3K72A

Structure of integrin alphax beta2
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
1082
structure length
884
Chain Sequence
FNLDTEELTAFRVDSAGFGDSVVQYANSWVVVGAPQKITAANQTGGLYQCGYSTGACEPIGLQVPPEAVNMSLGLSLASTTSPSQLLACGPTVHHECGRNMYLTGLCFLLGPTQLTQRLPVSRQECPSSFELEMAQEGFSAVFTPDGPVLGAVGSFTWSGGAFLYPPNMSPTFINMSQENVDMRDSYLGYSTELALWKGVQSLVLGAPRYQHTGKAVIFTQVSRQWRMKAEVTGTQIGSYFGASLCSVDVDSDGSTDLVLIGAPHYYEQTRGGQVSVCPLPRGWRRWWCDAVLYGEQGHPWGRFGAALTVLGDVNGDKLTDVVIGAPGEEENRGAVYLFHGVLGPSISPSHSQRIAGSQLSSRLQYFGQALSGGQDLTQDGLVDLAVGARGQVLLLRTRPVLWVGVSMQFIPAEIPRSAFECREQVVSEQTLVQSNICLYIDKRSKNLLGSRDLQSSVTLDLALDPGRLSPRATFQETKNRSLSRVRVLGLKAHCENFNLLLPSCVEDSVTPITLRLNFTLVGKPLLAFRNLRPMLAADAQRYFTASLPFEKNCGADHICQDNLGISFSFPGLKSLLVGSNLELNAEVMVWNDGEDSYGTTITFSHPAGLSYRYVAEGQKQGQLRSLHLTCDSAPVGSQGTWSTSCRINHLIFRGGAQITFLATFDVSPKAVLGDRLLLTANVSSENNTPRTSKTTFQLELPVKYAVYTVVSSHEQFTKYLNFSESEEKESHVAMHRYQVNNLGQRDLPVSINFWVPVELNQEAVWMDVEVSHPQNPSLRCSSEKIAPPASDFLAHIQKNPVLDCSIAGCLRFRCDVPSFSVQEELDFTLKGNLSFGWVRQILQKKVSVVSVAEITFDTSVYSQLPGQEAFMRAQTTTVLEKYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Integrin alpha-X
publication title Structure of an integrin with an alphaI domain, complement receptor type 4.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 120
structure length 884
sequence length 1082
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
A PF01839 FG-GAP FG-GAP repeat
A PF08441 Integrin_alpha2 Integrin alpha
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1460 Mainly Beta Sandwich Immunoglobulin-like Integrin domains. Chain A, domain 2 3k72A02
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 3k72A03
2.60.40.1530 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 4 3k72A04
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 3k72A01
2VDLB 2VDOB 3T3PA 3ZDYB 4IRZA 4Z7OA 3NIDA 4G1EA 4Z7NA 3NIGA 3FCSA 3ZE0B 4MMXA 3K71A 4WJKA 4WK2B 3VI3A 4O02A 2VDRA 3IJEA 4UM8A 4Z7QB 3ZDXA 1TYEB 5ES4B 4MMZB 5HDBA 3ZE1A 4WK4B 4UM9A 3K72B 2VDPB 3VI4A 3V4PA 2VDQB 1M1XA 3T3PB 4WK0A 4Z7OB 3NIDB 2VDKA 4G1EB 5E6SA 4MMYA 4Z7NB 3NIGB 2VC2A 3ZE2A 3FCSB 5E6UA 4MMXB 4UM9D 4NENA 3K71B 3V4VA 1U8CA 1JV2A 1L5GA 4WJKB 3VI3B 4O02B 3NIFA 5E6RA 2VDRB 2VDMA 5FFOA 3T3MA 3IJEB 4UM8B 3ZDXB 2VDNA 5HDBB 3FCUA 4G1MA 3ZE1B 3ZDZA 3K6SA 4UM9B 3VI4B 2VDLA 4JX0A 3V4PB 2VDOA 3ZDYA 1M1XB 4WK0B 5FFGA 2VDKB 5E6SB 4MMYB 3ZE0A 2VC2B 3ZE2B 2P26A 4NEHB 5E6UB 4NENB 3V4VB 4WK2A 1U8CB 1JV2B 1L5GB 3NIFB 5E6RB 4Z7QA 1TYEA 2VDMB 3T3MB 4MMZA 2VDNB 3FCUB 4WK4A 4G1MB 3K72A 2VDPA 3ZDZB 3K6SB 2VDQA
chains in the Genus database with same CATH superfamily
4BKLA 4UUJA 2G3ZA 5K1CC 5H2BB 3SKUD 2XA3A 3X11A 3SVWD 2E9GA 4AY0A 3EH2A 2HB0A 4G43A 3L3JB 3P2TA 4AGMA 4R0LC 4R96B 2UXVA 2ZXGA 4KVNH 1VCAA 3PWPB 4NHUA 3RFHA 2QR0A 4DKFL 2IDUA 3FO0L 3SGEI 3GFCA 3KPQB 3IFPA 3AZUA 1JZ8A 5I8EB 3FT9A 3CK0L 1MAJA 1WFJA 4G6KL 3WJJC 1KEGL 4CADB 3HLAB 1NEUA 2KQNA 3HC2A 4UWQB 1L0PA 3VXTB 1M57B 3HLKA 5D7EA 3KLAB 1REIA 3G5YA 2Q20A 3ZE1A 4Z1PA 5TK4A 4XMZA 3QUYB 2X7LB 1F6LL 1NGPH 2EUZA 1UWEL 2CE9A 3MRRA 4JFTA 3RIFF 5LBGA 1B0WA 1Z2KA 4DPRA 1M42A 2QV4A 4N8UA 3ME0A 4P99A 4PJ7B 4MMYA 4X9YA 3BIKA 3DBXB 4NQSA 1KEML 4M1DL 1HOEA 5LDSA 1CURA 1M56B 3B9VA 3OL2A 2GT9B 3SCMB 4E9LA 3VWJA 5IGOA 4NNPL 1CL7L 4ZFOB 1R24A 1MW0A 3S3DB 3CDFA 2IANB 3JV6A 5D1ZD 2C7UA 3QFJA 3Q01A 4TQPA 4G7YH 1X7QB 3HW7A 3FFOA 1V10A 3MLUH 3DJZA 1V3LA 1DVUA 5C0BE 4QRPB 3IFNL 4NNYB 1RUQL 5T1DH 3ZTJG 3EJPA 2JIXD 5DZ9A 5T3XE 1V3KA 2Q86A 4JJOA 4EUPH 5C6TL 1A3LH 4PJ6A 4GY4A 2JLLA 4Z3EA 2IANE 5KDOB 3HPLA 5FV1L 3RX5A 2CRMA 1PKQE 2NXYB 1D7BA 1F2XK 1U8HB 4PYHA 1M2VA 5FYLH 4QRPE 4Z3FA 1FZJA 5GJTH 3EI1A 5IFAH 3T4AA 4PRNA 4PR5A 5HQGA 5KBKA 2JVUA 3CHQA 4KZ0A 1URLA 5EUOB 3NSDA 5CGYD 5LQBL 3AAZA 1KWKA 1BD2D 3MBEA 5C2WB 3D05A 1WZ1H 5IROC 3GB7A 3T2PA 3C5XA 4R90H 1NIAA 2GY7B 3MRIB 1DBMH 4I9WD 4LZKA 1IBGH 4AQEA 1KTJA 4NSXA 3H2QA 4OZFB 1A9EB 3BPCA 1UVQB 5DURD 3SKOB 1DVTA 2GSIA 2YAPA 3C5JA 1N3NB 4JANB 4XCFL 3C2AL 4L4TE 2LU4A 4K8RH 4P23A 3BUDA 5B8CB 3F7KA 3KMDA 3CPLA 3FRXA 2HVKB 5TEEA 2G9KA 3CWGA 4KI5D 5FLXg 3K5SA 3GTVA 1G7MB 3ARGD 5T1MA 2WXMA 3VSVA 3G08A 3PAYA 1VA9A 2W95A 3WNOA 1P4LA 3QQDA 2VDPL 5EDSA 1SM3L 3RWFB 3TIDB 2CZNA 2HRLA 4JPKH 4UNVA 4AYMC 3TTSA 5F9OH 4D9RD 3WKPA 4PRBB 4XMLL 3VQMA 1FDLH 3KLLA 2A7BA 3ROOA 3IGLA 3B43A 1GXRA 3HFML 1KCSL 3HZKA 3QO0A 3U48A 4XNYL 2HG0A 1SYSB 3VGAC 3C60D 5IB4B 4M48L 2CU9A 3A0OA 2CLRA 2OZ4H 1DFXA 1J0KA 5E5LA 2E9BA 2NUPA 4K8RD 2GHZA 4FN0A 2YRZA 2X2IA 4FTVA 5HD8D 2XQBL 4G1EB 4AGPA 1S7TB 2P24A 2VRKA 4E68A 4DP5X 3Q8CA 5JQ6L 3QISA 4P0DA 3ZDXF 3BEVB 1IGFL 4N0CD 2ZWSA 1TVBB 1JZ5A 1MFEL 4JG5A 2B5NA 3BT2H 2VSMB 5KVDE 2VDRB 1CFBA 4CDHA 2IDSA 1WH0A 2HRPL 5AFU3 3OKMA 5F96H 4BIKA 5AOKA 2WLIB 4M4RB 2VZSA 4RH4A 4ZK8A 3O3UN 5CD3A 4U6YB 2V33A 2BNRD 3HN5A 4F15B 2KMWA 1CU4H 4JRXD 2YD7A 5EORH 2J56A 3L6FA 3MRDA 5EWIH 4KZEH 2XICA 2IEPA 2Z93A 1D9KD 1OB1A 4ONFH 3VMNA 3EYSH 5B1JC 4BRVA 3VD4A 1BF8A 1IAOB 4JR9H 2CUIA 4XHQA 5AENA 4L4VD 4JKPH 2YKLL 4Q0XH 1MPAH 1OE2A 3BLKA 1FZMA 4MKTA 3BC9A 4WQOA 3V4VB 4JY4A 1LHZA 3E2HB 3QI9D 4MASA 2VXSL 1QSEA 1OP3K 3BHBA 1RP8A 2ADJB 1NFDE 2BCKB 1CGVA 2CR6A 4EO5A 5A16B 3GSNA 4WJ5B 3HHSA 1YY9D 1GGTA 3SO5A 3IMTA 