3K72A

Structure of integrin alphax beta2
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
1082
structure length
884
Chain Sequence
b'FNLDTEELTAFRVDSAGFGDSVVQYANSWVVVGAPQKITAANQTGGLYQCGYSTGACEPIGLQVPPEAVNMSLGLSLASTTSPSQLLACGPTVHHECGRNMYLTGLCFLLGPTQLTQRLPVSRQECPSSFELEMAQEGFSAVFTPDGPVLGAVGSFTWSGGAFLYPPNMSPTFINMSQENVDMRDSYLGYSTELALWKGVQSLVLGAPRYQHTGKAVIFTQVSRQWRMKAEVTGTQIGSYFGASLCSVDVDSDGSTDLVLIGAPHYYEQTRGGQVSVCPLPRGWRRWWCDAVLYGEQGHPWGRFGAALTVLGDVNGDKLTDVVIGAPGEEENRGAVYLFHGVLGPSISPSHSQRIAGSQLSSRLQYFGQALSGGQDLTQDGLVDLAVGARGQVLLLRTRPVLWVGVSMQFIPAEIPRSAFECREQVVSEQTLVQSNICLYIDKRSKNLLGSRDLQSSVTLDLALDPGRLSPRATFQETKNRSLSRVRVLGLKAHCENFNLLLPSCVEDSVTPITLRLNFTLVGKPLLAFRNLRPMLAADAQRYFTASLPFEKNCGADHICQDNLGISFSFPGLKSLLVGSNLELNAEVMVWNDGEDSYGTTITFSHPAGLSYRYVAEGQKQGQLRSLHLTCDSAPVGSQGTWSTSCRINHLIFRGGAQITFLATFDVSPKAVLGDRLLLTANVSSENNTPRTSKTTFQLELPVKYAVYTVVSSHEQFTKYLNFSESEEKESHVAMHRYQVNNLGQRDLPVSINFWVPVELNQEAVWMDVEVSHPQNPSLRCSSEKIAPPASDFLAHIQKNPVLDCSIAGCLRFRCDVPSFSVQEELDFTLKGNLSFGWVRQILQKKVSVVSVAEITFDTSVYSQLPGQEAFMRAQTTTVLEKYK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin alpha-X
publication title Structure of an integrin with an alphaI domain, complement receptor type 4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 120
structure length 884
sequence length 1082
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
A PF01839 FG-GAP FG-GAP repeat
A PF08441 Integrin_alpha2 Integrin alpha
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1460 Mainly Beta Sandwich Immunoglobulin-like Integrin domains. Chain A, domain 2 3k72A02
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 3k72A03
2.60.40.1530 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 4 3k72A04
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 3k72A01
3ZE2B 3ZE1A 4UM8A 3VI4A 4MMXB 2VDRA 2VDMA 3ZE1B 1M1XA 4UM8B 3NIFA 3VI4B 1JV2A 2VDRB 5HDBA 2VDMB 1M1XB 3ZDZA 3NIFB 3V4VA 4UM9A 3K72A 5HDBB 2VDQA 2VDOA 3ZDZB 3IJEA 3V4VB 4UM9B 3T3PA 3K72B 2VDKA 2VDQB 2VDOB 4IRZA 3IJEB 1U8CA 4MMZA 3T3PB 3FCUA 1L5GA 5E6SA 4UM9D 3K6SA 2P26A 2VDPA 5FFOA 1U8CB 4MMYA 3ZE0A 1L5GB 4NENA 1JV2B 3K6SB 4WK4A 2VDPB 5E6UA 4Z7OA 4WJKA 3ZDYA 4MMYB 3ZE0B 2VDLA 5E6RA 4WK4B 5FFGA 2VC2A 5E6UB 3T3MA 4Z7OB 4WJKB 3ZDYB 2VDLB 3NIDA 4G1EA 2VDNA 2VC2B 1TYEA 4Z7NA 3T3MB 3NIGA 4WK2A 2VDKB 4O02A 4G1EB 2VDNB 3ZE2A 1TYEB 4MMZB 3FCUB 3ZDXA 3NIGB 4WK2B 5E6SB 4O02B 3V4PA 4WK0A 3ZDXB 3FCSA 4NENB 4G1MA 3V4PB 4WK0B 4Z7QA 5ES4B 4NEHB 3FCSB 3K71A 4G1MB 5E6RB 3VI3A 4Z7QB 3NIDB 3K71B 4Z7NB 3VI3B 4MMXA 4JX0A
chains in the Genus database with same CATH superfamily
2HLAB 3BD3A 3LQMA 4LLWB 4X7DC 2XVBA 1EX0A 3FHQA 5FO9A 4H8QA 4IGBD 4HJUA 2P43B 1JWMA 1Q9LB 3O6MH 3KZ8A 3PFUA 1S8DA 3L13A 1CLOL 1Q0XH 4QTHA 5I74B 1U93A 4Y16A 3VI4B 5B4MC 1DVQA 2D0HA 2GBUA 3H1ZA 4YSDA 4NSXA 1AQDA 4WEUD 1NCGA 4Y5XB 1LNUA 2VL4A 1CE6B 2LOEA 5BUAA 4X99B 2Z92A 1ULVA 3IKCB 1RZIA 4DO6A 5HBBA 5IHBA 2NUTA 3U9PH 1A14H 4Q14A 3SYCA 2D7TH 5AZ2H 5KVFE 4A39A 4W1TA 3TPKA 3UVOA 1CT8A 2BKLA 5EFIB 4KK9C 5FYLD 2I0TA 3LH2L 3KL0A 2IMNA 4JDZA 5J7CC 3D0LB 2MIZA 3WXVH 4RRPG 1N5YL 4UCFA 1WBXB 1N59B 2G5BB 3D8MA 5CSZB 3BT2L 1A4JB 1VYHC 3MR9A 2DM4A 3PGCA 4G42A 4WGVB 4MJIA 2HUHA 3F5WA 5CUSL 4QIRA 1BAFL 4UYQA 1ZHBA 2YUWA 2ENYA 2VLKB 1HAWA 2Z9TA 1SJHA 3W0WE 1A1OB 3IU4H 3KPQB 4H88L 5CZXC 4K7FA 3TS8A 1PQZB 4QRPB 2XZCL 1PLCA 3U0TA 1C5DA 4UT7L 3FONA 3C09C 1K4DB 1P6AB 2AJSH 4C57C 4QLRA 2WUBH 3VH8A 3O4JA 1JUFA 1AXSB 4ZUWB 2I9TA 2ATPA 4MNGA 1GHFH 3HRPA 5T33H 3K26A 5FLXg 4U1MA 4HCIA 4QHPA 4MZ2A 5GS1B 1TEYA 3D30A 2J43A 2EEDA 5IJVB 4XXCC 2JSFA 2V9UA 2ZPKH 4FYSA 5C07E 2DAVA 3UO1L 1AKPA 4Y2OB 3PAYA 3D69B 3L4VA 3TA3D 3FO9B 4V2CB 4DZ8A 3EGDA 4HIHB 5F7EL 1JNJA 1FZMA 2MNWA 4O9DA 2HSIA 4PS8A 5TQ0L 4F27A 1HINL 1DN0B 1J1PL 3PFQA 4WK2B 3U4EB 4XMPL 1QFWI 1U6AL 3FU3A 4TTDD 3QWOA 1EFXA 3F62A 4RGOL 4JRLA 3BW9A 2K45A 5ICYA 3C6EA 3QQ3B 5EU6D 3MV7B 4IBLT 3UPRB 5EU7E 4NQSA 3QRGL 2LLGA 4Y9EA 4NUMA 3OR6B 3CXDH 5IVZB 1AGEB 4FJYA 1A47A 1LP9E 1WAAF 3O3BB 1PVHA 2VLRD 1UWEL 3CFBA 5ABDE 3VI3A 3TXAA 1A2YB 3MUJA 3VD2A 4JK0D 2VTFA 2Z7YA 2X1QA 3GK8L 5F9DC 2WP3T 3MRHA 4C54A 5T1LA 4YJZL 3WFHA 4C8XA 4HC1L 1RK1A 1MG3C 2UV3A 5EIQA 3Q8AA 4QD2E 1EMTL 2OMNA 5L8KB 4O2FB 1I53A 3A23A 5JQHC 4V33A 3I2CH 2WQUA 1IKNC 1XIWA 2EEAA 4B3VA 4MJ6B 5HHPA 3NQKA 5I9QC 4S0SD 2LW3A 2UWEB 4GAJH 5TDPA 1MWAA 1V7NL 5FGCE 3CQFA 2L0DA 3L7EB 2YUXA 1ONQA 2DD8H 2X3CA 2BS8A 1G7PA 2J8UA 4N2EA 5JHLL 2HWZL 5B38B 3NJNA 3DV6A 5JNYA 4M02A 1KGIA 5D96C 4YN3A 3AB0C 5DA0B 1MUJA 2IIJA 1MG3A 1B0RB 1UATA 4PJBE 3EH4B 1XD0A 3MREA 4WUUE 5D1XD 4B0MM 4B9GA 4JFYA 3HA0A 1BBJB 5FWQA 3WD5H 3ZR5A 3WU1A 3TYFB 1NBYA 1DDHB 3LKSA 1THCA 3CSFA 3IU3B 1JSYA 1DFBH 2SEBB 3AROA 3P4LA 4QRUA 3RB5A 5KZCB 3OLDA 1C9IA 1H6FA 4JO1H 1F3JB 5HPMA 1CLZL 5ICXB 4Z7WB 5E99L 2VERN 4PJ7A 5KSVA 3RL1A 3NEXA 1GYVA 1IAMA 5E4IA 1BM7A 3DI2B 1TJHH 5CSBA 2KPWA 4XBMA 5K39A 4GSDH 5ANME 4E42B 2AJ3B 1NGYB 3I2NA 3ZE0A 2WBJD 3R4DA 1LO5A 1P2CA 2MOGA 4IEFA 3ZHFA 1J8KA 1J8RA 3EYUH 3GMMA 4JXMA 2OMYA 1DEDA 3FUMA 1MNUL 1J9SA 1NGPH 5I18H 1IC1A 2FD6H 5IJ7E 3HC2A 3B7UX 2VSDA 5DZAA 2EXTA 5C8JA 4QNPF 1YYLL 2VDQH 4G55A 3T4AB 2YSTA 3EI3A 1QFWL 1XGTA 3D48R 2VC2B 4K23L 5HI3D 2VAJA 