4G55A

Clathrin terminal domain complexed with pitstop 2
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
358
structure length
358
Chain Sequence
FMAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis
molecule keywords Clathrin heavy chain 1
publication title Role of the clathrin terminal domain in regulating coated pit dynamics revealed by small molecule inhibition.
pubmed doi rcsb
source organism Homo sapiens
total genus 76
structure length 358
sequence length 358
ec nomenclature
pdb deposition date 2012-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01394 Clathrin_propel Clathrin propeller repeat
A PF09268 Clathrin-link Clathrin, heavy-chain linker
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.110 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Clathrin heavy-chain terminal domain 4g55A00
3GC3B 1UTCA 5M61A 5M5TA 5M5VA 1BPOA 5M5UA 4G55A 5M5SA 2XZGA 1C9IA 3GD1I 1C9LA 5M5RA
chains in the Genus database with same CATH superfamily
3AH8B 3OF7A 4IMMA 2WQ8A 4Y7RA 3K27A 5EAMA 2Z2PA 3JZNA 2PM6B 3JB9L 2AQ5A 5GXIA 1VZ2A 4EWRA 4MMXA 3F3GA 2EIBA 2XL2A 3C75H 3RLMD 4WK2A 1N6DA 4A0BB 4BCDA 3PSLA 3SN6B 1PI6A 4ERZA 3RSEC 3RMZD 4N14A 1PGUA 3DXMC 1OLZA 4CI8A 3FRXA 3EQ9A 4X61B 2GC7A 2EIDA 3KRWB 3SJLD 4AN0A 2CN3A 3ORVD 5HE3B 4J73A 4O3UB 1JJUB 1MG3A 4JD2C 1TYEA 2HJ4A 4XEIC 1O6GA 1RI6A 1TBGA 3SBQA 2QXVA 5IT9g 3EI1B 1GOFA 3OL2A 4QT8A 4JHNA 3I7HA 3V4VA 3VI4A 3JAMg 5EMJB 4FA4D 3SCYA 5C86A 2H68A 4RE5A 3AL8A 2QC5A 4ERQA 4NAAA 3V9FA 3SBRA 5EAPA 4BH6A 3OKTA 2G9AA 1E8NA 5HE0B 5A2Qg 3CFSB 5CYKB 4BUJC 3IVMA 4G55A 3PVWB 4JSPC 3EI2B 1Q47A 3V7DB 1QFMA 3UVLA 4E5ZB 4TZ4A 5FFOA 4QAMA 2I3SA 2H9LA 4YVDA 3N0DA 3KCIA 3PXWD 4A11A 2IURA 1H2ZA 5EMKB 5H14A 4ERYA 2JKXA 2G99A 4PBYA 2QR5A 2P9IC 4X63B 1GP2B 4A0AB 5I5MA 4AEZA 4CI1A 2J57G 1FWXA 5M5SA 2AGZA 3FCUA 2Q7QA 3I8CA 3QHYB 5HE1B 3IIWA 4A0BA 3SXTD 2I3TA 2HESX 4WJKA 4FHLA 3I7PA 2GC4A 1UOOA 3PVUB 2PM9A 2IAAA 3MXXA 4WK0A 4U7AA 2XL3A 3AL8B 3F3FA 3GFCA 4GQ1A 