3IK2A 4G80A 3SE8H 1JTDB 2KS0A 3IXTB 1OW0C 2A5UA 5KTEH 2CBQA 4NO3A 3EOBA 4HFWA 2PR4L 1JV5B 3RY5A 3AT0A 3ARBA 5FLUA 3IDMA 2NW3A 5EM2A 5CJ5A 5HYQB 4JN1L 1IQWL 1LLAA 4YXHH 4UIKH 2NY2B 5IQMA 5L2KE 4CA4A 4HOZA 1XCQB 1ZWIA 3DJRA 3QT2A 4O02L 2FBOJ 1XF1A 5DFVD 2N7SA 5DSCA 2VLRA 3SY6A 5D1XA 2IG2H 2OJZL 5E7BA 3SYOA 4APQB 5EZIL 4OV5A 4J8BA 1X5ZA 3NRFA 2XRAH 3UBFA 1S3RA 2BHFA 4L48A 3L2MA 3ZRSA 2AVGA 4LE8A 3FTVA 4N2AA 1J11A 1P0SE 1RI6A 4WV1A 3ASOB 2XFXA 4MD0B 4RX4D 2C8NA 3MUHL 1T83C 4Y9CA 4U1LB 4Y8AA 2NY4B 5BZDB 2ZCKL 3LZRA 4GS7B 2MIZA 4WNQB 2Z4QA 1RHHA 2JKXA 3WTSA 1BZ7B 4LOVA 4UT7L 5SWZD 3IJCA 2VM3A 2E3VA 4YX2L 2Y07L 3S4SG 1PY0A 1GCYA 1MJ8L 3HI1A 3QEGL 4PJ9C 4CUCA 3GJFK 4QT8A 2CLVB 2YA2A 4EIUA 1AAJA 2EXWD 2EDKA 5E99L 5B1KA 4DFHA 3BN9D 2BZCA 3RPIB 5TFSL 2AJXL 4XOCA 2FB4L 4JFOA 2WLLB 1A0QL 3IKKA 3R8QA 4RFOH 4DN4H 1UOWA 1R5IA 3ULSB 5D7IB 4KK5C 4E41E 1CGXA 2OYMA 1ZA6B 1T22A 2AW2A 4PJHF 2ZWYA 1E2VA 4GO6B 1PLCA 1MIEH 1HEZA 3LRSA 3NFPB 5BS0D 2Z65C 1FL6B 2AH1A 4N8CL 4GW4A 3U4BH 4PYGA 3HG1A 3S4SA 3R1GL 3CMOH 1TENA 2WK2A 3AREC 1AY1L 4W6WB 5D7IE 1CXFA 3JBG7 1BLNA 3V5DA 3BVVA 5INCA 1D5IL 3OKLA 1PTZA 1A1MB 3LS4L 4YHPA 1CB4A 3CFKB 4XNAA 2AJZA 4DO4A 4ZW5A 4RZKA 1AZNA 2EDFA 4X98A 1YVLA 1BEYH 1GXEA 4XAKE 2X4NB 3DSMA 4Y4HD 1G9ML 1CLOL 2VCOA 3D07A 4TNVK 3UC2A 2HKMA 2H9GA 5DMIL 1Q0YH 1TZHA 2J4WL 3DTDA 1FL5A 1HILB 1TQVA 2A9AA 1SQ2N 4HHGA 5EU6B 1UM6L 4FXLA 4HS3A 5AD0B 3I74A 4Y7RA 2FH8A 2NZIA 1XCTA 4XPHL 4G5ZL 4OZIE 4M62L 3VFOB 1Q38A 2C7FA 3RN0D 4EKJA 3BFQG 3GLDA 4NI3A 5C2UB 2FBJL 2OTPA 5K9OB 2ADFH 5DA4A 3EADA 1NGZA 3O0RH 4LHUD 3TNMB 4AMKH 1BXXA 4L8SC 4A2DA 3DTUB 4TL5A 1PFOA 2IQ9L 5K33A 3X3GL 1ZLEA 4HWBA 1SEQL 4EDXA 1Y07A 4LQFH 1JRHH 1IQDA 5DHVA 3TT1H 5IVXB 3MFGB 5EUKA 1Q4NX 1OXYA 3TJEH 4L3EA 4JFQA 4XNXL 1S9YB 4I0KA 2IGFL 2IQAB 4N0RA 4XPBL 3KYKH 4UZGA 1VJSA 3UO1H 5BUGA 4NM8L 5L8LB 1MF2L 1B6UA 2J20A 2ARJB 3GXPA 2ZKYA 1SN0A 2PYED 1YAIA 4G7QB 1EHLL 4KKLD 1OL0A 3IVKB 1V8HA 4IRSB 5H35B 1H8SA 2KYIA 2I07B 3S0PA 3U0WL 1WFIA 3U4EB 3IURA 5F6IC 3OAUL 2OJ1A 4X8JB 3FN3A 5C0JA 15C8L 1XXFC 5FO9B 4BFRA 4IGBB 1IBYA 4PP1D 4TNVF 3ERXA 2W07A 1S6NA 1AACA 3Q9QA 5GSVA 5EZPA 3DX3A 2W9DH 4ZOCA 2I85A 4PWEA 3OAZK 1HH6B 2BXYA 1XGRB 2QKIA 2R2CA 3GGWA 3MR9B 5HVHC 3ZVVA 2CD0A 5TDHB 2VR4A 1CDCA 5FHAH 1Q94B 4WUUE 3ZN6A 4UM8B 3L2NA 2CIIB 1CXKA 1JHTB 1SMDA 3QC5X 5IQ7H 5FO2A 2DLFL 4QTIH 5KYWA 4QI3A 2H2PD 1WFNA 3T9WA 3QNZB 3RWCB 2PTTB 3HRZB 4UBDD 1NGQL 1EH9A 3MLRH 3MCLL 3VXSA 2H68A 2BXZA 5C0CE 1C9LA 2C9QA 4WRLA 1M7IA 3PG2A 3WNLA 2VWEC 2BSTA 1HXMA 3QZMA 4KRMB 4X7CC 4J78A 5I17B 1DQDH 5BXFA 5J6GB 4AYID 3MJ8A 5E2VH 2ADGA 3RNKA 3D4ZA 3QXDA 3EGXA 1KY7A 3HMXH 3L4YA 4AYDC 3C75H 2R4RH 3AXLA 3JT0A 5D1QC 4YR6A 4LSRH 1TLKA 5IIEA 1GZQA 4P4KC 3F65A 1OD7A 1WWCA 3V6OA 1U91A 3K1KC 3S3BB 1QABA 4MCZA 3BKJL 4M1DH 4TSAL 3E7JA 1YEKL 1NEZG 4LCVA 1SOXA 1I75A 1IB5A 1IBDA 4FQ1H 1X9RA 1ADQA 2VIRB 2C3HA 1T5KA 5DUPL 4ZAKD 1RUPL 4RWYH 1H2ZA 3OF7A 1JVOA 3MODH 1A9VA 4KI1A 3DI2B 3P02A 3E8UH 3IMWA 4GIPD 1YEDA 1P2CA 4M7LL 5KS9A 3OF6A 4J81A 1NANH 3H7LA 1XV8A 4FEIA 4N0YL 4ODHH 5TE7H 3N85L 1FJ1A 1U42A 4A66A 5H37H 4JG0L 5DEZA 1RSFA 1IKFH 3GINA 1DVSA 4LARL 4JGJA 1CFTB 1CZ8H 1O6SA 2ZWZA 1AS7A 1NEZA 3OBAA 5JW4N 3NSJA 4WGVB 4UB0H 1OGTB 1N4XL 5GRYA 3Q8AA 2HG5B 4L29B 5HI4D 1ZEAH 2I0TA 3CBKB 1TMCB 4RISL 1CICA 1AGFA 3GO1L 2VAAB 4HJJL 5IK3B 5FCUL 4BK8A 5AKTA 1GMEA 2DM2A 3AQYA 2HMID 3HS0C 5JW3H 2VN6A 1WD9A 5D4JA 1M05B 2B1AH 3NTCH 2QPEB 1XCXA 2BP3A 2BCJB 1ZSDB 3I7NA 2WOYA 4LNVA 5DYOB 1DLHB 5GGVH 1KN2H 1QQDB 1JXKA 4X9HA 1X7TA 4DPCX 4EZJA 1I8UA 2W59A 4L37B 4X4XB 3TO4B 3V0IA 4N1HB 2GUOA 2NY3C 5CXBA 4N0UE 4NKDB 5E4AA 1ZS8A 3I9GL 4J8QA 3EO0B 5E94B 3LPPA 3ZRFC 3U4KA 3UAJA 1FVCA 3BEWA 1JV2A 5FOJA 3GXFA 2YNOA 4AEHL 4Z76A 5H8DA 4I0PA 4BV1A 3TH2T 1F45A 1QKZL 2ICWA 3VSQA 1Q9LA 5HDBB 1WBXB 4GT7A 1VPOL 4JFFD 3PGFH 4W9EC 3MRPA 1CF1A 1P4BH 4HK0A 3OMIB 4ZUVA 3WJMB 3C6SB 5EA0H 1H8LA 1LWJA 2YO3A 3E6HA 4NM4H 3HE6B 2W38A 4BFNA 2P8LA 2W0LA 4Z7UB 2NX5B 1H3VA 5GS3A 3CN4A 2A73A 3F7RA 4PWKA 1TQCB 3OKYB 1S7VB 4JPVL 2G2RA 3QIWA 4X5XB 1A7QH 2PM9B 1NDGA 4ONOA 1A66A 5I2IB 4HQQH 5IQ9A 4B3EA 4ZBJA 5A7BA 1AQDA 1USQA 2H6OA 3B7TA 2J5WA 1VEPA 2CJUL 1E2WA 2NX5E 4XHJD 2OXHB 4C56E 1YNTF 5D2LF 4V2BA 3T3MB 4K5NA 2YPVL 4F7EB 4W81A 1K4CB 4FTDA 4RVBA 5CLWA 4BFIB 5BO1H 1YEHH 2ZYSA 3FQRA 3PWPD 1FFPB 3SOBL 1S9WA 4M7ZC 3GHEH 4S2SA 2FBRA 1KIQA 1EXGA 2DWXA 5CD5D 2O5YH 2NYZA 3T3ME 2OYKA 1S7RB 5A2JH 4WF7A 5T3XH 4HC1L 1XEDA 3PHQB 1AZBA 4BQBA 1XIPA 4HS8L 2VGLM 5M61A 2ZAIA 2BSRB 4S10A 4LSDA 2XYBA 1QNZH 1U8QB 1SY6H 3MYJB 4UU9B 5IBUG 5TE6L 3SD5A 2QQNH 4P5SA 5HHVH 4CGTA 4LGRB 3QUYD 5TDOB 3FUHA 2FJSA 3OB0K 4CY3A 2RR3A 1SUHA 2NRDA 5GZOC 2H0FA 2OMYB 1ECYA 2BS8A 2QMJA 2XTLA 3DX7A 5DQJA 3DARA 3OZ9H 5SWQB 4NC2B 2PWHA 2LOEA 1N7MH 2D31B 1S8DA 1VFBB 2IAAA 3MNVB 3PPSA 2ZXBA 1PKOA 2VLKE 4FA8A 4XVTL 1MG2C 2NY7H 3VH8A 4ZSOA 2EDEA 4HPYH 4POZD 3SCMD 1A4AA 4MRBA 3I3BA 4ZUTB 5JOPD 2G99A 1J5OL 2FZ3A 4S1RL 2HFEB 5T3XD 2UWEA 3QO1B 2VDKA 4M6AA 2XQ0A 5JOEA 4Y1AE 4K3JH 3H9SB 4ODXB 5DJCB 4H0LC 4IBYA 3DJ9A 5JW4R 4WUKH 4P2QB 3WIHH 2CDGB 1H2XA 2IMNA 3DDGA 3HE7A 4Y88A 3LKQA 4OZFH 4J7RA 5CO1A 3GPSA 3QZLA 2F8OA 1GYCA 2V7HA 2X88A 4LLDA 4RIRA 1AHWB 4U1KA 5HHQB 1DJSA 2AABL 4XOEA 3KPRB 