7TAAA 4NGHH 3KLDA 4PMEA 3P3RA 1UB5B 3VGAC 5J3HC 2NY2B 1YECH 3NZHH 4Q4IA 1AKJB 5E5MA 4QCIA 4R3SA 2CHZA 3CDCA 3M8OL 3CVBA 4M8UA 4PJFE 3RA7L 3SCMC 2V37A 3PPSA 4WEBL 3VFTB 2W80C 3I9IA 3RTQC 2EUVA 5J0BA 5E2WH 4XHJD 2FGWH 4KHXL 4P3DA 3ARGB 3SO3C 3QIUC 3J07A 4A7VA 2ZYHA 3FOLB 3I6GB 4HDJA 2LU4A 2Y7MA 5JHDB 5CEZD 1HCZA 3IN2A 2QGDA 1HSBB 4LU5L 3MUY1 2NDFA 1CGSH 3NFNA 2BC4B 1CI5A 3ZTCC 4DGVL 3D18A 1JZEA 3B34A 4LMQE 1NM4A 1EK3A 3ARBD 4KVPA 1JHKH 1NEZB 1KIRA 3ZHNA 3OF7A 4G43B 1YUHA 4G8GA 1X5LA 2XPYA 2YD7A 2K4AA 1XV8A 3CHRA 4KROC 3MRLA 4NQXA 4P5MA 5DCCA 5MP6H 2Z0UA 1EHLH 2VIRA 3DVGB 4ZUTA 4DTGL 4AH2B 5AG8A 4M93C 4U6YB 3ZTDC 3DXKC 2IWKA 1DBAH 2IVFC 4JZOB 3B9VA 2R9HD 1BLIA 4TNWK 4QTFA 1U8QB 1QSFB 1WIOA 1L9RA 4D6VA 5ESAB 2EUXA 2ZJSL 2J88H 1R3LB 3V2AR 5TK4A 3H6AA 1W16A 4KFZC 5DO8A 4KJWC 3P9WB 3IURA 5M5SA 2OFQA 4PGZA 3V0FA 3WOVA 2PCFA 3EJRA 2CLRA 3LPGA 1KTDB 4AM0A 4XP5H 1KEMH 2HU7A 4TNVF 4BCDA 5JXEA 1VGEH 2EEFA 4R84A 4GXFA 1VACA 2GSIA 5CZVH 5GGVY 1UTCA 3B3IA 3F3FA 4G9FA 4PJDE 1E4KC 3S8GB 1OT4A 3LV3B 1VFBB 4X3EA 4YDJB 3PGDB 3KLQA 1LWHA 1CWVA 3MXVH 4OZFA 5FCSH 1T04B 4UDUA 1ZV5A 3WENA 4AVKA 5D9SA 4KQ0A 3DOIA 3LJ3A 1LVEA 4UM9D 2WZ0A 2XYBA 2CBTA 3ECBA 4HXAH 4KKRA 3W2DH 1P9MA 2X4SA 2YGQA 2YD0A 3WMQA 1DVZA 1HXMB 2PW2A 3ARTA 3N0EA 4JFWA 2FSDA 4PB9L 2DZEA 4JO4L 2ED8A 2WLHA 1FE8L 1Q0EA 5TTRA 1KF9B 4EXPX 1ORQA 2MNJB 2VWEC 4G3YH 3O2WL 3QFDB 4FXGC 5HHOD 1P84K 1MCJA 1N70A 4PBXA 4DN4L 3PXSD 4PJIB 1FVDB 2FX9L 3IGKA 4GUCA 3ESNA 3L5XH 4WEEA 3G5ZB 1DQMH 5AB0A 4ZOBA 3K8KA 1HEHC 2A6KA 3MBED 3VFSA 1Q8MA 3O6ML 4JO8A 4PJ7F 3MLSL 2J21A 1VCAA 2AJUH 5B8CC 2HYEA 1T4KA 2FYYB 4V11A 3BN3B 5K9OA 2WCGA 4YSEA 2CKBA 3DVNB 1WCQA 2IXQA 4JKWA 3THMH 2YNNA 2HMIC 2DEYX 3GZOA 2BFVL 2EDOA 2IDTA 5AB2A 4KNTA 2AMUA 4IRSB 4DUWA 3B9EA 2UYLA 2NY0C 2EXYD 3GSQA 2H6KA 3G04B 4FNLH 2D7TL 5KN5B 4ELKB 3MLPA 4QTIH 2DWSA 3ABGA 3DO4A 3GMOA 4F57H 2J5LC 2J1YA 3L4YA 3EI4B 2IUQA 1DJIA 5B8CA 4WNQB 2CALA 3OHXC 3QJFB 1XMEB 3OX8A 4BFJA 1CFTB 2SODB 3LDBC 1XF5B 1A6AB 2W0KA 4EN3B 3EO0A 2XNAB 4CI8A 3SJLD 2P8LB 3T0WA 4F7CB 2UY6A 4FEMA 1NFAA 1YDPB 3EADA 4ZPVB 5DGRA 3SOBH 1U3ZA 2GNQA 2R2BA 3AG2B 1OP3H 2OMXA 3S3PA 1Z9LA 4GEJA 2P9KC 1XGUB 1AZRA 2G9HA 5IMMA 4ZDHA 2WLYA 2YHGA 1AH1A 1R5MA 2XXMB 4ODHH 1HL5A 3NT0A 4WI3A 1U8IA 2ESVB 4GI8A 2AJSL 5IJBC 5B38G 2WUBL 5T5NF 4G8IB 3NJMA 4BFKA 3MACH 5JLZB 4M7ZB 5T33L 4B27A 2Q1EA 4FLOA 5C0BE 3ROOB 1UEYA 1AGFB 2DH3A 2IANE 1W15A 2ZPKL 5EO1A 2JKSA 4A2DA 4LPCA 5DZLA 4U1SB 1J05A 1TG8A 1NC2D 3BVVA 2OBGA 4ERZA 2DWEA 5KEZA 3I9PA 4DF9A 5BO1H 1HCVA 3RY6C 3HS0B 2VUYA 3DPDA 1ZVYA 4KV5E 5I6KA 5DFWH 2DIEA 2NX5B 4D8PA 3VXRE 1C16A 2AEQL 2E6PA 4MQXC 4OCLC 3CXDL 2BCJB 1JV2B 1HNGA 3ZX1A 3PHQA 4LBEA 4XO3A 5D71H 4U4IA 4CMMA 2NY3D 4KC3B 4L2YA 4JZJB 4LSTH 5J9PA 3FB5B 1N6UA 3V7MA 2LFEA 5AW7B 1F1GA 1JWSA 2PYEE 3MBWA 1VZIA 4TSBH 2AQNA 4J1UA 3WO3B 1RZ7H 5FYJH 1FSKB 3FTYA 5CGTA 3BAEH 3CBJB 4F33B 4J8QA 5E4EB 2PTUA 3QJQB 5EUOB 3CNKA 1KPRA 2VGLM 1YEGH 4PJHE 1XXDC 4F8PA 4Z7VE 4MDIA 3BSZA 5ACZB 2A74B 1V54B 3HG1B 3ZWLB 4JPIB 5JOEA 5D2LE 2DD8L 2RH0A 1MHHA 1NUDA 5FGBA 4F7EB 5KSBE 1AGCB 3WEXA 1K8DA 2LVEA 5B4MD 4TUJA 3V9FA 1P6WA 4DCQA 5T1DL 1OGAD 1H3GA 1Z1WA 2NMSA 3ZYIA 1CXFA 1XHHA 4F93B 1DLHA 3L16A 3WJJA 5CBEB 2FR4A 3WAJA 2ROXA 1BFTA 1U42A 3PF2A 3WD5L 3CJJA 3MV9B 1R24B 2RAMA 1T6WA 3EJTA 1P22A 1AZZC 2WUCH 4QF1B 4KK9D 1D6EB 4HCRA 4UMSA 5CXPA 1MFNA 5DUBA 43CAB 2DLHA 4M5ZH 5BO0D 1O6FA 3BPNB 5D93B 4HOWA 3AG1B 1L0XA 1E7VA 3QAZB 4NCC1 4NZRH 2P9PC 3JROA 5B1CA 5EMLB 1T66C 2X0UA 5HPOA 2X2UA 1MY5A 2X10A 3FQUA 3ZE1A 3RRQA 1TJHL 1NEXB 4GSDL 3DVIA 4Y9FA 1SDAB 2K7PA 4KKQA 3QULA 1BQSA 5F7KC 3S36H 5FECA 5GMKn 1NDMA 5E8DH 4OZGB 2UZXA 4N9OB 4Y5VC 1LEKA 3OAZK 4K3JB 4QJ3B 5I18L 4Y2DA 2FVNA 1TQBC 2NTSP 5BRZD 2YXVA 1TU2B 1VSCA 2FLRT 2K6YA 2VL5A 1W0YT 3LPFA 4GW1A 4F2MB 3O41A 3T6QC 1SFDA 3CMOH 1CGUA 3CIAA 4YFDB 2Z7WA 4NGHL 1ND0B 1EO8H 3NZHL 1WUZA 3C5ZA 4JEGB 4ATWA 3DX3A 1X7TA 1MWAL 5ALCH 5DHXB 4Y5VA 3DJSA 1RPUA 2JJWA 1G9ML 3MXXA 2WP3O 1W6LA 5E2WL 4L4VD 1BJ1J 5CEXB 2NXYC 2V3FA 5D7IF 1A1MA 1J5DA 3DIVA 5F1NA 3RNQA 1Q47A 2P80D 1FFPB 4AQEA 2P5EB 2FHFA 1BA9A 2NY4C 2ADIA 1G6VK 5KS9B 4B60A 1G7IA 1QEXA 2WLKA 2JXMB 1T7WA 1CGSL 2XDHA 3DHJA 4PLOB 2XQYK 3RHWK 1A1NB 2XIDA 4V1DD 1JTTA 5PCYA 1WYJA 3HZKB 3MJ7B 5C09A 1JHKL 5HP5A 2FB4H 5HHMD 5I5JA 3LRKA 1M7DA 2EDBA 4M61A 4WJKB 4DUVA 3FQXA 5MP6L 1EHLL 3B8YA 4Y4HC 5HGBB 1ZSDA 2VRAA 4LCWA 4XPFH 3WMPA 3GHEH 1GYWA 4LG8A 5GS3A 4QJ5B 4OF0A 1DBAL 1MFVA 4MKTA 1AQ8A 1QWHA 3AS1A 4PBDA 4FQIH 1U2YA 3O3DA 3NIGB 2DIJA 2X88A 2ZUVA 3FKUS 5B3SB 4JN2B 5L9DH 1G7MA 5CLZA 2MKWA 2O5ZL 3V4PA 1T6VN 4PRNB 5F8QC 4UQ2B 4YX2H 4YS4A 4RRPM 2BLFA 1V10A 2WXRA 1W8NA 4AE0A 4XP5L 2WINA 3GXPA 4ODXB 5EU5B 3UL4A 1T83C 4DUXA 4RBPK 1VGEL 2XZAH 2NNAA 4Z7QF 3JV4A 3QXAA 5CZVL 3FTGA 4KRPC 4TULH 1SYVB 3SPVA 3K4AA 4RQQA 5JDJA 2E5EA 4XP6L 2DRUA 2DQTH 4NQCB 5BZWA 1O9VA 2X9XA 2DMGA 5INDB 1LEIB 1Z9NA 2EH8L 4X6CF 5LHDA 2OQJB 2MWCA 1AO7E 3T1FB 1T83A 4X50A 1OMWB 1GC1L 4HXAL 3W2DL 1V55B 5EULV 2R7EA 1ETJA 4ZD3H 4LDOB 1TNMA 3QG6A 4R6UA 3GTNA 1CFMA 3TF7C 1TFPA 2DYPA 3E9TA 5DVLA 3WIFB 3EJYC 3NGBB 3KPRD 4KX7A 1P84J 3EWEA 3GS0A 5FO7A 1GS7A 3V4VA 4W9IC 1BX2B 3L5XL 4F91B 3NN8B 1DQML 3F7LA 2F5BH 3ZDZB 4Z0XA 1U8PA 2PMZA 