4NC4A 5GSAA 4FA1D 2QZPA 3ZE2A 3SLED 3K72A 1JMXB 3OKWA 2P9UC 1SQJA 2XZGA 4CY2A 1UOQA 2XE4A 3IULA 5M5UA 3RRMC 2P9PC 4AMYA 4O02A 4PNKB 3I89A 4CY3A 4J84A 4JT6C 2P9LC 4GM8A 5TF2A 1OMWB 4CI3A 4J81A 4Y5RD 3RN0D 3FCSA 4A11B 1VYHC 2O9KA 4CZXA 1R5MA 5CYKA 5C2WB 2CO0C 2P9SC 4X3EA 5C9ZB 3K6SA 4OZUA 3EI2A 2CE8A 1K32A 4E5ZA 3O4IA 5FXYA 4OWRA 2AGXA 1JMZB 3VH0A 4ES0A 3I7LA 4LG8A 2B5LA 2XDWA 3QI0A 3MUNA 4D9SA 4QQEA 4G1EA 2UZXB 4X60B 5FKSA 4J79A 4FA9D 4A0AA 5HE2B 2PM9B 2Z2NA 4WK4A 1B9YA 2CO0A 2H6KA 3NIFA 5TEFA 2H9NA 1U4CA 2CNXA 3UR4A 4UI9R 4BP9A 4J0WA 2VDQA 1E8MA 1XKSA 3AFCA 2XYIA 1U2VC 2J55H 4FWWA 4O1QD 3RN1D 3NVQA 4JSXC 2I0RA 3A0FA 4L3HD 3EI3A 3EI4B 5K1CC 2VDRA 4Z7NA 1H2YA 4CY1A 2BKLA 5C92A 5EM2B 1E5TA 3OTTA 4K3ID 2VZ3A 3O4JA 2PM7B 4J8GA 5I5IA 3JROA 4PXWA 3J80g 1T2XA 3OW8A 3VI3A 2HKMA 4E54B 2H6QA 3IKOA 4JHPC 3E0CA 4PC0A 3DDUA 4ZOYA 3KRXB 3PSCB 4D6VA 2YMUA 3CIKB 4ZOZA 5IJ8E 1MG2A 4A2LA 4BCCA 3SMRA 3FGBA 3SVWD 4J87A 1XHMA 2YNNA 2OVQB 3JPXA 4RE6A 3ZE0A 1TYQC 4R7AB 1C9LA 2B5MA 4GM3A 2HYEA 3W15A 3BG1A 3VGZA 3DXKC 4BP8A 5FQDA 5JWZA 2HXCA 3OKYA 2P9NC 3SBPA 2VDKA 3I2NA 2Z2OA 3I7KA 2OJYA 3IUNA 1I2MB 3ODTA 5H1MA 5M61A 1QFSA 1VZ3A 1GXRA 3BWSA 3SWSD 2I0TA 3IJCA 4MMZA 3L4OD 3EI3B 5KDOB 4XYHA 2OIZA 5TEEA 1JV2A 1MDAH 3L4MD 4FAVD 2W18A 4BCBA 2H3XA 3SHFA 3UVNA 3BG0A 2VDLA 1U8CA 2EICA 3UVMA 4J78A 5THAA 5AFU3 5I5JA 4ZN4A 3IUJA 1GOHA 3IUQA 1A12A 4FB1D 3RFHA 3IJEA 3ZDYA 4JSVC 3VA6A 5CXBA 1B9XA 2OVPB 3DWLC 2VC2A 3EMHA 4GZ8A 5HYNB 4MMYA 3EI4A 4ZOVA 2EIEA 5CXCB 5M5VA 2H13A 1H2WA 5EM2A 2IUPA 4AOWA 4CC9A 1PEVA 1M1XA 4AMZA 5B4WA 4J0XA 3ZWLB 3MUOA 4DNUA 4H5JA 5E6SA 4A7JA 1P22A 4A08A 2H9PA 1SHYB 3GD1I 4MK0B 4E54A 3V5WB 1GG2B 1YFQA 1BPOA 4GGCA 3DM0A 4A09B 3EG6A 1PBYB 3F3PA 5IGQA 2VDPA 3GC3B 3OKYB 4KFMB 3MKQA 2YB8B 5K19A 3EQ7A 2P9KC 1L0QA 1N6EA 4I79A 1NR0A 2VZ1A 1UOPA 2H47A 2VDOA 5FKQA 3SFZA 2AGYA 5C2VB 4GM9A 3IIYA 4GGAA 2H14A 3I7NA 1S4UX 3IJ1A 4O3TB 4J77A 3FM0A 4LG9A 4O2WA 2HJBA 4DNWA 4NENA 4L1QD 2YBAA 4ESGA 3J81g 5FLXg 5CXBB 3B7FA 1SQ9A 