4G55A

Clathrin terminal domain complexed with pitstop 2
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
358
structure length
358
Chain Sequence
FMAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Role of the clathrin terminal domain in regulating coated pit dynamics revealed by small molecule inhibition.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Endocytosis
molecule keywords Clathrin heavy chain 1
total genus 76
structure length 358
sequence length 358
ec nomenclature
pdb deposition date 2012-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01394 Clathrin_propel Clathrin propeller repeat
A PF09268 Clathrin-link Clathrin, heavy-chain linker
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.110 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Clathrin heavy-chain terminal domain 4g55A00
5M61A 2XZGA 5M5RA 5M5SA 5M5TA 1BPOA 3GC3B 1C9LA 5M5VA 5M5UA 1UTCA 3GD1I 4G55A 1C9IA
chains in the Genus database with same CATH superfamily
2EIBA 5M5RA 3NIFA 3DDUA 4E5ZB 2VDLA 1UOQA 4BCBA 1TYQC 1H2ZA 3F3GA 1MDAH 5H14A 4CC9A 2P9UC 2B5LA 3RLMD 4WK4A 4JHNA 2P9NC 5HE3B 2EICA 2Z2PA 2H6NA 1E8MA 2PM9A 4JHPC 4Z8LA 2OJYA 4N14A 4DNWA 4JD2C 3NVXA 5EAPA 5AJAA 5H1MA 3ZE1A 2PBIB 4RE5A 5FXYA 3SLED 2YNPA 4A11B 5TDHB 3OL2A 5FQDA 4A2MA 2W18A 3K6SA 4AOWA 3L4OD 3VI4A 3EI1B 3ZDYA 4CI1A 3RN1D 2IWKA 2H9MA 1UTCA 2HJ4A 2I0RA 3MUOA 1VYHC 3SWSD 3EI4B 5EM2A 1GOHA 3O4GA 2YNNA 1FWXA 2VDKA 1S4UX 1SQJA 3ZWLB 1JV2A 2XZGA 4Z7NA 3GFCA 3N0DA 5A2Qg 5HYNB 4L1MA 4L3HD 4H5IA 1VZ2A 1B9YA 5C2VB 4D6VA 2O9KA 4LG8A 5FLXg 2Z2OA 3VI3A 4AN0A 1GXRA 3SJLD 5EMKB 4BCCA 4CY3A 3QI0A 2B5MA 1C9LA 2H14A 4JT6C 3F3PA 2I0SA 4MMYA 2HYEA 2EBSA 1N6DA 4LG9A 1K8KC 5CXCB 2VZ3A 2G99A 2HU5A 4ZOYA 4J0WA 4CY1A 4XYIA 4MMZA 1GP2B 3FCUA 2OVPB 1L5GA 4CY2A 4NC4A 4CZXA 2PM6B 3DM0A 4WK0A 4JSVC 3K26A 3W15A 5K19A 3PE7A 3JROA 4XYHA 2HKRA 3CFSB 1NR0A 1N6EA 3EI2B 3EG6A 4L3GD 1K3IA 4D9SA 2CO0A 2YB8B 1JOFA 2WQ8A 3ZDZA 2OIZA 2I0TA 2VDPA 5AMSA 4EWRA 1Q47A 4JSPC 