3K72A

Structure of integrin alphax beta2
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
1082
structure length
884
Chain Sequence
FNLDTEELTAFRVDSAGFGDSVVQYANSWVVVGAPQKITAANQTGGLYQCGYSTGACEPIGLQVPPEAVNMSLGLSLASTTSPSQLLACGPTVHHECGRNMYLTGLCFLLGPTQLTQRLPVSRQECPSSFELEMAQEGFSAVFTPDGPVLGAVGSFTWSGGAFLYPPNMSPTFINMSQENVDMRDSYLGYSTELALWKGVQSLVLGAPRYQHTGKAVIFTQVSRQWRMKAEVTGTQIGSYFGASLCSVDVDSDGSTDLVLIGAPHYYEQTRGGQVSVCPLPRGWRRWWCDAVLYGEQGHPWGRFGAALTVLGDVNGDKLTDVVIGAPGEEENRGAVYLFHGVLGPSISPSHSQRIAGSQLSSRLQYFGQALSGGQDLTQDGLVDLAVGARGQVLLLRTRPVLWVGVSMQFIPAEIPRSAFECREQVVSEQTLVQSNICLYIDKRSKNLLGSRDLQSSVTLDLALDPGRLSPRATFQETKNRSLSRVRVLGLKAHCENFNLLLPSCVEDSVTPITLRLNFTLVGKPLLAFRNLRPMLAADAQRYFTASLPFEKNCGADHICQDNLGISFSFPGLKSLLVGSNLELNAEVMVWNDGEDSYGTTITFSHPAGLSYRYVAEGQKQGQLRSLHLTCDSAPVGSQGTWSTSCRINHLIFRGGAQITFLATFDVSPKAVLGDRLLLTANVSSENNTPRTSKTTFQLELPVKYAVYTVVSSHEQFTKYLNFSESEEKESHVAMHRYQVNNLGQRDLPVSINFWVPVELNQEAVWMDVEVSHPQNPSLRCSSEKIAPPASDFLAHIQKNPVLDCSIAGCLRFRCDVPSFSVQEELDFTLKGNLSFGWVRQILQKKVSVVSVAEITFDTSVYSQLPGQEAFMRAQTTTVLEKYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of an integrin with an alphaI domain, complement receptor type 4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
molecule keywords Integrin alpha-X
total genus 120
structure length 884
sequence length 1082
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
A PF01839 FG-GAP FG-GAP repeat
A PF08441 Integrin_alpha2 Integrin alpha
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1460 Mainly Beta Sandwich Immunoglobulin-like Integrin domains. Chain A, domain 2 3k72A02
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 3k72A03
2.60.40.1530 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 4 3k72A04
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 3k72A01
3ZDXA 1JV2A 3FCSB 4MMYA 4MMZA 4UM8B 4UM9D 3VI4A 1M1XB 4G1MB 5HDBB 3K72A 2VDKA 5E6SB 4WK4A 2VDLA 3ZDYA 1JV2B 4MMZB 5FFOA 1U8CA 3K6SB 4O02B 3VI4B 3NIGB 4MMXA 4UM9A 4G1MA 2VDRB 4NEHB 4WJKA 4IRZA 3K72B 5E6RA 2VDOB 3ZE2B 4Z7NA 4Z7QA 3ZDZB 1L5GA 3IJEA 4Z7OB 3FCUA 5E6SA 3T3MB 1TYEB 2VDLB 3ZDYB 3ZDXB 3K6SA 4Z7NB 4Z7QB 4MMXB 2VDQA 3NIDB 3V4PA 1L5GB 2VDNB 4MMYB 2VDOA 3V4VA 3VI3A 3K71B 4NENA 5ES4B 3NIFB 3FCUB 1M1XA 2VDMA 3T3MA 2P26A 4JX0A 2VDKB 4WK2B 5FFGA 3V4VB 3VI3B 2VDPB 3T3PB 1U8CB 3NIGA 4WK0A 3IJEB 2VC2B 5E6UB 4WK4B 2VDRA 3ZE1A 1TYEA 4NENB 3FCSA 3ZE0A 4WK2A 4UM8A 4O02A 4UM9B 2VDMB 4G1EA 3NIDA 4WJKB 4Z7OA 5HDBA 2VDNA 5E6RB 3ZE1B 3ZE2A 2VDPA 3T3PA 3ZE0B 3ZDZA 3K71A 3V4PB 4WK0B 3NIFA 2VC2A 5E6UA 2VDQB 4G1EB
chains in the Genus database with same CATH superfamily
3RNKA 1MCEA 1N64L 4U49A 3DXAD 3TO2A 5DQJA 1AI1L 4LPCA 3EYUH 1HNGA 2P8MA 4XOCA 1J88A 2OR8A 1N8ZB 4ZS6C 3FFDA 2ZXGA 3WNJA 5AG8A 3RRQA 5FDWA 2WAQA 1G6RA 4ZUSA 2C3HA 3EIFA 3PP4L 1CUOA 2ZONA 1JK8B 4KDTC 2BNQD 2QLYA 5JOFB 3PPEA 3KPRD 3L3OA 2NY2C 1FHGA 2EDRA 3MRKA 4LRNH 4D8PA 2VT0A 2RA1A 4Z8LA 3S5YA 4YXLH 3GKZA 2V33A 1G9MH 2F0CA 4JVWA 3WE1A 2DKMA 3LPWA 3OHXC 1E4WL 5I2IB 5JHDA 4LAQH 1SHSA 2R2BA 3KPRE 2D7TH 2V3DA 2ZJSL 5D8JH 4BDVB 2PR9A 3PAUA 4P2OB 3MMYA 2P9PC 2F8XC 1EEYA 4JRWA 1MCBA 1RZGA 2WJ7A 3RHWF 1VE7A 1WT5C 2NY5H 3T6ZA 4D0CA 2YBAA 1GW6A 5ESQA 4PD4K 1JGDA 3P77A 2G75B 3FSWA 3O4LD 5A16B 1Z5HA 4F8OA 4O58H 3K8MA 4N1CA 2WW8A 3LNFA 1UXMA 3HG2A 2YD6A 3FU8A 3W81A 2BSCA 5ABDE 2WCGA 2FEEI 2ZCLL 3B4NA 5DC0A 3CFEB 1UCBH 3C9NA 2GJJA 4I5BA 5KANI 4NP9A 3FCUB 4UTCA 1VAHA 1LO2L 1TVHB 4QYAA 4G8FA 3QPKA 3M1BB 1U2VC 2CPUA 1DQTA 4JO2H 4LL4A 1BAGA 2IC2A 3GS4A 1FLRL 1IQWH 4YPJA 1MI5A 4NKQB 4ZUWA 4RBPK 2OZ4A 5E2UH 1I4FB 4AJYV 2UZYA 4G55A 4WF7A 2B1AL 2IDFA 3OKNB 5ITBH 5J9PA 3IAPA 5JPMA 1FYHB 4OGZA 1FN4B 4PVNA 1HL9A 4LSTL 4U4BA 3UACA 4KI5C 2AH1A 3P4FA 1OF2A 3NEEA 1TJHL 1BZQK 2JKNA 1N19A 3I85A 3N1FC 5KWYC 2VDMB 5BS0B 3JZNA 1M7DB 4LLWA 4X8XA 2NX5D 4XNQB 3AM8A 1RZFH 2KYIA 1HWGB 4PIBA 3O8XA 5D7IF 1K8KC 4LLMB 4DN4H 2VJ8A 4OZHE 1Z9NA 5CSZA 3SGJC 1O9ZA 2F74A 2R27A 3OQRA 2ZT9C 4XXCA 1EUUA 2YBRB 3L48A 4NUPA 3S96B 3EI3B 1UB5A 1GAFL 4HAFA 5LVEA 3JPXA 5IIEB 5EO1B 4ONHA 3SCMC 5CJOL 1JTDB 3M1BA 1NMBH 3SCMB 2CJUH 4OFQA 2HYEA 3AL9A 3CE1A 3GF8A 4A0AA 3GB7A 3MJ8A 2PW2A 5AAPA 3HOGA 2UXGA 5DEGA 3UZVB 3RTQA 1JSYA 3A6OA 5HE3B 3W9DB 4E0RA 3GKWL 4ODVH 5CXCB 1VFAB 1IEBB 4L4TA 5IB1A 4AQ1B 2Y06L 4XC1L 5I73C 4N0YL 1Z66A 4EN2A 4NRYB 5F7AA 5KSAB 1NCDL 1VPOL 3O2WH 1JD9A 2EXWD 3OPUA 5D70H 1S5IL 1MIEH 2F6AA 5TE6L 1WBYB 2CRIA 4JDVA 3B7UX 4L4VE 5B4MD 2WPGA 1X6NA 4KKRA 3ZDZB 2DQHL 3D39A 2MNWA 4LGSB 4NQSB 1IVTA 5FOJA 1TQSA 1MELA 2PPEA 4GPVA 3SDYH 4WFHE 3BVNA 3DYMA 4HIXL 4GSRA 4NRZB 4TSAL 1YQ2A 4D6VA 5DJ2B 1HI6A 1KIQA 2RALA 3EUUA 5KSUA 1MFNA 3O4GA 4Y4HD 2VXSH 4ZBJA 3WJLC 1SQ9A 1ITCA 1AQHA 4NO0B 4EDXA 4YHYC 2DWSA 3PDOA 2R0ZH 3AADB 1HIML 5EEYA 2CKBL 1JVLA 2IG2L 3O6FA 4E42A 4P2RD 4OT1H 4DESA 1O6VA 3IRZA 3IDJB 2Y6TE 4F57L 1SEBB 3QNZB 3UVKA 2WB7A 6CGTA 3S35H 1KGIA 5CEZH 1CURA 2R2HB 4H40A 4DGYH 4MNQA 1E90A 3QFDA 5TDPB 2MCPH 1ZA6A 3KW7A 4JRFA 1WBYA 5HHQA 4X61B 3VSUA 4RAHA 4XMPL 2WO2B 3BGMB 3VGFA 3BISA 4WRLA 5IESL 4ZUTB 5JIIA 1P7QB 1DQQA 1QRNB 4E41D 1XSOA 3VTMA 4J3TA 3TBTB 3VGAC 2CE9A 4ZFZB 1GZPA 4FNLH 1CFSA 1A6UL 1NGPL 3E9UA 4YSDA 1SBSH 1MOEA 2VLMD 3PVUB 6TAAA 5FO8A 1V55B 4M5ZL 