4G55A

Clathrin terminal domain complexed with pitstop 2
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
358
structure length
358
Chain Sequence
FMAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Clathrin heavy chain 1
publication title Role of the clathrin terminal domain in regulating coated pit dynamics revealed by small molecule inhibition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Endocytosis
total genus 76
structure length 358
sequence length 358
ec nomenclature
pdb deposition date 2012-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01394 Clathrin_propel Clathrin propeller repeat
A PF09268 Clathrin-link Clathrin, heavy-chain linker
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.110 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Clathrin heavy-chain terminal domain 4g55A00
2XZGA 1UTCA 4G55A 3GD1I 5M61A 5M5RA 5M5SA 1C9LA 1BPOA 5M5TA 5M5UA 3GC3B 1C9IA 5M5VA
chains in the Genus database with same CATH superfamily
3SBQA 2P9PC 5FFGA 4BL0A 2VDOA 3U4YA 5FKQA 4YVDA 3DXKC 3EU7A 5HDBA 1PGUA 2P9UC 4A08A 3JZGA 4ERYA 4GGCA 3P4FA 3I7HA 2B4EA 4NSXA 2XYIA 1E8NA 2BCJB 4CC9A 5TEFA 3NVNA 5GSAA 1VYHC 2VDMA 3IULA 2CO0C 2JKXA 3KRXB 4A2MA 3DM0A 3NIFA 3MVDK 2QXVA 3ZE0A 2H9PA 2IWFA 4E5ZA 1E5TA 4L3GD 5THAA 4L3HD 4K3ID 4OWRA 4NC4A 3CIKB 4LG8A 3EI3B 4L9OA 1H2WA 3SMRA 4J0WA 4GZ8A 4WK2A 2MTAH 2XL2A 2I0RA 3QI0A 5H17A 2QC5A 3IIWA 4AMYA 3I7KA 4J8BA 4HDJA 2YMUA 4LG9A 3SCYA 4JT6C 2H13A 1UOQA 4UM8A 3UVMA 1A12A 4MK0B 3RFHA 4O2WA 4BP8A 3C99A 3ZE1A 3N0EA 4O3UB 2J57G 2YBAA 3JPXA 4A0AA 1UOOA 2P9SC 3J80g 3GC3B 3I8EA 1U2VC 2VDRA 3RN1D 2IURA 3PSCB 2AGZA 1FWXA 1QNIA 4WJKA 4Z7OA 2P9KC 3UVLA 3OL2A 4FAVD 3IJCA 2EIDA 4BCDA 5EM2B 4A11A 2HYEA 2UZYB 3IJEA 2OJYA 4WK4A 2UZXB 4O1QD 5AMSA 3ZDYA 1A0RB 5AJAA 2VDKA 3V7DB 3C75H 5C86A 1OLZA 2HKMA 3MKSB 3IUNA 5C92A 1VZ3A 1MDAH 1RI6A 3O4IA 2XE4A 4FWWA 4JHPC 2GC4A 1GOFA 4XEIC 3NVQA 3FGBA 4J77A 4BUJC 2XDWA 4GM3A 3I89A 4FB1D 1JOFA 4J73A 5FQDA 3E0CA 1UOPA 3QHYB 