1JMXB 3PXTD 3UVOA 3CFVA 2BCJB 4PBYA 1MG2A 3EWEA 1T2XA 3IUNA 1RI6A 3N0EA 1SHYB 3MZLA 3EI1A 4A0BB 1NEXB 2IWFA 4K3ID 5JWZA 3O4HA 2YBAA 4G1MA 3IURA 4L1QD 5GMKn 4QQEA 4O45A 2P9KC 3UKRC 2BKLA 3AL9A 2P9PC 1PGUA 3ORVD 5CYKA 3JAMg 2YNOA 5TEEA 3IUQA 3AL8A 1H2XA 5EAMA 3RN0D 2HJBA 3VA6A 2UZYB 1TBGA 4J73A 4GQ1A 4MK0B 4CI3A 3NVNA 5HE1B 4UM8A 3FRXA 4J82A 3IIYA 5IJ7E 3O4IA 3P4FA 4E54B 3V4PA 4TZ4A 5K1CC 3UVKA 4FB1D 3GC3B 3JB9L 1U4CA 1M1XA 5KDOB 2AQ5A 4J86A 4GMBA 4J79A 4UM9A 3J81g 4ZN4A 1QFMA 2VC2A 2J56H 5FFGA 2P9SC 4J8GA 2OK4A 3PXWD 4ES0A 3K72A 4GGAA 5IJ8E 1XKSA 2OK6A 2CN3A 3O4JA 4GQBB 2XDWA 2VDNA 2H47A 3KRWB 4KFMB 5AFU3 2BBKH 2QC5A 4IMMA 5E6SA 4NSXA 3JZGA 4K3JB 5IT9g 3I7HA 1VE7A 3C75H 1A12A 5M61A 5H17A 1GOFA 4AX4A 4UI9R 4Z7QA 3AFCA 3QHYB 3PVWB 2B4EA 5HE0B 4Z7OA 1JJUB 4PC0A 2XE4A 3C5MA 3PXSD 5E6UA 2HU8A 4L9OA 2JKXA 4PXWA 3IJCA 3EI2A 3EU7A 4GM3A 4CZVA 4A2LA 3FCSA 4CZYA 3GREA 4A0AA 4DNUA 2TRCB 1GOTB 3SBQA 2XL3A 5IC7A 4A08A 4ZOXA 4RE6A 1E8NA 1O6GA 3ODTA 4E5ZA 4A0BA 3EQ9A 1GG2B 3AL8B 4GGDA 2AGYA 1ERJA 2EIDA 2G9AA 3ZE2A 3K27A 2H9PA 4BH6A 3RMZD 5HDBA 4ERYA 3RSEC 2QXVA 3NIDA 3V9FA 3SBPA 2J55H 3EI3A 3BG0A 5M5UA 4A7JA 3F3FA 3B7FA 4IRZA 4J78A 2H6QA 1VE6A 2AGZA 3OW8A 4QL1A 2XL2A 3RFGA 5E6RA 1QFSA 4PNKB 2B5NA 2XU7A 3MKSB 4NAAA 3OKYA 3PSLA 4PSWB 3J80g 3SN6B 4I79A 4JSXC 3NVQA 2I3TA 5CXCA 3FM0A 5M5SA 1UOOA 4J0XA 3I7LA 4QRJA 4AMZA 5I5JA 3K71A 1OLZA 1GOGA 3PVUB 5FKQA 1R5MA 4WK2A 2CE8A 4J87A 4O9DA 3VH0A 1PEVA 3BG1A 3SMRA 4A11A 4FAVD 4G1EA 3I2NA 4FWWA 5FFOA 3T3MA 5I5MA 2OVRB 3FGBA 3A0FA 3SFZA 3MVDK 2P9IC 3EI4A 2AH0A 5FKRA 2PM7B 1H2YA 2AH1A 1YFQA 5TEFA 2IAAA 4NBMA 1JMZB 3V4VA 2GNQA 1U8CA 3I7KA 2CNXA 2GC7A 3OL2B 3V5WB 1O6FA 4OWRA 3GD1I 4J84A 5GXIA 4PSXB 4G55A 2XYIA 4LGNA 3C99A 5C86A 4GGCA 4BP8A 4A09A 4CI2A 2HU7A 1I2MB 4J81A 5TF2A 2CE9A 3IULA 3MXXA 3I8EA 3UVMA 4GM9A 1C9IA 3RFHA 3L4MD 3SXTD 5EMLB 3CIKB 3IJ1A 3I7NA 4BUJC 4HDJA 4U1EI 3IUJA 3EMHA 1K32A 3I8CA 3SHFA 4A09B 3IKOA 4H5JA 1U2VC 2Z2NA 3AH8B 2H3XA 4X63B 4AEZA 2VZ1A 2VDMA 