4G55A

Clathrin terminal domain complexed with pitstop 2
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
358
structure length
358
Chain Sequence
b'FMAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Clathrin heavy chain 1
molecule tags Endocytosis
source organism Homo sapiens
publication title Role of the clathrin terminal domain in regulating coated pit dynamics revealed by small molecule inhibition.
pubmed doi rcsb
total genus 76
structure length 358
sequence length 358
ec nomenclature
pdb deposition date 2012-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01394 Clathrin_propel Clathrin propeller repeat
A PF09268 Clathrin-link Clathrin, heavy-chain linker
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.110 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Clathrin heavy-chain terminal domain 4g55A00
5M61A 4G55A 1UTCA 2XZGA 5M5VA 3GD1I 1BPOA 5M5SA 5M5UA 3GC3B 5M5TA 5M5RA 1C9IA 1C9LA
chains in the Genus database with same CATH superfamily
3UVMA 2CO0A 1FWXA 3EWEA 3ZWLB 1JTDB 3EMHA 3OKYA 4BP9A 3IUMA 3RSEC 4CI1A 5I5IA 2P9PC 1UTCA 3MUOA 1GOHA 4CZYA 4CI3A 3QHYB 4FHLA 2OJYA 4J79A 2B4EA 4GQ2P 3IUJA 3B7FA 5GMKn 2PM9B 5FQDA 2XYIA 3I7NA 5JWZA 4ZOXA 5EARA 2H3XA 4A08B 2OVPB 3FCUA 1GP2B 2GC4A 2YB8B 1RI6A 3O4GA 2AGXA 4BCDA 3EI1B 1QNIA 4PC0A 3J81g 4ZOYA 5A2Qg 3IJ1A 3RMZD 2EBSA 2HXCA 4UM9A 3V5WB 4E5ZA 1Q47A 3VH0A 2AH0A 2WQ8A 3DXKC 5IGOA 3K72A 1VYHC 4AN0A 1O6GA 3IVMA 5TF2A 4JD2C 3V7DB 4FA9D 2CNXA 3MMYA 1GOFA 3MKQA 2P9UC 4R7AB 2H68A 5CXCA 4CI8A 3ZE2A 1O6FA 3EU7A 2YNNA 5FFGA 3OL2B 3FGBA 3IIYA 3SWSD 4TZ4A 4PSXB 1N6FA 2B5MA 2H9PA 4XYIA 2H9NA 4AX4A 5GSAA 1UOPA 3U4YA 4DNVA 3ORVD 3QI0A 4H5IA 3V4PA 1B9YA 3IJ0A 3MZLA 3I7HA 1TYQC 5CXBB 3DSMA 2PM7B 2BCJB 3L4OD 3SHFA 1SHYB 4NSXA 2JKXA 4A11A 3AL8B 4KFMB 4G1EA 4DNWA 4D0KA 2VZ1A 3SVWD 5EMMB 3T3PA 1C9IA 1PI6A 2HU5A 1A0RB 3VI4A 1E8MA 3BG1A 4JSVC 5C2WB 3EQ9A 3I2NA 4AMYA 5K1CC 5C86A 5HE0B 3PVUB 3I7OA 2PM6B 3KRWB 5IJ8E 3SXTD 4PNKB 3EI4B 1E5TA 2P9KC 