3K72A

Structure of integrin alphax beta2
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
1082
structure length
884
Chain Sequence
FNLDTEELTAFRVDSAGFGDSVVQYANSWVVVGAPQKITAANQTGGLYQCGYSTGACEPIGLQVPPEAVNMSLGLSLASTTSPSQLLACGPTVHHECGRNMYLTGLCFLLGPTQLTQRLPVSRQECPSSFELEMAQEGFSAVFTPDGPVLGAVGSFTWSGGAFLYPPNMSPTFINMSQENVDMRDSYLGYSTELALWKGVQSLVLGAPRYQHTGKAVIFTQVSRQWRMKAEVTGTQIGSYFGASLCSVDVDSDGSTDLVLIGAPHYYEQTRGGQVSVCPLPRGWRRWWCDAVLYGEQGHPWGRFGAALTVLGDVNGDKLTDVVIGAPGEEENRGAVYLFHGVLGPSISPSHSQRIAGSQLSSRLQYFGQALSGGQDLTQDGLVDLAVGARGQVLLLRTRPVLWVGVSMQFIPAEIPRSAFECREQVVSEQTLVQSNICLYIDKRSKNLLGSRDLQSSVTLDLALDPGRLSPRATFQETKNRSLSRVRVLGLKAHCENFNLLLPSCVEDSVTPITLRLNFTLVGKPLLAFRNLRPMLAADAQRYFTASLPFEKNCGADHICQDNLGISFSFPGLKSLLVGSNLELNAEVMVWNDGEDSYGTTITFSHPAGLSYRYVAEGQKQGQLRSLHLTCDSAPVGSQGTWSTSCRINHLIFRGGAQITFLATFDVSPKAVLGDRLLLTANVSSENNTPRTSKTTFQLELPVKYAVYTVVSSHEQFTKYLNFSESEEKESHVAMHRYQVNNLGQRDLPVSINFWVPVELNQEAVWMDVEVSHPQNPSLRCSSEKIAPPASDFLAHIQKNPVLDCSIAGCLRFRCDVPSFSVQEELDFTLKGNLSFGWVRQILQKKVSVVSVAEITFDTSVYSQLPGQEAFMRAQTTTVLEKYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion
molecule keywords Integrin alpha-X
publication title Structure of an integrin with an alphaI domain, complement receptor type 4.
pubmed doi rcsb
source organism Homo sapiens
total genus 120
structure length 884
sequence length 1082
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-10-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00092 VWA von Willebrand factor type A domain
A PF01839 FG-GAP FG-GAP repeat
A PF08441 Integrin_alpha2 Integrin alpha
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1460 Mainly Beta Sandwich Immunoglobulin-like Integrin domains. Chain A, domain 2 3k72A02
2.60.40.1510 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 3 3k72A03
2.60.40.1530 Mainly Beta Sandwich Immunoglobulin-like ntegrin, alpha v. Chain A, domain 4 3k72A04
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 3k72A01