2I3SA 3IIWA 4J77A 3HFQA 1XHMA 4R7AB 4ZOZA 4O3TB 1MG3A 2H68A 5EARA 4FA9D 2UZXB 3VGZA 4BL0A 4Y7RA 2AGXA 3NIGA 4AMYA 1H2WA 5C2WB 1XIPA 3KRXB 3EQ8A 4FA1D 3UR4A 4FA4D 1JTDB 2J57G 3OTTA 1P22A 2H9LA 2QR5A 5EMJB 4ESGA 4GQ2P 4JSNC 2OVQB 3ZE0A 4MMXA 3JZNA 3SBRA 4G56B 4DNVA 5GXHA 2CN2A 4GZ8A 3MUNA 4X3EA 2AGLA 5I5IA 4A08B 3DXMC 3BWSA 3IJ0A 3C9CA 2IUPA 2VDQA 3V7DB 4A0AB 5HE2B 4U7AA 2MTAH 3MMYA 1TYEA 3I7PA 1BPOA 4X60B 4NENA 5FKTA 3KCIA 3U4YA 4QAMA 3SVWD 2H9NA 3EI3B 2HKMA 4FHLA 2EIEA 3JZHA 4O1QD 4Y5RD 5HQGA 3ULEC 5M5VA 3UVNA 3EQ7A 4JXMA 4O2WA 2IURA 3SCYA 5M5TA 1QNIA 1B9XA 2YMUA 4WJKA 4ERZA 2H13A 5GSAA 2VDOA 3PSCB 4J8BA 5B4WA 2P9LC 5THAA 3JRPA 5C92A 1N6FA 4JT5C 3UKUC 4E54A 1E5TA 1SQ9A 3OKTA 3MKQA 5CXBA 3IVMA 2CO0C 3ZDXA 3DXKC 4O3UB 5EM2B 3IUMA 5EMMB 2PM9B 5EALA 2HESX 3E0CA 1OMWB 4PBZA 1PI6A 4FA5D 2QZPA 4IA9A 2GC4A 5CYKB 1A0RB 2Q7QA 2H6KA 1L0QA 1UOPA 5CXBB 2IUVA 3I7OA 3OKYB 3RRMC 2VDRA 4D0KA 5IGQA 4YVDA 4ZOVA 4BP9A 4OZUA 5FA5B 4AN1A 3MZKA 5IGOA 4BCDA 3JPXA 4ERQA 4CI8A 5SXMA 2HXCA 3IJEA 5FKSA 4CY5A 3OKWA 4FAND 3DWLC 2AGWA 3I89A 3T3PA 3OF7A 2IUQA 1PBYB 1VZ3A 4QT8A 4O02A 3DSMA 4X61B 4XEIC 5C9ZB 3UVLA 1YR2A 4GM8A
chains in the Genus database with same CATH topology
5M61A 2XZGA 5M5RA 5M5SA 5M5TA 1BPOA 3GC3B 1C9LA 5M5VA 5M5UA 1UTCA 3GD1I 4G55A 1C9IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M61 A;  2XZG A;  5M5R A;  5M5S A;  5M5T A;  1BPO A;  3GC3 B;  1C9L A;  5M5V A;  5M5U A;  1UTC A;  3GD1 I;  4G55 A;  1C9I A; 
#chains in the Genus database with same CATH topology
 2EIB A;  5M5R A;  3NIF A;  3DDU A;  4E5Z B;  2VDL A;  1UOQ A;  4BCB A;  1TYQ C;  1H2Z A;  3F3G A;  1MDA H;  5H14 A;  4CC9 A;  2P9U C;  2B5L A;  3RLM D;  4WK4 A;  4JHN A;  2P9N C;  5HE3 B;  2EIC A;  2Z2P A;  2H6N A;  1E8M A;  2PM9 A;  4JHP C;  4Z8L A;  2OJY A;  4N14 A;  4DNW A;  4JD2 C;  3NVX A;  5EAP A;  5AJA A;  5H1M A;  3ZE1 A;  2PBI B;  4RE5 A;  5FXY A;  3SLE D;  2YNP A;  4A11 B;  5TDH B;  3OL2 A;  5FQD A;  4A2M A;  2W18 A;  3K6S A;  