2HYEA 4X60B 1JMXB 3SBRA 2OVRB 3O4IA 5AFU3 5HE3B 4J77A 5H17A 4ZN4A 4RE5A 3JZHA 3SCYA 1JJUB 2H9LA 2VZ3A 1H2YA 4L3HD 1PEVA 1VE6A 3EI2B 3RLMD 2H14A 3CIKB 3RFHA 2J57G 2IUVA 4J84A 4CC9A 2P9IC 3RRMC 2Z2NA 5C2VB 4A09B 3UVLA 3EI3A 1XKSA 2HU7A 4A2LA 4FA1D 5FFOA 1MG2A 2Z2OA 5FKTA 3UR4A 4QRJA 3GC3B 4JT5C 3A0FA 1H2WA 4OZUA 4EWRA 3NIDA 3F3FA 4IA9A 4BCBA 4CZVA 4U7AA 4Z8LA 1VZ2A 4J81A 5I5JA 3DWLC 4A0AA 4QT8A 4J73A 4AMZA 2G9AA 3C9CA 4J78A 3IUQA 1OMWB 4GMBA 4PBZA 1TYEA 3OKTA 5EM2B 1GOGA 2I0TA 3UVKA 3J80g 5IC7A 1TBGA 3I8CA 3NIFA 3VI3A 4CY5A 2QZPA 2VC2A 2YNOA 5B4WA 2XL2A 5CXCB 1A12A 3JZGA 3RFGA 3RN0D 2P9LC 4D6VA 3PE7A 2H6NA 3PSCB 4BL0A 5E6SA 1MDAH 3SJLD 4J0WA 2AGWA 4J82A 3MZKA 4WK4A 3NVQA 4BP8A 3ULEC 3W15A 3CFSB 3FM0A 3MXXA 3IJEA 4LG8A 5CYKA 3NVXA 2VDKA 5GXHA 2BBKH 1PGUA 2HJBA 1L5GA 4LGNA 1GOTB 4HDJA 3K26A 2OIZA 5IGQA 2H6KA 3ZDYA 2EIBA 4NENA 3OF7A 1R5MA 4XEIC 3I7LA 3AH8B 3PXWD 2IUQA 3AFCA 2AGYA 2MTAH 4A0BA 3V9FA 3HFQA 4ESGA 2H13A 1P22A 4GM9A 1QFSA 1BPOA 3I89A 5IJ7E 3BWSA 5AJAA 5FXYA 4IMMA 5M5SA 4ES0A 4K3JB 4X61B 4AN1A 4E54A 4GGDA 3O4HA 3K71A 3PSLA 3SN6B 3JB9L 3ODTA 4O45A 3GREA 4JSPC 2QC5A 3JROA 1U4CA 5E6UA 1K3IA 1U8CA 3MKSB 5HE1B 2I3SA 1B9XA 3K6SA 3EI2A 1JV2A 3OKYB 2VDLA 5TEEA 3SLED 3P4FA 1JMZB 2CE8A 4ERZA 4AEZA 4N14A 3AL8A 3K27A 3RN1D 4QQEA 3N0EA 5HDBA 4NC4A 4O3TB 2GNQA 4QL1A 5HYNB 1U2VC 2PM9A 4ERQA 3AL9A 5EMKB 2J56H 3UKUC 2AGZA 3EQ8A 3F3PA 1H2XA 4GQ1A 1GG2B 3N0DA 2YNPA 2I3TA 5EMLB 1JOFA 4AOWA 4Z7NA 3L4MD 1K8KC 2CE9A 4J8BA 4FAVD 4A11B 3MUNA 2GC7A 2I0SA 3IUNA 2VDOA 2H9MA 5EAPA 4A08A 4J0XA 4GGAA 3O4JA 5EAMA 4PXWA 5CXBA 1OLZA 4JSXC 4E5ZB 2O9KA 2VDMA 2OVQB 2AQ5A 2AH1A 2VDPA 4X63B 4ZOZA 2W18A 4U1EI 3OL2A 3KCIA 3SMRA 4CY1A 3DXMC 4L1MA 2CO0C 5K19A 2Z2PA 4D9SA 4A09A 2OK6A 4GM8A 3JRPA 3IURA 3OKWA 2IWFA 4NBMA 1ERJA 3F3GA 4JHPC 4XYHA 3NIGA 1UOOA 4ERYA 5FLXg 4J8GA 4CZXA 4L3GD 2IURA 3E0CA 4GGCA 4I79A 1N6DA 1M1XA 4G55A 2HESX 5FKQA 2TRCB 3C75H 2AGLA 1C9LA 5FKSA 1VZ3A 4O9DA 2IWKA 5C9ZB 5CYKB 4A7JA 4A2MA 4A0AB 5TDHB 2H47A 3IIWA 