5EZIH 1RIHH 3G6AB 4K94L 3FTUA 3MUNA 3NBNA 1MLCA 1T7YA 3PP3K 3FFDB 3DX9A 4YAQB 4Y7OC 2QTVA 3OHXC 2NXYD 4U05A 1AI1H 1YYLH 2WIMA 2LFGA 2JNZA 2EIZA 3VXOA 5GS0L 4Y1SA 2VDLA 4NWUL 5GJSH 4PD4K 1OCWH 2D7OA 1L3WA 4RESB 4NC0B 5E8NB 4C54A 3BVNA 3NCMA 4TQ8A 1WTLA 1MOEA 3MLWL 2PW2A 1UTDA 1ET7A 3VWKB 3V9FA 5H1MA 3KJ6L 1SDAB 2JV6A 2DICA 3ALPA 3NDYE 3QEGH 3UZVB 2FJFA 5IF0B 2Y7NA 1RKRA 4OCXH 4DP1X 1ED3A 1G7JB 3K2KA 1KULA 2AJXH 1KBWA 1YPZA 2FB4H 5GRVL 4YPGB 1NGYA 1A0QH 4NQQA 3ZY7A 4H1LB 3FT4B 5KVDH 2HH0L 3OGOE 3ISWA 3CU7A 3P2BA 1VFMA 3KDMB 3UAJD 1BZ8A 1N6EA 1SEBB 1OK0A 3NGBB 4BUHA 2ZUUA 3TT3L 1F00I 1E8MA 3SE4C 4QNPE 2IPUK 4NQXA 2PR9A 1D5XB 1GS7A 3JSSA 4N8CH 3ZKXC 2VDRH 3KYMA 4NPJA 1E4KC 3W39A 4P59H 1AIZA 5EC2A 3FCSA 1N6VA 1P7KA 3VFUB 3F00A 3JZYA 5M5SA 3US0A 5J3HC 4R7NB 2HKHL 2XKNA 3B7RL 3G5ZB 4V11A 4DP4X 4LHJB 1LO0L 3B5HA 1DBAH 4FQLH 2F1EA 2J6WA 1M3JA 2F53B 1SJXA 2GFBA 4Y89A 3IU3B 5I24A 5LAXA 2FIKB 1G6VK 1E65A 2IV8A 1I1FB 3T0EB 4NJ9H 4B6ZA 3MBWB 5DJYA 2ENYA 1OSZA 4LSQH 5EO9B 5GZNC 2YEZA 3V4VH 4NQDB 2P5EB 2VJ8A 1JGEA 3T4YA 4HJTA 2F53E 5M95B 4ODWA 1NMCC 1GW6A 3DX0A 1BV8A 5ENWB 4KKCC 1BYOA 4ODBD 2IPKB 1UYWH 1OPGH 1J88A 2OMXA 3JVGC 4EI5A 4KRNA 4YHLL 5DJ2A 4ZMLA 5L6YH 3NZUA 3OLGA 5FM8A 2OI9B 4G56B 1YYMH 2X5PA 2P5EE 2ICCA 2V9TA 4NQDE 4YDIH 1VYHC 1U30A 1U8KB 3BAKA 5KANI 2B1HL 3K5RA 1NKRA 3P9LB 3O3DB 1XL4A 4XYHA 5ECJE 3D5OF 2BVEA 3PABB 5DYFA 1BQLH 2E47A 3GHPA 4I4WA 1J8HE 3VI4F 2CNXA 2GEEA 4JO4H 4QR7A 3NAAH 4AMXA 5LJYH 1MFCH 3RVVC 1YNKH 1FN4A 1MEXH 2BOBA 2WKOA 5CGMA 4G9FA 3Q2WA 3TBYA 2WQUA 4OGXL 1JIBA 4G11A 3ZE2F 1M53A 5FA5B 4D8PB 1CFQA 1UKQA 4WU7A 1I4FB 3DRQA 3QXWA 1ZLVH 3HS9A 3ULVF 2ITDB 3CQFA 1GS8A 3Q1SL 1AC6A 2MTAH 3FH5A 3UBXG 4AYGA 1Q1JH 1BOGA 3QRLA 2EEBA 2WXJA 2J1KA 1P1ZB 2X9YA 3P9WB 4P5TB 3S3JA 4H44C 5BRPA 4PRHA 3UACA 2G75B 2QSQA 4B9PA 4ZW3A 4L8BB 1N59B 1U8IB 4U3CA 3VYOA 4GIOA 5J06A 3GPEA 2FTAA 4LL1A 5IZ7A 3KGRA 4X60B 4FNLL 4ZMTA 1NMAL 3IDIB 5DO2D 4TM9A 2VOTA 4XP9L 3T2NH 3IMUA 1NCDH 2WUCL 3GS7A 2WBJA 1OV8A 4RAVA 4C55A 3IAQA 5GSRA 3IGUA 1K2DA 1RZQA 1CFSA 2M83A 2XZAL 3QS2A 3K3QA 4GKNB 4UTCA 3IETA 3TV8A 3EFDL 5M5VA 1T89A 3D09A 4APQD 4F58H 1TYRA 4ZDHB 2CGZA 1KB5B 4B27A 4D3CL 2ENQA 2BY3A 2Q3ZA 3QEUA 3UBXA 4S11A 4MJIB 5C0AB 4WNSA 4Y5YC 4DGIH 1ORQB 2XV2A 1XSOA 2ZX6A 1Z3GL 4KK8C 3DETD 3ZU8A 1AFVL 2V2WA 1Q0EA 3ABZA 1GC1L 1GVIA 2X4RB 2XWBA 3REWA 4BD4A 2NY4D 1IZJA 2GK0A 1RK0B 3Q1EA 5CZVH 5CIPB 1N64L 3RGVB 1DDTA 1KCVH 3MCKA 3V52H 4J4PA 5JXAL 4XPFL 1DSFL 3EO9H 3TVMC 4GBXA 4L9LA 3R8BB 5FM5M 2A83B 5A6LA 3L1EA 4YSPA 3ZYZA 5FLVA 3B6SA 2G3XA 4OD1H 5FR3A 2APWA 3QQXA 4GFTB 4WKXA 3WD5H 1W16A 1QHQA 2EYTB 4J3OG 3ZTNH 2OLDA 4F9PC 1YJDH 3DOIA 2AMGA 4JLRB 1H8OA 4U3SA 1EZLA 1OAUL 3F58L 3HN8A 1KENH 2ZOLA 1PVHA 3P77A 4JFEB 3GTTA 5GQBA 3GSUB 4Y19A 4OD2A 2OMWA 1AJ7L 1JGVH 1GIGL 2KLSA 3UCQA 4XNUL 4B9FA 1PJ9A 5KVEE 2GY5A 1E4XI 1NC2B 2P8MB 1CIUA 4LCCA 3UFIA 4ODUB 3GIVA 1WSST 1COBA 2A9BA 2V2TA 1IGTB 1T20A 2PETA 4JRYA 4F7TB 2H13A 4PRPE 3RA7L 5JWZA 1A4KA 4JFEE 5TQ0H 4JHBA 4ZQTA 1KIRA 3JXAA 3QXAA 4JY5H 1B88A 1XF5B 3STBA 4NYLA 5EZLB 3FUJA 3FTYA 3GMLA 3WXVH 2BH0A 3BZFA 5JOFA 5BVPH 3EI2B 3IFLL 4GAJH 4YHYC 2A4ZA 4HUXB 3DIFA 1PBYB 5BRZE 3A3YB 4U6XB 3W37A 3G5WA 3MGAA 1HYSC 3TBBA 3KVPA 4WFEE 5EU6D 4IKIA 2YFOA 5ETUA 1FZOA 1WDAA 4AQOA 1R75A 2HLAA 3BDYH 3LIZA 1LEGA 2C1PA 3ES6A 4MAYA 3GXUB 2D9QB 4LP4A 2AJ3B 1BAFL 4WK2A 5HYIA 1UG9A 1CLZL 4U1EI 3QA3B 2HN7A 4NUGH 1CFVL 4GUPB 4KK6C 5I71C 4PRAA 2X4QB 3SKJH 3X1NA 4ZXBA 1M71A 5I1KL 4OI8A 5IW3A 5BJTA 3EI3B 3VGEA 4ICXA 4ELKA 3MV9B 3RHWK 4P5MA 4K7PL 4OIBA 4JHAL 1D6VH 1KLFA 1DHKA 4RMWA 1R33A 1O7DC 2WANA 3NIGA 1GH7A 1QVOA 1ZVSA 3VXNA 1SBSH 3BW9A 4ZMPA 2F19L 3CFVA 2XT1B 5AW7B 1H3PL 4IRSD 2GITB 1YECL 3KR3H 2QADB 3RWGA 1MAML 3BH9A 3KNBA 3MV9E 5DTFA 1WHOA 2R1XA 3BWAB 3QUML 4UQ3A 4XP4L 4O58L 4QDGA 1KXQE 1MCBA 5DQDL 2PXYA 3LEVL 3ZMNA 3VI3A 3BRDA 4Q9QL 1OHQA 2P8PB 2J57G 1I7ZB 2OVRB 4IGBD 3RFZB 3K4ZA 5CR8A 4MLIA 4OLYH 4X7EC 5ITBH 4HEME 4X5WA 1J48A 1LDSA 3KPSA 4UIMA 3K46A 2VXUL 2BDNH 3SKNB 3GSOA 4HGWA 2OMTB 2R4SL 2Q6WB 3TN0B 3A0FA 4L5FL 3ORVD 4IKLA 4WI9A 5D2NA 1K6QL 1MIMH 3CGTA 5GGQH 2WP3T 5IHLB 3ESPA 1T4KB 2B08A 5E9DB 4Z7NB 4GLRI 4ZS7H 1WT5A 2VQ4A 3ZDXE 5FCSH 4L8CA 3KYOB 5HHMB 4FFTA 1ZLUH 4P2RA 2X3AA 1C08A 1JN6B 2J57A 1GZPA 1AKJA 2XZZA 4MNQB 3ZL4H 5EF3A 3MTXA 3RY6C 1WFTA 1PIFA 5FXCH 5D1ZC 3RHWF 3F05A 5IR1B 2VE6A 5CN1A 4ZO7A 2XBZA 1WZKA 1I7TB 4XC3H 1YMMB 4IMLA 4X4ZA 2VDOL 4MJ4A 3TPUB 5DZJA 1TTAA 4MNQE 4PJCB 3NFSH 2WC7A 4LLWB 4CY2A 5I74B 5I8CB 1ZGLP 2CNYA 3KYNB 5GGTA 3DO7A 2X87A 3EU7A 2QT6A 3MRFA 3CLEL 4ADIA 2FSEA 4DFIA 1PYWB 4UT9A 1EZVY 2FATL 3N3EA 4X6FB 1F90H 3H9SA 2LTQC 4G7VL 5CGYC 4YOKA 3V0VA 3JZGA 4GM3A 3R19A 5L2JB 3TWCL 3QNYB 1MXDA 5FKPA 3PJNA 4H13C 4UT6L 4G6AD 4X4ME 2AABH 3L3KB 3FQ1A 1S7QA 1PLGL 2EBSA 3AFLA 4NQCE 3TEXA 3MREA 5IUSA 2HX7A 5I1HH 2EH8H 5HHXL 3QEQA 1OP4A 4H1LG 1B0RA 1KTKE 3MJ9A 4QGYA 1U58B 3O3BB 3NPSB 4NPYB 4X9BA 1TBGA 1U4EA 3K91A 1OAYH 4KI5C 3WFZA 3ARDB 3RWEB 2EC9T 1I9RH 3ARGC 3K8MA 3UAAA 3IM1A 3QULB 1A64A 2DL2A 4GNKB 2RCSH 2YBAA 4KQ3L 3ZR5A 3LH2L 4PJDB 2CKBA 2PCFA 2XWRA 1DVZA 3GMOA 4LPUA 3S5ZA 5L0QC 3U7YH 3UDWA 3SJVB 3QYNA 1DZ0A 4L18A 1IRAY 3HJEA 3DV6B 4HEPA 3D85A 3VJ6A 4YDZA 4LVHB 3TO4D 