1BLNB 4ZW3A 1U9KA 5A7EA 3GBDA 4Y19A 4D9LH 4J4PA 5J3HD 4GOSA 1NM9A 1SDYA 2PM9A 3PDOB 2G99A 1JGDB 3V4PH 3SCMD 5KAQF 3THML 1LWJA 1G4MA 3RTQD 1NWPA 5F3BA 3CZEA 3PP3H 3SN6B 5CR8A 4G8GD 3SB3A 3MJ8A 2M2DA 4E9TA 5I1CH 1EHKB 3QIUD 2VLME 4L3FA 4AYID 4LSUH 5I26A 3KPTA 4QTIL 2IC2A 3T8XA 3WKMH 1CLYH 1KLUA 3STLB 4F57L 1KJMA 1CXEA 3LX9A 4FDWA 1B0WA 4JJ5A 2J4WH 1O5DT 1DQQB 3LS4H 4FABL 1HSAA 1UXLA 4UAOC 2QPFA 4KROD 2QVFB 4QRSB 3ZKXB 4PJEB 1NIBA 3GXUB 5A43C 1P1ZB 3POHA 3B6SA 4U3HA 3TURA 5SV4A 4G1EB 3NPSB 1FNLA 4WJG3 1OE1A 4K07A 2DOCA 2ENSA 1NC4D 4G7YL 4K71C 4H25B 1BMWA 5EN2B 3IMRA 2FIKB 1CUOA 4KJWD 2WM0A 3MACL 5A2JH 3T0EB 1DQDH 1INQA 4JT5C 1CDBA 1FL3B 3DBXB 3I3DA 3TO4A 3VSTA 4FA6A 5IFHH 3VGFA 4CNIB 2X2JA 1F90H 1PKQB 3VWKC 2H8PA 2J20A 4E9YA 3GUTA 2AAVA 1M6OB 4HAKA 3CPLA 2IALB 1RJYA 1FPTH 1Z9OA 2DIBA 5GGRB 4NN5B 3PUUA 4W9KC 4Z3TA 4YZWA 3H9SB 4XAKD 3KLSA 3U48A 3GEFA 4OZIF 3V7DB 5BO1L 4ZMOA 3GF8A 1Q72L 4GQZA 4PJAA 5D4IA 3QRLA 4ZXBB 3PSLA 3H7LA 2F5AH 3NACH 2WGNB 3TN0C 3RN0D 5HJDA 4MX7B 4XBEH 5EEXA 2BHFA 4MMXB 2IH9A 3RB7A 3KYOB 4HMEA 4PG9B 1TQTA 1Z9MA 2CBQA 1KV3A 3BO8B 3QI9A 3BDXA 4XVOA 4YNYB 4PQXA 5AL8A 1ZLSH 1PFCA 2EVIA 3ISYA 1GTNA 5ALBH 3PQYA 1P7QB 2J7LA 2VISB 4ODVH 2R0LH 4TSBL 5F3HB 1RUAH 4I48A 5HDBF 4HMDA 3M17A 3TN0A 1RZ7L 4HETA 5AKRA 2WVVB 4I0KA 4L0ZA 3BAEL 5TDNB 2WKOA 3PDDA 5FUZH 3BPLB 4H2AA 5DJCA 5E1GA 5H94B 4HH8A 1I8MB 1YEGL 3T6XA 4Y1SA 3T0AA 2V7HA 4WUKL 4AYFA 3OL2A 2AABH 3U7WH 1AP2A 1JPSL 5IB3A 3VFVB 2CKNA 3N1FC 4BBWA 5SWZE 3WN6A 3CN2A 1IL1A 4XNZC 5EZJA 2J55A 1R34A 3EDKA 2KHAA 3TBYA 3IJ0A 2PTTA 2Q6WB 4ZYKA 2HMID 2VH5H 4JREB 3D3VD 2YAFA 1CG9B 2QPEB 4HIQA 5DZNA 2D3JA 5DJ0A 5FYJD 5T5NG 4A2EA 4UTBA 2NY0D 1F86A 2WXGA 1QI3A 4QHLB 3BWSA 4R4NC 4JMXA 4NT6B 2XBDA 1I1YA 4J77A 3POCA 5D7LB 3V0WH 5D7KD 1HC1A 2G60H 2WUCL 4O00A 4AQ8C 5IJCC 5C9KA 2AJZB 1H2YA 3MC0A 2Z4QA 4IJTA 4M5ZL 4JCLA 5F96H 3WTUA 4X9GA 4NZRL 1QOKA 1IRAY 1MLBB 5C0IB 1VDGA 3NUKA 1YNTB 1J8HA 2H47A 3O3EA 3OKYB 1ZV9A 3KG5A 4YDZA 3P3SA 4HA1A 3S36L 3ZL2A 2R69A 5F71A 3JWDC 5HE3B 3L3JB 2F1EA 1RHHA 4JSPC 3SGDI 5E8DL 3RVVC 3GLDA 1F11A 2HG0A 3D51A 1OP5H 3IE9A 2IAMA 4XMKH 5SWSE 3D06A 4L5FE 5HXMA 2XV0A 5HQGA 4HIJA 1T0NB 3PHSA 1YQ2A 1F4YH 3JTBA 2ZOKB 3OAUH 4FFYA 4MA3A 3GJFB 4LSVH 5KYUA 3DBSA 4JKKA 4KWUA 1MHCA 1ASPA 5C0CE 1S7UB 2EDYA 4WDIB 1FBIH 5JYMA 3RDTC 3QNYB 4DEPB 3T6VA 4EE2A 5HY9B 2YZ1A 5ALCL 4XR8C 5GZNC 3EDJA 5DJ6A 3KPMB 4MNQE 3VO0A 3D4CA 3U7YH 2NY1C 5FCUH 4B7IA 3UABA 3VFRB 4JR9L 1S9YA 1AANA 2EIDA 4G71B 4UTBH 3QUXA 2XVKA 4MQXD 3ZTJG 4A0AA 3LHAA 3GSUB 4M7LH 4LHUA 2AC0A 1OT2A 3LN4B 5IF0B 3ZYZA 3APDA 4PBWD 2OX5A 3ARUA 2FB4L 4GSQA 2IJ0C 1AE6L 5FOBB 5CILH 2IQAB 4XPFL 3GHEL 3CFIC 4MJHA 2JMRA 3LH9A 1ACCA 4A7GF 2LT9A 1YEIL 3QYMA 2R69H 2ZWSA 5HSFA 1XCQA 1GGUA 1K32A 4NJ9L 4Y5YA 4LLMA 3IDYB 3MFFB 4FQIL 5AVRB 5ETUA 1MH5A 3NJLA 3TBTA 3Q3GB 1JZ2A 5I28A 1BREA 2P8MA 4YSCA 3LAFA 3NSJA 4RMWA 2BVOA 2ZQKA 4L29A 1N6QL 4EUPB 1E9QA 3OJ2C 2A5UA 2NT0A 5ANMB 3S9DB 4BE6A 3ZY7A 3O11A 1BXXA 5KVDE 4L8BB 3LKNA 3JWDH 5A2IH 4Y7RA 1DP0A 4GBXB 2N7SA 3DRTB 1S9WA 4BDVB 1QHPA 3V7AE 3B2DC 1HHGB 3CVIH 2W0FA 4NI6A 1ZS8A 4XMLH 2DQTL 3U1SH 3KPNB 4BQBA 4NZJA 3ULVC 1H19A 5EU4B 2QHLA 4HIPA 3QIWA 1R5VB 3QRBA 4MD5A 3GXFA 4OZ4A 3QZWB 1VADA 2ZE0A 3FRPG 3RWIA 4CVZA 3T3MB 4JRXE 3MRJA 4PV8B 2I07B 1BQHA 1T66D 1JTDB 1OAYH 3B7TA 1INDH 5AOIA 3D50A 1VZGA 3EJQA 2YPLA 4FNTA 5EUKA 1I4FA 2VMDA 2VXSH 4ZOEA 1E4JA 2JTDA 2X12A 4N8VB 3EOBB 3I7LA 2EDRA 2CZNA 1OV8A 1LE5B 5AW4B 5BZZA 2P9SC 3NVNA 3OKEB 5CZRA 3LZFH 1WV7T 4FMKA 4F3FB 5PAZA 4AIXA 2WTRA 3CLWA 4WJ5B 1JDDA 1J5OH 3PWNB 5BS0B 4KU1A 2X4NB 3B5HA 2MTAH 1XEDA 3O6FB 3V6BR 2F5BL 5F7BA 2CNYA 4Y5XC 5IQ9B 2CO6B 3KBHE 1CF8H 4CSTA 1KLFB 1VEMA 4TNEA 5D1ZA 3OHMB 3IDGB 1FYTB 4D9LL 4PREB 1WFJA 1I9RL 4LLWA 3TZVC 3QJHB 3F7VB 3V4PL 4PHZA 3BUIA 2OK0H 1U36A 1M3JA 6FABH 2K4WA 1Q9LA 4RWHA 1SEQH 1HH9B 5H8DA 2L4OA 2UZIL 2NXYD 3L17A 1GGYA 4MD4B 1T3FB 4OKVA 2BVPB 3VI4A 5I1CL 1AJ7L 4CN1A 1FL6B 4JRYB 4LCWD 4LSUL 4Y5XA 4AQAA 1CE6A 5BCAA 2FEEI 2NY4D 4X99A 1C9SA 4YDKL 3WKML 3AG3B 3IKCA 2VZUA 3VXNB 1LGVA 4AC4A 5DVOA 4AX3A 4Q97A 3HB3C 2MEJB 4RMUA 2Z3FA 1O6GA 1OSPH 2J4WL 3LS4L 3VX1A 1TUPA 3PP4H 1U8OB 2GAZB 4OUUB 5IB4B 5EFIA 1L9PA 3E1F1 4ODUB 4B9PA 1GL4B 3D0LA 4F2FA 4Y4HD 3ERXA 3DO3A 2G5BA 3L1FA 5CSZA 1J5HA 1PCSA 4QXUL 2VNCA 1G7JB 1OLZA 3EFOB 1OARH 4A0BB 4W6WB 1G6RH 2VLKA 1H15B 3PWPD 3ULVH 5CD5C 1A1OA 1F4WH 1OP4A 3KPQA 3KYNB 4QXVA 4XPGH 1PQZA 4QRPA 4K2UH 4NKDB 2HFFB 2OMTB 1DQDL 4NC1E 4E68A 3Q8EA 1K4DA 3QDGA 5IFHL 1Z0MA 1F90L 1AXSA 4ZUWA 2JE8A 4KI1A 4X6DE 3X1EA 5GS1A 3UZEC 2EVJA 3DJRA 1FPTL 4KRPD 3TT3H 1FC1A 3AS3A 4RISH 5TF2A 2F15A 1X5AA 4DT2A 4G6JH 4Y2OA 3CE1A 4Y1TA 3D69A 3X3GH 4IKLA 4RGNB 1YG9A 3QEQA 3LEYH 3D1MC 3FO9A 2VUKA 3CXHK 4BV1A 4HIHA 2F5AL 2EXSA 5D5MF 3WE6B 4WK2A 1DN0A 2XTSA 3U4EA 4HIIB 1TJXA 5KAQG 2VMCA 4JG5A 4P2AA 1J0HA 5DEGA 3QQ3A 1C1EH 4OBRA 1G0DA 3FTWA 4YGAB 5DD6B 3RPKA 3IBOA 4XYIA 3UPRA 5H4YA 3IFPB 3ZE2E 4R96B 2DQJH 2ZP8A 4Y19D 1CXLA 1GGCH 3OR6A 5IVZA 3KRWB 1AGEA 5ALBL 2PO6B 3D39B 3EJYD 4PJXB 3O3BA 2R0LL 4ODVL 1RUAL 3NP3A 4PGDA 2X4UB 1A2YA 2CHWA 4UT9H 2FWLB 2L3BA 4R0LC 4BSJA 4EDXB 1WITA 4X0KA 5FUZL 4BUQA 4N20A 1EUUA 3N40F 1RV6X 2V7NB 2Z4TA 2OTPA 1XGRB 3R06B 3L9RB 4JT6C 3MV8E 