A;  3JZH A;  2UZY B;  2VZ1 A;  1GOT B;  4L3H D;  3I7L A;  2AQ5 A;  4E5Z A;  3OL2 B;  5CXC B;  2EIB A;  3IUQ A;  2AGL A;  3IKO A;  4FAN D;  2OK4 A;  5K1C C;  3RRM C;  4K3I D;  2CN2 A;  3SBQ A;  4AOW A;  5I5M A;  4NSX A;  3PXT D;  2I3S A;  3I8E A;  4AX4 A;  3FGB A;  4E54 B;  2AGZ A;  3EWE A;  5TF2 A;  4GQ1 A;  4WK2 A;  3OKT A;  4BCB A;  4A0B B;  1C9I A;  2XZG A;  4MMY A;  5EAM A;  2XDW A;  5GXI A;  4DNU A;  4OWR A;  3BG0 A;  4JXM A;  4O1Q D;  4WK0 A;  4AN1 A;  3ULE C;  1JV2 A;  3V5W B;  3AH8 B;  4X60 B;  4FA5 D;  3QHY B;  4DNW A;  4X3E A;  3V7D B;  2QZP A;  3K72 A;  1E8N A;  4G55 A;  1FWX A;  1UOQ A;  5EM2 A;  3O4H A;  2P9L C;  1C9L A;  4FWW A;  2UZX B;  3T3M A;  5C2V B;  4FA1 D;  4JT6 C;  1OMW B;  2I0T A;  1YR2 A;  3SFZ A;  1B9Y A;  3VI4 A;  3I7K A;  4MMX A;  4ZN4 A;  5IJ7 E;  3IUR A;  4J81 A;  4R7A B;  4BCD A;  3EMH A;  2HKM A;  2P9U C;  3EU7 A;  3C9C A;  4WJK A;  3UVN A;  1S4U X;  5M61 A;  5TEF A;  3J80 g;  4N14 A;  5KDO B;  4ERY A;  5IT9 g;  4XYI A;  3VA6 A;  1UTC A;  4GMB A;  4UM9 A;  3JB9 L;  2P9I C;  1K32 A;  5HYN B;  2B5N A;  5H1M A;  3L4M D;  1N6D A;  4K3J B;  5AMS A;  1H2W A;  3ZE2 A;  2Q7Q A;  3FRX A;  4UM8 A;  4GM3 A;  4H5J A;  3IUL A;  2B4E A;  2VC2 A;  3IUN A;  4NEN A;  3PSC B;  3CFV A;  3AFC A;  2VDN A;  3PE7 A;  4NC4 A;  5THA A;  4BUJ C;  5C86 A;  4IA9 A;  4G1M A;  2VDO A;  3SLE D;  2XYI A;  3MKS B;  3AL8 B;  1PI6 A;  3OL2 A;  1L0Q A;  3CIK B;  4U1E I;  5CXC A;  4CZX A;  4I79 A;  5TDH B;  3ZE0 A;  4JSV C;  5C2W B;  3ZDX A;  4E54 A;  2H9M A;  5FFO A;  3IJE A;  5HQG A;  3I89 A;  4GQB B;  2YB8 B;  4CZV A;  3SHF A;  2J57 G;  3JAM g;  4A2M A;  4A0B A;  4AEZ A;  4Z7Q A;  2J56 H;  4G56 B;  1JTD B;  1NR0 A;  4X61 B;  1P22 A;  3N0E A;  4O3T B;  4JHP C;  4A0A B;  3VI3 A;  1O6G A;  4A7J A;  4MK0 B;  2B5M A;  2YMU A;  4QT8 A;  4X63 B;  3PSL A;  4ZOZ A;  3MMY A;  4A08 B;  2CNX A;  3RN0 D;  1SQ9 A;  3IIW A;  1GOF A;  2EIE A;  5CXB B;  4HDJ A;  4RE6 A;  3P4F A;  3EI4 B;  2XL3 A;  5IC7 A;  4FA4 D;  2CN3 A;  2EBS A;  3K26 A;  4JSN C;  3VGZ A;  4NAA A;  3O4J A;  2Z2P A;  1Q47 A;  3NVX A;  1VE6 A;  3F3P A;  5FKS A;  4H5I A;  4FAV D;  2HXC A;  4A2L A;  3SN6 B;  3UVK A;  2AH0 A;  4CY3 A;  1BPO A;  2IWF A;  4J78 A;  4PSW B;  3F3F A;  2CE9 A;  4J0W A;  2VDQ A;  3DSM A;  3IIY A;  1QFM A;  3B7F A;  1U4C A;  3RMZ D;  4ZOV A;  2XU7 A;  5B4W A;  1VE7 A;  2HKR A;  2AGX A;  1H2Z A;  2VDM A;  1VZ2 A;  2BBK H;  4QAM A;  4J86 A;  4RE5 A;  3FCU A;  2XE4 A;  3O4G A;  3AL8 A;  1TYE A;  5K19 A;  4Y5R D; 
#chains in the Genus database with same CATH homology
 4O02 A;  1JV2 A;  5FFG A;  4UM9 A;  3NIF A;  3K6S A;  1U8C A;  3V4V A;  2VDQ A;  2VDK A;  5HDB A;  3K72 A;  3ZE0 A;  3T3P A;  1L5G A;  4MMZ A;  1M1X A;  3K71 A;  3ZE2 A;  3ZDX A;  3T3M A;  3FCS A;  4UM8 A;  5FFO A;  3IJE A;  4WK2 A;  5E6U A;  2VC2 A;  4NEN A;  4G1E A;  5E6R A;  5E6S A;  2VDR A;  3VI4 A;  2VDM A;  4WK4 A;  3ZE1 A;  4MMX A;  2VDN A;  2VDL A;  4Z7N A;  4G1M A;  3V4P A;  4Z7Q A;  2VDO A;  4MMY A;  4WJK A;  3ZDZ A;  3FCU A;  3NID A;  4IRZ A;  3VI3 A;  3ZDY A;  3NIG A;  1TYE A;  4WK0 A;  4Z7O A;  2VDP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...