3HNTL 3Q05A 3GSNL 4HIEA 2I3SA 1R5VB 3HNVL 4XR8C 1E5CA 3II3A 2AGLA 3QDGD 3ZTNH 1SYSA 5E2VH 3ETBF 3VH8B 4PRDA 3OMZA 2AEPL 2UZXB 3RPIB 3BW9A 2MTAH 2LT9A 1OF0A 2HLAB 4F8PA 2J5LB 3MDJA 5JOEA 5I8OL 3CHXA 2CDGB 2XKUA 2Y07L 3WJJC 2IBZX 4QR7A 1NA8A 2CE6A 4NO3A 43CAA 2OMXA 1BQUA 2AJYL 3I9IA 4FQQA 4P2CG 1HEZA 1ZAGA 2J20A 2N7BA 4TSBH 1YPZB 3FNKA 1TPXB 1CXKA 3QUZD 4JANB 1AC6A 4H13C 4UT9A 5T5NF 4O9HL 1YJDH 4ODUA 3VSTA 4LKXB 3I9GH 4CSZA 3VFUB 3CN0A 4ETQA 4G7VL 1MI5B 1DBAH 2XXCB 1NAML 1N7MH 1D3CA 1MRCH 1TMQA 4ONFH 3GHPA 2CRMA 2OM5A 3MOQA 4MVBC 2J6EL 3MKGA 4LPUA 4XBPB 3WIHA 5C0GA 1U8PB 5CIPA 2CRYA 4H5SB 5IC7A 5FGBA 1GSKA 4JFXB 1BP3B 3U2SB 3D3VD 4G8GD 4QYOB 2VL5A 4MD5B 4MAYC 3FAXA 1KPUB 7PAZA 1BFSA 1FGVL 2VDLB 2DPKA 5I82A 3SKJL 3KL0A 3HMWL 4MCZA 3S35L 5KSBA 3O3DB 5F9OL 3INUL 2BKLA 4HJJH 4HS6B 4WI0A 5IJDC 4X4KA 1TVBA 1A7RL 3IETA 4X6EB 1AR1C 3QDGB 5DZAA 2I3TA 3MHZA 3KPNA 2HLFD 5HGAA 4ESKA 1J9CT 1EO8H 3SPIA 1TBGA 2AP2A 2WSDA 2QR0B 3L3GA 3LN5A 3CZGA 1Q9WB 3T6QC 2ROXA 4HP5A 1JNLH 3LIZA 5I1LA 3VXUD 1PZBA 3MUUA 2GKIA 3PWPD 1KYAA 1WZAA 4H5SA 4M7LT 2ZQKA 4X7TB 1ZHBB 4JRXA 5IVXA 1H9DA 5DJ8A 4Q14A 5IHZB 4DUVA 3VCLA 3NGBB 3I9PA 4WUUA 3ZE1A 1CC3A 1IM3D 2VMCA 4UOW1 1JXDA 4UT6H 5B39G 5FYKD 2C4FT 2WK2A 2EO9A 4ONGH 1B4TA 4IIQC 3UIZA 4XB7A 4HU8A 2X2UA 3VGBA 1DZ0A 2R39A 1YY9C 4MVBD 4Y4FD 3BOVA 4GSXA 5HPMA 2W65B 2FCBA 2EO7A 5FW6A 3RL1B 4TUKH 4BE5A 5GRJL 3MXVL 5HGDB 4YL9A 1DFBH 3L2NA 2WLJA 4WDIA 5EOCL 3RY5A 1DVFC 4EN3C 1QSEA 1KJ2A 4QHMB 2C4XA 2CBOA 3DHUA 4PW3A 3UZQA 3J7HA 3QIWC 4JLRA 4WFGD 5C8JB 12E8L 5BCAA 4LVEA 1NL0H 1A14L 3NCXA 4Q6IB 4CJ0A 2AEQL 1RFDL 3EYQD 3BPLB 5AW5B 3SGKC 3WD5L 3BPLC 5DUJA 2ICES 3VFWB 2EXYC 1GHFH 1ZXQA 1BYOA 1KDIA 5EDSA 4JHAH 5HJGA 4JO1H 5D6DA 5IB4A 5F88A 4YDLB 3HE7D 4H1LA 4IMMA 3TT3L 4ZZFA 1J8HE 3VI3E 1G4MA 3L4VA 3QK0A 2AK1L 5JW4Q 3CZEA 1IC4H 3KR3L 1KB9K 4M7JH 3Q8BA 5HVGB 4H88H 3J2PA 3VI4E 2NYZA 3QO1A 3DBXB 1GOGA 3L81A 4PBZA 3US9A 1WA0X 4KJWC 3EXJA 5D71L 2PM7B 4YLCA 3I3EA 1L5GA 2H9MA 4JFFE 3MLSH 1ZV9A 3OTTA 2NY5L 1GYCA 4AGOA 1F4WH 2ZSVA 3TV8A 2YS4A 3ZDZE 5FA5B 1IKNC 2MCAA 3WEBA 5C2BH 4KXZI 1SEQH 2HWZH 4LSRH 4AEHL 4F92B 1THAA 4DPRA 1OGAE 2CMRH 4KMTL 2AI0H 3KZ8A 1JMXB 1JUFB 3HPJB 3AL8B 4LLQB 2D2OA 1HE8A 1M9SA 5LLIC 4LVOC 4G72B 2CDGA 1ML0A 1TQCC 1QI5A 4WENB 1AH1A 4HFUH 3ES6A 3NACL 4LF3A 4R6UA 1R3IH 4TNWK 3K6DA 1C7SA 4H1LB 4DQOH 2WHVA 3SYOA 3W9EB 3BLKA 1JXJA 1PZ5A 3HLAA 2GTWA 1GVIA 3OBAA 4OJAA 3HHSA 4D0DA 3OM3B 5A2JH 4DGIH 4ETQB 1X9QA 2K0RA 3IAGC 4OI8A 1QWUA 3G5XA 4NC1C 5T1LB 4FTVE 4HXBH 3WIIL 3BVXA 2CIIB 1XCXA 3D39D 1SZNA 4OBRA 4NQUA 3VWKB 1ZJBA 1FZJB 1TJHH 3QUMA 3EBAA 2BSSB 4ZOCA 2R69A 4JPWH 4J0WA 2YWYA 4RGND 4LHUA 2BPBA 5H1MA 7CGTA 2F8VA 3HZKA 4HXAL 4N8UA 2XHNA 12E8H 2VERA 4JM4H 3MRNB 3HHSB 4BWUA 2YSTA 5F9WC 4GQQA 2I9TA 1F8TH 2F15A 4XMLL 5JA8B 5DJ0B 4WK0B 3L7EB 4OZIE 1AFVL 1J0KA 3HLKA 2AQRA 3DO7A 5EEZA 4AC4A 1FWXA 4UTAA 2OVQB 3SKNA 1MF2H 2V8MA 3QEQA 4BK5C 1TR7A 4ZQTA 4S1QH 1OP3K 2HKHH 5FGSA 4A08A 2PM6B 2DIJA 3IU4H 3FMGL 1FPTL 1PZSA 3OKLB 1WS7A 2F58H 3RU8L 1AGDB 4W9HC 4WEMB 5GSRA 4P48A 4A7TA 2P5WB 1A4KB 4M6MH 3JB9L 1MIML 2A4CA 2FQEA 1KZQA 3NSCA 5KVFE 3LZPA 4PG2C 1N26A 1U58A 3RAJL 4Z3FA 1GXRA 3L7EA 4OZFH 3ASOB 5PCYA 3QIUC 4IJ3B 4KKPA 1MCWW 3VFSA 1GXEA 2BSTA 4M03A 5FR3A 2YQ3A 4WEBL 3N44B 1MI5E 3MRNA 3JWOC 4U1KA 2DF3A 3QEQD 1UKQA 4OFIA 2P9SC 2VR7A 3UCRA 4MA8L 4AZ8B 3JWNE 3ZE2B 4ERZA 3W11C 1FL3A 4AIOA 5EMMB 1K3IA 1OL0A 2LU3A 1T89C 1UASA 2V9RA 4JFEA 3I02B 4NHCH 1MI5D 3KVPA 4EBQH 1G7PA 2RACA 3D3VB 1J05A 4G8GB 2NNXA 4FNSA 3B9AA 4RNRA 2WLZA 4I3SL 3RUGB 1WD9A 3PGCA 2D0HA 2TAAA 2XA8H 1A6VH 3B2VH 5DK3A 1CD9B 3BZ4B 1A21A 4OV6F 4DH2A 1K6QH 5SWZB 3IJ8A 2DTMH 5HHPB 4L3EB 5D1XA 3SKMA 1JDCA 4FXTA 4I2XB 1A3QA 3KPPA 1ACCA 3SB3A 2CA4A 1U0QA 3Q44A 4HXBL 5I1CL 5J7CC 4OJFH 5JO5B 3C75A 1DN0A 2R29H 2VMFA 5DJYA 1MQKL 3X17A 3MOBL 3FO0H 3A47A 3OX8A 4UIMB 5F8RC 2Y4SA 1MW2A 4WI5A 3U1PA 2A7BA 1QO3A 4JFDB 4P3WA 4DN3H 5CLWA 2QADC 4WO4B 4X6BA 1I31A 4BUJC 2B39A 2GIYA 3T0AA 1ZSHA 2VABA 2VZUA 2XX0A 4U1HA 3NCBB 3P11L 4FQHB 4G11A 5EORL 2APFA 4ATWA 4Y5RD 3BKJH 4DAGH 4HIJB 4LAJH 4LLMA 1MJJA 2CBQA 2X70A 3B9EA 2GUYA 4L8BB 2WANA 2WZPA 1XQ4A 4QTFA 5ACLA 1RZKH 2XKNB 3BFOA 4L3FA 5EBMB 1N6QH 2DOCA 1UD8A 4E9SA 2XG4A 3NDYE 1KPRB 1KEGL 2CNZA 4XMWA 3LNIA 1P7QD 4JDVB 1FPTH 2XUWA 2IURA 2XOTA 2EYSA 5FKSA 4PMFA 4XP1L 3ZDZA 4NO2A 4X4MA 3MJWA 4KTDH 2YC1A 4DOHB 2FWSA 1OAYL 4JZNA 1WFOA 5EUOF 2DJ4A 4NUJA 5ISZA 5C86A 4J3OG 2CDEA 3BWAA 3VXSE 2BNRA 5CXCA 4WEUD 3GXIA 4HBQA 2IANB 3BUTA 3D6GA 2HMID 4IBQA 2KUTA 4FG2A 2ID5A 1TKWA 3NTCH 3ZKMD 5F7BA 3C12A 2HJKA 3SDXB 3N3EA 3UJJH 3UROR 4JXMA 1G6RH 2KERA 2ZNXA 2VABB 4WSJA 1A64A 4X9BA 1KENL 3WFHB 1HZHH 2A6KA 3MI6A 1OAKL 5JMOC 4PJ7F 2FK9A 2XVLA 3JUZA 1CICB 3DHJA 4Y4KA 3H0TB 1B6DA 4JL1A 2PXYB 4K94H 5K9KA 5IGQA 1UEYA 3C5MA 3V5DB 4FAND 3K2IA 5DT1H 1X5HA 2E9IA 5AAMC 1QA9A 4U1SB 4DO5A 3QFDB 3Q8FA 1IGIL 5BVPL 3FONB 4UZSA 1SJMA 2PCXA 3NZHL 2H14A 2W60A 4QJ3B 4F33A 3FM0A 4GI6A 3B5GA 4LCVA 3ULAB 4E42B 5BMFH 1OXYA 3TV3H 2BNRB 2ZCHL 1HH9A 5FLXg 1LEGB 2BWIA 3WG7B 1UD2A 1XH1A 1VHPA 4OJFL 3ZHNA 1LEIA 1YEFH 4M93B 1A6AB 5HJ3A 4TUOA 1B3JA 5IK3B 2NRDA 3RDTD 4K94C 4RVBA 1UWYA 4PRID 2CJSA 2XVGA 2L7QA 3GI9H 2E6JA 5DURB 5I71C 3N44F 