1JXKA 2AABL 4I3GA 3REVB 3U7WL 4O2FA 4HFUH 2FEEL 4AYDC 1X5GA 1U8NB 2CGZA 5C0RL 5JORB 4MJ6A 3PWUB 2IBZY 2UWEA 4ZS6C 2X3AA 1S5HB 3G5YB 4XTRC 4PRPE 1JFQL 1TJGH 3L7EA 2IDSA 2BIPA 3ESOA 3QJUB 2HESX 3VXUD 5BXFB 1KY7A 2H1LM 4PWGA 4GO8A 5B38A 3U79A 2XTJB 3E3QC 4YAQB 5AAMA 3DIFB 3DGCR 4OF7A 2WWMD 3ZQXA 1B0RA 3V0WL 4CMHC 4NC0B 1JD7A 3QZOA 2G60L 4JCWA 5D1QE 1BBJA 3F3PA 3KYMB 5J13B 4JFDB 1GSKA 3MCKA 3TYFA 4GAAA 4DP9X 3FOMA 1DDHA 1SXSA 5F96L 3SQRA 1B3JA 1F97A 4J0WA 3IU3A 4JY6B 1QSEB 2SEBA 3UXFA 1S7WB 2I26N 1XO8A 1CYXA 5EIIG 1F3JA 5ICXA 4Z7WA 1BZ7B 4FC3E 1XSOA 3ZKQD 3X1NA 1CI3M 1QP1A 1TOXA 2GBVA 4DOHE 1CD1B 1QAWA 4E42A 4XMKL 1NGYA 2YAOA 2QKIC 4H0LC 4B9YA 5JIDA 2J1WA 2NY2C 1HYSC 3NDYE 4BCCA 1F4YL 4MXQC 4ONFL 2XYCA 1NL0H 4C55A 4NQUA 3SKNB 3N43F 5A2KH 3D2TA 3CBRA 5EEYA 1FBIL 3BI9X 3PAZA 4NAJA 4OFQA 4MBOA 3MNZB 1MLCB 2Y5TB 4F92B 3VWKD 3QUYB 3T4AA 4J2QA 3A6CH 4OCYH 5GRVL 2VC2A 3ECVA 4PRHE 1H6UA 1ZLWH 4MRCA 1YPZB 2IFGA 4LEXH 1S9KC 3QZWG 1AKJA 3RWEA 1PJWA 3MQIA 3U7YL 3HAEB 1ZLVH 3VFTA 2Z34A 4I9WE 5FCUL 4Q89A 3ML9A 4UTBL 5EBGA 1ZVSB 3ARGA 4M7LL 1QACA 2G0KA 1SF3A 3HUJF 3I6GA 3Q2NA 3SYAA 4J82A 5D2LB 5IB5B 1RUMH 2X6VA 1HSBA 1Q1JL 3K2UH 2XZZA 4YFLF 4Y4KC 4C56E 2WQAA 2BC4A 4LCUB 1I3GL 1G9NL 3WTWA 4EJ1C 3OAYK 1DO5A 2ATAA 4JFZL 2V0AA 1NEZA 3B2MA 1J12A 3L45A 4G43A 1RIHH 5AWNH 1ZLUK 5M5RA 2GUYA 3IFNL 4G5ZH 1KGUA 2R69L 2VKWA 3FQNB 2BZDA 3DVGA 4L3EE 5F8RC 4AH2A 3VD0A 4FQQB 4U6YA 1MCWM 4EBQL 3EUDA 5DFAA 5CO1A 3VG9C 5CXCB 1F8TL 4AXWB 1B4TA 1U8QA 3IM1A 4QRJA 1HILB 1QSFA 2AK4B 4KXDA 5HYJB 4AUYA 5ESAA 4NN7B 4FFYL 1AVAA 3NESA 1R3LA 5EOTB 4BCBA 4WFFE 4YSPA 1WHOA 1ZV2A 5L2KE 4GM3A 5FOJA 3RFZB 1E6JH 2EEBA 3Q9QA 4GJTB 4LF3B 3VE0B 3F05A 2R0WH 4FMFA 1C7SA 4FXKB 4L2LA 4I8DA 2DWDB 2OR8A 3A67H 5T1KB 4ESGA 4R4ND 4NZTH 4BUHA 3WKPA 2OPCA 4X7FC 3U1SL 4J8RB 4BH7B 4L1SA 3JB9L 4P49A 4ZAKB 5GJSH 1E8MA 2DLFH 4JFQB 2ICWJ 2YQGA 5D1ZI 3ET9F 3LV3A 1VFBA 2CO0A 4YDJA 3PGDA 1OAYL 2H6QA 4OLXH 4WIQA 1T04A 4RZCB 1KCRL 1BYOA 3D2UB 3BKCH 3PXHA 3MCG1 4L4TB 1KCLA 4XMZA 3ARWA 1KCVL 2BNRE 2P52A 4QO1B 3RVVD 1S7VB 1WHPA 4X6FB 5J11C 1IILE 4R7DB 4JFED 1UHVA 5CN1A 2DQFB 1NBZB 5CJ5A 1VZ3A 3PWVA 4XX1G 3LZFL 3SQBB 1JZ8A 1JGLH 4KKBC 1J5OL 2Y7LA 4N28A 3VB9A 1HZHH 3QFDA 4IOSD 3RDTD 1B88A 1CF8L 4NQEA 1FVDA 4PJIA 4AWJC 1CJYA 2HJ4A 4BQ9A 1MN4A 5HYEA 3G5ZA 4WO4C 3PWJB 4H8UA 1U30A 2YB8B 4NWUL 4LNVA 2EDMA 1WFNA 2QMKA 4M4RB 3II3A 3RIAK 5GZND 5C0FB 5BPPA 2X9ZA 3AW5A 2NYYC 1QYGH 2FYYA 4PWKA 2OJEA 1XFPA 3DVNA 2NY1D 1I3VA 5JXAH 3B2PA 3OR7B 1M56B 4XOAA 3WHXB 2H26B 3S34H 3V0IA 4AENB 4XPBL 4IRSA 1QRKA 5IK3B 2HG5B 4BP9A 3G04A 1UOOA 5KN5A 3A3YB 4ELKA 1X7QB 1OSPL 2C4FT 1EAQA 3PP4L 3WCYA 3EI4A 3F00A 4P2RD 4WNQA 3QJFA 4ERSH 1N7MH 1UURA 1XF5A 1A6AA 2J2ZB 2JIXD 4TUOB 3ZZQA 2XNAA 1C8PA 1IC4H 2XPZA 4YHPB 5FAAA 2P8LA 3EJZC 3NZ8B 5IQLA 5IVXE 4F7CA 1YDPA 1OARL 4ZPVA 4L23A 3DX9A 3JZ7A 5F7LB 4IMKC 3ULVL 2D7PA 4CN6A 1XGUA 1XD1A 4ZMTA 1F4WL 2H3XC 1OD7A 2WVUA 4O4YH 4XPGL 2X4RB 5AVXB 4CA4A 5H1MA 1MFEH 3KS0H 2BWIA 2IBZX 4JRWA 4CZXA 2CHXA 5EWIH 3KJ4C 4XNAA 3E7JA 2ESVA 3T8VA 1YEJH 3IUJA 4G8IA 3H54A 3K80A 5JLZA 1OAZH 1QVOA 4HLEA 1KGXA 1NCWL 2BXYA 1AGFA 2YGPA 1CS6A 2VZOA 2QQLH 1H3WM 3N50A 3NIFF 3BGMB 3RVTC 4AMYA 2DTMH 1KCSL 3T0XA 2YGNA 1MF2L 3ULVD 3I6SA 4U1SA 3CXHJ 3LEYL 2Y1VA 1YR2A 1I8AA 4Z7UE 3DX6B 1SXCA 3JWOC 4WTXA 3CHPA 3NJFA 1HX0A 3QHZL 1FGNH 5E9DD 3LXBA 4WKZB 1IAIM 3HS0A 5DT1L 4RMSA 1IC0A 5EEWA 2VXTH 2NX5A 2Y2TA 4GMTL 4QLWA 4PJ5E 1P5UC 1GH7A 1UXSA 2DQJL 3CHXA 3OKDB 4CC4C 1W0VB 3AREB 1KN4H 1A9BB 3OQRA 1N6FA 4PBZA 4YE4L 4U7KA 4ZMVA 1D7CA 3PL6C 2AHIA 3FB5A 4NENA 4UT9L 3K6SB 1MHEB 3FUDA 3G6JB 2G3ZA 4FLHA 3ATAA 1PX8A 4CDGC 2X6AA 1LO4H 3CFJB 4Y4FC 5IW6B 3TO2B 4U6XB 1BPVA 5JOFB 1X6NA 1MCDA 3S88H 4F33A 3APMA 3RX9A 4N1HB 1A5FL 2YGVA 4OIAA 4RDBA 5EUOA 4WHTB 1RI8A 3TZVD 5H17A 3T2NH 3QQNA 3FB8B 4WLCA 4ELMF 3EYQC 5TE7H 1LO3H 2A74A 1TJGL 3HG1A 4XB7A 5AAWA 2YNOA 3EJUA 4XCYB 4F7EA 4X6EB 4WTQA 1JMZB 1Z2KA 2OXGB 1AGCA 1ES0B 4G8EB 4G59C 1F1AA 5I1JH 2KMWA 3BN9C 1GIGH 1MCHA 3LKQA 4FLQA 4M7KL 3L3IB 5CBEA 3ZL1A 4KUCF 2P49B 1AD9B 3GI8H 4JQXC 1E8ZA 1R6VA 3HB3D 1MNNA 4AK1A 2ID5A 3MV9A 4J5VA 1R24A 5KVMC 2B9BA 4XN5A 2ZXQA 1ESOA 1CGWA 1CFVH 4PNKB 4IQHA 3FCSB 1D6EA 43CAA 2DKUA 5EZOH 3QDGD 3A22A 1AI1H 4HSQA 1IM9B 3LZNA 4G70B 4ZOVA 2KLSA 4A2GA 2Y6TE 4WSJA 1TVDA 2QJDA 2YD4A 4ALAC 5EBMB 1TFHA 3T2OA 2HVKB 3QWQB 4E41D 2HXAA 3QI0A 5CD5D 1UM4H 3S37H 3ZRFC 2C3XA 2WVSA 3PE7A 3QEQD 4OZGA 3JWOH 4A7SA 1NL0L 4X9HA 2CM5A 4LLYB 4BYHA 4P5KB 1TF4A 5AUMB 4WI4A 1RPQA 1OGSA 1CN4A 3GIVB 3E1ZA 2JJSC 1TU2A 1N18A 2B20A 2JLLA 1ZLEA 5JOPE 5C2BL 5LGKA 1HI6B 2NW3A 4F2MA 3A6CL 2C9UA 4OCYL 3AS0A 4LAQH 4BA0A 3NCBB 3DX8B 1E5YA 4BFRA 5A6MA 1WGOA 3D5OF 5DURD 1ZPUA 3ARDB 1MW0A 3BIKB 5TDOB 5JPNC 4Y88A 1KFGA 2Y0SA 4JQVC 5AZUA 4AKQA 4ZFOB 3ODTA 2ENQA 1UH3A 2ZYSA 5IT2H 3U30C 1GGBH 4QT5B 4KOCA 2F8OA 2ITFA 4QAWA 2G4GA 5ENWA 2X9YA 2VR3A 2DLEA 3P30H 4HIXH 1XB3A 1FFPA 4KXCA 2P9UC 2P5EA 3MAWA 4GRWB 2Y7QA 3FTVA 3N1GC 1YC8A 1RUML 3TEYA 3DA0A 4OCNC 3K2UL 2HXCA 2ITEA 4I2XE 1TQUA 1F4XL 1A1NA 3KW7A 5JIPA 3FSZA 3D25B 3HZKA 3MJ7A 4JFVA 5FHBH 1DYZA 5GSRB 1A7NL 1COBA 4DETA 5AWNL 2ODHA 1HU8A 5AVYB 2ZF9A 4WJKA 4Q2ZB 4QOKB 5IBUB 4G5ZL 2O6FA 3CFTA 2YOCA 1RZQA 3QJTB 3JVFC 