4A08B 3SWSD 1GOHA 4PSWB 2Q7QA 4Y5RD 1XIPA 2H6QA 2H47A 2VZ1A 3SLED 5FA5B 5C2VB 3RRMC 3BG0A 4D9SA 4FHLA 1JMZB 3F3GA 3IKOA 5E6SA 5FFOA 1S4UX 3L4OD 1BPOA 2AH1A 5K1CC 3AH8B 2I0SA 5EAPA 4ERZA 1N6EA 2P9NC 4J84A 3I7OA 1K32A 3IUJA 1T2XA 3O4GA 4ZOYA 5CYKA 5HE0B 3C5MA 4BH6A 5C2WB 5IC7A 3PVUB 3O4HA 3NIGA 3OKWA 2H6KA 5E6UA 4FA4D 2YNNA 4IRZA 4MMXA 5CXCB 4ESGA 2H9NA 3V5WB 2J55H 3C9CA 3ZDZA 4OZUA 5GXHA 4A0AB 3EQ7A 2EIBA 3F3FA 1TYEA 2H68A 4G1EA 2IUVA 2PBIB 4O45A 5B4WA 4R7AB 4ZN4A 4X3EA 5FXYA 2CNXA 3OL2B 4E54A 3SBRA 2AGXA 3CFVA 2AH0A 4A11B 4AN1A 5I5IA 3IJ0A 4D0KA 3N0DA 3W15A 3OKTA 2IAAA 3GREA 5M5TA 4A09A 3EG6A 1YFQA 5KDOB 5HE1B 1MG3A 4EWRA 2P9IC 2CE8A 4JSXC 3T3PA 3ULEC 4J86A 4NAAA 2H9LA 2XU7A 3AFCA 3UKRC 3JROA 4G55A 5IGOA 3V9FA 3SXTD 4GQ1A 1SQJA 3V4PA 4NBMA 5K19A 3VH0A 4D6VA 3KRWB 5CXCA 3UVNA 3PSLA 2OVQB 4ZOZA 3EWEA 2CO0A 2W18A 3UKUC 5CXBB 5M5UA 2Z2PA 4UM9A 3IUQA 3VA6A 5JWZA 5SXMA 3ZE2A 3NIDA 4CI8A 2H6NA 3FRXA 2PM7B 2YNPA 5I5JA 3RFGA 3ZDXA 3OW8A 4JSVC 2G99A 5A2Qg 3OKYA 4CI2A 1TBGA 3JZNA 4J8GA 5IJ7E 5HE2B 2I3SA 4JSNC 3F3PA 2H14A 3KCIA 4U1EI 5CYKB 2HU7A 4ZOXA 5H1MA 4GMBA 1MG2A 2HU8A 2PM6B 1B9YA 2OIZA 3MKQA 3MZKA 4ERQA 2AGLA 1OMWB 5H14A 4IMMA 3FCSA 2HKRA 2VDQA 2IUPA 3PVWB 4G56B 2VZ3A 5EAMA 4GGDA 3PXWD 3VGZA 3I2NA 3IURA 5E6RA 2VDLA 4L1MA 2VDNA 4J0XA 1UTCA 2HJ4A 2AQ5A 3EI2A 1NR0A 3IIYA 4J79A 1P22A 1VE7A 4UI9R 4Z7QA 5CXBA 2BBKH 4FA5D 4RE5A 2HJBA 1QFMA 4J78A 4O9DA 5FLXg 4MMYA 3SVWD 4O3TB 4E54B 1C9LA 4CZVA 2CN3A 4A0BA 3AL9A 3JZHA 4FAND 3MUNA 1VE6A 3EMHA 3GD1I 3I8CA 2AGYA 4A09B 3UVOA 3EQ9A 2H3XA 2I3TA 5EMMB 2VC2A 1L5GA 2G9AA 5M5SA 4K3JB 2GC7A 5GXIA 5FKSA 2XZGA 5C9ZB 3SJLD 2OK4A 4AN0A 1JJUB 4FA1D 3MUOA 2H9MA 1SQ9A 2EICA 5I5MA 4BCBA 1H2YA 4GQ2P 1QFSA 4L1QD 4JT5C 4PBZA 2Z2NA 4XYHA 3EI4A 5IGQA 2CN2A 3UR4A 1JV2A 3IVMA 5HYNB 4GM9A 1K8KC 1N6DA 2QR5A 1TYQC 3DDUA 3DWLC 3EI1A 1H2ZA 3OKYB 2B5LA 4XYIA 4LGNA 4BCCA 4CI3A 3AL8A 5GMKn 3K72A 3SBPA 3DXMC 2EBSA 2BKLA 3BWSA 1ERJA 2P9LC 3GFCA 2Z2OA 4PC0A 1U4CA 3PXSD 4MMZA 3PE7A 4AOWA 