4DIXA 3TYGH 3O6ML 4LPWA 4XBEL 4ODTH 3N42B 3O6LL 3DURB 1J86A 4CGTA 1H3TA 4XP4L 4Y2DA 3VQLA 3PNWA 1IGJB 2XT1B 3MRMA 1R5MA 1UB6B 1PFCA 4GAJL 4Y2LA 5AYTA 4PRIE 2X4NB 2P9IC 1INDH 4MMZC 2ATPB 1KEGH 4M02A 4XRCA 3LV3A 4P9HL 3IVKA 3CLEL 4I0PC 4DZBB 4DTGH 4FHJA 1QFWL 4AUYA 5EU4B 1VFBB 4KO6A 4MA1C 3E38A 5CJ8A 1NAKL 5BRZA 1K9TA 1EH9A 1QEXA 4WEEA 5FXCH 4DVRH 1JP5A 2IQ9L 4PCKA 1RZIA 5EN2B 1UC6A 4F7MA 1U3NA 4BZ2A 3EAKA 1KCVL 1RUMH 4OCWH 3WFEL 5JDJA 1UB6A 4UINL 4RFOL 3B2DC 3MXVH 3B7YA 3ZDXE 2V2XB 1F56A 5HYFA 3GNML 3T3ME 3QDMB 3FUFA 4XO4A 4N0RA 4ZOXA 3K74B 1AIFA 4L48A 4AKQA 4UNUA 3H7BB 5AENA 2IPUG 1MG2C 4OSUL 4CC9A 3MA7A 5BRZB 1BQRA 3T2PA 1BV8A 2H3NB 4X5QA 3P4MB 2VQ1A 4APQD 1Z5LA 3RI5F 4HU2A 3CPLB 1CDUA 4Z76B 2CHDA 4WTWA 3ULVE 1VZ3A 1JPSH 4MNQE 5T33L 1TVBB 3IETB 2LLGA 5F7EH 2ZP8A 1XZ0B 2ZKYA 5T1LD 1OTSD 4FKKA 4HF5L 4WW2B 5ADOH 1IAKA 4PTUA 5L4MA 3ARTA 1UWFA 3CCHB 3HRPA 2MHAA 4KH2A 1KBVA 4M62H 4H8HA 2W1NA 3CC5B 5AZ2H 4IRJC 2X0WA 4JZJB 3UPRB 5HGGS 3BGFB 1JGIA 3QZMA 5KVEL 4YK4C 4FFYH 4JQXA 4Y8AA 1QUNB 3P3UA 1XB8A 1XL6A 3QUKB 5DJDA 3JV5A 1OSZB 1WFIA 4F7EA 3MV7B 1OM3L 4X4ZA 4OCYL 3W38A 3QP3A 4A2LA 1A7PL 1RIVL 1XF4B 4Z7WE 4WWKB 3IBEA 4AX4A 5TQ2H 4UDTB 4PJHA 2E46A 3FH5A 1AQKH 2H6UA 4DEPB 4L37A 1RUPH 4D0BB 4IHOA 3LEYL 3RN1D 1UT2A 4XH2B 3WNNA 3PF2A 4P04A 3WDHA 2NY0B 1ZLWH 4IDLA 3ZYZA 5I71B 1I3GH 4FA6A 2Z0UA 4NWUL 4OKDA 3QQ3B 2QDVA 5M5UA 3PL6D 2IV9A 4OFKA 3O45A 4P5KA 3LHPH 4NPKA 4DTGL 2VSMB 2D4DA 2DJUA 1I7TB 3WNPA 2X9ZA 1OAJA 3Q8CA 2P26A 2EO1A 1LK3L 32C2B 3GT6A 3QWOB 4ORGA 4P46B 3KBHE 5JPNA 1DEEB 4NKOA 5HHVL 2XFGB 1HAWA 3ORVD 2A6KB 4OGXL 1RUKH 3STZB 1M7IA 1NUNB 3MSPA 4AYMC 1YDPB 3VG0H 5BO1H 2NY4C 3PWJB 3WTSA 2B5NA 2BDNL 1K3ZA 4P2RA 5CSGA 4D7BA 2I69A 2X7LA 3VMPA 4G43A 4K8RH 4KGJA 2MQ3A 1UD5A 2AXHA 4Q8BA 1L9NA 3FRPB 4WO0A 2ED6A 3OSVA 4FG0A 1B6UA 3Q06A 3BIBX 3MRBA 1T7XA 4F8TA 4Y8DC 5IMKB 1KJ2B 3EH5B 1GKEA 2PXYD 4JRYD 5FOBA 1NTDA 4WHCA 3OZ9H 1AI1H 3X12B 1MNNA 1GCFA 3HE7A 3QG6B 3DUSB 4DCQA 1CLVA 2Q3ZA 5IQ9B 1HT6A 4F7KA 4M7LL 4QLRA 3KYMB 2HKHL 1RJLA 3EGDA 2VMDA 5FHBH 3QFGA 3VNYA 2H32H 4PWKA 3FU9A 2YUVA 3INOA 3C5ZC 2F58L 3PAYA 2V2WB 1ETJA 2WCSA 4B3EA 1YDPA 4NCC2 1HHJB 1D7CA 3PAVA 1C9SA 1BD2E 5KVEH 5CXBA 5B21A 3MYZA 4XXDA 1FVCA 1NUGA 5CEZD 1RSFA 5E23A 1A3LL 3MRPB 4M6AA 4XO8A 4UCFA 3CDGA 5IHUH 3J80g 3PL6C 3SODB 4K8RD 2J4WL 4Z7AA 4YXKH 1GIGH 2YMUA 2GHWB 2EQDA 5D93B 4FXGB 3IFLH 1A7NH 1S3KL 3AAZB 2YMXH 5DK0A 3VXMA 4XN2A 1MFEL 2VNCA 4K3EH 3UYPB 1NGPH 3AGWA 2XBZA 1I85A 4I85A 4Q9RL 2R4SH 4XN9A 4I1PA 1AG6A 2OTUA 2I0RA 4JFWA 3OJDA 4G3YH 4K55A 4OLXL 3SQOH 1AS7A 3NMEA 4X9YA 5EBLA 1P84K 3GMOA 1KJMB 3RTQC 2FBJL 5JQIB 2VR6A 3L3OC 5EFIA 1P4LA 3F01A 3LQAH 2Z91B 4N0CC 1IFRA 5K69A 5E8PA 3UAAA 3MRFB 4D0DB 1RK0B 1UZ6F 3ILPA 3BQUA 5A1AA 4YX2H 4AGLA 3VYOA 2WXFA 4HWNA 1JF1B 4JDZA 1E4XL 3AREC 4Y1AA 1PBYA 1JOFA 3KVDD 1H3PH 5I74C 3AXLA 1TCMA 1JGEB 3QIUB 1QVOB 3DSNA 3FUNA 4ALAC 5E6ID 1CR9H 3FT1A 4PP2B 1ETZB 2ZOTA 4WTZA 1P4BL 2MHAB 1GOFA 1P4LB 3ETBJ 1U36A 2CNXA 1NFDF 4N0FB 1DUZB 4WKXA 1A4KA 1QRNE 3NIFF 2YAQA 4U1JB 4Y5VB 4EZMA 2ICWJ 1U8IA 3ARDD 3ZE0A 4KZ0A 4RX4D 3CVCA 3HZMB 4L3CA 1UD4A 3E3QE 4EXPX 1TZOA 2AKRB 2UX6A 1GAFH 4JFFD 3DO7B 3I7KA 1I8UA 3RVWD 4G1EA 4PGEA 1U8QA 5ECGA 5F72S 1FL6B 4YS4A 3TXAA 1MFVA 4KTDL 3HJEA 4L1SA 5D72L 2EYRA 4FA1D 5M5RA 4XNDA 2H9GB 4O45A 2R0WH 1NANH 3N9GL 5LXGL 4YZWA 5LXVA 5FC9A 3RWIA 1KXHA 1M53A 3ULUL 3QISA 2ZX7A 1A3LH 4TN9A 4CBZA 1OAUL 3MO1B 4NOBA 1P6WA 3OKMB 1B0IA 4MJ5A 4DP8X 2X4OA 4YXKL 3RRMC 1YYLH 4GKNA 2JELH 4U1MA 1ZLDA 4TULL 1AGCB 3O2WL 1N2RB 3DPBB 5ESVB 1VGEH 4X6FA 3VJ6A 5I1DA 1DBBL 1PD6A 1PFOA 1X9UA 2LE9A 3UAJC 1PSKH 5D2LB 4R0LC 1ZHBA 3UCQA 1EFXD 1XV8A 2CUHA 2KZBA 4G5ZH 3NABL 1O7DC 1KCSH 3ZQXA 1GGYA 1N3NB 5D4JA 4GG6E 4NXKA 4IRZH 1CZ8L 3BZFA 1TJMA 2AJUH 5D5MB 2AMUA 4AENB 3FTSA 1KFAH 2YEZB 5HI4C 2QFPA 3FQRB 4HJEA 1NZRA 2FSDA 3FRPG 4MAYA 5DJXB 2V5SA 3HZVA 3K46A 5DMJB 2CHNA 3SZKC 5AYUL 4YAQA 1JS4A 3UBXG 3F58L 1NR0A 2X4OB 1IIIA 3OKEB 2NY7L 1YEEL 3AQYA 4PV9A 3RVWC 5EUKB 4XHJC 2V8LA 1T1XA 5EZJA 4WV1A 4LOEA 4IU2A 2DYPD 2DB8A 2VQ4A 4NGHL 2YAOA 3Q5YA 4HKZB 2EE2A 3TN0B 1EEUA 2UY7A 4HJTA 2FL5B 3DVFA 2ZUUA 3O6FD 4H7VA 4KK8C 3P30H 2IXQA 4ODTL 4QOKE 3TYFB 2EJ1A 1A7QH 1TTRA 3I2NA 4U7MA 3T0EE 1XR8B 4GAJH 4U3XA 4PS8A 4EVNB 2IH1B 2OQJA 1KSRA 2ZWNA 1MCFA 3MLXH 3MRHA 4PNKB 1X5YA 3ZOAA 3HG4A 4PP1D 5DZOA 1UM6H 5F9DC 4RFEB 5IFHL 3DYOA 4WFED 1SHWA 3REVA 3S3PA 1N68A 3THML 4EIUA 2VC2B 4QOKD 3PUUA 3CUPB 3ENEA 4MA7H 3ZTNL 4X9FA 3FRXA 4F7PB 1E6OL 1FGNH 1NUDA 4XNZC 2ITCB 3EJZC 4QLWA 4JZNB 1E3ZA 3HE6B 1UB5B 3ETTA 3H55A 4WGVB 1FIGH 1CG9A 3EI2B 3O2DL 5GMKn 4ZMWA 2IBZY 1LE5B 2VZ1A 2HKFH 3O4OB 2WNGA 4QRTA 5DCCA 3X13A 1AO7E 4UU9A 1WAEA 3HTLX 3VGHA 1Z2KA 5HYEA 5HI4D 5KJ7E 1K4DA 3GJFA 1XSJA 2CRZA 2FUQA 4FG6C 4LEXH 5GGQH 3W9DA 4E0RB 4I1RA 2JQAA 3R1GL 3CMOL 1QATA 3EH1A 1F58L 4I77L 4WU7A 2Q20A 3CDYA 4JAMB 5CINH 1FRGL 3AREB 2BX5A 3LS5L 3B6SA 1SNRA 1AP2B 3IS0X 2R7EA 1X9RA 3H6JA 2VXUL 5IIEA 4NHUB 5E1GA 4O9DA 4XWGH 1W15A 4Y4FB 2R4RL 2AV7A 1SOQA 4I79A 3G04A 4HOZA 5D93C 3F3GA 3K91A 3G5YA 4MJID 3BVDB 5C7XH 5IBTL 2LU7A 4YBHA 3AJ7A 1B3IA 3PNRB 4GIOA 5DZ9A 5FGCB 3CU1A 1F45A 4YDZA 5HDRA 4YSEA 3NA9L 4R96B 3BZEB 2H9LA 4QRSB 3PWNB 4H25B 5CBEA 1G43A 2KDGA 4PCYA 