4J3TA 3ZDYF 4GXVL 1MCCA 3VXMA 4HHAB 1D9KC 3FUIA 2CCVA 3VXOB 2F8VA 4Y1AD 3H3BC 1I1RA 3QH3B 2OL3H 1RMFL 5FW6A 3ZO0A 4WNJA 1GA2A 3GDCA 2OSXA 2RD0A 3NIGA 1BVNT 4ZS6D 4YXKH 3VXPB 4XTRD 2CO7B 4JN2A 1M7IB 4KJPD 4IRZH 1T0OA 1K5WA 4PRNA 3MRRB 3WLBB 3DOSB 1NMAH 2KZKA 4MMZB 2FWOB 2R0WL 3BPCB 1HNFA 1MCIA 1NLDH 3GZQA 4E0RA 1BXUA 1HFUA 1RLWA 4ODXA 5EU5A 4G6KL 3WJLA 1O0VA 4ALAH 2ZCZA 2EE6A 2F54D 2I24N 4YHOH 4NOBA 4FJZA 5A1AA 5JMOC 3LIZH 5KYXB 4M43H 1SYVA 2DJUA 2DLFL 5FGSA 5BMFH 1MJ7L 2H3NA 2BSCA 4MJ4A 4HJ0C 4K5MA 4QYOB 1C7TA 5KVEE 4OLXL 2WLMA 5INDA 5BVJB 3VAEA 1BF5A 3TNNB 2FO4B 3OD3A 3FSVA 5DK3A 4UNTA 1XQ4A 3BAXA 2OQJA 3T1FA 4WKXA 2VDNH 3P77B 1LO0H 2BZ7A 2IAAC 1X5YA 4GXUN 1XHMA 5SX5H 1ZMYA 1FGVH 3MV01 1OPGH 1T5XB 2UY7B 2HRLA 3FFCD 1EAPB 5GRUL 1HYSD 3HC3L 1JGLL 4MXQD 4JFOB 4QXTB 3RE0A 2YBGA 3AC0A 4EIBA 5HDLA 1MIEH 1HESA 5KJRH 1E9PB 4FTVB 3DSNB 2ARJQ 2GK0B 4N68A 4HKBB 1FI8C 1BX2A 3NN8A 4MJIE 4OQ1A 4QRBA 3ZDZA 3AUWB 1QI4A 3N5AA 1OD9A 1M7XA 3GINA 1UTDA 2XIIA 1Q9WB 3BAWA 3PDOA 4OF3A 1JGDA 5AMSA 2XYIA 4ECNA 2HVBA 5C1MB 5JXAL 2VDKA 5ITBL 2UXGA 3FW6A 5DEZA 5LCVH 3ARXA 4MNGE 3S34L 3VSUA 1PD6A 1WRFA 2JJTA 4JM2C 4MA1C 1IAIH 4F1ZA 2LLNA 1XDTT 4ZO9A 3QXUA 1REIA 3STLA 2OMUB 2OMWB 4YDNA 4Y4KD 2GIMA 2IBGA 2WLJA 4HHWA 3EH3B 9PCYA 4ERSL 1YNKH 5FW8A 1A3ZA 2WXQA 3ECQA 1DQQA 1CFQB 3L4MD 2VRKA 1IC4L 3LN9A 2EE2A 2VQ4A 4F37F 5BUGA 1VAHA 2QFRA 4QRSA 1I8LA 4IKJA 3IGUA 5E00B 2AJYH 5IHUH 4PJEA 4FKEA 3L95B 4JM2A 1M2OA 2D03H 3NEEA 4NFBA 4BH6A 1P1ZA 3II2A 3RZCC 1ZY9A 4G1EA 5DJ8B 3FUJA 1AQHA 4E5ZB 1ETB1 4O4YL 2NW2B 1YNLH 1MFEL 2FT6A 3C2AH 3ZT6A 3CHOA 4H25A 4X7TB 4XMWA 2J1ZA 4MA8L 5EN2A 1WAPA 1YEJL 4PCYA 1V3LA 3VI3E 1EZLA 3IKKA 4B9JA 5E6YA 1T2XA 2FIKA 3QNZB 4JQIA 2AP2A 2JLPA 4J3BA 5JWZA 4NRYB 3T0EA 1FL3A 3DBXA 5F9JB 2BOLA 4NFCA 5CP3H 2X0WA 4W9HC 2DB8A 2QQLL 2WSPA 4PD4K 1PKQA 3RFRA 2XKNB 1CGYA 2F7IA 1M6OA 4Q0XH 2IALA 4HT1H 4GW4A 1JWUB 2PNDA 3EJSA 4U1GC 4P2OC 5GGRA 3ZL4H 3H9SA 2O6PA 1OB1A 3UACA 3IVKB 1HKLL 1VGKB 4KUCD 5L7XH 1H2ZA 2ZNXA 2VDKH 4ZXBA 2J8UE 3GD1C 3IJYB 4B9ZA 4NQED 4MX7A 4AOFA 4Z7NB 2IG2H 4MMXA 4K8RL 4P5TC 3KYOA 4XI5C 2VN4A 2DIAA 4PG9A 1KN4L 2H6PB 2IPUG 3BO8A 2BCMA 4WGWB 3A6BH 3FU7B 4YNYA 1EJ8A 2ARJB 5K59E 3VWJC 3KXFB 1UACH 4KKBD 4JHWH 5EF0A 5B3JE 3WTXA 1BYNA 3DPBB 1TSRA 1G84A 1BM3H 1P7QA 2VISA 2YEQA 2O5YH 4P8QA 2DBLH 4OV5A 1LO4L 2F7OA 3DVFA 4XVSH 4LCCC 3WV0A 4PLNC 4JREC 3AGVA 2WVVA 3S88L 2DQHH 2HFEA 4WO4D 5H94A 4XE5B 4MD0B 5BOJA 3HCVB 1I8MA 1RUPH 3T2NL 2IF7A 3C60B 1IAKA 3SY0B 1BZ9B 2CUIA 5TE7L 1HVXA 4OCWH 1LO3L 2NYYD 5TPWL 5I1AB 3VFVA 3UTSB 1XGPB 2JKRM 1BPOA 1QMUA 1WZLA 1SN5A 3WL9B 1ADWA 4DEUA 2Q6WA 5I1JL 4J79A 5I0WA 3HMWH 4QRRB 4AYGA 1GIGL 1NFDF 4QKTA 5I1GH 1CG9A 1SHSA 3U83A 2PPFA 1QUNB 3MOAH 2WWKT 1AG0A 1BHGA 4OCXH 1UVQB 4NT6A 5D7LA 1L5GB 1JL8A 3TPUB 4JE4B 4ANVA 5KTEH 1JTOA 1S7QA 3OGCB 1J7VR 2AJZA 5I1HH 2CJTA 4G7RB 5JDSB 1AI1L 4XN2A 3HN5A 3X2QB 4HSAC 3EJZD 4C59B 3BQUB 1MLBA 5C0IA 5EU7C 1HCFX 1QPKA 3VXSE 1HHJB 2H6OA 5C07A 3MRIB 1YNTA 5ABZA 3OKYA 3P4OB 4DK5A 4L1MA 3SPGA 3V9EA 3L3JA 1UM4L 1WSST 3S37L 2GJ6B 4D0CB 2EE0A 3JWOL 3ZBMA 1M9SA 3D87B 4U31A 5C08B 4AIOA 5FUOH 3GM8A 4O58H 1T0NA 2L7EA 2ZYRA 3IRZA 5E6SB 2OJZH 2ZOKA 3GJFA 4TL4A 1Q90A 1S7UA 4WDIA 1RERA 1AMXA 1DZ0A 2NX5D 1DHKA 4RMTA 3PUCA 2CBOA 3P2DA 3QNYA 4LAQL 3SDAB 5C2UB 2QKSA 4BWWA 3JVGC 3OPUA 1K5NB 1C5BH 3EUUA 1TQCC 3GMQB 5HY9A 5I6OA 4JM2F 3CHSA 4PG2A 4P0DA 8CGTA 5FK9B 3ARZA 2WC7A 5DLML 3O6LH 3SCYA 4U4BA 5EZPA 1ZJBA 3FH7A 3KPMA 4ZFGH 5IT2L 1GGBL 4L3CB 2JKXA 4XB8A 4KNSA 5HGHA 4NPYB 4ANUA 3P30L 4FFTA 3VFRA 1OAKL 4OIBA 5CFHA 3E38A 3C2SA 3ZXAC 3JVGA 3GSUA 2BNQB 3LN4A 1SDDB 4MDJA 5IF0A 3IYLW 3X12B 4ZZFA 1BD2E 3OLIA 4G9FE 5FHBL 5J4MA 1CYGA 3PL6D 4OLUH 1IAII 1HE8A 2DMBA 4NBZB 2K7QA 2ZICA 5FOBA 4MBRA 3R7RA 4O3UB 7FABH 3RJOA 4WUUA 2QV4A 4Y4FD 2IQAA 5KUKA 2X4OB 4OY9A 4XMVA 4MAYB 5B7MA 3H3PH 2OL3L 1SYSB 2YO3A 1TYJA 3BEVB 4TN9A 3LY6A 1E6OH 4YLQT 4YVNA 2O5XH 2VSKB 3DETC 5IFJB 1QX1A 3EYQD 1AGBB 3E2HB 4YXKL 5I75C 1D7FA 3KMDA 3Q3GA 5FUCE 3VQ2C 1BVZA 3VMNA 2CHDA 5I76B 1NMAL 2D2CC 1PJ9A 2K0RA 1LO2H 3HI5H 2P7TB 3TWYA 4D3CH 1OLLA 3APNA 1X4ZA 1WO2A 3ARYA 4DGUA 2R2HB 4OGYH 4EUPA 3L4OD 1NCDH 3BN9D 4ALAL 3LPOA 5ANMA 5AW1B 4GG6B 3HFQA 3RWFB 4WFED 4L8BA 2FBRA 2BZCA 4ABWA 4W4OC 1NGQL 1L7TH 1TZAA 2BP3A 4GBXA 5IJDC 3ULUL 3DRTA 4BDVA 2I3TA 1TMCB 3BP7B 5I30H 1HHGA 3TWCL 1KCUH 3KPNA 5GGTA 4OQTH 3RI5K 1R5VA 5K33A 4H1LH 2ICCA 2V5RA 2WO3B 4Z8LA 2J5WA 3T3MA 3CFDB 4Z7OB 2WYTA 1NFIB 2I07A 1QTSA 4PV8A 4PRHB 1IB5A 1MDAA 1TVBA 2NR6A 5CKGA 4OIFA 4MJ5B 2DQ6A 1FGVL 4U33A 4HLJA 1OPGL 1S3KH 2ZKMX 3FB7B 3BZEB 5E2UL 2P9LC 3UDWC 1KTRL 4N8VA 3U1PA 4UT6A 5BRQA 1WZ1H 3G5XB 2I32A 1H9DA 4AQ1B 1WFIA 1H3VA 4MZRA 2EYTB 2KKQA 3FC8A 4FL4C 3S3SA 3OKEA 4E2OA 1LE5A 4U1NB 4F3FA 2HT4C 3PREA 4FNPA 4WJ5A 3PWNA 5BS0A 3AM8C 4M1GH 3X13B 2X4NA 3M45A 1H0DB 3QS3A 7PAZA 3RP1A 3O6FA 3K5SA 4IHBA 2AZUA 4U1IB 4M29A 4UU9B 3U2IA 1T1YB 5IQ9A 2CO6A 4C56B 4IKIA 1KLFA 3FCBA 3DTXB 3NFPB 5ES4B 3IDGA 2Q5BA 5EARA 4PBYA 1FYTA 1TJIH 2EIZB 3KH3A 3P3UA 1EWHA 5IOPB 3QJHA 1YEFH 3DK0A 1IGCL 3F7VA 3EFDH 1HH9A 3DDUA 1EGJH 5KSAB 2CGRH 3IN0A 5LCVL 3H55A 4MD4A 4NO0B 2BSDA 3AM8A 4P4RB 1IAIL 3VXMD 2A9MH 1FL6A 1GS8A 4Z3EA 3C99A 3BWZA 3NCMA 3SJVE 3MV11 