5E6RA 2AH1A 2B4EA 2MTAH 5IGOA 4CZYA 4AN1A 4PBZA 4CY5A 4GMBA 4GQ2P 3EQ8A 4DNVA 2YNPA 3V4PA 5M5RA 4PSXB 4G56B 4NBMA 1JTDB 3JZHA 2PBIB 2AGWA 4GGDA 2IWFA 4UM8A 3C9CA 4XYIA 2HU5A 4A08B 4J8BA 4FAND 4O45A 3T3MA 2OK6A 5EARA 1N6FA 3RFGA 1QNIA 4ZOXA 3HFQA 5CXCA 3K71A 1UTCA 3T3PA 4BL0A 3K26A 4LGNA 5HQGA 4CI2A 3MMYA 2H9MA 2VDMA 2TRCB 2UZYB 3PE7A 2XU7A 3IJ0A 3MZLA 4Z7QA 4PSWB 1L5GA 3UKRC 1NEXB 3I7OA 3NIDA 3O4GA 3ULEC 1K3IA 4AX4A 3DSMA 3NIGA 4A2MA 3ZDXA 4A09A 4J86A 3UKUC 3UVKA 1A0RB 2I0SA 2OK4A 5SXMA 3U4YA 3PXSD 5GXHA 2BBKH 4L3GD 2OVRB 2CE9A 3EWEA 4JSNC 5TDHB 2VDNA 4O9DA 3PXTD 1ERJA 1VE7A 4QRJA 5FKTA 1VE6A 3GREA 4L9OA 3IUMA 2CN2A 4FA5D 3ZE1A 3CFVA 5IC7A 2HKRA 3P4FA 2YNOA 4U1EI 4Z8LA 2GNQA 5FFGA 4GQBB 4NSXA 4HDJA 5FA5B 5M5TA 3ZDZA 3C5MA 1GOTB 1H2XA 4L1MA 4UM9A 3OL2B 2J56H 2IWKA 4G1MA 3O4HA 5E6UA 5FKRA 3UVOA 2HU8A 5AMSA 3NVXA 1YR2A 4H5IA 2AGLA 4JT5C 5H17A 3MKSB 3MZKA 2EBSA 1JOFA 1K8KC 3I8EA 1O6FA 3AL9A 3MVDK 3JRPA 5AJAA 5HDBA 1C9IA 3EI1A 4J82A 1GOGA 2IUQA 4K3JB 1XIPA 2B5NA 2H6NA 3NVNA 5IJ7E 2AH0A 3JZGA 4Z7OA 5GMKn 5EALA 5EMMB 3IURA 4IRZA 4QL1A 2HU7A 4CZVA 5EMLB 3EU7A 3C99A 4IA9A 2BCJB 2IUVA 3N0EA 4JXMA 4D0KA
chains in the Genus database with same CATH topology
3GC3B 1UTCA 5M61A 5M5TA 5M5VA 1BPOA 5M5UA 4G55A 5M5SA 2XZGA 1C9IA 3GD1I 1C9LA 5M5RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GC3 B;  1UTC A;  5M61 A;  5M5T A;  5M5V A;  1BPO A;  5M5U A;  4G55 A;  5M5S A;  2XZG A;  1C9I A;  3GD1 I;  1C9L A;  5M5R A; 
#chains in the Genus database with same CATH topology
 3AH8 B;  3OF7 A;  4IMM A;  2WQ8 A;  4Y7R A;  3K27 A;  5EAM A;  2Z2P A;  3JZN A;  2PM6 B;  3JB9 L;  2AQ5 A;  5GXI A;  1VZ2 A;  4EWR A;  4MMX A;  3F3G A;  2EIB A;  2XL2 A;  3C75 H;  3RLM D;  4WK2 A;  1N6D A;  4A0B B;  4BCD A;  3PSL A;  3SN6 B;  1PI6 A;  4ERZ A;  3RSE C;  3RMZ D;  4N14 A;  1PGU A;  3DXM C;  1OLZ A;  4CI8 A;  3FRX A;  3EQ9 A;  4X61 B;  2GC7 A;  2EID A;  3KRW B;  3SJL D;  4AN0 A;  2CN3 A;  3ORV D;  5HE3 B;  4J73 A;  4O3U B;  