5IJ8E 2WSKA 1P5UC 2DQTH 2XTJB 3X12A 4PJDE 4ETYA 3C60C 4LRIC 5KVGE 2X53A 3SJVE 4K8RC 1KJ3L 5HD8C 4U1JB 1SEBA 1X5FA 1IFHL 2W9EH 4U1GC 4X61B 3DVNB 2FR4A 3PAUA 3OZLA 2CK2A 3WN5B 2XTJE 4N0CC 1F3DH 5E08L 3NEXA 1AGEB 3BZ4B 1AXTL 3IBEA 5A2AA 2H9NA 4FGMA 4ZUUB 2VW4A 3CZJA 3FT0A 4JN2B 1HSBA 4OLWH 5EG6C 3QQNA 4OZHF 5DGQA 3HE6D 3OKNB 2Y7QA 4N85A 4LF3A 2NX5D 2FX9L 2R8SL 1XIWA 1JNLL 2HPOA 3D0LB 3PQYA 1I8KA 4G6FB 4ZFZA 4UDUB 1OP9A 2V2XB 3PF2A 3PGCB 3MLSH 4GI8A 3EFFA 5FA3A 2XU7A 3LKSA 2Q76B 3BAJA 5CSZB 2XWCA 5CP3H 4D8OA 3N1GC 4FFYL 3BPNB 2OTWB 1OGSA 4M1GH 5JA9A 2HA1A 3P2DA 3RWIA 2E59A 1ZV2A 3P9MA 5GGVY 4KMTL 2QFPA 3WAKA 3I6GB 2H14A 2H45A 4WTWA 2NNFA 3UTSA 4QMEA 1H2YA 1DCLA 2JELL 3QI9C 4OJDH 5I8KL 4Y7MA 3H3PH 2XXMB 3GBDA 1MFBH 3SGDI 5DC4B 4CL7A 5GSAA 1YY9C 3EYUL 2VITA 1JMZB 4Z7QA 1HL5A 4N26A 3DX2A 4PTUA 5C9KA 1UZ8A 2WLNA 3QC6X 2R56H 1GRWA 1DVFA 2ZUQB 2WVTA 1MW2A 5J12B 3VXQB 2B0SL 4MDJB 4P2OB 3INUH 4DNWA 1K72A 2CA4A 4ADGA 4NCC1 4Z0XB 3P11L 3MA7B 5E2TL 1PPIA 4X4YA 4YZFF 4PJBA 1HC1A 3KPLA 5EALA 3P4OA 3VFGH 3EW3B 1H15A 1EV2E 2JF1A 2J6EL 4FXGA 3QDMA 2DDQH 4Z7OA 3WE6B 2WWKT 3ZKSD 1T7VA 1NCTA 2AXGB 5DFVC 2R51A 2XL2A 2FLMA 3S88H 1UB5B 3KPOB 3CXDL 3PHAA 1IGJA 1A7PH 1UA7A 4O2FA 4FABL 2VDMH 1IEBA 2XIIA 3CIAA 4U6VH 4AYSA 3FOLB 2EQDA 4XN7A 4WY7H 2X4UA 4W9DC 3B4NA 3FM0A 3DTXA 4D0KA 3TNNA 4MCNA 5LWYL 2E75C 5IY5B 3O2DL 3PLYA 3TCLA 3IDYC 4LLVA 1U2CA 2XG4A 3H9SD 2NTFA 4F2MB 4PVBA 4I8DA 4WK4B 3VMPA 4CW1B 1B9ZA 1AE6L 5LDUA 4QRSB 5MENB 4NC1C 4P2QD 4BCDA 3JWOL 4HAGA 3UPAA 2BSDA 5LN4A 3CHSA 5ACZB 4L3HD 4D0CB 5IW1A 3CFIC 4JG9A 3M86A 3H0TB 2MHAA 4MJJA 4XGZA 2EXWC 3WHE1 3ECBA 2QHLA 3BN9C 3KPRD 4JZJB 2R59A 1FF5A 5C7XL 2ZF8A 4F2ME 3HUJF 4BZ2A 3OKWA 2BMKA 5MENE 4QRRA 5E6UA 1R3LB 2L3BA 4NRZA 3V0FA 3ZUNC 1YEGH 2EEAA 4J6IA 3UGUA 4PBWD 3THML 1HK6A 4DK5A 4CRPA 3GKWH 5F0LB 4M43H 1MVYA 2AQRA 3MV7B 1MNUH 1MUJA 4HIIB 4NRXB 4XE0A 5FYJD 5C07A 5J11C 3IJEB 3CFJA 4WCYL 3A6OA 3EYOA 2PCXA 3MRLA 3LNIA 4AEEA 1Z9PA 4M5ZH 4HG4J 3VWKD 2Q8BH 3LEXB 1HTYA 1Q0XH 1OKEA 2YA0A 2CN3A 4ZW7A 1RJYA 3QZPA 1HXYA 3BP6A 1BZ9B 3FQUB 5GHWH 5F9JB 4Y16B 3WGUB 2MKWA 2KPWA 4MZIA 3AQZA 3GDBA 5GRJH 5TH2A 3CSFA 4OLUH 2I25N 3EH3B 1AD0B 1KC5L 3T2OA 4KQ0A 4X5QA 2WVSA 1FH5H 2Z31B 1N68A 2PN5A 5IHUH 2OZ4A 4HYTB 3VRJB 4Y4HC 3QIBA 4HH9A 2R29A 3VXRA 3VXUB 2D8KA 5C0FB 2H26A 1PX8A 4KPHH 5F88B 5J5EA 1D7FA 1C8QA 2XKUA 3D08A 5HDRA 5MEQB 3LRHA 4TVPL 3LXUX 1G7HA 5I66B 5CS7A 3CCHB 5FGRA 2PP9A 3U0TB 3ILPA 4K9EC 2F6AA 4OW6A 2F5AL 3STZA 2APTA 2ZSWA 3ZDYF 1XXDC 1I3VA 1PG7L 2YGVA 3JZ7A 1F4HA 2E7MA 3FCTB 2V3EA 4MD5A 3VFPB 4E9RA 4F33A 2C1OB 1NLDH 2L04A 3ALWA 4NC4A 1YUKB 2F53D 2J1WA 3D06A 4FC3E 5EOTB 3PYCA 1D5MB 4ELMF 5IB5B 5IJDC 1CO1A 3JWNE 3PL6A 1FGNL 1JPTH 3T0ED 1JZ7A 1KGWA 2BCMA 5C08B 2KQMA 4MWFB 3WDJA 1J9SA 4WEUD 4J77A 1NCGA 2P5ED 1FNSL 2XN0A 1QUPA 3JPXA 3VGGA 1RFDH 2PWFA 2YAOA 5HI5C 5F1IB 4KKLC 1M1SA 4FXKB 4PY7A 1QWHA 4PJIF 4X4KA 4YEFA 1UOPA 2C3GA 2QZQA 4PJGA 3MRQA 3VXMB 2ZXDA 5D70L 3D3VB 1JZFA 4R7VA 2X12A 3Q8FA 3K72B 5IJCC 3FAXA 3DUHA 5CGBA 4NUJB 1Q9KB 5KUMA 2CBPA 4PP1C 2FYYA 3CHOA 1UCTA 1XFPA 4I5BA 2DV6A 4HXBL 2MRYA 4JM2F 3SFZA 4WFFD 4A6YL 3FU0A 5A40E 2FECI 1XGQA 4Y8DC 3D3VE 5D72H 1ZKAA 3GJEB 2WW8A 2XPZA 3LPOA 1BZOA 4FQJL 3ZYOA 2PYFA 1QRKA 2JCCB 1Y18B 1C1EH 3UJTH 3O6KH 5EO1B 4U1HB 3AT8A 4AH2A 1XGTA 3QHTC 5CJQL 5AQ0A 1KB5H 3O8XB 4DTGH 5IHWA 2Y7MA 4NHCL 1WC7B 4O02B 5TDPB 4NKOA 3HBGA 4XP4H 1A2YA 1AG0A 5FV2A 2H2PC 3CZUB 5E6YA 3H42L 1OT1A 3P4MA 3WCYA 4OCRL 1OARH 1WEJH 2YBGA 3BGFC 4UBDC 2PNDA 2VM9A 3QIUB 1SDDB 5I1JH 5B7EA 1T4WA 1UCBL 4P5TD 4QXTA 3QDJE 3CN0A 1TCRB 4IIQB 4WI2A 2PF6A 2C9PA 3IE4A 3MRKB 5KBPA 4J3BA 3AL8A 2IVFC 2IMMA 3QWOB 3IDJB 4Q74A 1IL1A 5IMKA 3QZWG 4QLRA 5I15H 3DV4A 3UYPB 4HX1B 1TEGA 3GTNA 1S7UA 1WAPA 4BKTC 5HDWA 3B3IB 3BFWA 4XPGH 2VC2B 5E0FA 5ICXA 1WD8A 1MFAH 1A3RL 2LGNA 5KVEH 4Z78B 5E1IA 3MNMA 1U93B 5E5UB 3AT9A 3KCPA 3MV8E 4PJFF 1E8WA 1LO5B 4LLAA 4BCXA 1JD7A 5D2LE 4ZAKC 2J43A 3K4DA 4UYQA 3DHPA 4RE6A 2ZKWA 4MJID 4OFDA 5C0AD 4ES9A 5FW7A 1PQZB 4B95C 1L0YA 1YQ2A 4JMNA 5JHLL 1MCRA 3L3GB 3CC5B 1CGSL 4JY6A 4ZOZA 3B2UD 2D3VA 3K6DA 1AO7E 2WQXA 3QZWA 2WNXA 1NBQA 4OZ4A 4W9JC 1I9EA 1A12A 4E54B 4XZ4A 1FLRL 4HFUH 4DAGH 2E56A 4E42B 3RGVD 3HMWH 2QLYA 2J21A 3B2MA 4KITB 2HX8A 4D0BA 5JQIB 5HPOA 3SODB 1VGEH 1VADB 2MNUA 4JDTL 5F3BB 4CKQA 2OL3L 4R83A 3DO4A 3EJQA 1AGCA 5CP7B 1SHMA 5HI4C 5FUOL 1G7IA 2V9UA 3MXVH 4AEIH 1P84K 3HNTL 1JJUB 2O9KA 3RWHA 3PNRB 4RCAA 3SHSA 1T1XA 2FATH 3RZCA 4C57C 4PG2C 1AYRA 2ID5A 4DW2H 2HMIC 4FL4C 4MS8D 4NAAA 1U3NA 4NZTL 1QPKA 1GTFA 1MRDH 4K7PX 4Y4KB 4ZW8A 3MRNB 1NC2D 4GJTB 4OVVA 2BWDA 1SNRA 1RH8A 2EIBA 5D55A 2VDQB 4UILL 3UL4A 2CO1A 4TNFA 1Q9WB 3CVDA 5KAQF 3FQ2A 4D9LL 5EMYA 3BZEA 4ZPVA 5SX5K 1J12A 4N8PA 5E6SA 5EO0B 3OHMB 3RNQB 2XG5A 4QF1B 3VRIA 3QHYB 1XGZA 1D5BA 1KT2B 5EU5A 3S5YA 1Z0NA 2X4OA 5KYYB 3LKRB 4OF7A 1FI8C 1VE6A 4IBSA 1X5HA 1ZXQA 1H5BC 5LB1A 4QJ5B 3SGKC 3DYOA 2OW7A 3S9DB 4LLYA 4KTGA 1J1PL 3VFNA 4OD3H 4X6DF 1U2HA 5E8PB 3FJTA 3MLVH 1BECA 3OAYK 2GPZA 4BQ9A 3EJUA 5F7EH 3V9EA 4AE1A 4X6CF 5IV2A 1A6TB 1LMKA 4QHLA 1SRDA 2G60L 3VE0B 3B3BA 2A74C 1AIFA 4PV8B 3C9CA 1F02I 2FGWL 2BRRL 2GBUA 2WOBA 2CO6A 2H8PA 3KLSA 4KHXL 1PDKA 2CGRH 1MH5A 2UZYB 5ITFB 2CDFA 6PAZA 3W2DL 4G3YH 