4O3UB 1S4UX 1SQ9A 4FAND 1T2XA 3JPXA 4JSNC 1E8NA 1XHMA 3EG6A 4ZOVA 4UI9R 3IULA 2CN3A 4WK2A 4MMXA 5EM2A 5TEFA 4MMZA 3NVNA 2P9NC 4OWRA 3I7PA 3EI4A 4GQBB 4JXMA 5FKRA 4G1MA 2B5LA 3UVOA 3VGZA 4BCCA 4Z7QA 2XE4A 5KDOB 3MVDK 4WK0A 2HKMA 3EQ7A 2OK4A 4A0BB 2XL3A 4GZ8A 5FA5B 5HQGA 4L1QD 2P9SC 2IAAA 3OW8A 3VA6A 3FRXA 2IUPA 3IKOA 4O2WA 4X3EA 1NEXB 3EI1A 4O02A 2XZGA 5H14A 2HU8A 3C5MA 4Y5RD 2HKRA 3BG0A 3SFZA 2PBIB 1NR0A 1N6EA 2EICA 2VDQA 3C99A 2VDRA 5I5MA 2CN2A 2QXVA 4RE6A 5AMSA 4JHNA 4MMYA 3UKRC 5EMJB 2VDNA 5EALA 4Z7OA 1PBYB 3PXTD 4CY2A 4Y7RA 1L0QA 4FA4D 2YMUA 4BH6A 2B5NA 3EI3B 4G56B 3GD1I 4K3ID 4CI2A 5M5RA 2G99A 3V4VA 4BUJC 4NAAA 5E6RA 3OTTA 1K32A 2UZYB 2I0RA 5GXIA 3I8EA 2UZXB 3KRXB 4DNUA 1YR2A 4H5JA 4PSWB 5M5TA 4IRZA 2Q7QA 4FB1D 4YVDA 4FA5D 3PVWB 3ZE1A 5IT9g 1MG3A 4GM3A 5THAA 4FWWA 3JZNA 3IJCA 5M61A 5H1MA 2XDWA 3SBPA 4CY3A 1XIPA 2QR5A 5C92A 5SXMA 3DDUA 2XU7A 1H2ZA 1QFMA 2YBAA 3ZE0A 4MK0B 3UVNA 2EIDA 1UOQA 2EIEA 2BKLA 4L9OA 1I2MB 3DM0A 4J87A 3T3MA 4JT6C 1YFQA 4PBYA 4J86A 5M5VA 3ZDZA 3ZDXA 2J55H 3JAMg 3FCSA 4LG9A 4WJKA 3GFCA 5M5UA 4O1QD 5HE2B 1SQJA 3PXSD 4QAMA 2H6QA 3I7KA 2HJ4A 4E54B 1VE7A 4UM8A 3CFVA 1GXRA 3SBQA
chains in the Genus database with same CATH topology
5M61A 4G55A 1UTCA 2XZGA 5M5VA 3GD1I 1BPOA 5M5SA 5M5UA 3GC3B 5M5TA 5M5RA 1C9IA 1C9LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M61 A;  4G55 A;  1UTC A;  2XZG A;  5M5V A;  3GD1 I;  1BPO A;  5M5S A;  5M5U A;  3GC3 B;  5M5T A;  5M5R A;  1C9I A;  1C9L A; 
#chains in the Genus database with same CATH topology
 3UVM A;  2CO0 A;  1FWX A;  3EWE A;  3ZWL B;  1JTD B;  3EMH A;  3OKY A;  4BP9 A;  3IUM A;  3RSE C;  4CI1 A;  5I5I A;  2P9P C;  1UTC A;  3MUO A;  1GOH A;  4CZY A;  4CI3 A;  3QHY B;  4FHL A;  2OJY A;  4J79 A;  2B4E A;  4GQ2 P;  3IUJ A;  3B7F A;  5GMK n;  2PM9 B;  5FQD A;  2XYI A;  3I7N A;  5JWZ A;  4ZOX A;  5EAR A;  2H3X A;  4A08 B;  2OVP B;  3FCU A;  1GP2 B;  2GC4 A;  2YB8 B;  1RI6 A;  3O4G A;  2AGX A;  4BCD A;  3EI1 B;  1QNI A;  4PC0 