3HFQA

Crystal structure of the lp_2219 protein from lactobacillus plantarum. northeast structural genomics consortium target lpr118.
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
341
structure length
341
Chain Sequence
MQERILFGTYTKKTSQGIYQGTLDTTAKTLTNDGLLAATQNPTYLALSAKDCLYSVDKEDDEGGIAAWQIDGQTAHKLNTVVAPGTPPAYVAVDEARQLVYSANYHKGTAEVMKIAADGALTLTDTVQHSGHGPRPEQDGSHIHYTDLTPDNRLAVIDLGSDKVYVYNVSDAGQLSEQSVLTMEAGFGPRHLVFSPDGQYAFLAGELSSQIASLKYDTQTGAFTQLGIVKTIPADYTAHNGAAAIRLSHDGHFLYVSNRGYNTLAVFAVTADGHLTLIQQISTEGDFPRDFDLDPTEAFVVVVNQNTDNATLYARDLTSGKLSLLQKDVTVPEGVCVRFLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords uncharacterized protein lp_2219
publication title Crystal structure of the lp_2219 protein from Lactobacillus plantarum.
rcsb
source organism Lactobacillus plantarum
total genus 87
structure length 341
sequence length 341
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10282 Lactonase Lactonase, 7-bladed beta-propeller
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3hfqA00
5EMMB 3JZGA 4PSWB 5HQGA 1YFQA 3RN0D 2G99A 2AGZA 5HE2B 3CFSB 1ERJA 1JJUB 2PM9B 4O1QD 2IURA 3I7LA 4A09B 4GM3A 2P9KC 1OMWB 3DSMA 4ZOVA 1PI6A 4FHLA 3V9FA 4ZOYA 3N0EA 4TZ4A 4K3ID 1XKSA 2BBKH 5TDHB 5CXCA 3SBRA 4J77A 2OK4A 4J0XA 2CE9A 4GM8A 3IKOA 4FAVD 3SMRA 4AOWA 5CXBB 2H68A 4A0BB 4LG9A 2Z2PA 4FA5D 3DXKC 2H6KA 3JZNA 3A0FA 4J8BA 4BL0A 4K3JB 2CE8A 1A0RB 4CY1A 4L1QD 3I7PA 2YMUA 3IJCA 5GMKn 4JSPC 4CZVA 2P9IC 3OTTA 3IIWA 2HKRA 3VA6A 4CY5A 3UKRC 3P4FA 3IIYA 4FA9D 2B5LA 4LGNA 3V5WB 5AMSA 4CI8A 2IWKA 5JWZA 4GMBA 5B4WA 1GP2B 3I2NA 5FXYA 5HE3B 2QXVA 4CY2A 4U1EI 4U7AA 2HESX 2UZYB 3ODTA 5H14A 4A11A 2Z2OA 4H5JA 3FRXA 3GREA 4GQ1A 4CZYA 3F3GA 2BCJB 5THAA 2QC5A 2I0SA 1JOFA 4GZ8A 3PXTD 5HE1B 3ORVD 4CI1A 5EALA 1RI6A 1PEVA 2AGLA 2PM9A 5CXCB 3EI3B 3RSEC 4EWRA 3BG0A 4XYHA 1MDAH 4QRJA 2AGXA 2P9PC 2EBSA 4O45A 2H13A 3V7DB 5FKRA 1K32A 4GGCA 4JSXC 5EARA 1JMZB 3JPXA 3PXSD 5EMJB 5IJ7E 2P9SC 4H5IA 2UZXB 1S4UX 5FKTA 5CXBA 4XYIA 4ZN4A 4A0BA 4QL1A 4J73A 5SXMA 1SHYB 5HYNB 3VGZA 3SCYA 4ZOZA 5I5MA 5IT9g 2XL3A 5FKQA 1MG2A 2MTAH 3SN6B 3N0DA 4GQBB 4J0WA 3RLMD 4ERZA 1U4CA 3BG1A 3SJLD 4A11B 4FAND 2OVRB 2J57G 5I5IA 3E0CA 2J55H 4PBZA 4YVDA 1XHMA 3EI1A 3DWLC 3W15A 4JT6C 4J78A 3MKSB 3MZKA 5GSAA 4CZXA 3PE7A 3DM0A 2GNQA 2I0RA 2HJBA 5GXIA 3AH8B 3UVOA 3C99A 3IJ1A 5FKSA 3EI3A 4O3UB 3C75H 3MMYA 3OW8A 4PNKB 5EAPA 3RMZD 4PXWA 2CN3A 4Z8LA 1TYQC 4J84A 5EMLB 5KDOB 4CC9A 1B9YA 4D0KA 3GFCA 4A2MA 2IWFA 2HJ4A 2G9AA 3SHFA 1N6DA 3RRMC 4KFMB 5I5JA 4E5ZA 1GOTB 4CY3A 4HDJA 3K27A 4J86A 3SLED 2HYEA 3AFCA 2AH0A 2XL2A 3JAMg 3SXTD 1PGUA 3HFQA 4X60B 3EI1B 4A7JA 2I3SA 5TF2A 5IC7A 2GC7A 4OWRA 1VYHC 2HKMA 4BH6A 2Z2NA 2P9LC 3EMHA 3NVQA 3I7OA 4GGDA 2W18A 2GC4A 4GGAA 5C9ZB 3OL2A 3C5MA 5GXHA 3I7HA 3VH0A 5EMKB 3L4MD 4ESGA 3OKYB 1N6FA 5C2WB 2B5NA 1NEXB 3UVMA 5EM2A 3JRPA 4J79A 2I3TA 4A0AA 3F3PA 3J81g 4R7AB 4J81A 3SWSD 4FA1D 3PXWD 3ZWLB 4E5ZB 2J56H 3UR4A 3AL8A 2O9KA 2B5MA 3I8EA 2CNXA 3OKTA 2TRCB 4X61B 1MG3A 2OVQB 3UVNA 1QNIA 4L9OA 4Y7RA 2AH1A 4PC0A 2H6QA 2CO0C 4MK0B 5IJ8E 1U2VC 5FA5B 2YNOA 3RFHA 3UVLA 4JT5C 4ES0A 2IUQA 2YBAA 3ULEC 1PBYB 4CI3A 4JSVC 3SFZA 2H9MA 2XU7A 2OK6A 1K8KC 4J87A 3F3FA 3OL2B 4JD2C 2AGWA 2PM7B 3NVXA 3DXMC 5AFU3 4UI9R 5FQDA 3SVWD 2HXCA 4AEZA 5EM2B 2H9PA 4A0AB 5CYKB 2IUPA 4LG8A 3PSCB 4E54A 3BWSA 4OZUA 1P22A 5TEFA 3OKYA 3AL8B 4I79A 4NSXA 4XEIC 3KRXB 4A08A 4JXMA 1L0QA 2H9NA 3EI2B 2PM6B 3KRWB 3NVNA 4FWWA 4ERQA 