4XHJC 5ECGA 2AV1A 3RE0A 1KMGA 3MV9D 1OM3L 3I8EA 1NAML 5CSBA 1KGJA 5IB3B 3ULUH 3JROA 2QC5A 4PG9B 2QKIC 4MMZA 3RB5A 1KLGB 2X4TA 3WGVB 3G5VB 2FX9H 3SQBA 5CD5C 2EECA 3K6SB 2QADD 5A2BA 4N2MA 1P7QA 3MX0B 1E4XL 3V6ZA 4LCWE 1JPEA 5IFHL 2GSGB 2LFEA 1X5XA 5E6ZA 4HDJA 1R6VA 4MNGA 2XPGA 4XNQB 1OTTD 4O3TB 4OM1H 5L4MA 3QUYC 1PAZA 3QCVH 4RMSA 3EOAB 1JXJA 3C5ZA 2CQVA 1ONQA 4XRCA 5IW6B 5A1AA 4IDLA 5E1HB 1OWRM 4QRJA 2BVYA 1U8OA 1IUZA 1F58L 1TQBB 4BZ1L 3TBVB 3S7GA 2UVEA 2N7BA 3P54A 3VFMB 1PSKL 2O6FA 3TN0D 4ES8A 5JXED 3C75A 1WFUA 3ULUD 1XH3A 2NNCA 1WIOA 4HCRL 4FLOA 4ZN4A 4K7FB 4HKJA 3V6OC 1G6RH 5DRNA 3BVTA 5E9DD 4BWWA 3EYUH 1LE5B 2FEJA 5I6MA 1S7SA 4O9DA 1MLBA 5KBMA 1IU1A 4PNKB 5HHMD 4F37K 2VQ1A 4UTAL 4NUPA 4POZC 3SCMC 1G84A 4IHOA 5DEJA 5E4IA 5J8OA 5IJKC 4ZPTA 3TEUA 4FYSA 4MNQD 4P46A 5KBNC 1G7PB 1HWGB 2GI7A 3OXRA 2ZXAA 2NY6B 3K1DA 3U1SH 3V5WB 2YD6A 2QDWA 1N10A 3D12B 3GUFA 4NKMB 5EZJA 4HIXL 3IKCB 1YMMD 4LAQH 4YSDA 2NY1B 4MKMA 2DYSB 3LDBB 5C70A 1MVUA 5I6XB 4LU5L 1U21A 4X7SH 1DQML 4XVSH 2ODIA 4YHMH 1DANU 2QBWA 2OP4L 1NBYA 1U8CA 2YQBA 4S0HA 3KPTA 4NZRH 5C9JA 4RDQF 1FYTE 5T1JA 4YXLH 5C0IB 5FECA 3A67L 5KSUB 2NXYC 2COQA 5IWLA 4H5SB 3FT2A 4X99B 4W4OC 3EG9A 4ZD3L 3OSVA 3W38A 4OGYL 4JPIB 3KGSA 4FFZL 2BX5A 4YBHA 2QQKH 2UV3A 3WTTA 4W9LC 3ZE2E 3GI9L 4MDIB 3RBGA 4HUUA 5KVGH 4J12A 1AE6H 1G9NH 4IMKA 3SDCA 4XCCH 2GC4C 4AYBA 5E8DH 5D7LE 2A9NL 3HZVA 1OP3H 1FE8L 3CLWA 3MRGB 4IYKA 1ORSA 5JIHA 1TZIB 1KELH 3ROLB 1F42A 3OR6A 5ERWB 4BFEA 1KCUH 1AOHA 3D39E 1EAOA 1RZFL 4C59B 2CO0A 3UR4A 2DTSA 4ZMVA 1XF4A 1CQKA 3C6LA 4JFSA 3ZHDA 3IJYB 3DVIA 4FQ2L 1UXSA 5EOCL 2DQUL 2BERA 2I9LA 2IAMA 4MXWL 4AQAB 3F3GA 1KJMA 4EKXA 4H4NA 3UAJC 3BWSA 2OW6A 2VXQL 3ARDD 5K9KA 1B2WL 4IRZH 3ARXA 5EOQL 3TEZA 3CZNA 4EIGB 3I89A 4XNMA 2YMOA 2VDPA 3QUZB 2R2HA 2WAQA 3STLB 5KYUB 1WUNT 3SJVD 2OPCA 1N5YL 5C0GB 4JDEB 1OP5H 3O6LL 3ETSA 3HKZA 5F1OB 1F4YL 3L3DB 2WO2B 4CKVX 1L7IH 1T04B 3HS8A 5ICZA 2XTJD 2AK1L 1S7XB 3UXFA 1E2ZA 3FO9B 3AC0A 2WINB 3NJKA 3QIWC 2BSEA 1CXIA 1AZUA 1OAKH 4J79A 1CPUA 1ETZA 3OWEA 1I8AA 5GS1B 1RXLA 3QJOA 1U95B 5CN3A 1KFGA 3FBKA 3V6FB 1WWBX 4J87A 1EGJH 5CCHE 5F9DC 3V0JA 3C9NB 1QASA 2ZPKL 4BUGA 3CDCA 1RJLB 3CFTA 1LE9B 4GP5B 2APBA 4IOFD 5ISZE 3HNVH 4I3SL 4R7LA 2I9TA 3UTTA 2P28B 4POUB 3IJSB 5EC1A 2R0LH 4ZFGL 5B3JF 5A2LH 3FCGA 3BP7B 2NR6D 3K81A 4HF5H 2MJWA 4PH8A 5G55A 4ANVA 4YSCA 4XMTA 5C0BA 2H6PA 5CINH 1RQ5A 2XN9B 3UP1A 3VYPA 2Y69B 1U33A 4GI6A 5I8OH 3H55A 2K4AA 4KAQH 4A09A 3GKZA 3W9EB 2ZOKA 4DZBA 1CDJA 1MFDL 2PWGA 4JSPC 4LFHG 4KQ4H 4F15C 2E7HA 2X6MA 4JPWH 4BH8B 2Z35B 3LSOB 3LN9A 3QFGA 3CG8A 3F7VA 1PKQA 4X7TA 4UI9R 3SE3A 1UA6L 4HUKB 2OMUB 3GBML 3QJQB 4NO0A 4PJAA 4J3TA 5E5MB 5F9WB 5GGRA 3RLMD 4PVNA 1RUMH 1TU2B 2H47C 4DGYH 2ZCLL 1QTYT 5AEAA 3E2HC 5E2WL 1WHPA 3Q48A 2DM3A 3KE0A 4ZYKB 1MFMA 5PAZA 3JTTA 3CZFA 1I3UA 5E70A 1CTNA 3ULVL 3CIKB 3L3OA 3JWDH 4B9GA 4UANA 3ZTCC 4FQQB 1MQKL 3LRLA 2IOOA 3I6LD 4FFWD 4P2OD 5F6HI 4K3DL 3FT3A 5EULV 4BSVA 3AM8C 4J3XA 1JOIA 4L4TA 1HZLA 5DO2C 1E3FA 3HE7C 5K1VA 4FNQA 4H8WL 32C2A 1UD5A 1FP5A 3UEZA 1MG3A 1G0DA 1WJ3A 3LKOA 2WVVA 1P69B 3COOA 3GNML 4APQC 3D18B 1R0AH 3P0YL 4QHNB 4Y5VA 1GYWA 4DVBA 3SXTD 2X6VA 1YMHA 1O0VA 1BWWA 3L1OH 3QJVB 3WTYA 3PS6A 4F2EA 1KFAL 2ZQKA 3BCDA 4XMXA 2UY7A 3D0AA 1WVZA 3DUUA 2P9UC 4AX4A 5C71A 1RZJC 3DETC 5M94B 5FHBL 5AVWB 5BV7L 3NK4A 4WDIA 5I1CL 1JHKH 1VEMA 3CXHK 3UBGA 5IBLD 2NY4C 5I18H 5LUMA 2R0ZL 2O61B 4XO5A 2H3NB 4PSRA 1EBPA 5MEND 3SO3B 4N5ED 3TYGL 1NR0A 2R83A 3MRCA 3I02A 4OAWB 3HZMA 4EN3A 4EOWH 1J1OL 4KU1A 4OLVL 4PTTA 4MD4B 5DUBA 1H9DA 3BG0A 3C99A 3BO8B 4OCSL 4HIJB 4A38A 3KHQA 5AW1B 2VRQA 1HKLL 4ZMQA 2YD4A 1HJBC 1PG7X 1Q9OA 4Z7VB 4HLJA 1IAII 2ADIA 2VRAA 4DNLA 3WEXB 4JHWH 3QORB 4HZLA 2XCMC 2BNUB 1QOKA 3QJTB 2A9MH 4K73A 3FTXA 1ZT1A 2QSCL 4G8GB 4KXCA 4OZGF 1PD1A 3F12A 3MV7D 3OLDA 4Z18A 3IUJA 1JWMB 4LEXH 1C12B 3VQLA 4LLMB 4Y0GA 5EN2A 5I73B 4Z7VE 1T0PB 4FA9D 3WS3B 4AM0Q 3EBAA 3G6DL 1PNCA 3J8F7 3MRHB 3V9CA 1E50A 4ZTOH 1P7BA 3JWNH 3BP4A 4KGLA 3BE1L 5IQLA 1Y1DA 4G8GE 3L9BA 1A6ZB 1UH4A 4BXSV 1JGUL 1TJIL 3O11B 4FHLA 4Y16D 4YXKH 5I75C 4PV9B 4W68A 4MB5A 4J3WA 5D7KD 4PWHA 5TD4A 4R4BA 5G5DB 4HHAB 1A6WH 5JDSB 2HZHA 43CAB 4I77L 4IU2B 2DMHA 3T6QC 2XNAA 2Z31D 3EBIA 2OS7A 4HS6A 1N18A 1U8MB 1H0DB 4M93B 2WYIA 4KFMA 3VXUD 2D7TL 3ZT6A 2HKRA 1NFDA 3REVA 5C6WH 4JT5C 2B4CC 4L8DA 2F0CA 5DD6B 1EDYA 3DXMC 1JUFB 4HWUA 5IMLB 2UYLB 2HFTA 3SGJC 1T2JA 4WK0B 4AVJA 4QHKJ 2BZ7A 4U4BA 4HJGA 2YB8B 2L7EA 1K5WA 3ZE0A 2AJYH 1AQKH 4YZWA 1AP2A 2CBTA 3RGBA 3I75B 3NCJH 3MNZA 1MJ7L 1UXMA 4UOW1 2YPLB 5AL0A 3SN6N 4EI5C 2YMXL 2ZNXA 3GSNL 1RMFH 2WTRA 3BUIA 3AU0A 3KVQA 3MJ6A 1RZ8A 5C0ND 3S5LG 5L2KA 3R0MA 1DUZA 2QVTA 3FZUC 3NIFB 3DMMB 1WBZB 5KVMC 1I9IL 4HUCA 3ZGHA 4AC4A 2MOQA 5ADOL 5J89A 4AKOA 1KGUA 3VH0A 1SJHB 4LEOB 5TQ2H 4OCNC 4M00A 3QDGA 5C08D 1T66D 1E5AA 1PZUB 5KSVB 1KG0B 3GRWH 3FQTB 4DEUA 3NIFE 3O45A 2F8VA 4JFZH 1WBYB 3MOAH 3FSAA 3HPJA 4FG6D 3SD2A 3VXMD 2YARA 4IRSC 2JJSC 3WKNA 3ZKND 2WGXA 3L7FA 3D3VD 5D7JA 4C58B 4EDWH 4FWWA 1KDJA 4ICWA 3S5LA 1HZKA 2ZAHA 3K71A 5E1GA 4PV1C 4IGBC 4X6BB 2F7RA 3NCFB 4KI5F 4F7CA 2M26A 2VERA 2I5YL 3DI3B 2VJ0A 4D2NA 2IH3B 3BX7C 4LASL 1OCZB 1EK3A 4QY8B 1LYQA 4B41A 4DZ8B 5I1DA 5I1EH 2VC2H 3CHRA 4LGPB 5CNHA 4DT2A 