4AOW A;  3L4O D;  3VI4 A;  3EI1 B;  3ZDY A;  4CI1 A;  3RN1 D;  2IWK A;  2H9M A;  1UTC A;  2HJ4 A;  2I0R A;  3MUO A;  1VYH C;  3SWS D;  3EI4 B;  5EM2 A;  1GOH A;  3O4G A;  2YNN A;  1FWX A;  2VDK A;  1S4U X;  1SQJ A;  3ZWL B;  1JV2 A;  2XZG A;  4Z7N A;  3GFC A;  3N0D A;  5A2Q g;  5HYN B;  4L1M A;  4L3H D;  4H5I A;  1VZ2 A;  1B9Y A;  5C2V B;  4D6V A;  2O9K A;  4LG8 A;  5FLX g;  2Z2O A;  3VI3 A;  4AN0 A;  1GXR A;  3SJL D;  5EMK B;  4BCC A;  4CY3 A;  3QI0 A;  2B5M A;  1C9L A;  2H14 A;  4JT6 C;  3F3P A;  2I0S A;  4MMY A;  2HYE A;  2EBS A;  1N6D A;  4LG9 A;  1K8K C;  5CXC B;  2VZ3 A;  2G99 A;  2HU5 A;  4ZOY A;  4J0W A;  4CY1 A;  4XYI A;  4MMZ A;  1GP2 B;  3FCU A;  2OVP B;  1L5G A;  4CY2 A;  4NC4 A;  4CZX A;  2PM6 B;  3DM0 A;  4WK0 A;  4JSV C;  3K26 A;  3W15 A;  5K19 A;  3PE7 A;  3JRO A;  4XYH A;  2HKR A;  3CFS B;  1NR0 A;  1N6E A;  3EI2 B;  3EG6 A;  4L3G D;  1K3I A;  4D9S A;  2CO0 A;  2YB8 B;  1JOF A;  2WQ8 A;  3ZDZ A;  2OIZ A;  2I0T A;  2VDP A;  5AMS A;  4EWR A;  1Q47 A;  4JSP C;  1JMX B;  3PXT D;  3UVO A;  3CFV A;  2BCJ B;  4PBY A;  1MG2 A;  3EWE A;  1T2X A;  3IUN A;  1RI6 A;  3N0E A;  1SHY B;  3MZL A;  3EI1 A;  4A0B B;  1NEX B;  2IWF A;  4K3I D;  5JWZ A;  3O4H A;  2YBA A;  4G1M A;  3IUR A;  4L1Q D;  5GMK n;  4QQE A;  4O45 A;  2P9K C;  3UKR C;  2BKL A;  3AL9 A;  2P9P C;  1PGU A;  3ORV D;  5CYK A;  3JAM g;  2YNO A;  5TEE A;  3IUQ A;  3AL8 A;  1H2X A;  5EAM A;  3RN0 D;  2HJB A;  3VA6 A;  2UZY B;  1TBG A;  4J73 A;  4GQ1 A;  4MK0 B;  4CI3 A;  3NVN A;  5HE1 B;  4UM8 A;  3FRX A;  4J82 A;  3IIY A;  5IJ7 E;  3O4I A;  3P4F A;  4E54 B;  3V4P A;  4TZ4 A;  5K1C C;  3UVK A;  4FB1 D;  3GC3 B;  3JB9 L;  1U4C A;  1M1X A;  5KDO B;  2AQ5 A;  4J86 A;  4GMB A;  4J79 A;  4UM9 A;  3J81 g;  4ZN4 A;  1QFM A;  2VC2 A;  2J56 H;  5FFG A;  2P9S C;  4J8G A;  2OK4 A;  3PXW D;  4ES0 A;  3K72 A;  4GGA A;  5IJ8 E;  1XKS A;  2OK6 A;  2CN3 A;  3O4J A;  4GQB B;  2XDW A;  2VDN A;  2H47 A;  3KRW B;  4KFM B;  5AFU 3;  2BBK H;  2QC5 