4J0XA 2H3KA 4YBLB 3T9WA 1CFQB 4NYLA 3WHXA 1KYDA 4WSGA 4N28A 3B6SB 4P4RB 3QBTB 3NCWA 1FH5L 1CK0H 2EIMB 4ODUB 3G08B 2BOBB 3JTTB 1QLEL 2DQCL 4OM0L 5C0AE 5IWLC 3F7VA 5AB9A 1ED3A 1FNSL 1TSRA 1IKNA 2EYRB 5IQMA 2KS0A 3IFOA 4IBTA 4X5XA 3D69B 5LO7A 1WGOA 1M71B 1MDAA 3N0AA 4NJAH 4NBMA 4BDVA 4DT2A 3VTAA 4F9PC 4QAMA 3MLXL 5KS9A 4HGWA 5E1IA 4ZPTB 1HCFX 3HI6L 1DANT 1U4CA 1HI6B 3ISRA 3W11D 2A6JA 4NCDA 4JE4B 4FA8A 3UJTH 1T66C 3T65B 3VGGA 4W9ZA 1FLTX 5A2AA 3IE9A 3GBNL 2Y5EA 5IB2A 1XR9A 2BVQB 3DPDA 4NM4L 5C08B 3W56A 4XBGB 4XPFL 2XV6B 3TPKA 1PZAA 1G9MC 4O2EB 4WY7L 3ZYIA 2B1AH 3V0AC 5FO8B 4F15C 4PJHE 1P5UB 2DLEA 4Y2NA 5ID0A 3FUHA 4EI5D 5G4MA 4KPHH 1QFPA 2Y7QB 3HZYA 4BIKA 1HKLH 5A6IA 3TEWA 1U8KA 4L4VB 5K1VA 3QUZB 4XAWL 3MACH 1NGZA 4QTHA 3F7VB 1XCQA 4KOBA 3A21A 3H7BA 4H8WL 3RL2A 5DO2D 4IA9A 1YY8A 3CMOH 5IB3A 3UZEC 1DFXA 3HG1A 4NKDB 5CD5C 1JTPA 3KPRA 1I3VA 5JHLL 2QADD 3FU3A 3WN5C 3ZUNC 2CZNA 1QFHA 1BZEA 1R5IB 5SX5H 3OKEA 6FABH 2OZ4H 4WCYH 4M3JA 1HSBB 4WW2A 4IU2B 3ZU8A 3B37A 5FKAB 2JKSA 4YFLF 1DLFH 5DSCB 4BK5A 5D7LB 2Y6SC 2JCCE 5IBTH 1ZT4B 4P46C 3IXTB 1AQ8A 2E6PA 1UJ3B 5DI8B 4CU6A 3G5WA 4YXHL 2H47C 4JEGB 3ZO9A 2BCMA 4ENEC 3S3CB 5JORB 2VDOH 4AEEA 5M5SA 5L88L 2OMVA 2IEPA 3QUKA 2Z65C 3FF7A 3KXFA 2FNBA 1K5NB 4QUOA 2OCCB 4MMXA 2Z92B 1A6WL 6PAZA 2D4FA 4TNGA 4NSKB 5EU5A 4AGQA 2AERT 2AGXA 4FWWA 1WCBA 3GSXB 1OGPA 5C0JB 3ZKMC 3MKKA 2HYMA 1JV5A 3G5ZB 4LSUL 1BVKB 1KTCA 1V8HA 4NDMB 5DF0A 4NQXB 4PY7A 3SDDD 4ELMF 5J11B 2WY3B 1N6QL 4OLXH 1W6WA 1SRDA 5DMIH 4EMZA 1W72H 2WLLA 4U6YB 3NACH 3UTOA 3DX7A 1YMMD 4ANVA 4A2GA 5THAA 1A02N 3GMNB 5E6IA 1GGBH 2XV2A 4QRTB 1M05A 1HIMH 4F80A 5EU6E 4OZGA 3D39B 5HDBF 2E8YA 4IU3A 3N41F 1UWXK 3DBXA 4PWIA 1AZZC 4N25A 2V2TA 5IBLD 3FQUB 1IKFH 2L04A 1TPXC 1WA1X 2IWGA 3Q2VA 4H8UA 4HV8A 5C09A 3ISYA 1KTDB 5I0DA 1IX2A 4G43B 3L9RA 5EBWB 5F0JB 5KYYB 2BW5A 4K73A 3FTGA 4OQTL 1AGEB 4Y89A 3DECA 1I9IH 4NHUA 3WY1A 4B27A 3O3EB 2CU9A 3NZUA 3BH9A 5ECJE 2D2CC 1MPAH 3U9UA 4C54A 1S7RA 2QKIC 5B8CB 3Q6GL 1KTRL 1HSAA 3B3IA 3RVUD 3NEOA 3RDTC 3X1BA 5A43C 2ZOWA 1NH6A 4R7DB 1OP9A 3A6CL 1KLGB 2BBKH 4DK6A 3FCSA 3NN8A 3VXPB 2A5UA 1B9KA 5F1IB 2OYPA 3EJYC 5BS0E 2VRQA 1IGIH 5BVPH 1QSEB 1AXSB 2ZD0A 5AW6B 3SCMD 1HXMB 2NY6C 1EEQA 1C5BH 1FO0H 3NJFA 3OPZL 2P7TA 3MJ9H 2H6PB 3IN0A 4LRNL 4QGYA 3V2AR 4UBDC 4DGWC 5GRYA 3F6JA 4DNLA 2Z7YA 4K7FA 5AMSA 3QJXA 1G9ML 5CS7A 2HN7A 2W9EH 5HVWA 1XWVA 4GUPB 1Y07A 4XB8A 2RHEA 3ML9A 3NIFA 4KNSA 4Q58C 1Q0XL 2OZNA 5H94A 5H4ZA 1EERB 1CDJA 5L88H 5IK3A 4P5TC 3RAJH 1A6ZA 2JKIS 4ZMVA 4NZUL 4YDKL 3FTGB 1VCAA 2G5BB 3PY9A 4POZD 5IMOB 5I75B 4WW1B 3CFDB 2CDFB 3V6OA 3RFHA 4PY8J 3O6KL 3AB0C 1YEJL 3QIBD 1YJDL 2P7TB 2K70A 4NWTL 4U6VL 4WWPA 3FU5A 1FDLH 2DLIA 2WXOA 1PS3A 2ADFL 3BD4A 3BEWA 3UEQA 4QKXB 4LSUH 2I9TB 3VXMB 1I4FA 4LCYB 3V0DA 1NAMH 3HJ0A 4ONFL 4GRLB 2YD3A 4V1DB 3VXPA 4LEOA 4J6RL 4PJEB 4Z23A 1KC5H 2O5NA 4NQEA 4J2XA 2XWZA 3RTLA 3GBEA 4Y4HC 5I26A 4Q9CA 3GIVB 1G0YR 2VDOB 4FADA 3A4EA 1A1NA 3L4YA 1YLBB 4N87A 2CBTA 4G9FB 2QLVB 4AC2A 1SMAA 4ADGA 4E9QA 5IV2A 4POUB 1RU9L 1THCA 1YC7A 4X99B 2H4EA 5EC2A 5F7LB 2MRYA 5DR5H 5GGVL 1J5DA 5GSRB 3B7RL 4GM8A 1QSFB 5FECB 1OO2A 1X7TA 3C99A 1NC4D 2DJSA 1N0LA 2R69H 4AVHA 1GPOH 2AEIT 1KBPA 4FNRA 2YGPA 4PIRF 2QVKA 1TYRA 5IT2L 1R3HB 3FO0L 5C0AB 4HEPG 1S4UX 3TPUA 5DA4A 4AMWA 4EPSA 2GHZA 4ZMZA 4AQAB 1VE6A 4PTTB 5JW3H 3V6BR 2R2EB 3RWJB 5AVVB 3T4AB 1QHQA 1W8EA 3V0WH 5I6NA 3DC0A 3O41B 4S0SD 1E50A 5AW7B 3HPJA 3AL8A 3FO1B 4MQXC 1U9KA 3MLWL 4IK6A 1UFUA 2CG9X 4RAUA 5FO7A 4ZD3H 5GZOD 1IAIM 1BBDH 1W0VA 1NWPA 1N2RA 3VFGL 2DQGL 4TUUA 4IJ3C 5E4OA 4F9LC 3I7OA 3VJ6B 4F58H 2QPDB 3GBMH 3N85H 3QNYB 4ZQKB 3RNQB 1WO2A 2RGSA 1KWKA 2KMWA 4XMUA 1E4WH 2FE0A 5IGOA 4YO0B 3ZZSA 4AL8H 1PKOA 3MR9B 3WXWL 3TIDA 4BSVA 3R4DA 5HDBA 4I9WE 5CF3A 4RMVA 1AHWB 4ELMB 3ARXA 3X1NA 1S5IH 5DRXA 4FLRA 5E6YA 1J48A 4CC4C 2NY4D 4AXWA 2EDWA 3DGCR 1G7IA 5C07E 4XMKL 5JW4M 4OZGE 2MQGA 4AEIH 5BOPA 4MMZA 4LEBA 3C5SA 5KSBE 3NJGA 4HIXH 3SQRA 3ECBB 1GGTA 1E8ZA 5CP3A 4AITA 2HFGL 1NCOA 4LVNC 2H8PA 2FO4A 3S88H 3OLEA 5T1JA 2EDLA 1P6FA 5D1ZD 4ES8A 5CJQL 4EI5B 2QFRA 2CO0C 3U6RA 3HG0A 1D9KD 2G9HA 5KJRH 4Q7DA 2DN7A 5FYKE 2AQTA 1EXGA 5FXYA 1KGYE 4HUWA 1Z3GH 5FFOA 1NICA 5DZNA 4I18C 2IXQB 5GRVL 3QJQB 3SXTD 1KJ3H 1FLRH 2VDQH 2XXGA 2LFEA 3VD1A 1DQJA 3ARYA 4P5TA 3VG0L 2RCSL 4Z7VB 3ZTCC 2OYKA 3F7RA 3FQWA 4K7PL 3ECBA 4TNWF 2IH3B 2WBJB 1HKFA 3QJTB 5C9JA 2QPFA 2H8PB 4K3DH 3N0PB 4FAAB 1M2VB 3NJXA 4JFYB 4OZIA 3T3MB 3RWCA 2OMTA 1R5WB 2G2NA 1SJVA 3K2KA 3QJOA 2H1XA 4RIRA 5LAPA 3EF4A 5J0BA 2HSIA 2AGJL 3QO1B 4PS4L 5JW4R 3LSOA 3IMVA 2WQAA 1HL8A 4Z7QB 1WWBX 3OAZK 4XYHA 2HLAA 1CU4H 4AJVA 4O3TB 4AMYA 3NFNA 1EA9C 4GT0A 4QXUH 1QRND 4E41B 1DL7L 1NC2A 3CAFA 4ODHL 1YYML 3RA7L 5CD5D 2F2HA 3CSYA 2J21A 3KJ4B 3ZX1A 1ZHKB 2VE6B 4CU7A 3CFDA 4YWGL 2E5EA 4KROD 3OAUL 3OKTA 2HXCA 2HJBA 2YJQA 4PS7A 3S5LG 3QZWG 4OD2B 3E8VA 5ERWB 5IHLB 4HPHA 4TQEH 1QYGL 4TQHA 2E27L 2J55A 2JI1A 2A6IA 5KBPA 1RIHH 3CN1A 4Y4FC 2XXFA 1IFHH 5L2KD 1IQDB 2CCWA 2Z35B 4XBMA 4PH8A 2K8QA 1U8PA 5BZDB 1R0AL 5J1SC 2G4EA 3QIBB 1C8QA 2Z1KA 2V0AA 4H8WH 3MJ8B 4NJ9L 4XMKH 4J27A 4NUJB 5ISZB 4HW6A 2IJ0C 3VO0A 2ATKA 1I8AA 3OLDA 4OH2A 4PJBA 4TVPL 5HYIA 1SVZA 3NFNB 3BWSA 4G7YH 1T83A 3FT4B 3MXWH 3MGTA 3CXHK 4TL5A 4LVOB 3Q6FB 