1CBVL 4G8EB 1DZBA 5CWSA 2X05A 2GBAA 1I3GH 5D5MB 2QPFA 3DSNA 2FQDA 4JCWA 4E41A 4HDIA 3O8XD 3LS5L 2B59B 5A2IH 1X5JA 3CU1A 5FKTA 5EU7C 3VRLF 4PJ9B 4JRLA 1AVAA 5IJVB 4DHLA 1OALA 3U2IA 3MUGA 5ESQB 4AX3A 4DKEH 3QIUD 1NCOA 2H3XA 4XCYB 2FHCA 5D5ME 1A25A 1ZA3B 4FYTA 4N68A 4K0OA 4GG6F 3TYFA 3KM2A 5J56B 4J2QA 1PSKH 1PZ5A 4K3HA 5EBWB 2EDXA 4A0BA 1MWAB 4J4PC 1QW9A 1RULH 2G5UA 3DNKA 4KDTA 2K3TA 4AUYA 1NBVH 1R3IH 4G6JH 3HC0B 3ENEA 1T0NA 5SV4A 4MNHA 2APSA 2Q0ZX 3NRQA 2HJLB 4GW1B 4QOKB 2HWZL 4X5PA 3AREB 5LGHL 2I7SA 2HXCA 1M6OA 4AV4A 3WTWA 3ZDWA 1J5DA 3NZHH 2YUVA 3O3AB 1A4JA 1KOAA 1PCXA 1V55B 4RGNB 4RAUB 1QG3A 2OR8A 3NFNB 4OZIA 3MMYA 3QH3B 1W72L 4IEFB 5EBMA 3IF1A 1SHSA 2P52A 3EDDA 4MX7B 3OJ2C 1MCNA 3S37L 5IEHB 3G04A 4H2CA 1WIPA 3P1VA 4QOKE 4OKVB 4NFDA 3O3EA 5FGBA 3CIQA 1RUAL 4DQOH 5I9QC 4FQCH 3A4AA 2BNQE 2VDQH 2D7NA 2YSSA 1DQMH 1L5GB 1NSNL 5AYQA 4G6AC 1UM5L 4RGNE 3ZDZF 2UY6B 4IBVA 4WAFA 4HW6A 4XCNA 5AW4B 1R5MA 1K8IB 3UTOA 2EIDA 4KTYA 2X0VA 1J05B 1JK9B 2C9AA 2ZX8A 4JFDB 5I1IH 2AGZA 1HHJB 2I7OA 3O6ML 3B2DC 4YZFE 1XVSA 2W0FB 3EGDB 3A21A 1GCFA 1A7OL 4XXCA 3LQMA 4L8SB 1Z5YD 4QKXB 4HWBL 3LEYL 2BFVH 4D9QE 4XZUB 2PP7A 5SX4H 4QT5B 3GMMB 1JF1A 1XGPA 4MCYB 3DJSA 3IB4A 4JFDE 1UUSA 2WCSA 1NFKA 2R0WL 43C9B 4MA7L 2HLFD 3TASA 1FG2B 3MZKA 4AXWB 2GTZA 2R2BB 5C0RH 4ZOXA 2L7QA 3K2UL 4KY1H 2RJMA 3TO4C 1I3RA 3CFEA 1KPRB 4PGDB 5J1AB 3LMJL 1L4IA 3EJTA 1MCCA 1NGXB 1IARB 5EOCH 2AXFA 3H2WA 2YN3A 4TUOA 4DCQB 4Q14A 4WUUA 4KFZC 4ZXBC 2GI0A 2B5MA 4AM0A 3CDYA 1Z9LA 2ICWJ 4JGUA 1Z66A 5INDA 1AXSB 2F15A 4HJ1A 4YDMA 3S36H 3ABKB 3VGBA 4WIQA 1N5YH 3HUJE 2NCMA 5HYJB 4OFYA 2XWXA 5C0CA 2HT3D 1FL3A 2ORBH 5KBDA 5L88L 4AIZB 5F89B 1NAKH 2BOCA 4A0AA 1O7SA 4PJXF 3DX6A 3FRUB 1TG8A 1TQCC 2BVUA 3ZJAA 3MRBA 1P9MA 1XR8A 3LJ3A 1ZHKB 4IBQA 3CFCH 3DGGA 1NBZB 4HIHA 4PWJA 5HHNB 2DIBA 2YN5A 1E5CA 1BQRA 4OCMC 1KJ2B 2CO2A 2CWRA 3FONA 5BZZA 1I7RB 1QFUH 5FK9B 2Q87A 3HAEH 4NQEA 5F1NB 4JFYA 4IKNA 2DQEH 2YAMA 1T6VN 4M7JH 2OSWA 4PB9L 2VABA 3G6JF 4JFWA 3NH7H 3CX5K 3FB5A 4HT1L 1PX4A 3JTBA 5AB9A 4PS3A 2KPNA 1IIKA 1VFAB 3IYLW 1P5VA 4ERSL 4DK6A 2MH4A 3MC0A 1YAZA 5D2NC 2YPKB 3HC3L 1WE5A 2YWZA 4HKBB 3IIYA 4WFHE 4HUVB 5IHBA 2O5ZH 2VWEE 1A9BA 4JO2H 5DJZA 1R3KA 3DDFA 1ADQL 4LDCA 3LQAH 5AAMA 1EO8H 1FPTL 1F4AA 4KOCA 4NXSA 1DQLH 1KBVA 1NTDA 1NCNA 4JQIH 3L17A 2CUAA 1EVUA 4OSUH 3ILQD 1DL7L 2J88L 4U1MA 1JYNA 5JIMA 1FNEA 4WTXA 4GG8A 2ZX9A 2BVOB 4Y2OA 2ZKXA 4G5AA 4WW1B 1N5AA 1WAEA 2CHWA 2VDOB 3H7BA 3QS3A 1A7RL 4ELME 4WI5A 2MNJB 2YUZA 1N12A 3CE1A 3UAEA 2Z2OA 1J5IA 3O4LA 2DOCA 5JLZA 5D1ZI 2BP8A 4BQ8A 3OPZH 2Y25A 5BZWB 4N8VG 5D7SL 4J8RB 3IGAB 4RMVA 1ZK9A 3LN4A 1K8DA 1FAIH 1AR1B 1N67A 1K32A 1U3HA 4HGKC 4J27A 1QLEL 3VD9A 2B39A 2VLLA 1L9TA 3GSVB 4G70B 4PBDA 4N0UA 4NNXA 4PJIE 2HJBA 4PREA 1QLFB 4R4FL 4QXGH 1UD3A 2WCGA 3GMPB 4WWNA 3TA3B 3W56A 4F8NA 1U92B 1U8LB 4NDMA 3W82A 2NY1D 5F2FA 2O5NA 2X4SA 1DEEA 2AMUA 1DJIA 1BM7A 1AHWC 2SEBB 1DP0A 4H0IA 1E9PA 2W0PA 3CUPB 5AYUH 3IPBA 1M1XA 3LZNA 4FQXA 3SY0B 1TJHL 2ZP8A 3IUNA 2V7NB 2CO7B 2K45A 4N8VA 2OTUA 3MRJA 3MLYL 5ID0B 1F4XL 2X6UA 4PHZA 2FHBA 3IMSA 5JUEH 3LKNA 4MMXB 2HRHA 5D6CA 1FV1A 4ONHA 4GQ9H 1OM9A 4TSBH 5J0BA 3VG0L 3BKCH 3EGSB 3K74B 3DURA 4AVKA 4P9MH 35C8L 1LXMA 1VHPA 3MOBL 3EKCA 4JO1H 2DQDL 2VL5B 3VWKC 4IOIB 1MJJB 2AITA 4BDVA 2P44B 4P05A 5JPMB 4YHNA 4WWID 2WMPA 3UYRL 5KZCB 1X5MA 1V54B 4NAJA 1F8TL 4UMSA 1BX2B 1F4WH 2JB5H 4FI6A 5ADPH 3MXXA 4C56A 1UEMA 5KYXB 3RFGA 5EIIB 3HR6A 1G7LB 4WFGE 1CE6B 3V5KA 1A6UH 5F44A 4ZUWB 5C0DA 1INEL 4ZZKA 2GQHA 2FNWA 3N0DA 2CXKA 1Z5HA 3BSZH 3QUZD 2XX1A 3JYBA 4NSKA 2GJ6A 1N6DA 2EUWA 1B9XA 4PJFE 5GRUL 3F5WA 3QGVA 1T03L 2XQYG 3HG5A 3UKRC 1L6PA 4JRWA 2Z92B 4N2IA 2FL5B 4RMRA 4KDVA 4ETQB 4P57A 4Z6AT 4IRJB 3IDXL 1ZT4A 5BW7C 1KYFA 4HV8A 4M7ZB 4UNIA 3D2UB 5GGUB 3GHBL 1IAMA 4LXFA 3VX0A 4BL0A 1FBIL 2VH5H 3QCTL 2YRBA 1TQWA 4PJEF 4FHJA 1KTLA 3GWJA 3I3DA 4LBEB 4BH7B 3A22A 3BESR 5DFWH 4QRAA 2F8XC 3LX9A 3QHFL 2XKSA 4YGVA 3T0EC 5FX3A 1F86A 1HAUA 1HH9B 1NKGA 3FRPA 4NQED 1S5IH 2G30A 4XP5H 2VLKA 1B3JA 2J2ZB 1K5NB 5KSBF 4XX1E 3H53A 2XQYA 4QAMA 1RIVL 1BVLA 1DTUA 1P53A 4N2BA 1BMWA 1GG2B 1ML0A 1GW0A 2WUBH 5F6HJ 2HTLD 3DC0A 3RL1A 2WQVA 3B34A 4L3AA 2P5WB 3UADA 1G7QA 3SDXB 1KIPA 1Y6KR 4MJ6B 2W60A 4Y1AA 1RI8A 4X80H 1OEZW 2AV7B 3IXAB 3SWSD 3BUBA 2E4FA 5C09E 5DJAB 4PU2A 3LQZB 4Y9BA 3QJZA 2OI9C 1WFOA 4OFKA 2XN9D 4XH2B 2EC8A 4PS4H 3DSFL 1D6EB 4BE5A 3U9UB 2DWEB 3PJSA 5F72S 2JJUA 2E7BA 2ZYRA 4IIZA 1T5XB 5B39G 3ZIMA 3NJXA 2EYRB 1O9VA 2ILLA 3NIDB 4HKZB 2X3CA 2LLLA 4ELDA 2HFGH 1IBFA 1QSVA 4D0DA 1DO6A 3SPGA 5F7NC 4PY8I 4AGQA 4BSWB 3FOMA 4JRFA 2AEQH 1WLHA 2CK0H 1P6WA 2PO6A 4X6EB 5HJ3B 2EDRA 4N2NA 3MLTB 4OU3A 3KL5A 3U4AA 2VDMA 3B7SA 3ILDA 1BQKA 1H6UA 4PGCA 4QXUL 2UZXB 3OHXB 2B16A 2GABA 4P5TC 4Z7WB 4PJ5B 1X4YA 3QPXL 2J44A 2VDLL 2XIBA 1UT1A 3DROA 1N9PA 1OGAB 1ZIAA 3CHXA 3V6BR 1IEAA 5B39A 4X6CE 2E9JA 1W2KT 3ATEA 1IGMH 3A6CH 3HG2A 4X7FC 5T5NF 3BQUA 4JX0A 3VB9A 4AWJC 3LH8A 1VESA 1M9SA 4NZJA 4WEBH 5IMMB 2XE4A 1A1OB 1ZGLB 4JB9H 3KAAA 3CC1A 1OSEA 4Z7WE 5GXIA 4X9IA 4AL8C 1BJ1J 2J8UB 1ZHNA 2YSTA 1DQTA 3UG4A 4NKIL 1PG7W 2I32A 1OGAE 4XMKH 5I5RA 1UGNA 3HR5A 5DMKA 3KPNA 4TULH 4EI6A 5MP6H 4E9WA 1CF8H 3MLXH 4JZOB 1XSIA 3KLHC 4I18A 4NENB 5DI8A 2OZNA 1ES0B 5F7YC 4O5LH 