4HXBH 2H13A 4CGUB 2GBTA 4TRPH 3IJHB 1Q9KB 5L2KB 2A77H 4KJYB 5GGTH 3JWNE 1ZKAA 1BMGA 4YSTA 1LP9F 1U8OA 5GZOA 2AJVH 2BPBA 4OUUA 4GMSH 5IB4A 5J12B 4NQDD 1KYOK 3B56A 2E27H 2Z31C 5IHUL 5CLTA 5CIPB 3H7BB 3BLPX 3RY4A 1FLRH 2BDNH 3DDFA 1D9KD 3WGVB 5JW4R 1V05A 4IBZA 2HVJB 1G7JA 3EFOA 5AYQA 2PP7A 4A0BA 1YNLL 1DBKH 4CL7A 4LBAA 4NO3B 5F7AA 4P2QD 4RH4A 3DX4A 1H15A 4N90E 4ZG1A 1CXHA 2E4TA 2H32H 4Z6AT 1LEGB 2FEDC 5DLLA 3KYNA 1YQVH 1LLAA 2HU5A 5CSGA 2RB8A 4LP4A 3WO4C 4NKDA 2HFFA 4R7NB 2OMTA 5JIMA 1FZOB 4ZUVA 4MNHB 2Z2OA 1JNNH 2Z31A 4PD4J 4LQ1A 1ZXQA 3RFGA 1AZBA 3ESVF 1JFHA 3C75A 2VDRH 3GRWH 3NP4A 3HFMH 1J0YA 4Q0XL 4HT1L 2LR4A 4KUZH 4PJBF 5IW3A 5E1IA 3TTYA 1CICC 2LTQC 3EJJX 4LK4A 2WXFA 2JV6A 4U6VL 2WYHA 3CFKB 4HJ0D 4OGAC 3T8MA 4CSZA 2VDKL 1ZT7B 2C9PA 1NIFA 1T89C 3KPSD 5IROC 5TH2B 3SE9H 3WE6A 4CW1B 3FYEB 1WT5C 4L8SB 2BINA 2IG2L 4E9LA 2QMJA 1JRHH 4JVPA 5FYJU 2YN3A 3RWDA 2P9RA 3A6BL 5DD6A 2IBBA 1QWUA 3IFPA 4R96A 4F7TB 3ORVD 3O4OC 4NPJA 4KK5C 1UACL 3QEHB 3V9CA 5SXMA 3MGAA 1BM3L 2PO6A 3D39A 2R4SH 1KIPA 2DBLL 3RVXC 1VZ2A 4XVSL 1F3DJ 2X4UA 4WFHE 5AKVA 1Q0YL 2O72A 1WT5A 4L3HD 4EDXA 1OKEA 3ZE1E 4BFBD 4G72B 4LAJH 1AYOA 3R8QA 1JPFA 4U49A 3OV6A 3UP1A 4UAHA 4ZODA 3R06A 2V7NA 1XGRA 3EYSH 3L9RA 3UTPD 4YFEA 5AD0B 2QQKL 4OCWL 5G2NA 3REVA 2YRPA 2WXLA 3WTSA 2P5PA 4O5LH 4AMKH 4E5XG 5DSCB 5J13C 2YKLH 5J6SA 1U8NA 4ZRGA 5JORA 3PWUA 1LHZA 4R4FH 4JGNA 1S5HA 2KZWA 3G5YA 4PJFF 5SV3A 3L08A 1SY6A 3TT1H 1NPUA 4M62H 5I1GL 5BXFA 5C0EB 2VQUA 4JM2D 1T2QH 3MOAL 4PLKC 2X4TB 1AZVA 3VGEA 3WJMB 3DIFA 3JBG7 3C75H 1SRDA 3A4EA 3OAWA 4PIBA 1BJ1H 4OB5H 3NK4A 4JG0H 5KTEL 3GWJA 3HZVB 1A4BA 3KYMA 4OFYA 4HJEA 4UI9R 3QJXA 2XV6B 2BK8A 4A55A 2PM6B 2HTKC 3K4ZA 5TK2A 3VDBA 1S9VB 2W9LA 4KO7A 4JY6A 2JELL 2YPVH 4K7PL 1QSEA 3QWRD 3S35H 2AGZA 5IHWA 1S7WA 2NNRA 2Z1KA 3BVTA 2VAAB 4NQTA 5E24E 1GG2B 3KYKL 3UCRA 2WYIA 2Q7NA 1BV8A 4KHTH 4RSYA 5LGYA 3WEOA 3RZCD 2YWZA 3MROB 2JCCB 4OFKA 4FXTA 4TPRL 1I7RB 1CD1A 1MDTA 1G7LB 3LEXB 3MRDA 3QUMH 1V27A 3C87A 3MSPA 4O58L 3H9SD 4J6RH 4LOVA 5C09E 2DN7A 2OJZL 2HAZA 4DP0X 5JW3H 3D4ZA 3G08B 4HJGB 1UD3A 3SKNA 4JFUA 2DWXA 5EMJB 5IJ8E 5EOCL 2ZOOA 4N2HA 2FECI 3MNZA 3QARA 2C34A 1ERJA 2XI9A 5KOMC 3QUYA 1RIUH 3STBA 4GQRA 1U4FA 5ELIA 4UILH 4JCMA 1B4JH 3G7TA 3O6LL 1U3HC 4P2OD 1RK0B 3SBPA 2P4AB 2PYEA 2NDGA 3BVDB 4ZFGL 1YPZA 5T3XE 5DJXB 3HKZA 2WW8A 4PJDF 4Z23A 1AHWC 3HAEA 5IGQA 4XO5A 3P02A 1EIBA 3HNTH 2QTVA 4OM0H 4FA9D 2EDHA 1ZVSA 4P5TD 3HE7B 4XI5D 4W9DC 1WA0X 5IQNA 5D2LA 1FNEB 1MAKA 4B3EA 1U3HA 4PBVC 5EO9B 3C9NB 4OLUL 4J3WA 3VWJD 3P4NB 3W9EB 4KDTC 4LCUA 2VM3A 3W3BA 4JPSA 7FABL 5I15L 4JPWL 2DI8A 2MQCA 3X17A 1OGPA 5IQ7H 3W0WD 3H3PL 1E6OL 5JA9A 4XNXH 1KACB 2GEQA 4X4KA 5CXCA 4ZAKC 4AXWA 1LE9B 2VB5A 2QBWA 1HILA 5THAA 2AK4A 4KDTA 4I18B 3V6FB 3A5VA 5HYJA 4NM4H 3HI5L 2XXFA 3CZFB 4D3CL 4PJGB 5EOTA 3KVDD 5C6PB 2XLLA 4JZNB 4OGYL 1NCDL 4GS7B 3UAAA 3RFZA 4LF3A 3VE0A 5FS5A 5C07D 4AQZA 4FXKA 2CH8A 2WPGA 2BCKB 3PJLA 2DQDH 4TNWF 2DWDA 3EHBB 4UNIA 1L7TL 5T1KA 4CBZA 3TASA 4GAYB 1CURA 3SE4A 2P44B 4J8RA 4BH7A 4DN3H 1QFOA 5KBPA 4ZAKA 4YLBA 5DJAB 4OQTL 1DVXA 1TEGA 4H40A 3QQDB 4JFQA 3DUHA 2EAEA 3GI9H 4AEEA 2R0KL 3HAEH 3LIUA 1H5BC 1QNZH 4JO2H 4OGQC 4RZCA 1ZTXE 3PY9A 2GJJA 2MQ0A 3D2UA 1S3KL 3HN3A 4L4TA 4RVBA 2YGOA 1JHLH 2WQVA 1YEEH 4PY7B 5DYFA 3ZRSA 5JW4Q 2QLYA 4QO1A 1S7VA 2FECL 3M07A 4GFTB 4R7DA 1KLGB 1O6SB 2DQFA 1NBZA 4KO5A 4RGMB 1IZJA 3SQBA 2FJHB 4AYBA 2ISDA 3GS4A 1B9YA 3O9WC 3AAZB 4UINH 1QRNB 1AXTH 2W59A 1NEUA 4KKPA 1CPUA 3KLAB 1A8ZA 4J81A 2BHUA 2VDPB 3PWJA 3OWRA 3TA4D 2D73A 1YEFL 2C3GA 4OI8A 1RFDH 3EFDL 4M4RA 5EV7A 4PVBA 5L6YH 5FPIA 3UC2A 2FQGA 1EGJL 4MAUH 2CGRL 5B39B 4H8WL 5J6GA 4ADGA 4KY1H 2ROYA 4WUUD 4ZI8A 2A9ML 4FHKA 3NZUA 3MGOB 5DI8B 4KV5F 3OR7A 4HXBL 2H26A 4OD1H 5IK3A 2HG5A 2PCPB 4UQIM 4K3DH 5JHAA 1G0YR 1XF1A 4LIQL 5EH1A 1X7QA 5GGTL 3LZQA 4FN0A 3E6FB 4ZTPH 2AJVL 5GJTH 2KQMA 1KYOJ 2LHAA 3CN0A 3ZT7A 1E8YA 4PJAE 4TUOA 2J2ZA 1FLRL 2BDNL 5AENA 4YHPA 3NZ8A 2J8OA 2B1OA 3MNWB 4P4KB 2NPLX 1SQ2N 2QR5A 5CJQH 1DBKL 4Z3GA 5E6RB 5C9ZB 4PUBH 3DETD 4UT6L 3SKJH 1TYRA 3UAJA 3H85A 2CO1A 4N8CL 4PJHF 4XVJH 3ZR6A 4UB0H 2C4XA 4F15B 1YQVL 4Z7VF 2VN6A 1H8LA 2X4RA 1FORH 4N2GA 4DERA 5HGDB 1HXKA 3BWAB 3PQYE 1AO7A 4NDMA 1GJIA 5KSBF 3OWEA 1GYCA 2ZUWA 3J8F7 4E9RA 3WE1A 2WJ7A 3GRWL 4IDJL 1FL5B 3DSFH 2F53B 1TLMA 4XPAL 4WI7A 1RD6A 2PWFA 1NBQA 3CFMA 3JTTB 2BERA 2PWGA 1NAMA 3AREC 1HCYA 1AR1B 2BVQB 1OHZA 3DX6A 4BEIA 2H0PA 4TS6A 5KWYC 2XQYA 1JRHL 4WKZA 1SZNA 1DUYA 3N0PB 5EDSA 4L0PB 5HDQH 3TIDB 4KQ3H 1DQKA 4XC1H 5JPMB 2J71A 3OKDA 4L1BA 1ZEAH 1DVFB 1W0VA 3AREA 3GZKA 4EQ2A 1A9BA 4A66A 2QZ5A 1WWAX 2NY6B 2R4SL 3E6HB 5IUCA 5C97A 4DKFH 2CRYA 1UD6A 2HT4D 4GPVA 4PRID 3K6SA 1MHEA 1MFDL 3G6JA 4PJ8B 1B9ZA 3OAZH 5A16B 1J8HE 3CFJA 5IW6A 1RIVH 3TO2A 3V0JA 2I5YH 4U6XA 5ISZB 5JOFA 2X3BA 1W9XA 5CXBB 3EYSL 2BOBA 2ODIA 4WTZG 4GM9A 1M53A 3N85H 4O5LL 4H1LG 4LPYA 4WHTA 3VA2C 3WYRA 2YKLL 1A7OH 3FB8A 5B21A 4ODWB 5E6UB 5B7FA 3IDXH 2DI9A 5HHVH 4GLRH 4AK2A 4XCYA 4M62L 4X6EA 1JMZA 2AAAA 4G8EA 1ES0A 5MI0C 4BZ2A 1T2QL 5FM4A 4UIKH 1KYAA 2IDFA 4R26H 4K55A 1AD0B 3WFDH 4OB5L 1GMIA 4EQ3A 1AD9A 4JG0L 1KBGH 1FFTB 4DK6A 2XXCB 3FO2A 1NAMH 3QQ4B 3FDWA 2ICEB 2A9NH 4DJMA 3S8WA 2D8KA 3FFOA 5F2FA 3DDGA 4IIZA 3KCWA 3BAYA 4F5CA 