4ONOA 5F6HJ 2VW7A 1MF2L 5GS2H 2V9QA 3V8OA 2WXKA 2OMUA 3N43B 2BVYA 2X10A 2YN5A 5D1XC 1OARH 3WEOA 1S8DA 1Z3GL 1MRDH 5CCJA 1IAMA 4UM8B 4AK1A 2J72A 4XNUH 2WLIA 4PCSA 4KZEL 3TIEA 1O6TA 1MAKA 5JIMA 5C6TL 4BFIA 4WWKD 1S9WB 1Q9OA 1EHNA 3NSDA 4K7PH 3SE4A 2XQBH 4A09A 1MFDH 5IG7A 2WUCL 2DLFH 2WO3B 1AKJD 3I9AA 3MV7D 4JJOA 1KJ2L 3NP3A 1E8XA 3AT8A 5FUOH 2D7NA 1JMZA 1EO8L 5TF1L 4Q74A 3I7NA 2VZ3A 1ZA3A 1AGDA 2ZYRA 4XWOD 1EO7A 2VDNH 1ZLVK 3DIVA 4CN4A 1I1AD 2V9UA 2A0LC 4AX3A 5J6HB 3Q7JA 4L29B 2MCMA 3UAJA 5HJDA 1T4KA 1T80A 1QQDB 2QPUA 3F12B 5GS1C 3UJIL 5C1MB 1BQHG 4KKAC 2Y7QA 3GJFH 4TUJA 4Z7IA 2Q3AA 3DA0A 4X6DA 5C97A 3WEMA 3ZT6A 1ZVYA 1G1OA 5CWSB 1U4FA 3SCMA 1ZWIB 5HHQB 5LHDA 4S1SL 5T3XD 1OCRB 1X4XA 3EMHA 2VMJA 3F3HA 1MZYA 4OIAA 3FU7B 1SJXA 5CMAA 4YSTA 4ZUTA 4C59B 3UZQB 1IT9H 3QDHA 3QYMA 5H37H 1EEZB 5I6MA 3G7TA 2EDYA 1CLCA 5FCUL 1RUKL 3IFPB 3ULUH 5IROA 3NZSA 1OAUH 5DJDB 3EOBB 1PQZA 3EYVA 4MCYA 1JZEA 1SY6A 3DDGA 1BIHA 4XN8A 1YYLL 4M29A 3X11B 4U1LA 1YNKH 1JGVH 1H5BC 3ARRA 2GJ6D 3VQMA 2H32B 5DHVH 2DWXA 4WV1C 1AYRA 2YHGA 1EX0A 2CNYA 1ZTXH 4J3VA 4O2FB 1L7IH 4ZYKB 2N3JA 4FFWD 1UACL 5EOCJ 4NC1E 4XHJD 2F5AH 4MXWL 4HPOH 1X44A 4JBSA 2ZUTA 3DURA 5C0CA 3BPOB 1D5IL 3M45A 2CAKA 3PP3K 2JKXA 5DJ2A 5B1CA 3RWHA 4YOKA 3BH4A 4M7LH 3UTTD 3W2DH 3KNBA 3OQ3B 3LRSB 1LEKB 3OKWA 3TZVC 4HDIA 4JANA 4NLHA 5T3XH 3VMNA 3WFCH 1KJVB 3BT2L 2W9EL 5I30H 4CMMA 3ILQC 1ZT4A 5B4MC 4BFRA 1ZIAA 4JO8A 1AKJB 4MJIE 1UHVA 3GYRA 5EN2A 4PJ5D 2JQMA 2RBLA 3C5ZB 1IAKB 3L5JA 1RUQL 2DM2A 1DSYA 3U4BL 1S7TA 2XL3A 4XYIA 3KW8A 4QO1B 3DX8A 3ARDB 3EO9H 4B96A 1IUZA 2E7LC 5D2LF 4JG5A 3DKHA 1DQQB 5FO2A 1M3IA 4GP4B 3E9TA 4PJ5E 4ZXBC 3UBFA 5EU5B 5T5FH 2YSSA 2FEJA 3NK4A 3G5ZA 4HISA 3RGVD 3UX9B 3HN3A 3TU6A 5EWIH 4PGCB 1E9QA 2VLRD 2XKSA 3CPLA 1DQKA 3NJIA 4LDLB 4YHZH 3H3PL 2DWDB 5PAZA 5HSFA 1T04A 1FC1A 5E9DA 1XF5B 2YKLH 1AGEA 1T5KA 3HMXL 4MA7L 2W0PA 3KWUA 5DMYA 5LQBH 4HKXB 5DS8A 5ISZD 3NZHH 4ODWB 4F7PA 4IKIA 3GSWB 4BKSC 3VDBA 3ULUE 1EWHA 3S3DB 1WZKA 2ZG1A 2VJ0A 2I9LA 3EGSA 3MFFA 2GSIA 4LXFA 1JZ8A 2LVEA 1OOWA 1YEDB 3PVWB 2W38A 5AOLA 2A77L 4ANUA 3HN5A 4LLVB 1M6UA 3P73B 1E4XH 5L4JA 4GO9A 4ZTPH 5C09B 3NUKA 4Z7OF 4PJ9C 3DOSA 3NVQA 4KO9A 2E9WA 3I50L 2EC9T 2HT3D 4FZEH 4JHBA 1MHEB 4KVNL 1ZTXL 1CE1H 1MJ7H 4P49A 5DTFB 4XC3L 5CFHA 2IO5A 2JKLA 1AR1B 2WWKO 3H8NA 1ZK9A 4AH2B 3OKKA 3QZWB 4MDIA 1HNFA 1UVQA 2DQMA 2OTWB 4NPYB 3T6XA 3QW9A 2HJLB 1EHLL 3KLHD 4AYGA 1ZLUH 2YXFA 1MFBL 2FAUA 3EYFB 5ANHA 5ESAB 1Q0EA 1F5WA 3LEXA 4NAJA 3GSRA 3AQXA 2IAMD 2NY2D 5TD4A 1MVFA 3GFUA 3T5WA 3V4VH 3TOPA 4TOYH 2Q3XA 5FUZL 4OCNC 4XNYH 4QF1B 2AK4E 3AMLA 3QEUA 4N8PA 5E6UB 5C0FB 2I9LB 2M1KA 3PJLA 4JDTH 4RRPA 2PYFB 1FC2D 4GFXA 1FZKA 1QNZH 2LQRA 3BESR 3DGGA 4NENB 1XGYL 3WJMA 3FRUA 5ICUA 4CC1A 3DWLC 1H5BA 5E9DD 5HYJE 2XSKA 4PV1C 2X4SB 4AN1A 2DD8H 2JNZA 4JM2A 2EDTA 1D5ZA 1REIA 4G9FD 1CXLA 5EU6D 3V52H 1ZT1A 4R3SB 1A4AA 2FSEA 1JD7A 2C4FU 1URZA 2HVKA 5DUPH 3B2UC 2FDBP 5E6UA 3IFOB 1FNSH 1CDIA 5E94B 1PNCA 4X2UA 2Q2LA 5HVFB 1IBGH 4D3CH 1FNGB 3B3BA 1KIUA 3KYNB 3WJLA 2HH0L 2FB4H 3TA4D 3GSRB 4PVMA 5I66A 5DS2A 4IOFD 4PJEA 4N3UA 3MLZL 2F54D 2CO7A 1ADWA 4D9LL 1M6OB 4YN3A 1CDGA 3VE0A 3U4YA 3POHA 1G1KA 3TBVB 3LDBB 1JWSA 2DTML 2D73A 4XN5A 3E1ZA 3R0MA 2I7SA 2ARJA 2PWDA 1EDHA 5JHBA 4N8CL 2O6FA 4ZSOB 4RLDA 5FGCE 3V5HA 3BYTA 3G5VB 1QD0A 1URIA 1OQXA 5AFAA 8CGTA 1KCBA 1U8KB 1FVCB 3V55A 4U1MB 5D4IA 4DGVL 4PSRA 1ZT1B 3LRLA 1A7PH 1RIVH 5AOIA 5I1EH 2QR5A 4PLKD 4FHBD 1XGTA 2EH7L 3DX0A 2X40A 2OL3A 3HRZA 5FAAA 3GSVB 1Q9KB 1MCKA 4MA3A 3FOMA 4Z0BH 3QDAA 1TETH 5CD3A 4F8LA 1Q47A 1LWHA 3UR4A 4BP9A 1T5WB 2GJ6A 4QXUL 1NCWL 1F90L 43C9B 2EDDA 3K26A 3V6FB 1IE5A 3C8DA 5AB1A 1I9RL 1YYMH 4F3FA 1I9JH 2CHWA 3ZE2F 1FV1A 4QHLB 3OR7B 4LNRA 1WLHA 1QR1A 3V10A 4EUPB 1HJCA 4EIBA 3TO4B 1E3XA 4PD4J 5CUSH 3HCVA 3FMGH 3L3DB 3JTSB 1ZV2A 2NDFA 1DVFD 4EN3D 2OJ1A 1SY6L 5MERA 1NFIB 1SFHA 5T3ZD 1NCBL 3EU7A 4YXHH 1R24A 1X5ZA 2VDKB 4B60A 5FEBA 1C1EL 2WQ8A 3TO2B 5E0FA 3LXCA 3RWFA 3UGUA 1GY1A 4WHYH 1SM3L 2G5UA 1T1WA 4FRWA 4WWOA 2AQQA 2VR4A 2D7TL 2ZJSH 3JZYA 3NSJA 4M5YL 2X3BA 1RZJH 4QEGA 5D8JL 3C6LA 1NLBH 3ECVA 4V1DE 3NTCL 5EOQL 5AAWA 3L95A 3E6FB 5T3ZE 4DWHA 3DJTA 1UWGL 1IGCH 4Q9QH 1V3JA 4GGCA 2I27N 4LEEA 4U3HA 3V0GA 3L3IA 3VFRB 1MCPL 4KNTA 2C5DC 4CI2A 4U6HB 2ICEA 3N1GC 4E9RA 4R4BB 3IDGB 2WXLA 2I7OA 5F97E 2JXMB 4H20H 2FIKB 3ZJAA 3FO2A 2CLZA 2WWKT 2JLLA 2JJSC 2WLLB 4U6YA 4OIBA 4Y9CA 2BNRE 2CBMA 3TBWA 3C60B 3UFIA 3K4ZA 1OARL 2TRHA 1HQRA 2DQFA 4G1EB 1OAZL 1AD9A 5LNGA 1D7BA 1GGIL 3FT0A 4U1KB 4OM1H 4QHUB 3I84A 2O1AA 3HE6A 2AZUA 4P5TB 4NIKB 3RX5A 3NA9H 2F7RA 3GMPB 1JHTB 1H0DB 2JTDA 5B8CC 4QXGH 1YEWA 1F3JB 1PCXA 2AQ2A 5LAXA 3O0RH 2L7EA 4NZRH 1E8MA 4A1RA 2FD6H 3KLQA 4HS8H 4P2AA 4PRIB 4KKLD 1J10A 2HRPL 3VFOB 4U1IA 5GZND 1FH5H 2CWRA 2VC2L 3VXSA 1ILUA 4PAZA 1RZFL 3FF8A 3QJHB 1RUAL 2BO0A 4NEHB 2X4TB 1NIFA 1E42A 3LN4B 3X14A 4MB4A 2YMXL 2ICWI 2BM3A 2C7FA 1J7VR 3P54A 3SN6N 4GGDA 4HJGB 1VGKB 4P2OC 4GRWH 2G0LA 2IALB 4ZG1A 4E41A 5I9QC 4P9HH 2QVFB 1BG1A 3JWNH 3NIDE 1NOFA 3OX8B 4KO7A 3OPZH 4FXGA 1NBYB 3WEXA 2A9ML 1PEVA 4CZXA 3OC8A 3MTXA 1ZHKA 5C07D 2VDQA 3E8UH 4ALAH 3SOBL 4XNQA 4EAEA 3PHSA 2VW6A 2OLDA 2ZKHH 5AVWB 2EIEA 5F3HB 3T8XA 1RLWA 2VUKA 2QQLH 4M5YH 2H0JA 4FGMA 3WFEH 1NLBL 1DTUA 