3MZLA 4U7AA 2PM9A 2I0TA 3JAMg 3I7NA 1U8CA 5FKRA 5EMJB 2J56H 2HU5A 1VZ2A 4H5IA 4QAMA 4CY1A 3FM0A 2WQ8A 3HFQA 1H2XA 4ZOVA 4PNKB 4CY5A 4A2LA 4AMZA 3RSEC 4DNVA 2VDPA 3EI2B 1GOGA 4PBYA 3MMYA 3SFZA 3B7FA 5TDHB 3VI4A 3L4MD 3RMZD 2HESX 3JB9L 4DNWA 5EALA 5TEEA 4IA9A 1R5MA 4A0BB 4Y7RA 4G1MA 3IUMA 1GOTB 4JHNA 1O6GA 4GQBB 2OVRB 1PEVA 2GNQA 5TF2A 3SHFA 2OVPB 2HXCA 1GP2B 4Z8LA 3A0FA 3DSMA 4KFMB 2IWKA 2XL3A 3CFSB 4X61B 3PXTD 1YR2A 4QL1A 4PXWA 1GXRA 1PI6A 4DNUA 2QZPA 4CZXA 4AEZA 1C9IA 5FKTA 1M1XA 4CY3A 3K6SA 4TZ4A 5EMLB 1O6FA 5HQGA 3EI4B 3OTTA 3RLMD 1PBYB 3ORVD 1XKSA 4J87A 3VI3A 1JTDB 3I7PA 4O02A 3I7LA 4QQEA 5M5RA 4BP9A 4FA9D 3ODTA 3JRPA 3RN0D 1I2MB 4NENA 3T3MA 4AX4A 4X60B 4QT8A 3EI3A 3NVXA 2AGWA 4A7JA 3EI1B 3IJ1A 1K3IA 3K71A 2O9KA 1SHYB 1XHMA 5IT9g 4GM8A 3K26A 4PSXB 4N14A 4J81A 1Q47A 3AL8B 3UVKA 4RE6A 3J81g 2TRCB 3EQ8A 4CZYA 5IJ8E 3MXXA 4ES0A 2B5MA 4JSPC 5M5VA 1L0QA 5HE3B 1JMXB 1GG2B 4CI1A 4H5JA 4Z7NA 3ZWLB 4GGAA 2YB8B 2PM9B 1NEXB 2YNOA 4CY2A 3V4VA 3FCUA 5EMKB 3O4JA 4JXMA 2B5NA 5AFU3 1E8MA 4J82A 2CE9A 3SN6B 2IUQA 5EM2A 4E5ZB 2EIEA 1B9XA 3K27A 3BG1A 2OK6A 1N6FA 5M61A 3OF7A 4X63B 4I79A 4WK0A 4JD2C 4QRJA 5EARA
chains in the Genus database with same CATH topology
2XZGA 1UTCA 4G55A 3GD1I 5M61A 5M5RA 5M5SA 1C9LA 1BPOA 5M5TA 5M5UA 3GC3B 1C9IA 5M5VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XZG A;  1UTC A;  4G55 A;  3GD1 I;  5M61 A;  5M5R A;  5M5S A;  1C9L A;  1BPO A;  5M5T A;  5M5U A;  3GC3 B;  1C9I A;  5M5V A; 
#chains in the Genus database with same CATH topology
 3SBQ A;  2P9P C;  5FFG A;  4BL0 A;  2VDO A;  3U4Y A;  5FKQ A;  4YVD A;  3DXK C;  3EU7 A;  5HDB A;  1PGU A;  2P9U C;  4A08 A;  3JZG A;  4ERY A;  4GGC A;  3P4F A;  3I7H A;  2B4E A;  4NSX A;  2XYI A;  1E8N A;  2BCJ B;  4CC9 A;  5TEF A;  3NVN A;  5GSA A;  1VYH C;  2VDM A;  3IUL A;  2CO0 C;  2JKX A;  3KRX B;  4A2M A;  3DM0 A;  3NIF A;  3MVD K;  2QXV A;  3ZE0 A;  2H9P A;  2IWF A;  4E5Z A;  1E5T A;  4L3G D;  5THA A;  4L3H D;  4K3I D;  4OWR A;  4NC4 