A;  3J81 g;  4ZOY A;  5A2Q g;  3IJ1 A;  3RMZ D;  2EBS A;  2HXC A;  4UM9 A;  3V5W B;  4E5Z A;  1Q47 A;  3VH0 A;  2AH0 A;  2WQ8 A;  3DXK C;  5IGO A;  3K72 A;  1VYH C;  4AN0 A;  1O6G A;  3IVM A;  5TF2 A;  4JD2 C;  3V7D B;  4FA9 D;  2CNX A;  3MMY A;  1GOF A;  3MKQ A;  2P9U C;  4R7A B;  2H68 A;  5CXC A;  4CI8 A;  3ZE2 A;  1O6F A;  3EU7 A;  2YNN A;  5FFG A;  3OL2 B;  3FGB A;  3IIY A;  3SWS D;  4TZ4 A;  4PSX B;  1N6F A;  2B5M A;  2H9P A;  4XYI A;  2H9N A;  4AX4 A;  5GSA A;  1UOP A;  3U4Y A;  4DNV A;  3ORV D;  3QI0 A;  4H5I A;  3V4P A;  1B9Y A;  3IJ0 A;  3MZL A;  3I7H A;  1TYQ C;  5CXB B;  3DSM A;  2PM7 B;  2BCJ B;  3L4O D;  3SHF A;  1SHY B;  4NSX A;  2JKX A;  4A11 A;  3AL8 B;  4KFM B;  4G1E A;  4DNW A;  4D0K A;  2VZ1 A;  3SVW D;  5EMM B;  3T3P A;  1C9I A;  1PI6 A;  2HU5 A;  1A0R B;  3VI4 A;  1E8M A;  3BG1 A;  4JSV C;  5C2W B;  3EQ9 A;  3I2N A;  4AMY A;  5K1C C;  5C86 A;  5HE0 B;  3PVU B;  3I7O A;  2PM6 B;  3KRW B;  5IJ8 E;  3SXT D;  4PNK B;  3EI4 B;  1E5T A;  2P9K C;  2HYE A;  4X60 B;  1JMX B;  3SBR A;  2OVR B;  3O4I A;  5AFU 3;  5HE3 B;  4J77 A;  5H17 A;  4ZN4 A;  4RE5 A;  3JZH A;  3SCY A;  1JJU B;  2H9L A;  2VZ3 A;  1H2Y A;  4L3H D;  1PEV A;  1VE6 A;  3EI2 B;  3RLM D;  2H14 A;  3CIK B;  3RFH A;  2J57 G;  2IUV A;  4J84 A;  4CC9 A;  2P9I C;  3RRM C;  2Z2N A;  5C2V B;  4A09 B;  3UVL A;  3EI3 A;  1XKS A;  2HU7 A;  4A2L A;  4FA1 D;  5FFO A;  1MG2 A;  2Z2O A;  5FKT A;  3UR4 A;  4QRJ A;  3GC3 B;  4JT5 C;  3A0F A;  1H2W A;  4OZU A;  4EWR A;  3NID A;  3F3F A;  4IA9 A;  4BCB A;  4CZV A;  4U7A A;  4Z8L A;  1VZ2 A;  4J81 A;  5I5J A;  3DWL C;  4A0A A;  4QT8 A;  4J73 A;  4AMZ A;  2G9A A;  3C9C A;  4J78 A;  3IUQ A;  1OMW B;  4GMB A;  4PBZ A;  1TYE A;  3OKT A;  5EM2 B;  1GOG A;  2I0T A;  3UVK A;  3J80 g;  5IC7 A;  1TBG A;  3I8C A;  3NIF A;  3VI3 A;  4CY5 A;  2QZP A;  2VC2 A;  2YNO A;  5B4W A;  2XL2 A;  5CXC B;  1A12 A;  3JZG A;  3RFG A;  3RN0 D;  2P9L C;  4D6V A;  3PE7 A;  2H6N A;  3PSC B;  4BL0 A;  5E6S A;  1MDA H;  3SJL D;  4J0W A;  2AGW A;  4J82 A;  3MZK A;  4WK4 A;  3NVQ A;  4BP8 A;  3ULE C;  3W15 A;  3CFS B;  3FM0 A;  3MXX A;  3IJE A;  4LG8 A;  5CYK A;  3NVX A;  2VDK A;  5GXH A;  2BBK H;  1PGU A;  2HJB A;  1L5G A;  4LGN A;  1GOT B;  4HDJ A;  3K26 A;  2OIZ A;  5IGQ A;  2H6K A;  3ZDY A;  2EIB A;  4NEN A;  3OF7 A;  1R5M A;  4XEI C;  3I7L A;  3AH8 B;  3PXW D;  2IUQ A;  3AFC A;  2AGY A;  2MTA H;  4A0B A;  3V9F A;  3HFQ A;  4ESG A;  2H13 A;  1P22 A;  4GM9 A;  1QFS A;  1BPO A;  3I89 A;  5IJ7 E;  3BWS A;  5AJA A;  5FXY A;  4IMM A;  5M5S A;  4ES0 A;  4K3J B;  4X61 B;  4AN1 A;  4E54 A;  4GGD A;  3O4H A;  3K71 A;  3PSL A;  3SN6 B;  3JB9 L;  3ODT A;  4O45 A;  3GRE A;  4JSP C;  2QC5 A;  3JRO A;  1U4C A;  5E6U A;  1K3I A;  1U8C A;  3MKS B;  5HE1 B;  2I3S A;  1B9X A;  3K6S A;  3EI2 A;  1JV2 A;  3OKY B;  2VDL A;  5TEE A;  3SLE D;  3P4F A;  1JMZ B;  2CE8 A;  4ERZ A;  4AEZ A;  4N14 A;  3AL8 A;  3K27 A;  3RN1 D;  4QQE A;  3N0E A;  5HDB A;  4NC4 A;  4O3T B;  2GNQ A;  4QL1 A;  5HYN B;  1U2V C;  2PM9 A;  4ERQ A;  3AL9 A;  5EMK B;  2J56 H;  3UKU C;  2AGZ A;  3EQ8 A;  3F3P A;  1H2X A;  4GQ1 A;  1GG2 B;  3N0D A;  2YNP A;  2I3T A;  5EML B;  1JOF A;  4AOW A;  4Z7N A;  3L4M D;  1K8K C;  2CE9 A;  4J8B A;  4FAV D;  4A11 B;  3MUN A;  2GC7 A;  2I0S A;  3IUN A;  2VDO A;  2H9M A;  5EAP A;  4A08 A;  4J0X A;  4GGA A;  3O4J A;  5EAM A;  4PXW A;  5CXB A;  1OLZ A;  4JSX C;  4E5Z B;  2O9K A;  2VDM A;  2OVQ B;  2AQ5 A;  2AH1 A;  2VDP A;  4X63 B;  4ZOZ A;  2W18 A;  4U1E I;  3OL2 A;  3KCI A;  3SMR A;  4CY1 A;  3DXM C;  4L1M A;  2CO0 C;  5K19 A;  2Z2P A;  4D9S A;  4A09 A;  2OK6 A;  4GM8 A;  3JRP A;  3IUR A;  3OKW A;  2IWF A;  4NBM A;  1ERJ A;  3F3G A;  4JHP C;  4XYH A;  3NIG A;  1UOO A;  4ERY A;  5FLX g;  4J8G A;  4CZX A;  4L3G D;  2IUR A;  3E0C A;  4GGC A;  4I79 A;  1N6D A;  1M1X A;  4G55 A;  2HES X;  5FKQ A;  2TRC B;  3C75 H;  2AGL A;  1C9L A;  5FKS A;  1VZ3 A;  4O9D A;  2IWK A;  5C9Z B;  5CYK B;  4A7J A;  4A2M A;  4A0A B;  5TDH B;  