3SBPA 5TEEA 4JSNC 3OKWA 3CIKB 4PBYA 4X63B 4FB1D 4O9DA 3EG6A 5IGOA 2OVPB 5H17A 1B9XA 5A2Qg 3AL9A 2AQ5A 3C9CA 5C2VB 3I7KA 4BUJC 3JROA 2AGYA 2P9NC 2YNPA 3EI4B 2XYIA 2H3XA 2I0TA 4GM9A 4ZOXA 2CO0A 4O3TB 2IAAA 4ERYA 4J82A 2B4EA 4E54B 2H6NA 4N14A 5FLXg 1SQJA 3PSLA 4GQ2P 5H1MA 1N6EA 4L3GD 4L3HD 4QT8A 1FWXA 2YB8B 4IA9A 4J8GA 3K26A 4A08B 3L4OD 3B7FA 2YNNA 5CYKA 1NR0A 4IMMA 2OJYA 1Q47A 3RFGA 5AJAA 3EWEA 5K1CC 1GXRA 4A09A 3CFVA 2CN2A 5HE0B 3UVKA 1SQ9A 3PVWB 1TBGA 3SBQA 3EU7A 3JB9L 3JZHA 2OIZA 3I8CA 3EI2A 4PSXB 4Y5RD 3MKQA 5IGQA 3FGBA 4QQEA 3MXXA 1JMXB 2P9UC 2H14A 3UKUC 2PBIB 1XIPA 3I89A 3J80g 3IJ0A 3PVUB 2IUVA 4A2LA 2Q7QA 3FM0A 5EAMA 4X3EA 3RN1D 5K19A 4CI2A 4D6VA 1OLZA 3U4YA 1GG2B 3I7NA 4FA4D 2H47A 3MZLA 4G56B 3EI4A 2H9LA 1R5MA
chains in the Genus database with same CATH superfamily
3FCUA 5EMMB 3JZGA 4NC4A 4PSWB 5HQGA 1YFQA 3RN0D 2G99A 2AGZA 5HE2B 3CFSB 4NBMA 4RE6A 1ERJA 1JJUB 2PM9B 3K72A 4O1QD 2BKLA 2IURA 3I7LA 4A09B 5E6SA 2VZ1A 4GM3A 2P9KC 1OMWB 3DSMA 4ZOVA 1PI6A 4L1MA 4FHLA 3V9FA 4ZOYA 3N0EA 4TZ4A 4K3ID 1XKSA 2BBKH 5TDHB 5CXCA 3SBRA 4J77A 2OK4A 4J0XA 3IUJA 2CE9A 4GM8A 3IKOA 4FAVD 3SMRA 4AOWA 5CXBB 3GC3B 5HDBA 2H68A 4A0BB 4LG9A 4BCDA 2Z2PA 1UOQA 4FA5D 3DXKC 2H6KA 3JZNA 3A0FA 3VI4A 2EIBA 4DNVA 4J8BA 4BL0A 4K3JB 2CE8A 1A0RB 4CY1A 4L1QD 3I7PA 2YMUA 3IJCA 5GMKn 4NAAA 1O6FA 4JSPC 4CZVA 2P9IC 2EIEA 3OTTA 3IIWA 3IUNA 2HKRA 3VA6A 4CY5A 3UKRC 3P4FA 3IIYA 1GOHA 2B5LA 4FA9D 4LGNA 3V5WB 5AMSA 4CI8A 4BP9A 2IWKA 5JWZA 4GMBA 5FFOA 1K3IA 5B4WA 1GP2B 1QFSA 3QI0A 3I2NA 5FXYA 5HE3B 2QXVA 4CY2A 4U1EI 1UOPA 4U7AA 4Z7QA 2HESX 2UZYB 3ODTA 5H14A 4A11A 2Z2OA 4H5JA 1H2YA 3FRXA 3GREA 4GQ1A 4CZYA 3F3GA 2BCJB 5THAA 2QC5A 2I0SA 1JOFA 4GZ8A 3PXTD 5HE1B 3ORVD 4CI1A 3NIDA 5EALA 1RI6A 1PEVA 2HU5A 1H2ZA 2AGLA 2PM9A 4IRZA 4D9SA 5CXCB 3EI3B 3RSEC 4EWRA 5E6RA 3BG0A 4XYHA 1MDAH 4QRJA 2AGXA 2P9PC 4AN0A 2VDNA 2EBSA 3IURA 2H13A 4O45A 3V7DB 3O4IA 5FKRA 1K32A 4GGCA 4JSXC 5EARA 1JMZB 3JPXA 2XDWA 3PXSD 5EMJB 5IJ7E 3OF7A 4G1MA 2P9SC 4H5IA 2UZXB 1S4UX 5FKTA 3ZDYA 5CXBA 4NENA 4WK4A 4XYIA 4ZN4A 4A0BA 1VE7A 4QL1A 4J73A 5SXMA 1SHYB 5HYNB 3VGZA 3SCYA 4ZOZA 5I5MA 5IT9g 2XL3A 4JHNA 5FKQA 5M61A 1MG2A 2MTAH 3SN6B 1C9LA 3N0DA 4GQBB 4J0WA 3RLMD 4ERZA 1U4CA 3BG1A 3SJLD 4A11B 4G1EA 4QAMA 2OVRB 4FAND 2J57G 5I5IA 4WJKA 3E0CA 3MVDK 3O4GA 2J55H 1GOGA 4PBZA 4YVDA 1XHMA 3EI1A 3DWLC 1BPOA 3W15A 4JT6C 4J78A 3MKSB 1H2WA 3MZKA 5GSAA 4CZXA 3PE7A 5M5RA 3DM0A 3EQ7A 2GNQA 2I0RA 2HJBA 4AMZA 5GXIA 3AH8B 3ZDZA 2VDRA 3UVOA 4Z7OA 3C99A 3IJ1A 5FKSA 3EI3A 4O3UB 3C75H 3MMYA 3OW8A 4WK2A 4PNKB 5EAPA 3RMZD 4PXWA 2CN3A 4Z8LA 1TYQC 4J84A 1VE6A 5EMLB 5KDOB 5M5SA 4CC9A 1B9YA 3V4PA 5E6UA 4D0KA 1YR2A 3GFCA 4AN1A 4A2MA 2IWFA 3IULA 4MMXA 2HJ4A 2G9AA 3SHFA 1N6DA 3RRMC 1TYEA 4KFMB 5I5JA 3O4JA 4E5ZA 1GOTB 4CY3A 4HDJA 1U8CA 3K27A 4J86A 4DNUA 3SLED 2HYEA 3AFCA 2AH0A 4JHPC 3V4VA 2XL2A 3JAMg 3SXTD 1PGUA 3HFQA 4X60B 3EI1B 2JKXA 4A7JA 2I3SA 5TF2A 5IC7A 1E5TA 4G55A 2WQ8A 3GD1I 2GC7A 4OWRA 2VDMA 1VYHC 2HKMA 4BH6A 2Z2NA 1C9IA 1H2XA 2P9LC 3EMHA 3NVQA 1O6GA 3I7OA 4GGDA 1E8MA 3ZDXA 2W18A 2GC4A 4GGAA 5C9ZB 1L5GA 1T2XA 3OL2A 3C5MA 1VZ3A 3I7HA 5GXHA 4AMYA 3IUQA 3VH0A 5EMKB 3L4MD 4ESGA 3OKYB 1N6FA 5C2WB 2B5NA 1NEXB 3UVMA 3IJEA 5EM2A 3JRPA 5FFGA 4J79A 2I3TA 4A0AA 2XE4A 3F3PA 3J81g 4R7AB 4J81A 3SWSD 4FA1D 3PXWD 3ZWLB 4E5ZB 2J56H 3UR4A 3AL8A 2O9KA 2B5MA 3I8EA 2CNXA 3MUOA 2TRCB 3OKTA 4O02A 1MG3A 4X61B 4AX4A 2QR5A 2OVQB 3UVNA 1QNIA 4L9OA 4Y7RA 4UM9A 2AH1A 