2IPTL 1J5HA 2XXCB 3CDGB 2J8UE 1YDPB 4I89A 5GS0D 1NM4A 5IHZA 2IALA 2JE8A 3B2UC 1L7TH 1XH1A 3FCUB 4AVIA 3RGVC 1ASPA 4FNUA 3VSUA 2GVYA 1I1YA 3H4FA 2NZ9D 3AU1A 2OJEB 1MDTA 1NCHA 3II2A 4E5ZB 2DKUA 4J5VA 1IM9B 4K5LA 1EZUA 2JJTC 3AGWA 2HVJB 4YO0B 1BIIA 3QORD 1WS8A 1OY3B 5CMAA 5T1KB 1ZE3H 1LP9A 1U8PB 3ORJA 4G8GD 4N2HA 4MS8C 3QIBC 2V5RA 3FYEB 4RZCB 4XN4A 5L8KB 2QV2A 2IH1A 3N5AA 4WW2A 2GJ6D 1HHGB 3U7WL 3FTWA 3PWUA 1UM5H 1Y0LA 2DB8A 3AG1B 3PDOA 4OWRA 5JNYB 2G3MA 1QSFB 3RIAF 2DJ4A 4PJ7F 1WFMA 1T1YB 3KS0J 1CDGA 1J8HA 2H1PL 4XP1H 5FYKE 5I1LA 5DS8A 1KXTB 4ISVB 1ZCRA 1NCBH 4P3CH 1VENA 5CEXA 4O2WA 5DUML 3QG7H 4LKXB 3U36B 2YZ1A 5K5YA 3VGDA 3ESOA 5AVSB 4P4RA 1HE8A 1CFNA 3ZKMD 1SJEA 4DJMA 4U33A 3QJXA 4P04A 5D4HA 1QSFE 3KPMB 2UXTA 3W0WE 4WO4B 1WF5A 5E8EA 3CMGA 2UVFA 3P0VL 1NCIA 2EE0A 2QEJA 2P7TA 4BE6A 1IGIL 2PMZA 4AQ1A 3UJJL 5DF0A 4R5VA 4QRUB 3PP4L 4N2CA 4LPTA 3Q6GL 3HI6H 5E2UH 2CJSA 1LD9B 3RI5K 1I8MA 1F1GA 4KNSA 1UD6A 4V1DB 5ALBL 1A14H 4JDZA 3LYRA 5T5FH 3TBTA 2JMRA 3LV3A 4XCEB 3OJDA 5AAPA 1QBML 3BSGA 3RX8A 2ZOTA 3NA4A 2YPLD 4LT7A 3GI8H 1IBBA 5IVZA 3O2WH 1JYWA 1ZVYA 4I48A 2NNRA 4TTGA 3GMQA 3QRGH 5C0EB 1C9SA 4UAOB 1P6FA 4GMSL 3DMMD 2B8OT 3TU6A 3Q6FB 3ESMA 4YSOA 4AJ0A 4V1DE 3VXPA 4BELD 3U7AA 5CEZE 1A8JH 4FLRA 4M6NH 1EMTH 1TQSA 5CXCA 5IVOA 1HHHB 5EUOF 1RVFH 2FX8H 2D03H 5L9DL 3T0XA 4A6YB 4ESGA 1UZGA 1CD1A 1IAIL 3MFFB 1BDYA 4WTQA 4AG4L 5CJOH 4Z3JA 1JFQL 1S4IA 2AK4B 4LSVL 1I85C 2WZ0A 3ZXAC 4AV5A 2FJUB 2D7QA 2OK6A 2L7UA 1HHKB 4HUNB 5FA4B 4JS7A 4U0RB 1SYVA 2BVQB 3EH1A 3HZYB 1JRHI 1KCLA 5ABAA 3BXNA 2AJUH 4FD0A 4XPTH 1Z7JA 2AGJH 1HZHL 2EYSA 3FU7B 4KH2A 3QUMA 3VGHA 3ZMRA 4WLCA 4A04A 5BOZG 1KYDA 1ACYH 2X4PB 3W9DB 1PIGA 3RFZC 1OTTC 5D7HA 4KZDL 1BYNA 2YMTA 3S3CB 1HT6A 4Z8FL 1ACCA 2CUHA 2EDBA 2Y36L 2FWOB 1U9KA 1EXUB 1MWAH 1UJ3B 2VR9A 4NPKA 1R19A 4RFNB 3RI5F 5JXEC 3TN0C 4XBMA 5HDQH 4HPOH 1K4DB 3FFCA 5AOLA 3APCA 3QEHA 3ULUC 3BZDA 3KCIA 4U1SA 3L4OD 2WLMA 3GMNB 4HK3N 3EQ8A 4Y4FA 3TVMB 2JI1A 3P73B 4PJ9D 4JVPA 2XXFA 1QTSA 5DEGA 2W81C 4N86A 5DD0H 1P4IH 4PRPA 1E28A 4URTB 1MI5E 5IFJB 1P6AB 1FC1A 3PHOA 5FKAA 1ZHLA 4OLZH 5FYKL 3WN6A 5E56A 4BHUI 4RBPH 4ESKA 4N9GB 1BMGA 3P3YA 4A7JA 2F54E 3UMTA 2GEQA 4F91B 5I30H 4HU2A 1FFQA 2BS9A 4OBSA 1R17A 4DEPB 2AKRA 2BY1A 4P3DA 2X9XA 2CDEA 4KXAA 4PI2A 4OJEH 2DQJH 3DX8A 5I74C 5BRZA 4QOKD 5GISH 3ARED 1HL8A 3SPVB 4WGKA 2BSCA 3U2SA 4XVUC 2F74A 2Y4SA 1UACL 3FS9A 5HDLA 1RZ7H 3WY2A 2HJKB 3OMAB 1TTRA 1OT2A 3GIZL 2XV6B 4RGND 5IGXH 1ZLVK 4F7MB 5B38G 1IC7L 4XO4A 2XYIA 2C3VB 3EHBB 5JIKA 4UINL 5DZAA 2ZKHL 3TXAA 4PRIB 1OTSD 4O4YH 4R3SA 4ZMOA 3CDZB 3GSRB 2GTWA 5JA8B 4E9QA 3RUGB 2ZJSL 5BOJA 4ALAC 1AD9A 1KWGA 4UT6A 3DBSA 3P30H 3T1FB 3LIZL 3K6OA 3FH8A 1U8JA 3ETTA 5IMOB 2COVD 3U1QA 4XO3A 4NWTL 3RWDA 1YO4A 1AC0A 2IJ0C 4JFDD 4XBGB 1TZOA 2J73A 3NPSC 4FI7A 3BPLB 4KO9A 4YHOL 5A6MA 3EI4A 3OD3A 1QO3B 3ARDC 1NANI 2B3IA 2QMKA 3NACH 4WEMB 3RL2A 4A68A 5T3ZE 2AEPL 5B38A 1ND0A 1RZPA 1XGYL 2ITCB 4NOFA 3DXKC 3UC0L 4A7TA 2A1WL 3TBSB 4AYFB 2PCPA 2UXGA 5FAAA 1C9IA 1DUYA 2EDNA 3T0WA 3OV6A 4W9FC 1FIEA 3DUSB 3S96A 1M7DB 4OUUA 3EDJA 5FW8A 3RAJH 4LVHC 2GCYA 1J9TA 4HEMA 2XTJC 1DVQA 5AUMB 4YHKH 1TKWA 2AEWA 4A7SA 1E5ZA 4M61A 1CLYH 2I24N 3OZKA 4H26B 3MI6A 1HCYA 4NBZB 5E6IB 1IT9H 1KJ2H 4X9FA 2DWYA 5KN5A 3B56A 4OF6A 5CFHA 3BI9X 1AGDA 1JXDA 2C26A 4GO9A 2XZQL 4XWGL 5TTRA 3RKPA 1IAKA 4JM0A 1R9FA 5H17A 1L3NA 4F9LC 4F57H 1O7DE 5DD5L 1WZLA 3WN5C 1L6XA 4JD2C 3L08A 3RVWD 1E90A 2W80C 4LGSB 1FORL 4D7PA 2LLGA 5J9PA 3ZDXA 5AWNL 3QUXA 4YN3A 2ALAA 5I19L 5C7ZA 5HYJD 1MCFA 1NAMB 4HJIA 3ATFA 4XOBA 4IOFC 1THAA 1YY8B 2OX5A 2HUHA 4K3GA 3KXFB 5HGAA 1DSWA 4AIXA 1E6OL 4BFOA 3EZJB 3FHEA 4CN6A 1VB9A 1HIMH 4GMBA 2Q9OA 3QQ9D 5CBAA 1NJ9B 2NR6C 4JUTA 3T3PB 3FQWB 2P80D 4HSAC 3UIYA 2XZGA 1GGBH 4QRQA 5EFIB 4FP8L 3QHFH 2WIIB 1M7UA 3CXHJ 3OR7B 3KXFE 1QHPA 3TOPA 1TOXA 1J10A 3L1GA 3WUWG 5D7IF 5LNDA 2X6BA 3FF7A 2W8CA 4FFYA 4ERZA 1MCJA 2P5PA 5LNEA 4XC1H 1AANA 1TO4A 3LKPB 3T3PE 1QUNA 5JORB 3S3PA 3LXCA 3TO2A 2R27A 4L1MA 3FFCD 4JHZA 4PGBB 3KPPA 4JKLA 1J8KA 3HJ0A 4TLSA 2ICEB 3L4MD 4QKTA 3EQ7A 1G6RA 2FWUA 3AY4C 3MJGX 2QVMA 2Y5EA 4YJZL 4OB5L 3I6KB 1BP3B 4OR1A 2ZUQC 1S4UX 3SDYH 5J12C 1YEEL 2AI0L 3APNA 4P2OC 4FFWC 1WUZA 2BRQA 4LSUL 5DR5H 5EBLB 5DK0A 4NQCA 3WUWA 3ESUF 4A1RA 4LDLB 3VD1A 4NZDA 25C8L 3ZZSA 5FUCC 4ZMNA 1OZTG 2JK5B 2AGLA 5IC7A 2PPFA 3MRMB 2B1OA 2J6EA 1HNGA 4TUKL 3WLBA 3JT2A 2EDYA 4IDJH 5TF1H 1CJYA 1RAMA 1YN7B 2FWLB 3I8CA 3VNYA 5DEFB 1GS6X 3LN5A 5G4MA 3PIQA 4OJCA 4QYAA 1W8OA 1BD2E 2G2PA 4MLSA 4NZ8A 2OQJB 4JKKA 3JWDC 4HA1A 1AR1D 2D3LA 3GC3B 2MCPL 4I9WE 3PE7A 5AB0A 4JG1L 5IVXF 2BJMH 5IBLC 2DMKA 1XMEB 4PMFA 4FZ8L 3TA3D 1BFVL 1IGCL 1GA2A 1LO4L 2Z91B 3L2LA 3NN8B 4N5EC 1HCVA 5L0QB 3FU9A 5D6DA 1G1YA 1MRFL 5JHDB 2F5BH 4PGEA 4KI5E 1GOGA 4JZJC 5FF6B 4BQCA 4CSTA 3FL7A 4Q4IA 5FC9A 1O6TA 1GGIL 4JDVA 4XBEH 3MXWH 1P5UB 2F7IA 3SBWA 2YS4A 3GUTA 3QUKA 1RZKL 1MY7A 3HNSL 3MDJA 1JZGA 4XXWC 3AJ7A 3T8MA 4A2GA 4D9RE 3ODTA 1G43A 5F0PB 5F3HB 5C8JB 1BQ5A 5I5MA 2PW1B 1ZLUK 4N0FA 1LK2B 5JO5B 4JO3H 3VRLE 4BKLB 2OMBA 3FKUS 4UUJB 4PJHA 3X11B 2HU8A 4G43B 1RU9L 5KZCD 4WWKA 2M1KA 6TAAA 4Y16C 2QR5A 4NHUB 3K4AA 4KVNL 2QR0B 3UZEC 1S7WA 3LXBA 4N6RA 4GW5A 4YUEH 1ETA1 3IFPB 1CDBA 2G5BA 2X0WA 2Z31C 3EJZD 