A;  4IMM A;  5E6S A;  4NSX A;  3JZG A;  4K3J B;  5IT9 g;  3I7H A;  1VE7 A;  3C75 H;  1A12 A;  5M61 A;  5H17 A;  1GOF A;  4AX4 A;  4UI9 R;  4Z7Q A;  3AFC A;  3QHY B;  3PVW B;  2B4E A;  5HE0 B;  4Z7O A;  1JJU B;  4PC0 A;  2XE4 A;  3C5M A;  3PXS D;  5E6U A;  2HU8 A;  4L9O A;  2JKX A;  4PXW A;  3IJC A;  3EI2 A;  3EU7 A;  4GM3 A;  4CZV A;  4A2L A;  3FCS A;  4CZY A;  3GRE A;  4A0A A;  4DNU A;  2TRC B;  1GOT B;  3SBQ A;  2XL3 A;  5IC7 A;  4A08 A;  4ZOX A;  4RE6 A;  1E8N A;  1O6G A;  3ODT A;  4E5Z A;  4A0B A;  3EQ9 A;  1GG2 B;  3AL8 B;  4GGD A;  2AGY A;  1ERJ A;  2EID A;  2G9A A;  3ZE2 A;  3K27 A;  2H9P A;  4BH6 A;  3RMZ D;  5HDB A;  4ERY A;  3RSE C;  2QXV A;  3NID A;  3V9F A;  3SBP A;  2J55 H;  3EI3 A;  3BG0 A;  5M5U A;  4A7J A;  3F3F A;  3B7F A;  4IRZ A;  4J78 A;  2H6Q A;  1VE6 A;  2AGZ A;  3OW8 A;  4QL1 A;  2XL2 A;  3RFG A;  5E6R A;  1QFS A;  4PNK B;  2B5N A;  2XU7 A;  3MKS B;  4NAA A;  3OKY A;  3PSL A;  4PSW B;  3J80 g;  3SN6 B;  4I79 A;  4JSX C;  3NVQ A;  2I3T A;  5CXC A;  3FM0 A;  5M5S A;  1UOO A;  4J0X A;  3I7L A;  4QRJ A;  4AMZ A;  5I5J A;  3K71 A;  1OLZ A;  1GOG A;  3PVU B;  5FKQ A;  1R5M A;  4WK2 A;  2CE8 A;  4J87 A;  4O9D A;  3VH0 A;  1PEV A;  3BG1 A;  3SMR A;  4A11 A;  4FAV D;  4G1E A;  3I2N A;  4FWW A;  5FFO A;  3T3M A;  5I5M A;  2OVR B;  3FGB A;  3A0F A;  3SFZ A;  3MVD K;  2P9I C;  3EI4 A;  2AH0 A;  5FKR A;  2PM7 B;  1H2Y A;  2AH1 A;  1YFQ A;  5TEF A;  2IAA A;  4NBM A;  1JMZ B;  3V4V A;  2GNQ A;  1U8C A;  3I7K A;  2CNX A;  2GC7 A;  3OL2 B;  3V5W B;  1O6F A;  4OWR A;  3GD1 I;  4J84 A;  5GXI A;  4PSX B;  4G55 A;  2XYI A;  4LGN A;  3C99 A;  5C86 A;  4GGC A;  4BP8 A;  4A09 A;  4CI2 A;  2HU7 A;  1I2M B;  4J81 A;  5TF2 A;  2CE9 A;  3IUL A;  3MXX A;  3I8E A;  3UVM A;  4GM9 A;  1C9I A;  3RFH A;  3L4M D;  3SXT D;  5EML B;  3CIK B;  3IJ1 A;  3I7N A;  4BUJ C;  4HDJ A;  4U1E I;  3IUJ A;  3EMH A;  1K32 A;  3I8C A;  3SHF A;  4A09 B;  3IKO A;  4H5J A;  1U2V C;  2Z2N A;  3AH8 B;  2H3X A;  4X63 B;  