1JJU B;  1MG3 A;  4JD2 C;  1TYE A;  2HJ4 A;  4XEI C;  1O6G A;  1RI6 A;  1TBG A;  3SBQ A;  2QXV A;  5IT9 g;  3EI1 B;  1GOF A;  3OL2 A;  4QT8 A;  4JHN A;  3I7H A;  3V4V A;  3VI4 A;  3JAM g;  5EMJ B;  4FA4 D;  3SCY A;  5C86 A;  2H68 A;  4RE5 A;  3AL8 A;  2QC5 A;  4ERQ A;  4NAA A;  3V9F A;  3SBR A;  5EAP A;  4BH6 A;  3OKT A;  2G9A A;  1E8N A;  5HE0 B;  5A2Q g;  3CFS B;  5CYK B;  4BUJ C;  3IVM A;  4G55 A;  3PVW B;  4JSP C;  3EI2 B;  1Q47 A;  3V7D B;  1QFM A;  3UVL A;  4E5Z B;  4TZ4 A;  5FFO A;  4QAM A;  2I3S A;  2H9L A;  4YVD A;  3N0D A;  3KCI A;  3PXW D;  4A11 A;  2IUR A;  1H2Z A;  5EMK B;  5H14 A;  4ERY A;  2JKX A;  2G99 A;  4PBY A;  2QR5 A;  2P9I C;  4X63 B;  1GP2 B;  4A0A B;  5I5M A;  4AEZ A;  4CI1 A;  2J57 G;  1FWX A;  5M5S A;  2AGZ A;  3FCU A;  2Q7Q A;  3I8C A;  3QHY B;  5HE1 B;  3IIW A;  4A0B A;  3SXT D;  2I3T A;  2HES X;  4WJK A;  4FHL A;  3I7P A;  2GC4 A;  1UOO A;  3PVU B;  2PM9 A;  2IAA A;  3MXX A;  4WK0 A;  4U7A A;  2XL3 A;  3AL8 B;  3F3F A;  3GFC A;  4GQ1 A;  4NC4 A;  5GSA A;  4FA1 D;  2QZP A;  3ZE2 A;  3SLE D;  3K72 A;  1JMX B;  3OKW A;  2P9U C;  1SQJ A;  2XZG A;  4CY2 A;  1UOQ A;  2XE4 A;  3IUL A;  5M5U A;  3RRM C;  2P9P C;  4AMY A;  4O02 A;  4PNK B;  3I89 A;  4CY3 A;  4J84 A;  4JT6 C;  2P9L C;  4GM8 A;  5TF2 A;  1OMW B;  4CI3 A;  4J81 A;  4Y5R D;  3RN0 D;  3FCS A;  4A11 B;  1VYH C;  2O9K A;  4CZX A;  1R5M A;  5CYK A;  5C2W B;  2CO0 C;  2P9S C;  4X3E A;  5C9Z B;  3K6S A;  4OZU A;  3EI2 A;  2CE8 A;  1K32 A;  4E5Z A;  3O4I A;  5FXY A;  4OWR A;  2AGX A;  1JMZ B;  3VH0 A;  4ES0 A;  3I7L A;  4LG8 A;  2B5L A;  2XDW A;  3QI0 A;  3MUN A;  4D9S A;  4QQE A;  4G1E A;  2UZX B;  4X60 B;  5FKS A;  4J79 A;  4FA9 D;  4A0A A;  5HE2 B;  2PM9 B;  2Z2N A;  4WK4 A;  1B9Y A;  2CO0 A;  2H6K A;  3NIF A;  5TEF A;  2H9N A;  1U4C A;  2CNX A;  3UR4 A;  4UI9 R;  4BP9 A;  4J0W A;  2VDQ A;  1E8M A;  1XKS A;  3AFC A;  2XYI A;  1U2V C;  2J55 H;  4FWW A;  4O1Q D;  3RN1 D;  3NVQ A;  4JSX C;  2I0R A;  3A0F A;  4L3H