4PC0A 2H6QA 2CO0C 4MK0B 5IJ8E 1U2VC 5FA5B 2YNOA 4RE5A 3RFHA 4DNWA 3UVLA 4JT5C 4ES0A 1E8NA 2IUQA 1VZ2A 2YBAA 3ULEC 1PBYB 4CI3A 3ZE1A 4JSVC 3SFZA 2HU8A 3DDUA 2H9MA 2XZGA 3ZE0A 2XU7A 2OK6A 1K8KC 4J87A 3F3FA 3OL2B 4JD2C 2AGWA 2PM7B 3NVXA 3DXMC 5AFU3 4UI9R 5FQDA 3FCSA 3K6SA 3SVWD 2HXCA 4AEZA 2VDQA 5EM2B 2QZPA 2H9PA 4O2WA 5CYKB 4A0AB 2IUPA 4LG8A 3PSCB 4E54A 3BWSA 3T3PA 4OZUA 1I2MB 1P22A 5TEFA 2VDLA 3OKYA 4WK0A 4MMYA 3AL8B 4I79A 4NSXA 4MMZA 4XEIC 3KRXB 4A08A 4JXMA 1L0QA 1M1XA 2H9NA 3EI2B 2HU7A 2PM6B 3KRWB 3NIFA 3NVNA 4FWWA 4ERQA 3MUNA 3SBPA 5TEEA 1UOOA 3T3MA 4JSNC 3OKWA 3CIKB 4PBYA 3QHYB 4X63B 4FB1D 4O9DA 3EG6A 5IGOA 2OVPB 5H17A 1B9XA 5A2Qg 3AL9A 5M5VA 2AQ5A 3C9CA 5C2VB 3I7KA 4BUJC 3JROA 2AGYA 2P9NC 2YNPA 3EI4B 2XYIA 4BCBA 2H3XA 2I0TA 4GM9A 4ZOXA 2CO0A 4O3TB 2IAAA 4ERYA 4J82A 1QFMA 2B4EA 4E54B 2H6NA 4N14A 5FLXg 1SQJA 5C86A 2VDOA 3EQ9A 3PSLA 3IVMA 4GQ2P 5H1MA 1N6EA 4L3GD 4L3HD 4QT8A 1FWXA 3K71A 2YB8B 4IA9A 4J8GA 2VDKA 3IUMA 3K26A 4A08B 3L4OD 3B7FA 2YNNA 5CYKA 1NR0A 4IMMA 1JV2A 1JTDB 1A12A 2OJYA 1Q47A 2EICA 3RFGA 5AJAA 3EWEA 1UTCA 2VDPA 5K1CC 3NIGA 1GXRA 4A09A 3CFVA 2CN2A 5HE0B 3ZE2A 3UVKA 4UM8A 1SQ9A 2VC2A 3PVWB 1TBGA 3SBQA 5M5TA 3EU7A 4Z7NA 4BP8A 3JB9L 3JZHA 2OIZA 3I8CA 3EI2A 4PSXB 3EQ8A 4Y5RD 3MKQA 3VI3A 3KCIA 5IGQA 3FGBA 1GOFA 4QQEA 3MXXA 1JMXB 2P9UC 2H14A 3UKUC 4BCCA 2EIDA 2PBIB 1XIPA 3I89A 3J80g 2VZ3A 3IJ0A 3PVUB 2IUVA 4A2LA 2Q7QA 3FM0A 3O4HA 4X3EA 5EAMA 3RN1D 5K19A 4CI2A 5C92A 4D6VA 1OLZA 3U4YA 1GG2B 5M5UA 3I7NA 4FA4D 3MZLA 2H47A 4G56B 3EI4A 2H9LA 1R5MA
chains in the Genus database with same CATH topology
5EMMB 3JZGA 4PSWB 5HQGA 1YFQA 3RN0D 2G99A 2AGZA 5HE2B 3CFSB 1ERJA 1JJUB 2PM9B 4O1QD 2IURA 3I7LA 4A09B 4GM3A 2P9KC 1OMWB 3DSMA 4ZOVA 1PI6A 4FHLA 3V9FA 4ZOYA 3N0EA 4TZ4A 4K3ID 1XKSA 2BBKH 5TDHB 5CXCA 3SBRA 4J77A 2OK4A 4J0XA 2CE9A 4GM8A 3IKOA 4FAVD 3SMRA 4AOWA 5CXBB 2H68A 4A0BB 4LG9A 2Z2PA 4FA5D 3DXKC 2H6KA 3JZNA 3A0FA 4J8BA 4BL0A 4K3JB 2CE8A 1A0RB 4CY1A 4L1QD 3I7PA 2YMUA 3IJCA 5GMKn 4JSPC 4CZVA 2P9IC 3OTTA 3IIWA 2HKRA 3VA6A 4CY5A 3UKRC 3P4FA 3IIYA 4FA9D 2B5LA 4LGNA 3V5WB 5AMSA 4CI8A 2IWKA 5JWZA 4GMBA 5B4WA 1GP2B 3I2NA 5FXYA 5HE3B 2QXVA 4CY2A 4U1EI 4U7AA 2HESX 2UZYB 3ODTA 5H14A 4A11A 2Z2OA 4H5JA 3FRXA 3GREA 4GQ1A 4CZYA 3F3GA 2BCJB 5THAA 2QC5A 2I0SA 1JOFA 4GZ8A 3PXTD 5HE1B 3ORVD 4CI1A 5EALA 1RI6A 1PEVA 2AGLA 2PM9A 5CXCB 3EI3B 3RSEC 4EWRA 3BG0A 4XYHA 1MDAH 4QRJA 2AGXA 2P9PC 2EBSA 4O45A 2H13A 3V7DB 5FKRA 1K32A 4GGCA 4JSXC 5EARA 1JMZB 3JPXA 3PXSD 5EMJB 5IJ7E 2P9SC 4H5IA 2UZXB 1S4UX 5FKTA 5CXBA 4XYIA 4ZN4A 4A0BA 4QL1A 4J73A 5SXMA 1SHYB 5HYNB 3VGZA 3SCYA 4ZOZA 5I5MA 5IT9g 2XL3A 5FKQA 1MG2A 2MTAH 3SN6B 3N0DA 4GQBB 4J0WA 3RLMD 4ERZA 1U4CA 3BG1A 3SJLD 4A11B 4FAND 2OVRB 2J57G 5I5IA 3E0CA 2J55H 4PBZA 4YVDA 1XHMA 3EI1A 3DWLC 3W15A 4JT6C 4J78A 3MKSB 3MZKA 5GSAA 4CZXA 3PE7A 3DM0A 2GNQA 2I0RA 2HJBA 5GXIA 3AH8B 3UVOA 3C99A 3IJ1A 5FKSA 3EI3A 4O3UB 3C75H 3MMYA 3OW8A 4PNKB 5EAPA 3RMZD 4PXWA 2CN3A 4Z8LA 1TYQC 4J84A 5EMLB 5KDOB 4CC9A 1B9YA 4D0KA 3GFCA 4A2MA 2IWFA 2HJ4A 2G9AA 3SHFA 1N6DA 3RRMC 4KFMB 5I5JA 4E5ZA 1GOTB 4CY3A 4HDJA 3K27A 4J86A 3SLED 2HYEA 3AFCA 2AH0A 2XL2A 3JAMg 3SXTD 1PGUA 3HFQA 4X60B 3EI1B 4A7JA 2I3SA 5TF2A 5IC7A 2GC7A 4OWRA 1VYHC 2HKMA 4BH6A 2Z2NA 2P9LC 3EMHA 3NVQA 3I7OA 4GGDA 2W18A 2GC4A 4GGAA 5C9ZB 3OL2A 3C5MA 5GXHA 3I7HA 3VH0A 5EMKB 3L4MD 4ESGA 3OKYB 1N6FA 5C2WB 2B5NA 1NEXB 3UVMA 5EM2A 3JRPA 4J79A 2I3TA 4A0AA 3F3PA 3J81g 4R7AB 4J81A 