4AEZ A;  2VZ1 A;  2VDM A;  2I3S A;  3IIW A;  4J77 A;  3HFQ A;  1XHM A;  4R7A B;  4ZOZ A;  4O3T B;  1MG3 A;  2H68 A;  5EAR A;  4FA9 D;  2UZX B;  3VGZ A;  4BL0 A;  4Y7R A;  2AGX A;  3NIG A;  4AMY A;  1H2W A;  5C2W B;  1XIP A;  3KRX B;  3EQ8 A;  4FA1 D;  3UR4 A;  4FA4 D;  1JTD B;  2J57 G;  3OTT A;  1P22 A;  2H9L A;  2QR5 A;  5EMJ B;  4ESG A;  4GQ2 P;  4JSN C;  2OVQ B;  3ZE0 A;  4MMX A;  3JZN A;  3SBR A;  4G56 B;  4DNV A;  5GXH A;  2CN2 A;  4GZ8 A;  3MUN A;  4X3E A;  2AGL A;  5I5I A;  4A08 B;  3DXM C;  3BWS A;  3IJ0 A;  3C9C A;  2IUP A;  2VDQ A;  3V7D B;  4A0A B;  5HE2 B;  4U7A A;  2MTA H;  3MMY A;  1TYE A;  3I7P A;  1BPO A;  4X60 B;  4NEN A;  5FKT A;  3KCI A;  3U4Y A;  4QAM A;  3SVW D;  2H9N A;  3EI3 B;  2HKM A;  4FHL A;  2EIE A;  3JZH A;  4O1Q D;  4Y5R D;  5HQG A;  3ULE C;  5M5V A;  3UVN A;  3EQ7 A;  4JXM A;  4O2W A;  2IUR A;  3SCY A;  5M5T A;  1QNI A;  1B9X A;  2YMU A;  4WJK A;  4ERZ A;  2H13 A;  5GSA A;  2VDO A;  3PSC B;  4J8B A;  5B4W A;  2P9L C;  5THA A;  3JRP A;  5C92 A;  1N6F A;  4JT5 C;  3UKU C;  4E54 A;  1E5T A;  1SQ9 A;  3OKT A;  3MKQ A;  5CXB A;  3IVM A;  2CO0 C;  3ZDX A;  3DXK C;  4O3U B;  5EM2 B;  3IUM A;  5EMM B;  2PM9 B;  5EAL A;  2HES X;  3E0C A;  1OMW B;  4PBZ A;  1PI6 A;  4FA5 D;  2QZP A;  4IA9 A;  2GC4 A;  5CYK B;  1A0R B;  2Q7Q A;  2H6K A;  1L0Q A;  1UOP A;  5CXB B;  2IUV A;  3I7O A;  3OKY B;  3RRM C;  2VDR A;  4D0K A;  5IGQ A;  4YVD A;  4ZOV A;  4BP9 A;  4OZU A;  5FA5 B;  4AN1 A;  3MZK A;  5IGO A;  4BCD A;  3JPX A;  4ERQ A;  4CI8 A;  5SXM A;  2HXC A;  3IJE A;  5FKS A;  4CY5 A;  3OKW A;  4FAN D;  3DWL C;  2AGW A;  3I89 A;  3T3P A;  3OF7 A;  2IUQ A;  1PBY B;  1VZ3 A;  4QT8 A;  4O02 A;  3DSM A;  4X61 B;  4XEI C;  5C9Z B;  3UVL A;  1YR2 A;  4GM8 A; 
#chains in the Genus database with same CATH homology
 5M61 A;  2XZG A;  5M5R A;  5M5S A;  5M5T A;  1BPO A;  3GC3 B;  1C9L A;  5M5V A;  5M5U A;  1UTC A;  3GD1 I;  4G55 A;  1C9I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...