2H47 A;  3IIW A;  4O3U B;  1S4U X;  1SQ9 A;  4FAN D;  1T2X A;  3JPX A;  4JSN C;  1E8N A;  1XHM A;  3EG6 A;  4ZOV A;  4UI9 R;  3IUL A;  2CN3 A;  4WK2 A;  4MMX A;  5EM2 A;  5TEF A;  4MMZ A;  3NVN A;  2P9N C;  4OWR A;  3I7P A;  3EI4 A;  4GQB B;  4JXM A;  5FKR A;  4G1M A;  2B5L A;  3UVO A;  3VGZ A;  4BCC A;  4Z7Q A;  2XE4 A;  5KDO B;  3MVD K;  4WK0 A;  2HKM A;  3EQ7 A;  2OK4 A;  4A0B B;  2XL3 A;  4GZ8 A;  5FA5 B;  5HQG A;  4L1Q D;  2P9S C;  2IAA A;  3OW8 A;  3VA6 A;  3FRX A;  2IUP A;  3IKO A;  4O2W A;  4X3E A;  1NEX B;  3EI1 A;  4O02 A;  2XZG A;  5H14 A;  2HU8 A;  3C5M A;  4Y5R D;  2HKR A;  3BG0 A;  3SFZ A;  2PBI B;  1NR0 A;  1N6E A;  2EIC A;  2VDQ A;  3C99 A;  2VDR A;  5I5M A;  2CN2 A;  2QXV A;  4RE6 A;  5AMS A;  4JHN A;  4MMY A;  3UKR C;  5EMJ B;  2VDN A;  5EAL A;  4Z7O A;  1PBY B;  3PXT D;  4CY2 A;  4Y7R A;  1L0Q A;  4FA4 D;  2YMU A;  4BH6 A;  2B5N A;  3EI3 B;  4G56 B;  3GD1 I;  4K3I D;  4CI2 A;  5M5R A;  2G99 A;  3V4V A;  4BUJ C;  4NAA A;  5E6R A;  3OTT A;  1K32 A;  2UZY B;  2I0R A;  5GXI A;  3I8E A;  2UZX B;  3KRX B;  4DNU A;  1YR2 A;  4H5J A;  4PSW B;  5M5T A;  4IRZ A;  2Q7Q A;  4FB1 D;  4YVD A;  4FA5 D;  3PVW B;  3ZE1 A;  5IT9 g;  1MG3 A;  4GM3 A;  5THA A;  4FWW A;  3JZN A;  3IJC A;  5M61 A;  5H1M A;  2XDW A;  3SBP A;  4CY3 A;  1XIP A;  2QR5 A;  5C92 A;  5SXM A;  3DDU A;  2XU7 A;  1H2Z A;  1QFM A;  2YBA A;  3ZE0 A;  4MK0 B;  3UVN A;  2EID A;  1UOQ A;  2EIE A;  2BKL A;  4L9O A;  1I2M B;  3DM0 A;  4J87 A;  3T3M A;  4JT6 C;  1YFQ A;  4PBY A;  4J86 A;  5M5V A;  3ZDZ A;  3ZDX A;  2J55 H;  3JAM g;  3FCS A;  4LG9 A;  4WJK A;  3GFC A;  5M5U A;  4O1Q D;  5HE2 B;  1SQJ A;  3PXS D;  4QAM A;  2H6Q A;  3I7K A;  2HJ4 A;  4E54 B;  1VE7 A;  4UM8 A;  3CFV A;  1GXR A;  3SBQ A; 
#chains in the Genus database with same CATH homology
 5M61 A;  4G55 A;  1UTC A;  2XZG A;  5M5V A;  3GD1 I;  1BPO A;  5M5S A;  5M5U A;  3GC3 B;  5M5T A;  5M5R A;  1C9I A;  1C9L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...