3SWSD 4FA1D 3PXWD 3ZWLB 4E5ZB 2J56H 3UR4A 3AL8A 2O9KA 2B5MA 3I8EA 2CNXA 3OKTA 2TRCB 4X61B 1MG3A 2OVQB 3UVNA 1QNIA 4L9OA 4Y7RA 2AH1A 4PC0A 2H6QA 2CO0C 4MK0B 5IJ8E 1U2VC 5FA5B 2YNOA 3RFHA 3UVLA 4JT5C 4ES0A 2IUQA 2YBAA 3ULEC 1PBYB 4CI3A 4JSVC 3SFZA 2H9MA 2XU7A 2OK6A 1K8KC 4J87A 3F3FA 3OL2B 4JD2C 2AGWA 2PM7B 3NVXA 3DXMC 5AFU3 4UI9R 5FQDA 3SVWD 2HXCA 4AEZA 5EM2B 2H9PA 4A0AB 5CYKB 2IUPA 4LG8A 3PSCB 4E54A 3BWSA 4OZUA 1P22A 5TEFA 3OKYA 3AL8B 4I79A 4NSXA 4XEIC 3KRXB 4A08A 4JXMA 1L0QA 2H9NA 3EI2B 2PM6B 3KRWB 3NVNA 4FWWA 4ERQA 3SBPA 5TEEA 4JSNC 3OKWA 3CIKB 4PBYA 4X63B 4FB1D 4O9DA 3EG6A 5IGOA 2OVPB 5H17A 1B9XA 5A2Qg 3AL9A 2AQ5A 3C9CA 5C2VB 3I7KA 4BUJC 3JROA 2AGYA 2P9NC 2YNPA 3EI4B 2XYIA 2H3XA 2I0TA 4GM9A 4ZOXA 2CO0A 4O3TB 2IAAA 4ERYA 4J82A 2B4EA 4E54B 2H6NA 4N14A 5FLXg 1SQJA 3PSLA 4GQ2P 5H1MA 1N6EA 4L3GD 4L3HD 4QT8A 1FWXA 2YB8B 4IA9A 4J8GA 3K26A 4A08B 3L4OD 3B7FA 2YNNA 5CYKA 1NR0A 4IMMA 2OJYA 1Q47A 3RFGA 5AJAA 3EWEA 5K1CC 1GXRA 4A09A 3CFVA 2CN2A 5HE0B 3UVKA 1SQ9A 3PVWB 1TBGA 3SBQA 3EU7A 3JB9L 3JZHA 2OIZA 3I8CA 3EI2A 4PSXB 4Y5RD 3MKQA 5IGQA 3FGBA 4QQEA 3MXXA 1JMXB 2P9UC 2H14A 3UKUC 2PBIB 1XIPA 3I89A 3J80g 3IJ0A 3PVUB 2IUVA 4A2LA 2Q7QA 3FM0A 5EAMA 4X3EA 3RN1D 5K19A 4CI2A 4D6VA 1OLZA 3U4YA 1GG2B 3I7NA 4FA4D 2H47A 3MZLA 4G56B 3EI4A 2H9LA 1R5MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EMM B;  3JZG A;  4PSW B;  5HQG A;  1YFQ A;  3RN0 D;  2G99 A;  2AGZ A;  5HE2 B;  3CFS B;  1ERJ A;  1JJU B;  2PM9 B;  4O1Q D;  2IUR A;  3I7L A;  4A09 B;  4GM3 A;  2P9K C;  1OMW B;  3DSM A;  4ZOV A;  1PI6 A;  4FHL A;  3V9F A;  4ZOY A;  3N0E A;  4TZ4 A;  4K3I D;  1XKS A;  2BBK H;  5TDH B;  5CXC A;  3SBR A;  4J77 A;  2OK4 A;  4J0X A;  2CE9 A;  4GM8 A;  3IKO A;  4FAV D;  3SMR A;  4AOW A;  5CXB B;  2H68 A;  4A0B B;  4LG9 A;  2Z2P A;  4FA5 D;  3DXK C;  2H6K A;  3JZN A;  3A0F A;  4J8B A;  4BL0 A;  4K3J B;  2CE8 A;  1A0R B;  4CY1 A;  4L1Q D;  3I7P A;  2YMU A;  3IJC A;  5GMK n;  4JSP C;  4CZV A;  2P9I C;  3OTT A;  3IIW A;  2HKR A;  3VA6 A;  4CY5 A;  3UKR C;  3P4F A;  3IIY A;  4FA9 D;  2B5L A;  4LGN A;  3V5W B;  5AMS A;  4CI8 A;  2IWK A;  5JWZ A;  4GMB A;  5B4W A;  1GP2 B;  3I2N A;  5FXY A;  5HE3 B;  2QXV A;  4CY2 A;  4U1E I;  4U7A A;  2HES X;  2UZY B;  3ODT A;  5H14 A;  4A11 A;  2Z2O A;  4H5J A;  3FRX A;  3GRE A;  4GQ1 A;  4CZY A;  3F3G A;  2BCJ B;  5THA A;  2QC5 A;  2I0S A;  1JOF A;  4GZ8 A;  3PXT D;  5HE1 B;  3ORV D;  4CI1 A;  5EAL A;  1RI6 A;  1PEV A;  2AGL A;  2PM9 A;  5CXC B;  3EI3 B;  3RSE C;  4EWR A;  3BG0 A;  4XYH A;  1MDA H;  4QRJ A;  2AGX A;  2P9P C;  2EBS A;  4O45 A;  2H13 A;  3V7D B;  5FKR A;  1K32 A;  4GGC A;  4JSX C;  5EAR A;  1JMZ B;  3JPX A;  3PXS D;  5EMJ B;  5IJ7 E;  2P9S C;  4H5I A;  2UZX B;  1S4U X;  5FKT A;  5CXB A;  4XYI A;  4ZN4 A;  4A0B A;  4QL1 A;  4J73 A;  5SXM A;  1SHY B;  5HYN B;  3VGZ A;  3SCY A;  4ZOZ A;  5I5M A;  5IT9 g;  2XL3 A;  5FKQ A;  1MG2 A;  2MTA H;  3SN6 B;  3N0D A;  4GQB B;  4J0W A;  3RLM D;  4ERZ A;  1U4C A;  3BG1 A;  3SJL D;  4A11 B;  4FAN D;  2OVR B;  2J57 G;  5I5I A;  3E0C A;  2J55 H;  4PBZ A;  4YVD A;  1XHM A;  3EI1 A;  3DWL C;  3W15 A;  4JT6 C;  4J78 A;  3MKS B;  3MZK A;  5GSA A;  4CZX A;  3PE7 A;  3DM0 A;  2GNQ A;  2I0R A;  2HJB A;  5GXI A;  3AH8 B;  3UVO A;  3C99 A;  3IJ1 A;  5FKS A;  3EI3 A;  4O3U B;  3C75 H;  3MMY A;  3OW8 A;  4PNK B;  5EAP A;  3RMZ D;  4PXW A;  2CN3 A;  4Z8L A;  1TYQ C;  4J84 A;  5EML B;  5KDO B;  4CC9 