4Z7QA 5E6SB 3VI4A 3ZE0B 3NIGA 4NENB 3ZDXA 2VDQA 3FCSB 4UM8B 3T3MA 3ZE2A 4MMYA 3ZDZA 5E6UB 3ZE1A 2VDKB 4WK0B 1TYEA 4WK4A 3IJEA 4UM9B 1L5GA 4G1EB 1M1XA 3V4PA 3K6SA 2VDLB 4Z7OA 2VDRA 4G1MA 3T3PA 5E6SA 2VDMA 4IRZA 3ZE0A 4WJKB 1JV2B 3FCUA 5E6UA 5E6RB 2VDOB 2VDPB 2VDKA 4WK2A 2VDNB 5ES4B 3NIDB 4MMZB 4NEHB 4O02B 3V4VB 2VDLA 3VI3B 5HDBB 4MMXB 4Z7QB 3VI4B 2VC2B 4WJKA 4Z7NB 4NENA 2VDQB 4UM9D 3FCSA 3ZE2B 5E6RA 4UM8A 2VDOA 3ZDZB 1U8CB 2VDNA 3K72B 3NIDA 4WK0A 4O02A 4UM9A 3NIFB 1L5GB 4G1EA 2P26A 5FFOA 5HDBA 2VDRB 3ZDYB 4G1MB 3T3PB 3K71B 4MMXA 2VDMB 2VC2A 4Z7NA 5FFGA 3FCUB 1JV2A 3NIGB 3ZDXB 1U8CA 3T3MB 4MMYB 2VDPA 4WK2B 3K72A 3ZE1B 1TYEB 4MMZA 4WK4B 3NIFA 3V4VA 3IJEB 1M1XB 3V4PB 3K6SB 3ZDYA 3VI3A 3K71A 4Z7OB 4JX0A
chains in the Genus database with same CATH superfamily
4EBQL 5FUCC 1URIA 2X89A 4B5ZA 1P7QB 3VXMA 1BPLB 2FEDC 5DMGD 4BKTC 2X3AA 3LPPA 4I2XA 4A7SA 4D0CB 2B7DT 3PJSB 1CFNB 3RWFA 5GZOC 2AERT 3C08H 5FM8A 4OZGB 1XD1A 5EOTA 3QW9A 1MN4A 3O4JA 1EH9A 3FO2B 1SLXA 5D7LA 1F4WH 4GXFA 4LIQE 5CHNB 4LU5L 4N8VG 5B21A 5CBAB 1BYNA 1A6ZA 5C2WB 4JHPC 1Q9KA 1C9LA 1A21A 1UB6B 5B1AB 3V2AR 5KBPA 3SEPA 3V5KB 4IRSD 4CA4A 2CO2A 3OKMB 3QJUB 2AITA 1KPRA 2ZYSA 4M7LT 4NQVA 4DGYL 2HFTA 1F0LA 5F7HA 3UBXI 1PCSA 3FULA 4I9WD 5DT1H 5SX4H 3LNIA 5BZDB 3K74B 4ZPTB 1JMXA 2R9HC 1H15A 3JV6B 3VXRA 2EC8A 4EDWL 4LVHB 4I7ZC 4XEIC 2R2EA 4XVJL 3TF7C 2HG0A 1EGJL 5I15L 4LRNH 3U6XA 1T83A 1YEGH 1RUMH 2HXCA 1IEHA 1MCFA 3BAKA 4QLRA 3REWA 4A7VA 5KN5A 4F7EA 3APNA 5DO2C 4D8PB 2G4EA 1JRHI 1KULA 2AP2A 3N2JA 1YEHH 4KUZH 5DU7A 2VISB 2FSEB 2QMKA 1W8EA 4LP4A 5K1NA 3RL2A 2ZOKB 3C60B 4XX1G 1NCWL 4CUCA 5CFHA 2KH2B 3IMWA 4X8XA 5AYUL 1IZKA 2YRBA 3HNVH 3GK8H 5KUKA 2Q7QA 1KPUA 3C6EA 3LPWA 4HWBL 4XGZB 5E4EC 4MBOA 2BXZA 5C3LD 3KJ4C 5FYJE 3NIFF 5FLVA 5DI8A 4N2EA 3SQOH 5DGRA 1UCBH 1EA9C 2ADFH 4R7DB 2J4WL 4FYTA 5LDSA 1A6TB 2WINB 4WUUB 5C08B 1IL1A 1ETJA 3GRGA 3RWIA 2WPGA 2TRYA 4G8AC 3GSOB 2ZXBA 3HNTL 2RQ8A 3OKEA 4LOUC 1XIWB 3BAEL 4X8JA 5EIVA 1GZHA 