D;  3EI3 A;  3EI4 B;  5K1C C;  2VDR A;  4Z7N A;  1H2Y A;  4CY1 A;  2BKL A;  5C92 A;  5EM2 B;  1E5T A;  3OTT A;  4K3I D;  2VZ3 A;  3O4J A;  2PM7 B;  4J8G A;  5I5I A;  3JRO A;  4PXW A;  3J80 g;  1T2X A;  3OW8 A;  3VI3 A;  2HKM A;  4E54 B;  2H6Q A;  3IKO A;  4JHP C;  3E0C A;  4PC0 A;  3DDU A;  4ZOY A;  3KRX B;  3PSC B;  4D6V A;  2YMU A;  3CIK B;  4ZOZ A;  5IJ8 E;  1MG2 A;  4A2L A;  4BCC A;  3SMR A;  3FGB A;  3SVW D;  4J87 A;  1XHM A;  2YNN A;  2OVQ B;  3JPX A;  4RE6 A;  3ZE0 A;  1TYQ C;  4R7A B;  1C9L A;  2B5M A;  4GM3 A;  2HYE A;  3W15 A;  3BG1 A;  3VGZ A;  3DXK C;  4BP8 A;  5FQD A;  5JWZ A;  2HXC A;  3OKY A;  2P9N C;  3SBP A;  2VDK A;  3I2N A;  2Z2O A;  3I7K A;  2OJY A;  3IUN A;  1I2M B;  3ODT A;  5H1M A;  5M61 A;  1QFS A;  1VZ3 A;  1GXR A;  3BWS A;  3SWS D;  2I0T A;  3IJC A;  4MMZ A;  3L4O D;  3EI3 B;  5KDO B;  4XYH A;  2OIZ A;  5TEE A;  1JV2 A;  1MDA H;  3L4M D;  4FAV D;  2W18 A;  4BCB A;  2H3X A;  3SHF A;  3UVN A;  3BG0 A;  2VDL A;  1U8C A;  2EIC A;  3UVM A;  4J78 A;  5THA A;  5AFU 3;  5I5J A;  4ZN4 A;  3IUJ A;  1GOH A;  3IUQ A;  1A12 A;  4FB1 D;  3RFH A;  3IJE A;  3ZDY A;  4JSV C;  3VA6 A;  5CXB A;  1B9X A;  2OVP B;  3DWL C;  2VC2 A;  3EMH A;  4GZ8 A;  5HYN B;  4MMY A;  3EI4 A;  4ZOV A;  2EIE A;  5CXC B;  5M5V A;  2H13 A;  1H2W A;  5EM2 A;  2IUP A;  4AOW A;  4CC9 A;  1PEV A;  1M1X A;  4AMZ A;  5B4W A;  4J0X A;  3ZWL B;  3MUO A;  4DNU A;  4H5J A;  5E6S A;  4A7J A;  1P22 A;  4A08 A;  2H9P A;  1SHY B;  3GD1 I;  4MK0 B;  4E54 A;  3V5W B;  1GG2 B;  1YFQ A;  1BPO A;  4GGC A;  3DM0 A;  4A09 B;  3EG6 A;  1PBY B;  3F3P A;  5IGQ A;  2VDP A;  3GC3 B;  3OKY B;  4KFM B;  3MKQ A;  2YB8 B;  5K19 A;  3EQ7 A;  2P9K C;  1L0Q A;  1N6E A;  4I79 A;  1NR0 A;  2VZ1 A;  1UOP A;  2H47 A;  2VDO A;  5FKQ A;  3SFZ A;  2AGY A;  5C2V B;  4GM9 A;  3IIY A;  4GGA A;  2H14 A;  3I7N A;  1S4U X;  3IJ1 A;  4O3T B;  4J77 A;  3FM0 A;  4LG9 A;  4O2W A;  2HJB A;  4DNW A;  4NEN A;  4L1Q D;  2YBA A;  4ESG A;  3J81 g;  5FLX g;  