3IGAB 3BMVA 4TLTA 2DIAA 1NCDH 1NBVL 3BLBA 1GGUA 4X60B 1M1XA 3E6HA 4RGOL 4PGJA 4PJXE 3UG5A 1H8SA 1H6TA 1OY3B 1WBZB 3D9AH 3FTWA 5IWLA 4Q9QL 4AL8C 4DEWA 1L7IL 3X14B 3BKYL 4X6CF 2FWUA 2HA1A 1CS6A 3N04A 4OCRH 4MA1B 2PXYC 4FQJL 1JF1A 4JDZB 3DMMA 5D6DC 4PGDB 5LGHL 2CE8A 5GXIA 3ULVH 5DJZB 5H35A 3ELAT 2D03H 2OL3L 1OZUA 5LKNA 1PLAA 1NGQL 3JQOB 4I4WA 5C6PB 3MV01 2X4QB 1RP9A 4KZCA 3QH3A 1ONQB 2Q7NA 4H26A 5SWSB 5FLVA 4YDVA 2BCJB 1XGTB 2QVIA 1INEL 5D72H 1KN4L 3FOMB 5SX5K 1ASQA 2XY1A 5I24A 3F7QA 4DVBA 4ZNEA 4XP5L 1W16A 3N9GH 4P2OD 1GS7A 4XO5A 3CXFA 2PPFA 2WTRB 1O6SB 4B9IA 3MRRA 4Z8FL 2PPCA 1L0XA 1AO7B 2HLFC 1UJ3C 1KIQB 1MWAB 1T4WA 4LMQE 4MD0A 3B43A 3U9PH 4OIIH 1AIZA 2IANE 4TNVF 1QR1B 1U42A 2Y7OA 5ALCH 4LG8A 2XN0A 3QPXH 4W6YB 1WP6A 3L9EA 4BSWB 3R8QA 3RWDA 3FB6A 3MBEB 5ITFB 3NSYA 4HUXA 2DY2A 4DP0X 4OZIF 3TTSA 4K9EC 5HHOD 1MCQA 2XX1A 4G5ZL 4PM1A 3VWJB 5L2KE 1U8NA 2EE6A 3RWEA 3C6LB 3LB6D 3CIKB 2FZ3A 2COVD 1XGQB 4XOAA 5BW7A 2AJUL 2DJMA 3MCKA 3IJSB 4F58L 5FLUA 3MNZB 4Z7NA 5CILL 3V9FA 4DW2L 3T0EA 2J25A 1BREA 1X5JA 1JCKA 1QZNA 4JPVL 1TYEB 1LNUB 1TZGL 3PNWB 3TM6A 1NIDA 4LSTH 1OAXL 1RURL 1TLKA 3IF1B 4B9ZA 4RGMC 3P0VL 2Q76A 1D2OA 4ATTA 1YQVL 3NJHA 4JFZL 3EGDB 1R5VA 3MCYA 2FQDA 3QULA 3NCCB 4HMDA 3QCVH 4E9VA 2Q5BA 5EZPA 2VM9A 1HDMA 4GUCA 5IVZB 3RZCA 4HS3A 1CFSB 2EXYD 3UBHA 2LHAA 1PEWA 4UT9H 4DP1X 4X5XB 4PW4A 4XPBH 2YD4A 1NPJA 3N50A 4KFZC 3ULVL 4JFPB 2FZ3B 1D2PA 3ARDC 1KIRA 3L4MD 1G9NC 2E59A 2VZVA 4Z3IA 3U48A 4FQQB 3MCKB 5BZWB 2J43A 1J8HB 3VI3B 4X8GA 1MCSA 4LCUA 5H14A 3IJ1A 1DQDH 3ZDZF 2V3EA 5AOKA 1NGXB 2CGZA 2GFBA 1OV8A 3RVVC 1FA4A 3R06A 3REWB 2QJDA 4WIQA 3EFDL 2KBGA 2WUBH 5JHDD 4P4KB 3INUH 4XCYA 2BHYA 3GKWH 4ODVL 2ZX9A 5KVEE 1TOXA 2QMJA 4HJGA 3RJDA 1FIGL 3TCTA 1KTDA 3ARFD 3D30A 4R9HA 1GMEA 4WI3A 1RI6A 4AT6A 1FSKC 1IGTA 2F53B 1DSWA 5DFVC 5GZNA 4JFYA 3L6FA 4OCYH 3HZYB 4OZIB 5J06A 1M57B 1MH5A 4JMNA 1T1YA 3MUOA 3IXTA 1KJMA 1NGZB 3MTRA 2VERN 3BC9A 1TTAA 4KRPB 5TE6H 1H6EA 2YARA 3O6KH 5FK9B 4HJ0D 1JNLL 4MD5A 2OJYA 2YNNA 2DQTH 3DO4A 2FEDD 4NP4H 3DLQR 2Y7NA 4HK3N 4WNQB 3KG5A 3UPRA 5ICZA 1TSHA 4UV7L 1IU1A 2W80C 2XJLA 2VDLL 5C0GB 2FJGA 1J5OL 5EUOE 4EJ1C 1UWEH 2P3YA 4KC3B 4JM2F 4GMTH 1PAMA 3STBA 1AKPA 4H0LC 3B2XA 5GSVA 3HBZA 2FBJH 5GJTL 4H0HB 5FF6A 2WP3O 2KZ1B 5KN5A 3WTYA 4DQAA 4ONGL 3B7FA 1YSOA 1U8CA 2IG2H 2A74C 2A3TA 2X4RB 4FNPA 4XCYB 4KOCA 2XZQL 1MCJA 5E1AB 1CVSC 2A6IB 3T2LA 1UJ3A 3GTTA 5DI8A 4HLEA 2YD1A 4P2YA 4E5XA 1E40A 1SDDB 5MP6L 1FNAA 1PG7L 3FRPA 1ERJA 1UJTA 1ZHNB 3MUY1 1YEHL 5DVKA 3J8F7 3WFBH 3BRFA 4FG4A 4L9LC 2ZUSA 2V2XA 1CF1A 3IJHB 1QBLH 3BO8B 3P40A 3FW6A 4X7DC 4S2SA 3QYCA 2JTYA 2ESVB 3RSEC 4DK3A 2V2TB 4H4NA 5JPNB 4J7RA 1U92B 2MOVA 1L7TL 4LDEB 3GHEL 1E8WA 5EIIG 1U3YA 1GGCL 1X5FA 3PIQA 4FNLL 1GHFL 2Q86B 4ADJA 1KTJA 4RMSA 1T7VA 3P3SA 2W18A 4M3KB 3QE5A 4D2NA 4M6NH 1IC7H 1AO7A 1I1AC 4Z3GA 4MX7B 3DX7B 4YZFE 1VZGA 2YEVB 5FHBL 3T0VA 1JZ5A 3M8OH 3O4JA 2ALWA 3RBSA 5AW1B 4UQAA 1HHJA 1P9MC 1I8IB 1J18A 2WO4A 1JYNA 1NBQA 1X4ZA 4E5XB 2D7MA 5I8OH 1AZNA 1MHCA 4Q6IA 5CFAA 3B9KB 1A7OH 3B9DA 4AGPA 1E28B 2X1XR 4JM2B 5AZEH 4BWTA 3F62A 4DP9X 4EF3A 3C8HA 1OSZA 2FX8L 3WY4A 3O3UN 4ETYA 2XJKA 2NXYC 2BS71 2EADA 1S9YB 3F2LA 3KH4A 3L9RB 5EBWA 1PG7X 2WWMC 3JAMg 2FEEL 4YMPA 2BIIA 4PTTA 1UOKA 3IGFA 4JHVA 5E5LA 2DL9A 3RKDC 3HVDA 1JZ4A 3DVGB 4IIQB 1UOLA 3CDZB 4AEIL 3IXAB 4TQPA 1N5YH 1MHCB 2NYYC 1OMWB 4CY3A 5E7BA 4JO4L 5AUMA 3ATEA 1KLGA 3ESNA 3FN0H 3WIHL 3CJJA 1KBGL 3QI0A 3H4FA 4IRZL 3F7LA 4C83A 3OXSB 4A63A 4JD2C 5FM5O 2K9UA 1CTMA 3KLSA 2P9UC 2FBRA 3PDOB 5DEJA 2JH2A 3DHMA 2ZSWA 4MNGB 4XCEA 4DPAX 2DIEA 2B1OA 4YVNA 3GZOA 3WTXA 1H3VA 5FCUH 1ODUA 3DETD 1OIOA 2ARJB 3SOTA 1HH6A 3PHQB 4UV4H 4NQEB 3ULUD 5EF0A 5IJ7E 4HUVA 3K72A 2R2HA 1NCGA 2FO8A 4JVUA 2Z2NA 2FJUB 3D25A 2B1HL 5EU6A 3LQAC 4GW4B 2AK4A 2XV3A 3IULA 1OPGL 5IMOA 4FMVA 5IQ7H 3IMWA 4S1RL 5LBSH 3VXUB 5I1IL 3ALXA 4OGYL 5DVOA 3RGBA 3TBYA 3SKOA 4AJWA 3B56A 2Q8AL 3FFCD 5FYLH 1AGBB 2CD0A 5ACZB 3BUPA 4EIGB 1X7QA 3R7QA 2B2XH 3VFMA 3G5XB 1OT1A 3GSNA 4YHNB 3TT1H 5AVYB 3DARA 1PLGL 4UANA 2NXYD 5CHNB 4TNEA 5IBUG 1JWUB 4G9FE 3TBSA 1MJUL 3LKNB 4HPYH 2IBGA 4OLYH 4ERSL 2CO0A 2DBLL 2IAMA 3M86A 2IH8A 1JFQL 5GQBA 1J9QA 3L3HB 1E8YA 4RGMB 2E7CA 2NDGA 3DV4B 4L8DA 3V7AG 4B50A 2J1KA 4RQQA 1A7OL 3BUYA 4TQEL 5JMRA 2E76C 1IRAY 2ITDB 3VTTA 2R2BB 2KI6A 2TRYA 3SDXE 5AW4B 4AVKA 2ZPKL 1QSVA 1CGUA 3DX8B 5B38G 2OX5B 1RHHA 5HYJD 3CH1A 4OJCA 2LGNA 1JJUA 3X3FL 4OI9A 1L0QA 1IEAB 3QXDB 3UL4A 3SDCB 3BKCH 1ET8A 2CKBA 3ZZLA 4U33A 2C26A 4JKKA 4R26H 3CNKA 4L4JA 4UQDA 1OW0C 4WK0A 1T22A 4FA9D 2BLFA 1P0SE 2VUOA 2N4IA 4JO4H 2LU4A 3F64A 4MZIA 4X4YB 1ZS8A 3C5XA 1BOGA 1MCHA 1YCSA 2FHCA 5D2NC 5TDOA 3VFOA 4XWGL 2HKMA 2OXHA 5KYXA 1P9MA 2F1BA 3BGAA 3MPCA 1QPXA 3GSWA 4HIIA 1C5BL 2P1YA 4RSVA 4EDWH 5A16A 4U7AA 5DC4B 2XLLA 5BV7C 3MVDK 4PJEF 1AS6A 3H56A 4IGBA 5IROC 1DR9A 4C4KT 3KLLA 4KZEH 3F3FA 3EOTL 4CAGA 1X9LA 4JCMA 3OV6A 2XIDA 3GI8L 1ORQB 1U33A 4MAUL 5HPOA 2OX5A 1IB5A 4ELME 1WYJA 1MHPL 4KXZH 1XHMA 4JFHE 3Q43A 1UTCA 2DS4A 2QBWA 2EXSA 1JK8A 4ZW3A 4Z7NE 3LVTA 4HWEH 1ZE3C 4GUOA 1W8OA 2YA2A 4AIZB 1CDCA 3PRZA 4HWBA 2FX9L 4XMXA 3EZJB 1HS6A 4LSRL 4AEHH 5IB2B 2YQBA 4Y16D 4DAGL 5C0RL 4LK4A 1NCNA 2VAAA 4I18B 5IM7B 3QFJD 1LL1A 5E2TH 5KYUB 5A2FA 5IKCA 3OG4B 