A;  3CIK B;  4LG8 A;  3EI3 B;  4L9O A;  1H2W A;  3SMR A;  4J0W A;  4GZ8 A;  4WK2 A;  2MTA H;  2XL2 A;  2I0R A;  3QI0 A;  5H17 A;  2QC5 A;  3IIW A;  4AMY A;  3I7K A;  4J8B A;  4HDJ A;  2YMU A;  4LG9 A;  3SCY A;  4JT6 C;  2H13 A;  1UOQ A;  4UM8 A;  3UVM A;  1A12 A;  4MK0 B;  3RFH A;  4O2W A;  4BP8 A;  3C99 A;  3ZE1 A;  3N0E A;  4O3U B;  2J57 G;  2YBA A;  3JPX A;  4A0A A;  1UOO A;  2P9S C;  3J80 g;  3GC3 B;  3I8E A;  1U2V C;  2VDR A;  3RN1 D;  2IUR A;  3PSC B;  2AGZ A;  1FWX A;  1QNI A;  4WJK A;  4Z7O A;  2P9K C;  3UVL A;  3OL2 A;  4FAV D;  3IJC A;  2EID A;  4BCD A;  5EM2 B;  4A11 A;  2HYE A;  2UZY B;  3IJE A;  2OJY A;  4WK4 A;  2UZX B;  4O1Q D;  5AMS A;  3ZDY A;  1A0R B;  5AJA A;  2VDK A;  3V7D B;  3C75 H;  5C86 A;  1OLZ A;  2HKM A;  3MKS B;  3IUN A;  5C92 A;  1VZ3 A;  1MDA H;  1RI6 A;  3O4I A;  2XE4 A;  4FWW A;  4JHP C;  2GC4 A;  1GOF A;  4XEI C;  3NVQ A;  3FGB A;  4J77 A;  4BUJ C;  2XDW A;  4GM3 A;  3I89 A;  4FB1 D;  1JOF A;  4J73 A;  5FQD A;  3E0C A;  1UOP A;  3QHY B;  4A08 B;  3SWS D;  1GOH A;  4PSW B;  2Q7Q A;  4Y5R D;  1XIP A;  2H6Q A;  2H47 A;  2VZ1 A;  3SLE D;  5FA5 B;  5C2V B;  3RRM C;  3BG0 A;  4D9S A;  4FHL A;  1JMZ B;  3F3G A;  3IKO A;  5E6S A;  5FFO A;  1S4U X;  3L4O D;  1BPO A;  2AH1 A;  5K1C C;  3AH8 B;  2I0S A;  5EAP A;  4ERZ A;  1N6E A;  2P9N C;  4J84 A;  3I7O A;  1K32 A;  3IUJ A;  1T2X A;  3O4G A;  4ZOY A;  5CYK A;  5HE0 B;  3C5M A;  4BH6 A;  5C2W B;  5IC7 A;  3PVU B;  3O4H A;  3NIG A;  3OKW A;  2H6K A;  5E6U A;  4FA4 D;  2YNN A;  4IRZ A;  4MMX A;  5CXC B;  4ESG A;  2H9N A;  3V5W B;  2J55 H;  3C9C A;  3ZDZ A;  4OZU A;  5GXH A;  4A0A B;  3EQ7 A;  2EIB A;  3F3F A;  1TYE A;  2H68 A;  4G1E A;  2IUV A;  2PBI B;  4O45 A;  5B4W A;  4R7A B;  4ZN4 A;  4X3E A;  5FXY A;  2CNX A;  3OL2 B;  4E54 A;  3SBR A;  2AGX A;  3CFV A;  2AH0 A;  4A11 B;  4AN1 A;  5I5I A;  3IJ0 A;  4D0K A;  3N0D A;  3W15 A;  3OKT A;  2IAA A;  3GRE A;  5M5T A;  4A09 A;  3EG6 A;  1YFQ A;  5KDO B;  5HE1 B;  1MG3 A;  