5CXB B;  3B7F A;  1SQ9 A;  5E6R A;  2AH1 A;  2B4E A;  2MTA H;  5IGO A;  4CZY A;  4AN1 A;  4PBZ A;  4CY5 A;  4GMB A;  4GQ2 P;  3EQ8 A;  4DNV A;  2YNP A;  3V4P A;  5M5R A;  4PSX B;  4G56 B;  4NBM A;  1JTD B;  3JZH A;  2PBI B;  2AGW A;  4GGD A;  2IWF A;  4UM8 A;  3C9C A;  4XYI A;  2HU5 A;  4A08 B;  4J8B A;  4FAN D;  4O45 A;  3T3M A;  2OK6 A;  5EAR A;  1N6F A;  3RFG A;  1QNI A;  4ZOX A;  3HFQ A;  5CXC A;  3K71 A;  1UTC A;  3T3P A;  4BL0 A;  3K26 A;  4LGN A;  5HQG A;  4CI2 A;  3MMY A;  2H9M A;  2VDM A;  2TRC B;  2UZY B;  3PE7 A;  2XU7 A;  3IJ0 A;  3MZL A;  4Z7Q A;  4PSW B;  1L5G A;  3UKR C;  1NEX B;  3I7O A;  3NID A;  3O4G A;  3ULE C;  1K3I A;  4AX4 A;  3DSM A;  3NIG A;  4A2M A;  3ZDX A;  4A09 A;  4J86 A;  3UKU C;  3UVK A;  1A0R B;  2I0S A;  2OK4 A;  5SXM A;  3U4Y A;  3PXS D;  5GXH A;  2BBK H;  4L3G D;  2OVR B;  2CE9 A;  3EWE A;  4JSN C;  5TDH B;  2VDN A;  4O9D A;  3PXT D;  1ERJ A;  1VE7 A;  4QRJ A;  5FKT A;  1VE6 A;  3GRE A;  4L9O A;  3IUM A;  2CN2 A;  4FA5 D;  3ZE1 A;  3CFV A;  5IC7 A;  2HKR A;  3P4F A;  2YNO A;  4U1E I;  4Z8L A;  2GNQ A;  5FFG A;  4GQB B;  4NSX A;  4HDJ A;  5FA5 B;  5M5T A;  3ZDZ A;  3C5M A;  1GOT B;  1H2X A;  4L1M A;  4UM9 A;  3OL2 B;  2J56 H;  2IWK A;  4G1M A;  3O4H A;  5E6U A;  5FKR A;  3UVO A;  2HU8 A;  5AMS A;  3NVX A;  1YR2 A;  4H5I A;  2AGL A;  4JT5 C;  5H17 A;  3MKS B;  3MZK A;  2EBS A;  1JOF A;  1K8K C;  3I8E A;  1O6F A;  3AL9 A;  3MVD K;  3JRP A;  5AJA A;  5HDB A;  1C9I A;  3EI1 A;  4J82 A;  1GOG A;  2IUQ A;  4K3J B;  1XIP A;  2B5N A;  2H6N A;  3NVN A;  5IJ7 E;  2AH0 A;  3JZG A;  4Z7O A;  5GMK n;  5EAL A;  5EMM B;  3IUR A;  4IRZ A;  4QL1 A;  2HU7 A;  4CZV A;  5EML B;  3EU7 A;  3C99 A;  4IA9 A;  2BCJ B;  2IUV A;  3N0E A;  4JXM A;  4D0K A; 
#chains in the Genus database with same CATH homology
 3GC3 B;  1UTC A;  5M61 A;  5M5T A;  5M5V A;  1BPO A;  5M5U A;  4G55 A;  5M5S A;  2XZG A;  1C9I A;  3GD1 I;  1C9L A;  5M5R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...