2GY7B 2FNWA 4DK5A 2GC4A 4U3SA 3BWUF 3UVOA 1FO0A 2AAAA 4E9TA 5CZKA 5DD0H 1U8HB 1UA3A 3KGUA 2JV6A 4I0PD 3ARGA 4FMKA 3KRXB 3GD1C 2NNAA 3KWWB 4LLDA 3QIWD 4A7GA 1XIWD 2PP7A 4X7EC 1JN6A 1NCAL 1AZVA 4IGBB 5IUSA 4KHTH 1KLUA 3QDMD 5CBAB 4L3AA 1RU9H 1FYTA 3QO0A 2Z93B 5FKPA 3U4KA 4BHUA 2A9BA 1HHGB 4YSSA 3IUQA 4NKDA 1X7SA 4TVUA 2QSQA 2R69L 1V5JA 1MEXH 2R1XB 3NRQA 5T5FA 3AFCA 3FHAA 4QHNA 3T0BA 4ZOZA 4BE6A 1T1ZB 1U8HA 2FWLB 1U4EA 1UQSB 4LIQH 3UTPD 3QPQD 1JGVL 3HRZC 2XQYK 4V1DD 5KZCB 1ACYH 3FSZA 2G2RA 3NAAH 2YN3A 4LBEB 1WC7B 4Q52A 1W80A 1FNGA 4JM4L 2ZP0T 3F85A 4W4OA 2UXTA 3MZGB 1OB1A 2ITFA 4CDHA 1XD0A 2BS8A 3MLWH 1DVYA 2AABH 1O7VA 1DE4A 3CZKA 4HC1H 4IMLA 1UH4A 1FP5A 3EI2A 4PG9A 4D9LH 2YA1A 4P5MB 4NBZB 2R4RH 4Q89A 2X87A 1OCCB 3G9VA 4NO2B 1NMCB 2A9DA 4Z78B 3VGAB 3TF4A 5C7XL 1UYWL 3PP3H 1JRHH 2EC8A 1AJ7L 3DK2A 3I6LE 3Q2LA 3UAJD 4M1CD 3PJSA 5GGSY 4OKVA 4M6ML 5I17A 1YNLH 1YNTA 2ZOKB 3IKKA 1N5AA 4R4NC 4AIEA 4UAOC 4HH9A 4JSVC 3MOAH 3MRQA 4QXVA 2FH8A 3WE6A 3NIDA 1AQDA 3WO4B 4K3ID 3G08A 1AP2A 4AVJA 4MLIA 5J1AB 3IJSA 1A5FH 1Q90A 4MCNA 4FTDA 4Y2OA 3EO0B 4BEIA 4NQDD 1M05B 2M2DA 4U1GC 3SE3C 4MA8H 2PCFA 4OZFG 4OWRA 2E9GA 4JHWH 1BA9A 1KGCE 4LLYB 4PN6A 2OK0L 2C9RA 5AYQA 5M94B 4HUCA 3H9ZA 4DNVA 4LU5H 5MEQA 1I9EA 4HJUA 4BELD 3OJVC 4RGNC 1LO2H 2MQ0A 2P5EB 1EBPA 3H3PH 1JMZB 4FE9A 4Z7QF 5JIKA 3TNNA 5BV7L 3KCIA 3AG2B 4I3SH 3K4AA 2X09A 3SO3C 3LZFL 1WAPA 2X3AA 1U21A 4PGZA 4MMZB 4HCFA 1C1EH 5T3ZH 2WQWA 3BXNA 3O6FC 1J5HA 3HUJA 5MEOB 2O5YL 4OCWL 1IKFL 1A9EA 1NBCA 3JYBA 3UTSD 4EOWL 2VAJA 1N6FA 5K9JL 1KB5L 5J6GA 1MCCA 1RI8A 4N26A 3X1EA 3BP6B 3TCLB 1R47A 1QACA 2Q76B 4PP1C 2UXFA 1ND0B 4IRSB 3X13B 2F19H 5KTEH 2WIIB 4J3OF 1TF4A 4KY1L 4HOWA 1VIWA 1HL4A 1RQ5A 4XC3H 3IDGA 4B0MM 25C8H 1KLFA 3MROA 3UTSE 3BDBA 1HWWA 3SJVB 5EAMA 2WKOA 3ATBA 4TNVK 5JYLA 3MBXL 3A6BH 5GS0D 2IH3A 4XOBA 5EPMA 4R4ND 3DDFA 2RR3A 1NINA 3NPSB 2DV6A 1YUKB 4UZGA 4W4OC 5LG6A 1HXKA 3O3AA 1XXDC 3RA7H 3OL2A 2BP5M 4WUUD 5E8DH 5C0EB 4N2GA 4OQTA 1HAUA 3MJ9L 1ND0A 3NJMA 4NC2B 3LSOB 2UWEA 1G9HA 1XCQB 4XGZA 4UB0L 1CFNB 1NEUA 3SDCC 1KPVB 2R1WA 5CZVH 3LOWA 3APDA 2W91A 1PJ9A 2Z31C 3MA7B 2MJWA 1AXTL 4NFBA 2VO8A 4YDIH 1ZGLB 5K5YA 3PWNA 4H25A 4P5SA 2VDOL 5B7EA 4DP5X 4XCFL 2FWOA 2WWNA 5JDSA 2VB5A 4JY6A 3VYPA 4J73A 4K3JB 1I1RA 3MV9D 4L8SB 4JQIA 5IFJA 1AIFB 4IHBA 3LZQA 4URTB 5B1JC 4F2ME 4PJ9A 5KUKA 2VN7A 1SYSB 3AFLA 3BQVA 3KLAA 5EBGA 3L4OD 1G7QB 2N0MA 2UWEB 4XGZB 2I07A 4TM9A 4MCZB 1J9SA 2NY3B 4HCRL 1WWAX 4K94L 4PBXA 3HBQA 5GS0H 4GKSB 3HC0A 3CVHA 1E8NA 3AWGA 1KC5L 3QWNA 4NWUH 1QSFE 5C08D 1A3RH 3T71A 5AWNH 4NFDA 3RX9A 1HEZB 2EUWA 1R3KB 2CLRA 2VO5A 5HGAB 4CI8A 2QSCH 1I7RA 5B3JE 1TU2A 4HHAA 5AOJA 1GGBL 2K9FB 1CDHA 3VFTB 1JYXA 1HL5A 3DX4A 4LBEA 2IAAA 1ERNA 5C08E 3UDWA 4P9HC 2RFXA 2DMGA 2O5YH 2VDKL 3T4AA 1HVXA 3MQIA 4NAMA 3VGDA 4FMFA 4OZHF 3MV7A 4Q56A 3BP5B 3PPSA 3SJVD 3S96A 5J89A 3EI3A 5E6SB 4L3HD 2EILB 4GH7B 3ZHKA 1PYWB 5MENE 3ZDYA 3NZ8B 2IFGA 2XNAB 4WO4C 4GKOA 1T6VN 4KGLA 2VLJA 2ISDA 1C9LA 5TE4H 9CGTA 2YAFA 1G7LB 4UIKH 4S2SB 5AFU3 3D1MC 4WJKA 3AS0A 2P24B 5TTRA 3NN8B 4DZ8B 2HFEB 4PJ6A 3SE9L 3FPYA 5INCA 1NC4B 3IUMA 4H5JA 1JZ7A 1Z9OA 3NVNA 2X89A 3N06B 2VITA 3PWVA 1WZ1H 1KCKA 4GI8A 3D2UB 3V0VB 5C9ZB 4V2CB 4DO6A 2VSDA 3FQNA 4XOEA 2FATL 4LO9A 2G4GA 5DTFA 5IW3A 3VFGH 2CJUL 4J1UB 4QHMA 1D5BA 5JW4N 4P46A 3KYAA 1TFPA 2WQVA 1KYUA 2VLKB 3VG9C 5H2BA 2PWGA 5F7UA 3TA3C 1F3DJ 5B8CA 2Y07H 5KVGE 1S7VB 3CDFA 2PNDA 2V7HA 5DZJA 4LOUD 1SM3H 1G84A 5FKTA 1JNNH 2I60L 4GP5B 1F3DH 1UXSB 1TKWB 1G9NH 4NQDB 3CBJB 2HRGA 2B5IC 3PSLA 2VDMH 1NFDE 3QYNA 1VCBC 3RB5A 2ZWYA 1KOAA 1OCWL 4KZDH 5IJBC 3CFBA 2QV4A 2ZKXA 4L1HA 2YPKB 3HS9A 1MLBB 2GJRA 4HEMA 1L9QA 4OB5L 4P46D 4RH4A 1H5BB 2TSAA 4GS7C 4RDQF 2DH2A 2LFGA 4NDMA 1S7VA 2BVEA 3KPQA 3L4CA 1E65A 4ZFFA 3T1FB 4AEZA 4OCLC 3GMMB 4B5EA 5ESAA 5T33H 3EF7A 4MXQD 4KI5E 1AMYA 5HGDA 4HF5H 5ADOL 1OE3A 5CZXC 4Y19A 2YNOA 2PMZA 2Q7AA 4J86A 3EJPA 5DLMH 3A0OA 3LQAL 3NPZB 5JW5A 2GCYB 3L08A 3LRHA 4F93B 1CFTA 4HZLB 1S3RA 4LGNA 1F4YL 3FU6A 4PI2A 4OLZH 2Q10A 4WU5B 5EU3A 3CSFA 4BCYA 1IGYB 1YO4A 3WAKA 4Z7WB 4G8IA 4IMKA 1E6JH 2CALA 3UTZB 2OJZH 5M7QA 2GJ6E 3L3KB 4NM8H 2BSED 3QC5X 4JFZH 5ACMA 1G7JB 3U36A 5JIDA 4JB9H 3FB7B 3NCJL 4MYWB 2Q87A 1LDSA 3FCTB 3AG1B 1F97A 2WINB 1QHPA 2B3RA 3DV6B 5GGRA 4I1NB 5LGYA 3WN6A 2BC4B 2EXWC 3DIDA 1ZVSB 3T1FA 4QRRE 2Q9OA 4FQ1L 2OYMA 1FBIH 4U7KA 3BIKB 1AS8A 1UM5L 4YHNA 1XL4A 5E8EB 1OK0A 1GS8A 3AXIA 1LO3H 3LV3B 3IVKB 4MSWA 4GEJA 1BVNP 4KVPA 1IL1A 2V5RA 3BYYA 4CVZB 4FXKB 3A5VA 1BAFH 2ZYIA 4QRRD 1M7IB 2AEPH 5HHVH 2WLMA 5I0ZA 2W81C 2W0LA 1BYPA 4X7FC 4ALAL 5E08H 1IIKA 3PABA 1G7MB 2BC4A 4N5ED 3SD5A 1JGLH 2VR3A 1DFBL 1C5CH 1DUYA 4IEFA 1MXGA 4MB5A 2CM5A 3MRBB 4LHUG 1BMWA 2VXQA 3QEGL 5TE7L 1H8NA 5AKRA 2Y69B 5L4FA 3D0AA 5JQHC 1QFWM 2GSIB 1RULH 3KYKH 2EECA 3FJTA 4WAFA 4N14A 4NQVA 3MBEC 3MRIB 2H2PC 1UTDA 1AZRA 4XP9L 3UXFA 1MFBH 1N8ZA 4NNYA 4UDUB 1WFJA 1NUFA 4K23L 4Z76A 5I6KA 1FJ1B 1EEYB 1F1GA 1LO5B 2PETA 4XCNA 4X4YA 3MA9L 2WN3A 3GIZL 2D03L 3RIKA 5TH2A 3BSZA 2OMBA 4IOSA 5D7LD 5GHWL 4DPBX 1PYWA 2X0VA 3ATDA 4QHLA 4QRAA 3L3IB 3UBXA 5BJTA 2BVPA 5FYKL 2OTWA 3SSGA 3BH8B 3MV11 4N2EA 4R4BA 5E2UL 2BNQB 2QELA 1G7HB 2WMPA 1EAPB 2VDQL 2Y5TB 5B3SB 4Z7VA 2B08A 3SKJH 4N9GA 5HHME 4ABUA 