A;  1B9Y A;  4D0K A;  3GFC A;  4A2M A;  2IWF A;  2HJ4 A;  2G9A A;  3SHF A;  1N6D A;  3RRM C;  4KFM B;  5I5J A;  4E5Z A;  1GOT B;  4CY3 A;  4HDJ A;  3K27 A;  4J86 A;  3SLE D;  2HYE A;  3AFC A;  2AH0 A;  2XL2 A;  3JAM g;  3SXT D;  1PGU A;  3HFQ A;  4X60 B;  3EI1 B;  4A7J A;  2I3S A;  5TF2 A;  5IC7 A;  2GC7 A;  4OWR A;  1VYH C;  2HKM A;  4BH6 A;  2Z2N A;  2P9L C;  3EMH A;  3NVQ A;  3I7O A;  4GGD A;  2W18 A;  2GC4 A;  4GGA A;  5C9Z B;  3OL2 A;  3C5M A;  5GXH A;  3I7H A;  3VH0 A;  5EMK B;  3L4M D;  4ESG A;  3OKY B;  1N6F A;  5C2W B;  2B5N A;  1NEX B;  3UVM A;  5EM2 A;  3JRP A;  4J79 A;  2I3T A;  4A0A A;  3F3P A;  3J81 g;  4R7A B;  4J81 A;  3SWS D;  4FA1 D;  3PXW D;  3ZWL B;  4E5Z B;  2J56 H;  3UR4 A;  3AL8 A;  2O9K A;  2B5M A;  3I8E A;  2CNX A;  3OKT A;  2TRC B;  4X61 B;  1MG3 A;  2OVQ B;  3UVN A;  1QNI A;  4L9O A;  4Y7R A;  2AH1 A;  4PC0 A;  2H6Q A;  2CO0 C;  4MK0 B;  5IJ8 E;  1U2V C;  5FA5 B;  2YNO A;  3RFH A;  3UVL A;  4JT5 C;  4ES0 A;  2IUQ A;  2YBA A;  3ULE C;  1PBY B;  4CI3 A;  4JSV C;  3SFZ A;  2H9M A;  2XU7 A;  2OK6 A;  1K8K C;  4J87 A;  3F3F A;  3OL2 B;  4JD2 C;  2AGW A;  2PM7 B;  3NVX A;  3DXM C;  5AFU 3;  4UI9 R;  5FQD A;  3SVW D;  2HXC A;  4AEZ A;  5EM2 B;  2H9P A;  4A0A B;  5CYK B;  2IUP A;  4LG8 A;  3PSC B;  4E54 A;  3BWS A;  4OZU A;  1P22 A;  5TEF A;  3OKY A;  3AL8 B;  4I79 A;  4NSX A;  4XEI C;  3KRX B;  4A08 A;  4JXM A;  1L0Q A;  2H9N A;  3EI2 B;  2PM6 B;  3KRW B;  3NVN A;  4FWW A;  4ERQ A;  3SBP A;  5TEE A;  4JSN C;  3OKW A;  3CIK B;  4PBY A;  4X63 B;  4FB1 D;  4O9D A;  3EG6 A;  5IGO A;  2OVP B;  5H17 A;  1B9X A;  5A2Q g;  3AL9 A;  2AQ5 A;  3C9C A;  5C2V B;  3I7K A;  4BUJ C;  3JRO A;  2AGY A;  2P9N C;  2YNP A;  3EI4 B;  2XYI A;  2H3X A;  2I0T A;  4GM9 A;  4ZOX A;  2CO0 A;  4O3T B;  2IAA A;  4ERY A;  4J82 A;  2B4E A;  4E54 B;  2H6N A;  4N14 A;  5FLX g;  1SQJ A;  3PSL A;  4GQ2 P;  5H1M A;  1N6E A;  4L3G D;  4L3H D;  4QT8 A;  1FWX A;  2YB8 B;  4IA9 A;  4J8G A;  3K26 A;  4A08 B;  3L4O D;  3B7F A;  2YNN A;  5CYK A;  1NR0 A;  4IMM A;  2OJY A;  1Q47 A;  3RFG A;  5AJA A;  3EWE A;  5K1C C;  1GXR A;  4A09 A;  3CFV A;  2CN2 A;  5HE0 B;  3UVK A;  1SQ9 A;  3PVW B;  1TBG A;  3SBQ A;  3EU7 A;  3JB9 L;  3JZH A;  2OIZ A;  3I8C A;  3EI2 A;  4PSX B;  4Y5R D;  3MKQ A;  5IGQ A;  3FGB A;  4QQE A;  3MXX A;  1JMX B;  2P9U C;  2H14 A;  3UKU C;  2PBI B;  1XIP A;  3I89 A;  3J80 g;  3IJ0 A;  3PVU B;  2IUV A;  4A2L A;  2Q7Q A;  3FM0 A;  5EAM A;  4X3E A;  3RN1 D;  5K19 A;  4CI2 A;  4D6V A;  1OLZ A;  3U4Y A;  1GG2 B;  3I7N A;  4FA4 D;  2H47 A;  3MZL A;  4G56 B;  3EI4 A;  2H9L A;  1R5M A; 
#chains in the Genus database with same CATH topology
 3FCU A;  5EMM B;  3JZG A;  4NC4 A;  4PSW B;  5HQG A;  1YFQ A;  3RN0 D;  2G99 A;  2AGZ A;  5HE2 B;  3CFS B;  4NBM A;  4RE6 A;  1ERJ A;  1JJU B;  2PM9 B;  3K72 A;  4O1Q D;  2BKL A;  2IUR A;  3I7L A;  4A09 B;  5E6S A;  2VZ1 A;  4GM3 A;  2P9K C;  1OMW B;  3DSM A;  4ZOV A;  1PI6 A;  4L1M A;  4FHL A;  3V9F A;  4ZOY A;  3N0E A;  4TZ4 A;  4K3I D;  1XKS A;  2BBK H;  5TDH B;  5CXC A;  3SBR A;  4J77 A;  2OK4 A;  4J0X A;  3IUJ A;  2CE9 A;  4GM8 A;  3IKO A;  4FAV D;  3SMR A;  4AOW A;  5CXB B;  3GC3 B;  5HDB A;  2H68 A;  4A0B B;  4LG9 A;  4BCD A;  2Z2P A;  1UOQ A;  4FA5 D;  3DXK C;  2H6K A;  3JZN A;  3A0F A;  3VI4 A;  2EIB A;  4DNV A;  4J8B A;  4BL0 A;  4K3J B;  2CE8 A;  1A0R B;  4CY1 A;  4L1Q D;  3I7P A;  2YMU A;  3IJC A;  