2YPVL 5IMLB 1PX4A 2X4QB 3FCSA 3MLVH 3S35L 2Z31D 5JOPD 3MUOA 4JKPL 1DO6A 2R29A 3ESPA 3QJOA 4JFFE 1KG0A 2YRLA 1IM9A 3RLSA 1R3IH 4N25A 3BPOC 3QHFH 4YSRA 2N0KA 5EBMA 2HVKA 4PJCB 3GSRB 4X2UA 1LWRA 4J6RL 3NIDB 1ZWIB 2FEDD 3P0VH 1QSVA 5AOMA 3S96B 4Y7OC 4DO5A 5JW3L 3ABMB 5TDHB 3M1BA 3HE6B 4XP4H 4LLYA 3SDXE 3AWEA 4P5KA 5AEAA 5IEHB 5BV7C 2HN7B 5AUMA 1HQ4B 3ZIYA 2DY2A 3GIVA 1OM3H 3OTTA 4MCZB 4O45A 1RIUL 5F72S 4UILL 1B4JL 4JSNC 1VEOA 2IPKB 1CICD 3DX8A 1C9LA 4RBPH 1CDUA 3ARDA 2GT9B 4OGAD 3BIKA 4DZBB 5TDOA 1ECZA 1MZZA 4EPSA 4G83A 5DD5H 5DMJB 1SY6L 3RWGB 3S5LB 4ZFOA 3WUZA 5C6TL 5IROD 1A9VA 3S6CA 2XE4A 4AN0A 4LPVA 3HNTL 4QT5A 4BZ2H 4OM0L 3D52A 1GSMA 3TIEB 1A9EB 1JYWA 4UTAA 2QQQA 5SWZA 2Q8AH 2D4DA 1J9TA 1F4HA 2J44A 3UBXG 1IIIA 2AI0H 3DXMC 5KDOB 3ARFB 3GIZH 4N0FB 2FL5B 3D25A 2PR4H 3TONA 3RVXD 4ZPTB 5GSRA 2ZWYA 1UWYA 2R29H 3O8XC 3QFJB 5IQ7L 4Q2ZA 2M83A 1I85C 2E8YA 2ZUUA 4H0HB 5LUMA 4I4WB 5CJBA 4HHAA 2YPLE 3NYKA 2H0EA 2WBWB 3PNWB 4DNLA 1F3RB 3VXOA 2FCBA 5CJOH 3QH3A 5F1OB 3IDJB 5D70L 1SVCP 3C6LC 5F7MC 3HI6H 3MDJA 3SDDC 4ERYA 5F0PB 1XZWA 2LFGA 2EUWA 3JT0A 4LVNB 5C0BD 3VXPA 2CO7A 4B41A 1M7IA 2HZHA 2N56A 1I1AB 2IAND 3MRRA 3WLBA 4DVRL 3DOSA 3BYTA 2FWOA 1OF2B 1WF5A 1NKGA 3BPCA 3MKKA 5GSVA 1CMOA 1EO7A 2YZ8A 3QWNA 4PLKD 5I71C 3AABA 4LT7A 4PAZA 5EU6E 5GRYA 1HJBC 3N44F 2UVEA 2XU7A 3MUNA 1B0GA 2NXZB 4DP6X 2OXHB 3K7UA 3CSYB 3QIBC 1MJUL 1WVZA 5KYXA 4UQ9A 1OF0A 2VLRE 3DTUB 2HTKD 1T1XA 3UVMA 4QYOA 3U46A 1SEBA 3VXRD 5BV7H 4UOZA 2HKFH 2Y07H 4UDTB 1QNZL 5BVJA 2YPKA 3OC5A 1ET5A 3RWHB 2FO4A 3TNNA 1GZHA 1EEQA 4N0CC 5AVSB 3VI4E 4NN6B 4DW2L 3MYZA 4POYA 5D2NB 2VQTA 3EBIA 1YUKB 1YEEL 3P77A 4LGPB 4WV1C 3WXWH 3N3EA 3SXTD 4GG8B 1JK8B 2BW5A 2WMPB 2JQZA 4ZW7A 1T5XA 2UY7A 2PYED 4XN9A 4DVBB 4OWRA 1EAPA 2P46B 1JNHB 3BGFC 3HBPA 2CPCA 1L9TA 4JFOA 4QXTA 4ZOZA 3O4LD 2VZ1A 1IGMH 1TTGA 4UINL 3CLEH 4NX0A 1AXTL 3KLLA 2AK1H 1MELA 1E9PA 2VKXA 1DSFL 3DSNA 2GK0A 2EC8A 4HKBA 4HALA 4K73A 1WFOA 4TMPA 2FGZA 3HPLB 4CVXB 4JMNA 2FRGP 2XWCA 4F8TA 2VLKE 2X6MA 1U3HD 1T21B 3NCFB 4AEHH 2BSED 2CRMA 4CJ0A 4G82A 4N0YL 1X5XA 1Q9WA 4KI5E 3NH7H 4GH7B 4JKLA 4QRPE 3IPEA 1A6VH 3IIWA 2XX1A 2ZUQC 2XPGB 4KY1L 3RAJH 1OZTG 1G7HB 3LS5L 5I73B 3FPXA 1UA3A 1JVOA 3EBGA 2H0FA 2XA8H 4BFFA 5C86A 4CY3A 3CDGB 2WLZA 4K3DL 5DS2A 4A2FA 4GLRI 4NHUB 4AV5A 4IRJB 3JRPA 4ZTPL 2OMUA 2OMWA 5GJTL 4N2MA 2A7BA 1MI5D 1CU4H 4HS3B 3EI2B 3B9KC 2F1AA 1CFQA 4OFVA 4WI5A 2J25A 3QS2A 4F7MB 1RLBA 3H2PA 3EJCA 4M5TA 2V5SA 4XBGB 5E00A 3G9AB 2AGXA 4FD0A 3L95A 1TENA 2FYVA 1ACYH 5KG9B 3MV7E 4IK7A 4CN4A 4XVJL 3LSOB 1ICTA 3ALXA 5DJ8A 1KC5H 4UB0L 4E5ZA 1A8JH 1F58H 2NW2A 3BKJH 4K5PA 3GFCA 5TEEA 1FORL 5CZKA 4XNYH 3QAQA 4H20L 3R19A 4JRXA 5BZDB 4X7TA 1E5UI 2E76C 4HS8L 3B9KA 4D0DB 2FH6A 2F9BT 2IEPA 3QNZA 1KPVB 2CXKA 2Z8SA 3MLWL 2Q7YB 4EF3A 4NRYA 5GGSB 5FB8B 5F9JA 4CY5A 4EKXA 5AZEH 3D2UD 4OJYA 4HK3J 5HJGA 1ZOXA 5K9KB 5LGJB 2XIBA 4DP8X 1RSFA 1UT2A 2WQWA 3C5XA 1JWUA 3QDJB 4FQCL 5FX3A 2EXWC 3WS6C 3F7QA 1MCPH 2UWEE 1DJSA 4G80B 1XTLA 4MVBC 1VGKA 4ZMZA 2IOOA 3QZMA 5E94B 5HDQL 1K4CB 4KQ3L 1H8NA 1KZYA 2VE6B 2X38A 4BM7A 1ZEAL 5FKAB 4DHLA 2H6PA 4HK0B 1A6WH 8PAZA 2IUPA 4JFXB 1KCKA 3FU7A 3WS6A 1OCCB 2XJLA 2HLFC 3KXFA 2I0SA 5A2Qg 4OCSH 3FN3A 3MO1B 3DPBA 4JN1H 1B9XA 1I9EA 3O9WD 3SJVB 4YC2C 4NP4H 1KZQA 4YHKH 3IUQA 1RIVL 2I5YL 3QC5X 2Q86B 4Z78A 3MRKB 2LLLA 3TYGH 4MD0A 3VD4A 3FT2B 4N0UB 1A7OL 5ERWB 3HZMB 1M05B 3B7YA 3C60A 3SY0A 5K1NA 3QJRB 4MB3A 3F58H 4NC1C 3IDXL 4WCYH 5F6IC 2VM4A 5I1AA 2Z65C 4J3SA 4QAMB 4P46C 3UTSA 5FFLA 1CFBA 1XGPA 1WBZA 4M6AA 4NO2A 4J2XA 3OXSB 4RWYH 3WL9A 4R26L 1N10A 4WAFA 5FC9A 3NFSH 4PSXB 2IADB 1QUNA 2X42A 1KBGL 4CY2A 1NAML 4J3OC 5E2VH 1PG7X 3OMAB 4KK8C 1UVQA 1JG9A 2A9NL 4YVDA 2DEXX 1L5GA 3QUZC 1T4WA 2OI9C 4XBPB 3TPUA 2YBAA 3MLVL 1AO7D 3OGCA 4C47A 3BEWA 3OVUB 5JDSA 3J27A 3TBWB 3JPXA 1SJXA 2FWSA 3WN5C 3PXLA 3BQUA 5E8EB 4Q6IC 2VMFA 5IBTH 3U2JA 1HHJA 4FI8A 3H53A 3ROLB 3P4OA 4MMYB 4U3XA 3UTTB 5IV2A 2VN5A 2Z7UA 4XNUH 4MYWB 2Z8VC 4RDQF 2QHRH 2F0CA 4GSXA 5JHDE 3UPAA 3SDCB 35C8H 3QISA 1IU1A 2GJ6A 3WUWB 3DYMA 1E0OB 3MU3A 4XP4L 5C08A 2JFCA 1FNHA 4KTGA 4BFNA 1A6PA 2UXVA 3GXTA 2ZT9C 5D8JH 3S4SG 4DGIH 2ZWZA 1WTLA 1OM3L 2WZ5A 3KYAA 3QORC 3ZE2A 4LEBA 2BP5M 3DI3B 5E0FA 4NUGL 1RURL 2XN9B 3SDAA 3HG5A 3ARED 5A2CA 3ZDXE 1K5NA 3GMQA 3SGEH 4AGMA 4Z7IA 1QSFE 5L4JA 4YBLB 4OLVH 5DD5L 1KYDA 1ID2A 1DTUA 4QJ4B 3WAKA 1WCBB 2VLMD 4BZ2L 4L3CA 4U1LB 3TNMB 3VDAA 2JK5B 4LG9A 1SHYB 5E9NA 3V0GA 5I5IA 4NPYA 3PSCB 5D1QC 1X5JA 3TC9A 1L4IA 5LGHH 1SVBA 2V17H 1JI1A 2Q8AL 4TM9A 4PS3A 3VQMA 3AGWA 2AEPH 2BNQA 1MAJA 2AI0L 3UG4A 1SDDA 1YO4A 4HBQA 2YRZA 3X12A 1QFUH 1UFGA 3IE4A 2PR4L 3CU1A 1ML0A 3BDBA 2R29L 1PI6A 1E4XH 2AQSA 3OSKA 3DMMB 3V0AC 3SMRA 4G7SB 4Y9BA 3E0GA 1LMKA 2X4OA 2FJGB 5EMYA 1HOEA 1ZLDA 4MAYA 5LAPA 2EO1A 5CJOL 5DU7A 3WNOA 4J3OH 4LPXA 3BEVA 2WLLB 3PJNA 1AAJA 4PWHA 4OZHF 5IFJA 3VCLB 2F74B 1AGBA 3GSWB 3TF4A 1R3KB 3FB6A 4LGRB 5I8CB 2GSGA 1PDKB 2J57G 3SE3C 1J1OL 2R2HA 4PJIE 1X5KA 4GG6A 5TE6L 3RWFA 3O3AA 3ORJA 1ACXA 1VFOA 3D34A 2YKKA 2CO3A 1EEZB 1UWXK 4D9RD 3BP7A 2W18A 3DXAB 5I8KL 3ARQA 4ZFOL 1FUNA 1MCRA 2ZSWB 3Q1EA 5BV7L 1BVNP 2VDMH 1ZT1B 2Y07L 2G9AA 4M1DL 4UQEA 1YSOA 1PEZA 4U0RB 3Q5TA 1JZGA 2XX0A 3CFDA 3N42B 2VJ8A 1K6QH 3MLXH 1NFIA 4O51B 