3HMWH 1W0WA 1XXFC 2VN5A 1W72B 2PPAA 5FA4B 5G5DB 2IWFA 4PJBE 4JK0D 1F02I 2BY1A 4AQOA 3LKPA 3MOAL 1OK8A 3WUWA 3SQBA 4TRPH 5EBMA 4QJ4B 2X53A 5I76A 1VKXA 1MAMH 5HE1B 4FI7A 4TUJB 4PREA 1TEGA 1WBXA 1ADQL 4JKPH 4KHXL 5CBAA 3FB5B 5CEXB 5FX3A 1VACB 4KUZL 3R7RA 4Y4KD 4L3EA 5D1XB 3SKMB 2FQGA 4KI1A 5DURD 4JE0A 4DN4L 2IQAA 2WMPB 2Q86A 3PIQB 4OVUA 1X5GA 5TDNA 2HH0H 3TJPA 5IHBA 1J1OH 3EBGA 2DI9A 4HQQL 2MH4A 4BH8A 2AQSA 4R8WL 4J84A 3Q2NA 4Y0GA 4FD0A 4CADB 1T66D 3VACA 1WSST 5IOKA 2BVOB 1KB5B 4MWFA 1FZMA 2AK4D 4JHUA 4X80H 2BNQA 5KYWA 2B5IB 3I7HA 1I8MA 3CVBA 3U30B 5E8PB 3DUHA 2KC0A 3V7MA 4ZTEA 2JK5A 1MDTA 3QWQB 4XP6H 5FGRA 2BZ7A 4EI5C 3GDBA 5IJVB 1F00I 3FHEA 1AE6H 4LESA 1XDTT 1DLHA 1IC5L 3JWDH 5AZEL 1OP4A 3VFPA 2IH1A 3ZDWA 5AL0A 4WJ5A 2EDQA 4UOJA 1OD7A 4FYRA 2RH0A 5F7FA 4ZT1A 3BUIA 1KV7A 1YQVH 1LEKA 1OCOB 4UMGA 3LN9A 2J8HA 1J8RA 4L9LA 3TJHC 3FK3A 3S34L 4PJBB 3ULUC 2LVCA 2VE6A 4WI7A 5HDLA 3RWDB 1RULL 3BZ4A 1M9WA 1KJVA 3CDZA 3KYKL 1J9TA 3QJHA 4Z0BL 3NCYP 2AQ5A 3WN5A 3T3MF 4TVPE 1N5YL 5CCHE 1YNTB 2ZOKA 3QAZC 3ZDXF 5CSZB 1PX4A 3WNOA 3GXPA 3ECUA 3FZUC 3KLHC 2EE3A 1Z32X 2VDRH 2DRUA 3BP7B 3FO9B 3U0PB 3CFSB 3REVB 3A4DA 1F41A 4MJIB 3LS4H 3NIFE 4Z7UE 3GTNA 3I6SA 5TGBB 5J1TC 2IAMC 1BZ8A 2Y6SD 1Q0YH 3MNDA 4XCEB 4LQ1A 2NZ9C 3D05A 2WBWB 1XIPA 5IW6B 4W9LC 2N59A 4ENED 1K4DB 3GJFB 3U6XS 2V2WA 4UOW0 5GGRB 3EW3B 3B34A 2HG0A 3V6OE 3DTUB 5SWSD 1P6AB 3V6ZA 4F3FB 5D71H 1USQA 5AL8A 3FQWB 2GK0A 3C2AL 3LXAA 1RUQH 4JHPC 2AK4B 5DEFA 1UZGA 3QH3B 5DGQA 5D55A 3MJGX 4W9FC 5IVXE 1QBBA 2HKAA 4J4PA 4MSWB 3T4YA 2GIMA 1ZT7B 4CN1A 4YH6A 2P5ED 3WKML 1KYOJ 4G59C 4KDVA 3DVIA 3K6FA 1DBJH 2NY3C 1XBRA 5HYJB 4NP4L 4QL1A 5EF3A 2FIRT 1RZKC 5D7HA 1SMDA 4KAQH 1A6AA 1IE4A 4JFPA 5GRUH 3TT1L 1F2XK 1LP9B 3CVDA 3HI6H 4MJIA 3MRLB 4PBVC 1WFMA 5AWNL 2AF2A 5E6IC 1JTTA 3Q3GB 5KSUB 2H6OA 3QI9A 2YKLL 3HMXH 5D7IB 3OJDB 4DQOL 2UV3A 3QNXB 1I1FB 3RLSA 5CGBA 1FORL 1TIUA 3RGVB 3CSYB 5D7JB 3TJHD 3BIAX 4E9WA 1RMFH 1RH8A 1IM9A 1NANI 3IDXL 2YRPA 1GYWA 3QJFB 4P3CH 4OM1L 2QHRL 2UUDH 5A3ID 1NPUA 5F7KC 4JDEB 3ILPB 3U4EB 5E9NA 1MNUH 5LCVH 1SQMA 5EZJB 3RN0D 4B9PA 4AQ1C 2PW1A 2ZWSA 4QRPE 2ESVD 2NY7H 3HR5A 2H32A 4TSBL 4BFKA 4K7PY 4IKJA 5I8EA 4XVOA 2H26A 2L4OA 4KTEH 5EF2A 3U82B 3I6LD 1S9VA 1EJ8A 2YUWA 4KROC 3VXUE 2BSRB 1L7TH 2X42A 5C0BD 2WXRA 5I6OA 5ITFA 5KSAC 2EZ0C 4W9DC 2L7JA 3G6JB 4MDJB 1FZOB 5D4QA 4TOYL 1ZKAA 2IDQA 2NCMA 3ZK0A 3QULB 3THMH 5EO9A 4LP4A 2CM6A 4BKLA 4TLUA 1XZWA 4YHYB 5JR1L 3HG1D 3M8OL 2Y3AA 1SXBA 1T6WA 2YD5A 3AC0A 3FCBA 5D1QB 3DJSA 5DVNA 1EUTA 5I2IA 1P4IL 3MNWB 3GINA 1LP9E 4J87A 4KY2A 1YPZF 1TQBC 1ZTXE 3ZTEA 3W39B 2WNKA 5F8QC 4TYUA 3C5ZA 4HJJL 2HJFA 1U91A 2BWQA 4NUQA 2CLVB 4HUUB 4JCWA 1J8HA 3S5LB 3VI3A 1ORSA 5ES4B 2YLHA 1R5IA 4JO3H 4R7NB 4RGOH 3ROLB 2A9NH 2FX9H 1HILA 2WVVB 3DX2A 3FQ1A 1TZHA 1Q72H 2WBXA 3DPBA 1C12A 5L2JB 1CT8B 2F53D 4LCCB 4MJHA 2BP0A 3RY6C 4EE2A 5A3IC 2JKJA 1T5XA 4LGPB 2JIXA 2VXTH 3UVNA 4Y5YC 3F65A 3RJQB 5CM1A 2WM0A 1PKQA 5DT1L 1UCBL 2OBGA 1FZOA 5E56A 5EWIL 3OF6D 2VM4A 2W95A 5AQ0A 1I3RB 4RZCA 5F0LB 4R7LA 3PV7A 5TJWK 1SQ2N 2AV7B 4YHLL 3QQ3A 2F53E 2WP3T 3V4LA 4GM9A 1YG9A 3KXFB 5D1QA 4OZUA 4MB3A 2QEJA 4XVTL 5LQBL 3OZLA 5D1QC 4HWZA 1WEJL 5CGTA 5K9OB 5IHHA 4ZPVB 4U4IA 3GC3A 4CKQA 4FB1D 2Z8WC 2E7DA 5DJXA 3ZHDA 4FNUA 4AM0Q 2YMTA 3NYKA 1X4YA 2R29L 2IOOA 4Z8FH 4ES0A 2BMKA 4WUUE 3ZE1E 2EBSA 3FUJA 3ARBA 3EYOA 5SV3A 1JPST 1GJIA 5JXED 1HK6A 3CX5K 1MJ8H 1QX1A 4KKNA 4BCXA 3W0WA 4L9OA 3ZN6A 1T5XB 2BSBA 4ZOAA 3D69A 5IMKA 2OVRB 4PJGF 3MKQA 3MCLL 1LHZA 5K39B 1JZ3A 2I5YH 3CHRA 1A65A 3K2MC 1JHLL 2BFGA 4YHMH 5HHOA 1QSED 5EG6C 2PM9A 3HIZA 1I3RA 1DE4B 2WXNA 3FKUS 2YXVA 1T1WB 2B2XL 4OLWH 1ET5A 3LD8C 3RDTB 2DICA 3N2JA 4MD0B 4FA5D 4LLVA 3RKPA 2OYLA 2BMKB 3K8LA 4GQZA 1PDKA 3APFA 2DMKA 3AY4A 2ZSWB 4ODXB 4XNYL 5KBMA 3E6FA 5KYYA 1CFMA 4G80A 1IC4L 3KR3H 4GIAA 3BQUC 5IQOA 4NM4H 4GY4A 5ABAA 3SDAC 3IWVA 3W82A 4H88L 4JDTL 5CGYC 1HHKA 3KRWB 1XGYH 3BEVA 5I5JA 2YPLE 4M6OH 1RK1B 5HHOB 4HCRA 3P02A 4F2EA 4HV8B 3U46A 4NZUH 4YDKH 3MN8A 1TQBB 1RURH 4I13B 3VRJB 1X5MA 5F1IA 4JQIH 2VMEA 1ES0B 2OMWB 1E43A 2BP3A 4FYSA 4JFEE 2E7LA 1WAAE 2GJPA 1KGUA 2Z8VC 4B9GA 1HQRB 1I7TA 1EGJA 4WFFE 4Z3HA 4KU1A 1HSAB 3B3IB 1CICD 4WZ9A 2A6DB 2VIRB 3HBPA 1OHQA 4WUKL 4ZNEE 3CDCA 1SBBA 2WXQA 4Q0XH 3WYRA 2VOTA 3F05A 5BOJA 3GSNB 5HDWA 2P5WE 1JNHA 4ZXBB 1KG0B 3NIFB 3AW5A 4MXVF 3SO5A 1B4RA 4O2CB 4F7TA 1OLZA 1D9KC 1E67A 4BQ8A 1FFNA 3IB4A 4XVSL 1DQIA 4F2MA 2BJMH 4N2BA 1JYVA 1WEJH 3BAIA 4PJFE 5T3ZL 2QTEA 3ALWA 1H6FA 1Z7JA 3SZ6A 3ARWA 3N1PC 4JN2B 3EFDH 1QOKA 2OTUB 3MRFA 1KTKE 1Z9LA 3U9WA 3V95A 1A6ZB 3APNA 3DUSA 2OSLA 2YAHA 4WJG3 5DUBB 4L1QD 3CZNA 3OHXB 5HHNB 1OM3H 3B7TA 4LRIC 1ADQH 3CH1B 3CVHH 3G6JA 2PKDA 3UTZA 1VENA 5D7KD 1DVZA 1NOLA 1T7YA 4N2DA 4DZBA 4XNMB 3Q5OA 2HMIC 3TTYA 2EH7H 3SGJA 3QEQE 5KS9F 2RTTA 2CKBB 4GB9A 4Z7UA 3WOVA 4P59H 2B16A 1WTGT 43C9A 1A9VA 4LEOB 1XTLA 2XVKA 4JQVC 3W39A 5DHYA 4HQQH 2AGZA 1OW0A 3O3AB 1QKZL 1DUYB 2Y2TA 3D25B 4W6XB 4FQCL 3V0FA 1JPGA 2BOLA 4X9GA 4QMEA 4RMQA 3HFFA 3EBIA 3MV9B 1QI3A 4QT5A 4OZGB 4ODSH 3LB6C 4BRVA 5GJSH 1B0RB 1LK3H 3QWRA 3LN5B 4NB7A 3SPVA 3TPUB 4OFYD 3S4SG 3DROB 3WI9A 4JNXA 4YL4A 2HT3C 4L0PB 4IKNA 1XBDA 2O30A 5FWQA 2XZZA 3L54A 1MIMH 4FQLH 4JM2C 4L5FL 3PG2A 1P5UC 4P2QE 5ALBH