2CR0A 2QDVA 4YE4L 2E8ZA 1A1OA 4Y0GA 3DX2A 3G5XB 3CWGA 1K85A 3EIFA 3CU7A 1XGPA 3FQWB 5BS0E 2J88L 4JSVC 1T3FA 2LR4A 3A23A 4HIHA 2N7SA 3ILEA 1A0QL 1ILSA 1MWAH 1AYOA 5DK0B 4JY5L 3DROB 3GYRA 4OI7A 3IAQA 4F24A 1FGVL 4OLWH 4W9DC 5GJTH 3CSFA 1GW0A 3D2TA 4PY7A 1J5CA 4I9WE 2CIKB 4ZO7A 5KTEL 4B9PA 2FEDD 5E94A 3ZE1E 4JG1L 1X7TA 3CZFA 2C9SA 3S96A 4OLZH 3NIGA 4FAND 1QLEB 2EP6A 4H26A 2IADA 3MNMA 2E9GA 1E30A 2ED6A 3O3BA 4DK6A 1EAQA 4L23A 3WFZA 5KW9L 3VE0A 2HVJA 3QEQB 4FQXA 1TTCA 1TJXA 2MWCA 5GZND 4NRZB 3BN9C 1PQZB 1QNZH 4N1HB 4CDGC 2BIOA 5I75B 4KI1A 2C3WA 2E59A 2DM3A 2QQLH 3KS0H 1GHFL 4PS4L 1NFIB 5BV7L 1WRFA 2C1PB 4MAZA 5FYJU 2R39A 1PD0A 2TAAA 2L7UA 2OJEA 4JFZL 4Z3EA 5DUPH 2CUHA 4U1KA 1B0RB 4Q2ZA 3K6OA 5FCUH 3UTQB 3KPNA 1DDHB 4GI9A 4Q6KA 1DFBL 5KVDL 4GKZA 4RRPA 1JGEB 2Y5TA 2C7UA 1MHPL 4PLNC 3VFWA 4GQBB 4UZUA 4RBPK 4GM9A 5IVXE 3V8CA 2P8LB 2DWSA 3BH8B 2FGWL 4IU2B 3VI4F 2GQHA 1AGBB 5BVJA 1UVQB 3EW3B 3HPLB 4DCQA 1JNJA 4WJKA 1HHIB 4KVPA 1X6LA 4M61A 4L8SC 4OR1A 3MBEB 1BV8A 3ECBB 4RAUA 4OGXH 5ITBH 4ZMQA 2FLRT 3IMVA 3ISYA 1FL3B 1I85C 4LDEB 4NZUL 4PJBA 4ANWA 2X4NB 4BFIA 4FB1D 3O3UN 2EH8H 3HB3C 1PLCA 3KYOB 4GQ9H 1R34A 1L9TA 1A1MA 4PRPA 3ISWA 5E1QA 1AACA 2XN0A 3UZQA 5FUCE 3REVB 4PSRA 4U0RB 4N5ED 2FWOB 1BZ9B 1NSNH 3D9AL 3HE6C 5HPMB 4KMTL 4FJYA 2B0SH 5CN2A 3ARDD 1YEKL 4JANB 2QSQA 1K8IB 4ILDA 4FA7B 5EOCH 2NSMA 2WLMA 4AOWA 3HOGA 4AMXA 4L3EA 2XACC 2CBTA 1YEIH 1CGTA 2Z3FA 4UM9D 4ZOCA 5IHZB 1MFUA 3HRZA 2RMNA 3GC3A 3CV5A 2FO4A 2M8XA 4ZTPL 5HSFA 4QYAA 3TZVC 1A5FH 4N5UA 4K94C 2BJML 4UTCA 2Z1PA 4OCWL 1NAML 3VXUB 4ZODA 1T7ZA 5EZJA 3ALWA 5FKPB 3GSUB 3KM2A 3VUAA 3IUQA 4LKCB 4ZFZB 1U0QA 2HRPH 2YD8A 4NENB 4OZGF 3SYOA 1H19A 2ADJA 2V9QA 3L17A 3NCMA 5D5MA 4Y9EA 1SQ9A 5T1KB 4F2FA 1INDH 3RVXD 2WLNA 4IIZA 1J7VR 1IBDA 4AEHH 4KTEL 3UJTL 4OAWA 4NM4L 4L8BA 4N8CL 1BQUA 2HTKD 5GRWA 4OV6F 2ZKHH 4LPYA 3RLMD 1GJUA 1SOSA 1XTMA 4HFUL 4Q0XL 3ROLA 1QEXA 2BVQA 4RMVA 3WI9A 1HNFA 2EIZB 3FU5A 3R8QA 3ZZSA 1M6OB 4RE5A 5K39A 4J6RH 3I7PA 4CI3A 