4Z7OA 1DQTA 4PRHA 4NZUL 4KXZH 4UTAL 2Y5QA 2GC4C 1N3NB 2R23B 1JS4A 3MNVB 2WSKA 4MJ5A 4F58H 1G9HA 3SE6A 3FB7A 3BZEA 3SWSD 1ORSB 3NG5A 2BP0B 4BINA 4DP1X 3G5XA 2AQ3A 3ALWA 1AC6A 4NZFA 1IGML 2EYTA 2WV3A 3CLEL 4U1NA 5DZOA 5KSAC 1RUKL 1GAFH 1YN6B 2ZOTA 4HU2A 5I66A 4NZDA 1QFPA 3X13A 5IMOB 1H0DA 4U1IA 2GC4A 2HPOA 4UU9A 1T1YA 4LSRH 4X6DF 3MLUH 1UG9A 5SWZD 4AEHL 4C56A 5FF6A 3BG1A 3KHOA 5D7JB 3DTXA 3NFPA 1BF8A 5ITFB 2EIZA 2JNZA 3NH7L 1HNYA 1FFNB 4LRIC 5IOPA 1A6VL 1AZUA 3LH8A 1HH6B 4J3OF 3RAJL 2H7WA 4RESB 1NFKA 2ESVE 4UQCA 3C8KB 5FA3B 3I85A 3U7AA 5KSAA 2YIHA 3RDJA 4NO0A 2XA8L 4FA8A 1NKOA 5J56B 4P4RA 3OKTA 4X6BB 1NMBH 3EG6A 3CQQA 3QQXA 2OJ1A 4LSPH 3P69A 3IJHA 1KXHA 3ZE2F 4AEIH 1Q9KA 3OM3B 2DWYA 3KWWB 4XN1A 5MHSE 5L2KA 1MVFA 4Z8FH 2D31B 1CU4L 4AKOA 3EZJB 4KJYA 3EFFB 1GRWA 2YFNA 2C9XA 3EH5B 3IFLH 2EE9A 3O8XD 2WANA 3GSXB 5CIPA 3H7BA 5KBKA 4J39A 1SQ9A 3NCCB 3RJDA 5E6IC 3MODH 1ACYL 1YYMH 3MLYH 4HUWB 4PCTA 3GC3B 4ATTA 5SWSD 2DJSA 2HVJA 5IJKA 4WWID 4ETQB 1F58L 2F1BA 1CVSC 4NO3A 2UZYB 2ZUXA 3C6LD 1IBYA 3SDDD 3V8CA 5I19H 3US9A 2ZXCA 2E74C 5C0CD 1XF3B 5FDWB 4EI0A 3BJLA 4U3SB 2RFXB 4R7NA 1CF1A 2BSBA 5DGQA 3V52H 1FZOA 4MNHA 3OKKA 4I5BB 5BW7C 1YEDB 4I85A 1OSZB 5E6IA 3CSBA 3TVMB 1A22B 1MW2A 3QR0A 4P3WA 3BAKA 2GCYA 5EUOE 4BJLA 3FCUA 1DFXA 3QIBD 5GRWA 2BWDA 4MNQD 4S2SB 1MCPL 3CFKA 3FRUB 1N5YH 3HG1E 1LDPH 3HHMA 4DQAA 3CC5B 5C0JB 2MCPH 2ZXWB 4N0CD 5TH2A 1IEBA 1QD0A 4CW1A 4FADA 5BW7A 2ED7A 4HKZB 5CUSH 4L8SA 1X9UA 3IMVA 4KXBA 1RJZB 3QVAA 4BFEA 1ECYA 1NKRA 4MK0B 1A6WL 2NQ3A 2X40A 3K6IA 3MV9E 4LASH 4FQLH 4F7TA 2VSCA 2XZCH 3QEHA 4I9XA 4FQXC 4OCSL 3ZTEA 1A65A 1MCSA 2EQDA 2QQNL 4JN1L 1SPDA 1G43A 4NP4L 5HGAB 4YHKL 3U4AA 1PZUB 3GPEA 4DKDC 3OZ9L 4X80H 2CDFB 2VLJD 4OLYH 4HD9A 3LXUX 3TYGL 1EJ6A 3UO1H 4KITB 1W80A 2CXGA 3D85B 2W07A 3I3EA 4IYKA 5AD0A 1KEGL 3UTQB 2BX5A 5A3IC 5DSCA 2QVMA 4XMPH 2Y6SC 4RGOH 4EZJA 5DRXB 5E8NB 4RWYL 4NYLB 1KFAH 3CFCH 2OULB 4MB1A 1TO4A 1NMCB 1R3JB 5C0EA 4UTCA 1IVTA 4PTTB 4F2ME 2X4TA 1URLA 3QRGH 4HP5A 3UZQB 4QRQB 1T20A 1EXUB 5E2VL 2QVTA 4PJ9C 5F0LB 1N67A 2N4IA 4R5XA 3WIAA 1HL8A 3ULUE 5K19A 1UWEH 2TRCB 3HZVA 4JRXD 3BKMH 4YZFE 4FCHA 2HFGH 2DYSB 3B9KD 2QADB 1HWGB 1BXAA 3GK8H 3WY2A 1S9VA 1XVSA 1TZHB 5DMKA 1MQKH 3NSXA 4NSKA 3KWTA 5IBTL 1EMTH 3N91A 2VAAA 1BZQK 1QPPA 3OAYH 4XNUL 4TSAH 4LVOC 2P5EE 4GRLB 4JM4L 2QZPA 4NP9A 1ZLUH 3DKHA 4BSWB 1WH0A 35C8L 5KS9E 3MROA 4ISVB 4PYGA 5LO7A 2JCCA 4X5XB 4OV6F 1I7RA 3LEXA 1G7LA 4F7KA 1X4YA 2N3JA 1B6UA 4OFPA 5D8JL 4PYHA 4DGIL 3F04A 1EHAA 2LAAA 2P5WD 2D3VA 5CGYC 4L9LC 4GGCA 2C5DC 3G08A 3FU0A 4IHOB 5B3NA 2VN3A 4TVPE 4WSKA 5H37G 3GTTA 5L8JB 5E5UB 4R9HA 3KBEA 3BQVA 4DIXA 2PXYC 4YHYC 1K2DB 3KBFA 5EALA 5I1EH 1JV5B 4KRMB 3GLAA 3GHBH 1LMIA 4XXWA 4OLVL 3NIGE 2XN0A 1NLBH 3I02B 4XCFH 2PWEA 3L4WA 4WWOA 2YXMA 3W57A 5DJXA 2E0PA 2EDQA 4MVBD 4BA8A 1CLZH 3C5SB 4HGWB 4UYPA 4L9LA 2VXVL 3BP4B 5AKSA 5LGHL 4GB9A 2V17L 4JFPB 5HDOA 2APTA 3HE7A 4ZT1A 2AEPL 5C0AB 1KWGA 5I6XC 2Y2WA 1NCUA 4CJ1A 5FM8A 2JB6B 1FNEA 1DN2A 4K15A 1JE6A 2HJKB 5EO9A 3C9NA 4U1HB 1MNUH 2WXKA 4IIQB 1KJVB 3HVDA 3I6KA 3FU6A 3P4NA 4NQCE 4QEGA 2NOYA 1K8IA 1E4XL 4I18C 3W9EA 5JW4M 3RGVB 3GXNA 5DA4A 2B0SL 5CEYB 1A7PL 5E23A 4XVUC 4AEZA 5I1DB 1JGUH 3M8OH 4RDQG 1JBJA 2GI0A 4WEBH 2UZPA 3GJEA 1LE9A 4P46D 5DVMA 4BKTC 3IMWA 3TCXA 4I18A 3V6FA 2PPAA 3CZFA 4PJGA 4JDEB 3QP3A 4JZNA 4HEPA 3IMSA 4APQC 4HKJB 3I3BA 2AS5M 4IGBB 3ECWA 4KO6A 5DUJA 1XZ0B 3UMNA 3PABB 4AOWA 2GTWB 3ZDZE 2APSA 4J3OD 3O4IA 1SFHA 2IUVA 3AFLA 4KK8D 3WG7B 3IWVA 3SDXB 1ZT4A 4DGVH 2QZQA 4GAYA 5F9WC 4I0PC 5I6LA 3QUZD 4JE0A 2QGEA 5DJAA 4AYMC 1V3JA 1BQUA 1FWXA 2Z8RA 5LXGH 3BC9A 1OQXA 3MLRL 2C9RA 4NBXB 4FQ1H 1VLXA 4DTGH 1K6QL 3MLXL 1C08B 3HHSB 5TF1H 5A2BA 5K1VA 1AY1H 1E5AA 1FZKB 3L3DB 4OKDA 5IVXF 4ZZKA 2WHVA 1NWOA 2DH2A 4PCKA 3APFA 3TFKC 3BIBX 2WQXA 2CNZA 3MHZA 2BNUB 4PY7A 4EEEA 1KLGA 5D7SL 1O6SA 4F7PB 1JHTB 2I9LB 1GAFL 3CSTA 2EZ0C 1E3FA 4KFMB 3AAZA 3QORD 3MV8D 1R9FA 4PJEE 3CZSA 3WEMA 3ZZSA 1UKTA 3MLUL 3T3PB 2XUWA 4CSPA 3KLAA 2DMKA 3ETBJ 4QHMB 2VDPA 1QLEB 1QO3B 4XWGH 4PRPD 1QATA 3IJ7A 1KGJA 3KPOB 5IREA 2ADJB 2E47A 2RMNA 4F24A 1JXFA 1QPXA 4Z7UF 1B4LA 4XMXA 2J12B 1BQKA 5F7YC 5B39A 2FE0A 3UH8A 4A37A 1TXKA 1NMBL 1WFTA 5D1QD 5DI8A 2D3LA 4PY8I 3TA3B 1PKQE 4LLUB 3RIAF 3TBBA 3MRNA 1E8XA 1HHIB 3D4GA 4KH2A 2PCPA 4PB9H 5KW9H 4JO4H 4Z8FL 1FE8H 2PWHA 1XAUA 4Y16C 2XN2A 5E1QA 3E6FA 2RQEA 3RUGB 1OAUL 1QABA 2LQRA 5AVWB 5CYKB 4WW2C 5EU6B 4NIKB 4HISA 2ZAHA 4Q4EA 3QZLA 1IC7L 4A6YB 4DN4H 1MCNA 1ZVNA 1D5MB 2FX9H 3GM0A 5FM5O 3DLQR 1JZFA 3MODL 1YYML 3MLYL 1KELL 3O0LA 3QXDB 2ADGB 3MNWA 4P4KA 2VLRB 3GJFK 3AWFA 5I19L 3MLSH 1SBBA 2B15A 5L4MA 3RIFK 3WS3A 4HZLB 1QEWB 1PCXA 3Q8BA 5EORH 1D2PA 4FAVD 4BCZA 3FAWA 4WW2A 2LU3A 2OV0A 3V52L 2BFVH 4DPAX 3LNHA 4PRHD 1SLVA 2XG4B 5DK2B 3WTVA 3CLFH 2VDPH 1PBYA 4JANB 3JTTA 5I8OH 1T7YA 3FGBA 4I9WD 5CLXA 3I6LE 2FSEB 2K6WA 1LDPL 2NY6C 2BVQA 3CX2A 4QL1A 2H2PC 2MCPL 3K3QA 2Q8BH 1L3WA 5D1XB 1KBBA 1TETL 4PVMA 4UM8B 1CDIA 4HAGA 3ARSA 1J1XL 4FFWC 1NUNB 4J3OG 4TVSa 4G6FD 3QT2A 2QT6A 4APXB 1YAIA 1QBAA 3VDCA 2GVYA 4JLRB 5JPMA 2W60B 4LASL 4FQLL 5DHMC 1JPTL 1HWWA 4ZO8A 2FO1A 2E7LA 5D7LE 1DVFA 4U2ZA 3DK2A 3PGFL 3LXAA 3U1QA 1BFVH 3VACA 2WBXA 5ESQB 3E6HA 2EIJB 2HX7A 5DHVB 4PRAB 4YSQA 3NMEA