5GMK n;  4NAA A;  1O6F A;  4JSP C;  4CZV A;  2P9I C;  2EIE A;  3OTT A;  3IIW A;  3IUN A;  2HKR A;  3VA6 A;  4CY5 A;  3UKR C;  3P4F A;  3IIY A;  1GOH A;  2B5L A;  4FA9 D;  4LGN A;  3V5W B;  5AMS A;  4CI8 A;  4BP9 A;  2IWK A;  5JWZ A;  4GMB A;  5FFO A;  1K3I A;  5B4W A;  1GP2 B;  1QFS A;  3QI0 A;  3I2N A;  5FXY A;  5HE3 B;  2QXV A;  4CY2 A;  4U1E I;  1UOP A;  4U7A A;  4Z7Q A;  2HES X;  2UZY B;  3ODT A;  5H14 A;  4A11 A;  2Z2O A;  4H5J A;  1H2Y A;  3FRX A;  3GRE A;  4GQ1 A;  4CZY A;  3F3G A;  2BCJ B;  5THA A;  2QC5 A;  2I0S A;  1JOF A;  4GZ8 A;  3PXT D;  5HE1 B;  3ORV D;  4CI1 A;  3NID A;  5EAL A;  1RI6 A;  1PEV A;  2HU5 A;  1H2Z A;  2AGL A;  2PM9 A;  4IRZ A;  4D9S A;  5CXC B;  3EI3 B;  3RSE C;  4EWR A;  5E6R A;  3BG0 A;  4XYH A;  1MDA H;  4QRJ A;  2AGX A;  2P9P C;  4AN0 A;  2VDN A;  2EBS A;  3IUR A;  2H13 A;  4O45 A;  3V7D B;  3O4I A;  5FKR A;  1K32 A;  4GGC A;  4JSX C;  5EAR A;  1JMZ B;  3JPX A;  2XDW A;  3PXS D;  5EMJ B;  5IJ7 E;  3OF7 A;  4G1M A;  2P9S C;  4H5I A;  2UZX B;  1S4U X;  5FKT A;  3ZDY A;  5CXB A;  4NEN A;  4WK4 A;  4XYI A;  4ZN4 A;  4A0B A;  1VE7 A;  4QL1 A;  4J73 A;  5SXM A;  1SHY B;  5HYN B;  3VGZ A;  3SCY A;  4ZOZ A;  5I5M A;  5IT9 g;  2XL3 A;  4JHN A;  5FKQ A;  5M61 A;  1MG2 A;  2MTA H;  3SN6 B;  1C9L A;  3N0D A;  4GQB B;  4J0W A;  3RLM D;  4ERZ A;  1U4C A;  3BG1 A;  3SJL D;  4A11 B;  4G1E A;  4QAM A;  2OVR B;  4FAN D;  2J57 G;  5I5I A;  4WJK A;  3E0C A;  3MVD K;  3O4G A;  2J55 H;  1GOG A;  4PBZ A;  4YVD A;  1XHM A;  3EI1 A;  3DWL C;  1BPO A;  3W15 A;  4JT6 C;  4J78 A;  3MKS B;  1H2W A;  3MZK A;  5GSA A;  4CZX A;  3PE7 A;  5M5R A;  3DM0 A;  3EQ7 A;  2GNQ A;  2I0R A;  2HJB A;  4AMZ A;  5GXI A;  3AH8 B;  3ZDZ A;  2VDR A;  3UVO A;  4Z7O A;  3C99 A;  3IJ1 A;  5FKS A;  3EI3 A;  4O3U B;  3C75 H;  3MMY A;  3OW8 A;  4WK2 A;  4PNK B;  5EAP A;  3RMZ D;  4PXW A;  2CN3 A;  4Z8L A;  1TYQ C;  4J84 A;  1VE6 A;  5EML B;  5KDO B;  5M5S A;  4CC9 A;  1B9Y A;  3V4P A;  5E6U A;  4D0K A;  1YR2 A;  3GFC A;  4AN1 A;  4A2M A;  2IWF A;  3IUL A;  4MMX A;  2HJ4 A;  2G9A A;  3SHF A;  1N6D A;  3RRM C;  1TYE A;  4KFM B;  5I5J A;  3O4J A;  4E5Z A;  1GOT B;  4CY3 A;  4HDJ A;  1U8C A;  3K27 A;  4J86 A;  4DNU A;  3SLE D;  2HYE A;  3AFC A;  2AH0 A;  4JHP C;  3V4V A;  2XL2 A;  3JAM g;  3SXT D;  1PGU A;  3HFQ A;  4X60 B;  3EI1 B;  2JKX A;  4A7J A;  2I3S A;  5TF2 A;  5IC7 A;  1E5T A;  4G55 A;  2WQ8 A;  3GD1 I;  2GC7 A;  4OWR A;  2VDM A;  1VYH C;  2HKM A;  4BH6 A;  2Z2N A;  1C9I A;  1H2X A;  2P9L C;  3EMH A;  3NVQ A;  1O6G A;  3I7O A;  4GGD A;  1E8M A;  3ZDX A;  2W18 A;  2GC4 A;  4GGA A;  5C9Z B;  1L5G A;  1T2X A;  3OL2 A;  3C5M A;  1VZ3 A;  3I7H A;  5GXH A;  4AMY A;  3IUQ A;  3VH0 A;  5EMK B;  3L4M D;  4ESG A;  3OKY B;  1N6F A;  5C2W B;  2B5N A;  1NEX B;  3UVM A;  3IJE A;  5EM2 A;  3JRP A;  5FFG A;  4J79 A;  2I3T A;  4A0A A;  2XE4 A;  3F3P A;  3J81 g;  4R7A B;  4J81 A;  3SWS D;  4FA1 D;  3PXW D;  3ZWL B;  4E5Z B;  2J56 H;  3UR4 A;  3AL8 A;  2O9K A;  2B5M A;  3I8E A;  2CNX A;  3MUO A;  2TRC B;  3OKT A;  4O02 A;  1MG3 A;  4X61 B;  4AX4 A;  2QR5 A;  2OVQ B;  3UVN A;  1QNI A;  4L9O A;  4Y7R A;  4UM9 A;  2AH1 A;  4PC0 A;  2H6Q A;  2CO0 C;  4MK0 B;  5IJ8 E;  1U2V C;  5FA5 B;  2YNO A;  4RE5 A;  3RFH A;  4DNW A;  3UVL A;  4JT5 C;  4ES0 A;  1E8N A;  2IUQ A;  1VZ2 A;  2YBA A;  3ULE C;  1PBY B;  4CI3 A;  3ZE1 A;  4JSV C;  3SFZ A;  2HU8 A;  3DDU A;  2H9M A;  2XZG