4EWR A;  2P9I C;  2CE8 A;  4JSX C;  3T3P A;  3ULE C;  4J86 A;  4NAA A;  2H9L A;  2XU7 A;  3AFC A;  3UKR C;  3JRO A;  4G55 A;  5IGO A;  3V9F A;  3SXT D;  4GQ1 A;  1SQJ A;  3V4P A;  4NBM A;  5K19 A;  3VH0 A;  4D6V A;  3KRW B;  5CXC A;  3UVN A;  3PSL A;  2OVQ B;  4ZOZ A;  3EWE A;  2CO0 A;  2W18 A;  3UKU C;  5CXB B;  5M5U A;  2Z2P A;  4UM9 A;  3IUQ A;  3VA6 A;  5JWZ A;  5SXM A;  3ZE2 A;  3NID A;  4CI8 A;  2H6N A;  3FRX A;  2PM7 B;  2YNP A;  5I5J A;  3RFG A;  3ZDX A;  3OW8 A;  4JSV C;  2G99 A;  5A2Q g;  3OKY A;  4CI2 A;  1TBG A;  3JZN A;  4J8G A;  5IJ7 E;  5HE2 B;  2I3S A;  4JSN C;  3F3P A;  2H14 A;  3KCI A;  4U1E I;  5CYK B;  2HU7 A;  4ZOX A;  5H1M A;  4GMB A;  1MG2 A;  2HU8 A;  2PM6 B;  1B9Y A;  2OIZ A;  3MKQ A;  3MZK A;  4ERQ A;  2AGL A;  1OMW B;  5H14 A;  4IMM A;  3FCS A;  2HKR A;  2VDQ A;  2IUP A;  3PVW B;  4G56 B;  2VZ3 A;  5EAM A;  4GGD A;  3PXW D;  3VGZ A;  3I2N A;  3IUR A;  5E6R A;  2VDL A;  4L1M A;  2VDN A;  4J0X A;  1UTC A;  2HJ4 A;  2AQ5 A;  3EI2 A;  1NR0 A;  3IIY A;  4J79 A;  1P22 A;  1VE7 A;  4UI9 R;  4Z7Q A;  5CXB A;  2BBK H;  4FA5 D;  4RE5 A;  2HJB A;  1QFM A;  4J78 A;  4O9D A;  5FLX g;  4MMY A;  3SVW D;  4O3T B;  4E54 B;  1C9L A;  4CZV A;  2CN3 A;  4A0B A;  3AL9 A;  3JZH A;  4FAN D;  3MUN A;  1VE6 A;  3EMH A;  3GD1 I;  3I8C A;  2AGY A;  4A09 B;  3UVO A;  3EQ9 A;  2H3X A;  2I3T A;  5EMM B;  2VC2 A;  1L5G A;  2G9A A;  5M5S A;  4K3J B;  2GC7 A;  5GXI A;  5FKS A;  2XZG A;  5C9Z B;  3SJL D;  2OK4 A;  4AN0 A;  1JJU B;  4FA1 D;  3MUO A;  2H9M A;  1SQ9 A;  2EIC A;  5I5M A;  4BCB A;  1H2Y A;  4GQ2 P;  1QFS A;  4L1Q D;  4JT5 C;  4PBZ A;  2Z2N A;  4XYH A;  3EI4 A;  5IGQ A;  2CN2 A;  3UR4 A;  1JV2 A;  3IVM A;  5HYN B;  4GM9 A;  1K8K C;  1N6D A;  2QR5 A;  1TYQ C;  3DDU A;  3DWL C;  3EI1 A;  1H2Z A;  3OKY B;  2B5L A;  4XYI A;  4LGN A;  4BCC A;  4CI3 A;  3AL8 A;  5GMK n;  3K72 A;  3SBP A;  3DXM C;  2EBS A;  2BKL A;  3BWS A;  1ERJ A;  2P9L C;  3GFC A;  2Z2O A;  4PC0 A;  1U4C A;  3PXS D;  4MMZ A;  3PE7 A;  4AOW A;  3MZL A;  4U7A A;  2PM9 A;  2I0T A;  3JAM g;  3I7N A;  1U8C A;  5FKR A;  5EMJ B;  2J56 H;  2HU5 A;  1VZ2 A;  4H5I A;  4QAM A;  4CY1 A;  3FM0 A;  2WQ8 A;  3HFQ A;  1H2X A;  4ZOV A;  4PNK B;  4CY5 A;  4A2L A;  4AMZ A;  3RSE C;  4DNV A;  2VDP A;  3EI2 B;  1GOG A;  4PBY A;  3MMY A;  3SFZ A;  3B7F A;  5TDH B;  3VI4 A;  3L4M D;  3RMZ D;  2HES X;  3JB9 L;  4DNW A;  5EAL A;  5TEE A;  4IA9 A;  1R5M A;  4A0B B;  4Y7R A;  4G1M A;  3IUM A;  1GOT B;  4JHN A;  1O6G A;  4GQB B;  2OVR B;  1PEV A;  2GNQ A;  5TF2 A;  3SHF A;  2OVP B;  2HXC A;  1GP2 B;  4Z8L A;  3A0F A;  3DSM A;  4KFM B;  2IWK A;  2XL3 A;  3CFS B;  4X61 B;  3PXT D;  1YR2 A;  4QL1 A;  4PXW A;  1GXR A;  1PI6 A;  4DNU A;  2QZP A;  4CZX A;  4AEZ A;  1C9I A;  5FKT A;  1M1X A;  4CY3 A;  3K6S A;  4TZ4 A;  5EML B;  1O6F A;  5HQG A;  3EI4 B;  3OTT A;  3RLM D;  1PBY B;  3ORV D;  1XKS A;  4J87 A;  3VI3 A;  1JTD B;  3I7P A;  4O02 A;  3I7L A;  4QQE A;  5M5R A;  4BP9 A;  4FA9 D;  3ODT A;  3JRP A;  3RN0 D;  1I2M B;  4NEN A;  3T3M A;  4AX4 A;  4X60 B;  4QT8 A;  3EI3 A;  3NVX A;  2AGW A;  4A7J A;  3EI1 B;  3IJ1 A;  1K3I A;  3K71 A;  2O9K A;  1SHY B;  1XHM A;  5IT9 g;  4GM8 A;  3K26 A;  4PSX B;  4N14 A;  4J81 A;  1Q47 A;  3AL8 B;  3UVK A;  4RE6 A;  3J81 g;  2TRC B;  3EQ8 A;  4CZY A;  5IJ8 E;  3MXX A;  4ES0 A;  2B5M A;  4JSP C;  5M5V A;  1L0Q A;  5HE3 B;  1JMX B;  1GG2 B;  4CI1 A;  4H5J A;  4Z7N A;  3ZWL B;  4GGA A;  2YB8 B;  2PM9 B;  1NEX B;  2YNO A;  4CY2 A;  3V4V A;  3FCU A;  5EMK B;  3O4J A;  4JXM A;  2B5N A;  5AFU 3;  1E8M A;  4J82 A;  2CE9 A;  3SN6 B;  2IUQ A;  5EM2 A;  4E5Z B;  2EIE A;  1B9X A;  3K27 A;  3BG1 A;  2OK6 A;  1N6F A;  5M61 A;  3OF7 A;  4X63 B;  4I79 A;  4WK0 A;  4JD2 C;  4QRJ A;  5EAR A; 
#chains in the Genus database with same CATH homology
 2XZG A;  1UTC A;  4G55 A;  3GD1 I;  5M61 A;  5M5R A;  5M5S A;  1C9L A;  1BPO A;  5M5T A;  5M5U A;  3GC3 B;  1C9I A;  5M5V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...