1FRGH 1UOLA 5MEOA 1QFPA 1L9MA 3IS1X 4HCGA 2V5MA 4YL9A 2VZ3A 1YLBB 2CH8A 3Q8EA 3G5YB 3ZE1B 4HLZG 2YXVA 1A8ZA 1UWGL 1USZA 1SOSA 5A7EA 3K2MC 1EGJA 3OKOA 1G1CA 2DIJA 4MQXD 1NGPL 3MRRB 4LMQE 4CSZA 2DBJA 3GJFA 3JWNC 4IRJD 4FHKA 4JO5A 2MCG1 5HYSG 3ME0B 4LNRA 2BNRE 4WSKA 3D2UD 4MMYB 3BIKB 1I1AA 4JRXE 3ZE1E 4NQSB 3MUJA 4KHTH 3B37A 5C0NC 4YVDA 3IMBA 1L9OA 1SF3A 1WA1X 1D5ZA 5AL8A 1EEZA 4H7VA 4K5OA 3OL2B 2X6CA 4Q56A 1SXSA 4L4VE 5K9QI 4YHZH 3VWJB 1T66C 3TS8A 1JCKA 2AVFA 1R24B 5JHAA 2DW5A 2HX9A 1ZJBA 3JV6B 2C7UB 3QFJB 4HOMA 1MCHA 4OKDA 1EEQA 4G7YL 3BH8A 1OAZH 3MLUL 4FXKC 4FG6C 1PZSA 2P5WD 5HYSA 3MUY1 3ZKNC 4U31A 4BH6A 1OAQH 5T1DL 4ZS6D 3TC9A 2Q86B 1CD8A 3CH1A 2JKSA 5DRXA 2CMRH 1A3LL 4KOBA 3HPLB 3QFJE 4JFHD 3QVAA 1FH2A 1M2VB 3S8GB 3QXTA 5FYLL 4L4JA 3N1FC 3PU7A 1FZJB 2D7MA 3EI1B 5DC0A 5FGCE 5GJTL 3T4AB 4ENED 4PRNB 4PR5B 5IBTH 1J0IA 1TXKA 2RA1A 3MKKA 5IFAL 2AS5M 3WELA 3NCEB 3AAZB 3MBEB 3RRMC 1AS8A 4FX5A 1WZ1L 1BXVA 3GB7B 5I1GH 5IEKA 4R90L 1DBML 4AQEB 1YEFH 1IBGL 4GRLA 5CILH 4JE0A 2WSDA 1DEDA 3BPCB 3GXIA 4O00A 4PB0H 2GSIB 3C5JB 2WV3A 3H6JA 3QIUC 2EVFA 1E30A 2ZKMX 3UG3A 1SLWA 4P23B 4NC1E 4KZDH 4K8RL 4PJ5D 2J1ZA 3CPLB 4IIQC 4E9VA 4BK5A 3BIAX 2WQAA 1OGAD 3BAXA 5T1MB 5BV7B 2DD8H 1PEWA 3T71A 3G08B 1P4LB 3FN9A 3QQDB 5HDBF 2OCFD 5J11B 3MLZH 2CO3A 1JDAA 4JPKL 1J8RA 3VGZA 4OFIA 3APMA 2XOTA 2V37A 5F9OL 3VQ2C 1IM3A 1FDLL 3ROOB 3RX7A 3IULA 1U8NA 3TIEA 1ZVHA 4MYWB 4XBPA 4Z7UF 1VF5C 4KUZH 4M6OH 1NOLA 3HZKB 3QO0B 1XL6A 1VZHA 2VMDA 2RFXA 3BZ5A 1OSPL 4Q6YA 1ZSHA 1TPXC 2CAKA 2DTMH 4M56A 4QHMA 5BS0E 4N2OA 4GFXA 1BHGA 4M1CD 3RTQA 3FNKA 2YK1H 2OZ4L 5JHLA 2NUPB 4FTVB 1RY7B 2HAZA 3FU8A 4KTEH 3IDGA 3QNXA 2P24B 3VG9B 1ADWA 1E27A 2WLZA 4UTBH 3ZSTA 2XJKA 1IGYA 3T3MF 4FAND 1JAEA 1LO3H 2YJQA 2BZDA 3SJLD 4FLQA 4N2EA 1NDMA 2AJVH 5CJXC 3WKMH 2EVHA 1DLFH 1KV7A 3H9HA 3BT2L 4W9GC 4ZTEA 1IM9D 4RQQA 3CN2A 5HDOA 3FF8A 1UURA 2OL3A 3BDXA 1Z0MA 3V4PH 1UXWA 4RSVA 4ILDA 1PZDA 4WNJA 3DXAA 3B2VH 3GIZH 4OGAD 1J18A 3OKMB 5T1KD 3WYRA 3WO4B 5F96L 2Q10A 1S3KH 1BREA 2WCPA 5CKGA 1FZKA 5EB9A 4QUOA 2ICES 5ELIA 3BQVA 3CX5J 5CD3B 1E67A 2O5XH 4KWUA 4A2LA 1CU4L 3L6FB 3MRDB 5EORL 1HVXA 5EWIL 1U2YA 1URIA 2HLFC 3WTXA 5I76A 3P69A 1EO7A 5CEZH 2Z93B 4KZEL 1OB1B 2FQGA 5GZND 4ONFL 3EYSL 5HE1B 1QSFD 3V55A 1QR1A 3B7FA 4JR9L 1WAAF 4QCIA 1H6EA 4JKPL 1FZMB 1Z9NA 1MPAL 3ISYA 1N8ZA 4Q0XL 4JY4B 3SDAA 4YSQA 1QSEB 1FCCA 3BHBB 1JPST 5AAWC 1RP9A 3EJSA 3S48A 2FO4A 5FEBA 4YDJA 4ZT1A 2A2QT 2G4EA 3GSNB 1HINH 3ATDA 3HHSB 5LLIC 4G80B 3SE8L 5G4NA 4WO4D 4OF0A 3L13A 2A1WH 3O6FA 2BKLA 2PYEE 1ERJA 2GIYA 4NO3B 3EOBB 4HFWB 5KTEL 1QSEE 4HZ1A 5IT2H 2XWJA 3AROA 3ARBB 1XSJA 3IDMB 2NW3B 4S1SH 5EM2B 1QNIA 4Z3GA 3LPFA 3QQ3A 3GRWA 3CX2A 4N1EA 4V1DD 2XU9A 3QDJA 4GSDH 4YXHL 4UIKL 3WIFA 4BK4A 4AGNA 3N6YA 4GB9A 4LPXA 1O5DT 5DSCB 3WHXA 2VLRB 5BNXD 1RPQA 3GXMA 1BQSA 1W91A 5D1XB 5EU3A 4OV5B 4UDTA 2IG2L 2QL1A 3DK2A 2DWDA 2E46A 3TZVA 4FQHA 2XRAL 3U1PA 2YAFA 2NXZB 5E4OA 1KN4H 1QX1A 3DIDA 2E7DA 3MV8A 3CVIH 4WV1B 1YNTA 2XFXB 1TVHB 5D2LA 2DEYX 4BCCA 2EDOA 5T33H 4S1QH 2WWOA 2AK4D 3D9AH 4S0SD 2Z4QB 1RHHB 5HGDA 1JD9A 1QBLH 2V4LA 1M2OA 1GL4B 5DS2A 2QQLH 3HI1B 1AO7A 4QNPF 2FAUA 2HP4A 2WB1A 4PLKD 2MNWA 4JFOB 4PLOB 4FNRA 4ZG1A 3IRZA 4J6RH 4JQVC 2H3XC 4QWWD 4RFOL 1YEJH 2YZ8A 4O9HH 4DN4L 1MQ8A 2VMJA 2F68X 1R5IB 3WJLA 5HHOA 2Y1YA 4W4NA 2IDFA 4ZI8A 3SDDA 1SOQA 1TQBC 1OB0A 4U1NA 1T22B 2XETA 4U7SA 4PJEE 1MREH 3AUVA 3TGXA 5G4OA 4TPRH 1HEZB 3LRSB 3VFVA 4YIQA 2DMCA 2OMVA 4GW4B 5C3TA 3C87A 3CVCA 3HG1B 3S4SB 3U4BL 1BGXH 3CMOL 1KGIA 3QFDA 1NFAA 4OB5H 1BLNB 1KJVA 5INCB 3V5DB 1ZHBA 3OKLB 3OB8A 3SQRA 2CALA 3NP4A 4OV6F 4YHPB 1TEFA 3HN3A 3UGXA 3D4CA 2AJZB 2WWMD 1Z5LA 3LQAC 1TUPA 3ETBF 4X98B 4L9OA 4RRPM 3DPDA 5B1CA 1BEYL 3VMOA 1BJMA 4YVNA 4FL4B 2VW7A 5T3ZH 2H9GB 2NY1C 1IKOP 1TZHB 3LDBC 3N41B 2AXHA 1FL5B 1Q0YL 3EJJX 4FAVD 5KG9A 3QWRD 4HS3B 3FO1A 4QAWA 3PCYA 1XCTB 3I9PA 1IKNC 5K39A 2X70A 4QTHA 2ZNWA 2XWEA 3MACH 1XZ0A 1B4JH 4CZYA 1W8NA 1NGZB 2ADFL 4G8IA 3HFQA 1AHKA 3O0RL 5B21A 1NL0H 4AMKL 1S46A 4YWGH 1JPSH 3JV4A 4JAMA 1QI3A 4DOHE 3EHBD 4EDXB 4TLUA 1IGCH 1IQDB 5DHVB 1YEIH 1JXGA 1JRHL 4LQFL 3TT1L 3VTTA 2G2NA 4PRID 5EUKB 4TOYH 4L3EB 2YAHA 4JFQB 5H94A 1C5DA 3TJEL 1WS7A 3DRTA 4MAZA 5T3ZD 1CT8A 2D0FA 3AB0C 3KYKL 3PGDA 2GIXA 4QTFA 3X14A 3RIFK 4FADA 3UO1L 1GGIH 1JVKA 2N0MA 4L1LA 1X5GA 3CVBA 3CVHH 3A23A 4Q6KA 4NOBA 4JFFE 1PW3A 5F71A 5DZLA 4BQ6A 2VXQA 5C3LD 5C0JB 4PJ8A 5J7CC 1JNJA 2NUTA 3QUZC 5AOZA 1XEUA 2W07B 4TN9A 2OJYA 4QL1A 2Y6SC 5GSVB 1RU9H 4LCWA 1UJTA 3VFTA 5LVEA 2W9DL 2H0JA 2VL4A 5PCYA 2VR8A 3U79A 4MA1B 1RIUH 2QKIB 3GGWB 1BFOA 4LCYA 4LOUC 2D0HA 4Z7IA 1T0MA 1TYEA 1DQVA 3B83A 5FHAL 5C6PB 3TFKD 3RDTA 4J8GA 3OXSA 4R4ND 4Q9RH 3O9WA 5E6ID 2X2HA 4GQRA 5IQ7L 5KYWB 2Z64C 3IPEA 4KRLB 4QTIL 3T77A 1MRCH 3ARFA 4GP4B 3L8QA 4YQXH 5GS1C 2FYVA 2VQTA 3PWPE 4UQ9A 3VXSB 2GC7A 3MLRL 2IPUG 1UWGH 1M7IB 3RILA 4NN5B 4MGXA 1TYQC 2BSTB 1HXMB 3HAEA 4LPCA 3UKUC 3WKQA 5BXFB 3VDBA 2IOMA 1DQDL 2EO9A 2ADGB 2VLMD 3MJ8B 2WD0A 3EGXB 3QXDB 5E2VL 3RNKB 5AG8A 2HTLC 3AXLB 3HMXL 2R4RL 3KXFD 4YR6B 1IC5H 5IIEB 3T08A 1GZQB 4LSRL 4QO1A 1GAFH 1QWUA 3PWJA 4KXBA 4AI7A 1EPFA 3FTZA 3DLQR 4MFHA 4UV7H 2IURA 1U91B 3FBQA 8FABA 3AW5A 3A6BH 4MCZB 2R1WA 5LGYA 4CMMA 3GMRA 2OKMA 3NESA 3J81g