A;  3ZE0 A;  2XU7 A;  2OK6 A;  1K8K C;  4J87 A;  3F3F A;  3OL2 B;  4JD2 C;  2AGW A;  2PM7 B;  3NVX A;  3DXM C;  5AFU 3;  4UI9 R;  5FQD A;  3FCS A;  3K6S A;  3SVW D;  2HXC A;  4AEZ A;  2VDQ A;  5EM2 B;  2QZP A;  2H9P A;  4O2W A;  5CYK B;  4A0A B;  2IUP A;  4LG8 A;  3PSC B;  4E54 A;  3BWS A;  3T3P A;  4OZU A;  1I2M B;  1P22 A;  5TEF A;  2VDL A;  3OKY A;  4WK0 A;  4MMY A;  3AL8 B;  4I79 A;  4NSX A;  4MMZ A;  4XEI C;  3KRX B;  4A08 A;  4JXM A;  1L0Q A;  1M1X A;  2H9N A;  3EI2 B;  2HU7 A;  2PM6 B;  3KRW B;  3NIF A;  3NVN A;  4FWW A;  4ERQ A;  3MUN A;  3SBP A;  5TEE A;  1UOO A;  3T3M A;  4JSN C;  3OKW A;  3CIK B;  4PBY A;  3QHY B;  4X63 B;  4FB1 D;  4O9D A;  3EG6 A;  5IGO A;  2OVP B;  5H17 A;  1B9X A;  5A2Q g;  3AL9 A;  5M5V A;  2AQ5 A;  3C9C A;  5C2V B;  3I7K A;  4BUJ C;  3JRO A;  2AGY A;  2P9N C;  2YNP A;  3EI4 B;  2XYI A;  4BCB A;  2H3X A;  2I0T A;  4GM9 A;  4ZOX A;  2CO0 A;  4O3T B;  2IAA A;  4ERY A;  4J82 A;  1QFM A;  2B4E A;  4E54 B;  2H6N A;  4N14 A;  5FLX g;  1SQJ A;  5C86 A;  2VDO A;  3EQ9 A;  3PSL A;  3IVM A;  4GQ2 P;  5H1M A;  1N6E A;  4L3G D;  4L3H D;  4QT8 A;  1FWX A;  3K71 A;  2YB8 B;  4IA9 A;  4J8G A;  2VDK A;  3IUM A;  3K26 A;  4A08 B;  3L4O D;  3B7F A;  2YNN A;  5CYK A;  1NR0 A;  4IMM A;  1JV2 A;  1JTD B;  1A12 A;  2OJY A;  1Q47 A;  2EIC A;  3RFG A;  5AJA A;  3EWE A;  1UTC A;  2VDP A;  5K1C C;  3NIG A;  1GXR A;  4A09 A;  3CFV A;  2CN2 A;  5HE0 B;  3ZE2 A;  3UVK A;  4UM8 A;  1SQ9 A;  2VC2 A;  3PVW B;  1TBG A;  3SBQ A;  5M5T A;  3EU7 A;  4Z7N A;  4BP8 A;  3JB9 L;  3JZH A;  2OIZ A;  3I8C A;  3EI2 A;  4PSX B;  3EQ8 A;  4Y5R D;  3MKQ A;  3VI3 A;  3KCI A;  5IGQ A;  3FGB A;  1GOF A;  4QQE A;  3MXX A;  1JMX B;  2P9U C;  2H14 A;  3UKU C;  4BCC A;  2EID A;  2PBI B;  1XIP A;  3I89 A;  3J80 g;  2VZ3 A;  3IJ0 A;  3PVU B;  2IUV A;  4A2L A;  2Q7Q A;  3FM0 A;  3O4H A;  4X3E A;  5EAM A;  3RN1 D;  5K19 A;  4CI2 A;  5C92 A;  4D6V A;  1OLZ A;  3U4Y A;  1GG2 B;  5M5U A;  3I7N A;  4FA4 D;  3MZL A;  2H47 A;  4G56 B;  3EI4 A;  2H9L A;  1R5M A; 
#chains in the Genus database with same CATH homology
 5EMM B;  3JZG A;  4PSW B;  5HQG A;  1YFQ A;  3RN0 D;  2G99 A;  2AGZ A;  5HE2 B;  3CFS B;  1ERJ A;  1JJU B;  2PM9 B;  4O1Q D;  2IUR A;  3I7L A;  4A09 B;  4GM3 A;  2P9K C;  1OMW B;  3DSM A;  4ZOV A;  1PI6 A;  4FHL A;  3V9F A;  4ZOY A;  3N0E A;  4TZ4 A;  4K3I D;  1XKS A;  2BBK H;  5TDH B;  5CXC A;  3SBR A;  4J77 A;  2OK4 A;  4J0X A;  2CE9 A;  4GM8 A;  3IKO A;  4FAV D;  3SMR A;  4AOW A;  5CXB B;  2H68 A;  4A0B B;  4LG9 A;  2Z2P A;  4FA5 D;  3DXK C;  2H6K A;  3JZN A;  3A0F A;  4J8B A;  4BL0 A;  4K3J B;  2CE8 A;  1A0R B;  4CY1 A;  4L1Q D;  3I7P A;  2YMU A;  3IJC A;  5GMK n;  4JSP C;  4CZV A;  2P9I C;  3OTT A;  3IIW A;  2HKR A;  3VA6 A;  4CY5 A;  3UKR C;  3P4F A;  3IIY A;  4FA9 D;  2B5L A;  4LGN A;  3V5W B;  5AMS A;  4CI8 A;  2IWK A;  5JWZ A;  4GMB A;  5B4W A;  1GP2 B;  3I2N A;  5FXY A;  5HE3 B;  2QXV A;  4CY2 A;  4U1E I;  4U7A A;  2HES X;  2UZY B;  3ODT A;  5H14 A;  4A11 A;  2Z2O A;  4H5J A;  3FRX A;  3GRE A;  4GQ1 A;  4CZY A;  3F3G A;  2BCJ B;  5THA A;  2QC5 A;  2I0S A;  1JOF A;  4GZ8 A;  3PXT D;  5HE1 B;  3ORV D;  4CI1 A;  5EAL A;  1RI6 A;  1PEV A;  2AGL A;  2PM9 A;  5CXC B;  3EI3 B;  3RSE C;  4EWR A;  3BG0 A;  4XYH A;  1MDA H;  4QRJ A;  2AGX A;  2P9P C;  2EBS A;  4O45 A;  2H13 A;  3V7D B;  5FKR A;  1K32 A;  4GGC A;  4JSX C;  5EAR A;  1JMZ B;  3JPX A;  3PXS D;  5EMJ B;  5IJ7 E;  2P9S C;  4H5I A;  2UZX B;  1S4U X;  5FKT A;  5CXB A;  4XYI A;  4ZN4 A;  4A0B A;  4QL1 A;  4J73 A;  5SXM A;  1SHY B;  5HYN B;  3VGZ A;  3SCY A;  4ZOZ A;  5I5M A;  5IT9 g;  2XL3 A;  5FKQ A;  1MG2 A;  2MTA H;  3SN6 B;  3N0D A;  4GQB B;  4J0W A;  3RLM D;  4ERZ A;  1U4C A;  3BG1 A;  3SJL D;  4A11 B;  4FAN D;  2OVR B;  2J57 G;  5I5I A;  3E0C A;  2J55 H;  4PBZ A;  4YVD A;  1XHM A;  3EI1 A;  3DWL C;  3W15 A;  4JT6 C;  4J78 A;  3MKS B;  3MZK A;  5GSA A;  4CZX A;  3PE7 A;  3DM0 A;  2GNQ A;  2I0R A;  2HJB A;  5GXI A;  3AH8 B;  3UVO A;  3C99 A;  3IJ1 A;  5FKS A;  3EI3 A;  4O3U B;  3C75 H;  3MMY A;  3OW8 A;  4PNK B;  5EAP A;  3RMZ D;  4PXW A;  2CN3 A;  4Z8L A;  1TYQ C;  4J84 A;  5EML B;  5KDO B;  4CC9 A;  1B9Y A;  4D0K A;  3GFC A;  4A2M A;  2IWF A;  2HJ4 A;  2G9A A;  3SHF A;  1N6D A;  3RRM C;  4KFM B;  5I5J A;  4E5Z A;  1GOT B;  4CY3 A;  4HDJ A;  3K27 A;  4J86 A;  3SLE D;  2HYE A;  3AFC A;  2AH0 A;  2XL2 A;  3JAM g;  3SXT D;  1PGU A;  3HFQ A;  4X60 B;  3EI1 B;  4A7J A;  2I3S A;  5TF2 A;  5IC7 A;  2GC7 A;  4OWR A;  1VYH C;  2HKM A;  4BH6 A;  2Z2N A;  2P9L C;  3EMH A;  3NVQ A;  3I7O A;  4GGD A;  2W18 A;  2GC4 A;  4GGA A;  5C9Z B;  3OL2 A;  3C5M A;  5GXH A;  3I7H A;  3VH0 A;  5EMK B;  3L4M D;  4ESG A;  3OKY B;  1N6F A;  5C2W B;  2B5N A;  1NEX B;  3UVM A;  5EM2 A;  3JRP A;  4J79 A;  2I3T A;  4A0A A;  3F3P A;  3J81 g;  4R7A B;  4J81 A;  3SWS D;  4FA1 D;  3PXW D;  3ZWL B;  4E5Z B;  2J56 H;  3UR4 A;  3AL8 A;  2O9K A;  2B5M A;  3I8E A;  2CNX A;  3OKT A;  2TRC B;  4X61 B;  1MG3 A;  2OVQ B;  3UVN A;  1QNI A;  4L9O A;  4Y7R A;  2AH1 A;  4PC0 A;  2H6Q A;  2CO0 C;  4MK0 B;  5IJ8 E;  1U2V C;  5FA5 B;  2YNO A;  3RFH A;  3UVL A;  4JT5 C;  4ES0 A;  2IUQ A;  2YBA A;  3ULE C;  1PBY B;  4CI3 A;  4JSV C;  3SFZ A;  2H9M A;  2XU7 A;  2OK6 A;  1K8K C;  4J87 A;  3F3F A;  3OL2 B;  4JD2 C;  2AGW A;  2PM7 B;  3NVX A;  3DXM C;  5AFU 3;  4UI9 R;  5FQD A;  3SVW D;  2HXC A;  4AEZ A;  5EM2 B;  2H9P A;  4A0A B;  5CYK B;  2IUP A;  4LG8 A;  3PSC B;  4E54 A;  3BWS A;  4OZU A;  1P22 A;  5TEF A;  3OKY A;  3AL8 B;  4I79 A;  4NSX A;  4XEI C;  3KRX B;  4A08 A;  4JXM A;  1L0Q A;  2H9N A;  3EI2 B;  2PM6 B;  3KRW B;  3NVN A;  4FWW A;  4ERQ A;  3SBP A;  5TEE A;  4JSN C;  3OKW A;  3CIK B;  4PBY A;  4X63 B;  4FB1 D;  4O9D A;  3EG6 A;  5IGO A;  2OVP B;  5H17 A;  1B9X A;  5A2Q g;  3AL9 A;  2AQ5 A;  3C9C A;  5C2V B;  3I7K A;  4BUJ C;  3JRO A;  2AGY A;  2P9N C;  2YNP A;  3EI4 B;  2XYI A;  2H3X A;  2I0T A;  4GM9 A;  4ZOX A;  2CO0 A;  4O3T B;  2IAA A;  4ERY A;  4J82 A;  2B4E A;  4E54 B;  2H6N A;  4N14 A;  5FLX g;  1SQJ A;  3PSL A;  4GQ2 P;  5H1M A;  1N6E A;  4L3G D;  4L3H D;  4QT8 A;  1FWX A;  2YB8 B;  4IA9 A;  4J8G A;  3K26 A;  4A08 B;  3L4O D;  3B7F A;  2YNN A;  5CYK A;  1NR0 A;  4IMM A;  2OJY A;  1Q47 A;  3RFG A;  5AJA A;  3EWE A;  5K1C C;  1GXR A;  4A09 A;  3CFV A;  2CN2 A;  5HE0 B;  3UVK A;  1SQ9 A;  3PVW B;  1TBG A;  3SBQ A;  3EU7 A;  3JB9 L;  3JZH A;  2OIZ A;  3I8C A;  3EI2 A;  4PSX B;  4Y5R D;  3MKQ A;  5IGQ A;  3FGB A;  4QQE A;  3MXX A;  1JMX B;  2P9U C;  2H14 A;  3UKU C;  2PBI B;  1XIP A;  3I89 A;  3J80 g;  3IJ0 A;  3PVU B;  2IUV A;  4A2L A;  2Q7Q A;  3FM0 A;  5EAM A;  4X3E A;  3RN1 D;  5K19 A;  4CI2 A;  4D6V A;  1OLZ A;  3U4Y A;  1GG2 B;  3I7N A;  4FA4 D;  2H47 A;  3MZL A;  4G56 B;  3EI4 A;  2H9L A;  1R5M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...