2VDNH 1SFHA 3KM1A 1U21A 3UBXB 1ONQA 1UASA 4BZ1L 4F7TB 2Y6SD 3O6FA 5AW8B 3GHEL 2I60H 4HMCA 3S3PA 3G5VB 2G75A 1U92B 2ZXAA 2OSXA 4YSEA 2VDPB 2D7TH 3ZKMD 1NPUA 5JQIB 3DOSA 3CPLA 2KYIA 1RSYA 3RDTB 3H53A 3PSLA 3VD1A 4UTBL 3ULSB 3DVGA 1IRAY 3FB8B 4BQ6A 3DK0A 3P9LB 5HE1B 5HDRA 3V5DA 4L1HA 4L9DA 4WW2F 2EACA 2NY2B 4HK3N 5EBLB 4EI5C 2P9SC 1MCKA 1NCUA 1WFNA 2VMFA 3BAIA 3TPKA 5MERA 1LLAA 2V5RA 1WA2X 3K6DA 4EUPB 4NNPL 3W11D 4R7VA 1CFBA 2VLMD 2XZZA 5T3ZD 4IW4C 4JHWL 2Y4SA 4F37K 4JCMA 2ITFA 1TQSA 4M8QA 1A6WH 2UWEA 4KI5F 4A7UA 1VERA 2VE6A 4Y4KD 1XO8A 4AQ8C 1N18A 1HINL 1I82A 5LQBH 2KDYA 1I7TB 1FZKA 4MNQD 4XXDA 1Q1JH 3CK0L 4UDTB 3OKYB 1N0XH 4PGDB 4CVXB 1N10A 3SDAC 4AX3A 2IAMB 4EVNA 3K2IA 4JFDA 5E2TL 4OJDH 4JGMA 4BQ8A 5HBBA 4DGVH 1JGUH 3KRXB 1EHAA 5GRJL 3M8OH 1EBAA 4L9LA 1YVLA 5EDSA 3AL9A 1INQA 1UT9A 3QUXA 5DJ2B 2BSSA 3QI9B 4JN1L 4X6CE 2BIPA 1CL7H 1J88A 3TZVD 3UPRA 4PBVC 4UQDA 4U1GB 1U30A 4UQIM 4WFGD 2OV0A 2V5TA 5D6CB 3OPZH 3VACA 1MDAH 3PGDB 2ZAIA 3L7EB 2W60B 4KBPA 3ZDYA 4K5OA 3ESOA 2OSLB 4XXCA 2IOOA 4XP9L 3TNMA 5E6SB 2DRUA 4IBYA 3D30A 3T1FA 4K3HA 3V6OC 4UV7H 2HU7A 2CJUH 3E3QC 5B39A 1OVZA 2J1XA 4BZ2H 4JN2A 4ZJ9A 4TNEA 1XCTB 1KZQA 4QHMB 3APDA 5AW5B 1EHLL 4ZXBC 4XVTL 5I6MA 4YC2C 4JL2A 4P2RB 2EDYA 4YFEA 5L2KD 2JKXA 4UT9L 3V4PA 1UD2A 1WF5A 1AG6A 4KQ4H 4XB3A 1OZTG 4XP4H 2VDRA 3AWGA 4WO4C 3QORD 5IJVA 1KDJA 1V55B 1SBSH 3LKQB 3AM8A 2FSDA 4LSUL 3SIKA 4WF7A 5EU4B 5T3ZE 2WWKT 1YN6A 1MNUL 4PJDE 3S2CA 3NTCH 5DRXA 5AOZA 1GIGL 2WVSA 4JE0A 5F71A 1OSZB 4JG0H 5HE0B 4DQOL 4ODBD 3RFZB 4BCYA 1RUQH 4R5XA 4JXMA 4KK6C 3ZW3A 1Z5LA 5HHOE 4LOFA 5IW1B 1FUNA 2B3RA 1NGPL 4NAQA 2YOCA 4I85A 4L0ZA 1GGTA 4HHWA 4MZRA 1XF4A 2BP5M 1I9IH 4IGBC 4WHTB 5D2NC 2ADIA 2QGBA 3ARRA 3L5XL 4AKQA 4ZOYA 5E2JA 5I28A 1MG2C 2ZSVA 2E6JA 3DNKA 4LSVH 3MJ8B 2Y06H 4NWTH 3CHPA 2UZYA 1A4AA 3LHPL 5E00B 3U4AA 3IDUA 1Q4NX 4IHBA 3L3KA 3BZFA 1U8OB 3HUJA 2HWZH 3L5JA 1XF2B 1MCPL 4AL8L 2F1AA 3O8XA 4JGNA 4WFGE 4Z8LA 2BC4B 1ZLUH 1G9HA 5HYIA 2G2RA 1KSRA 2X4RA 4AQ1B 2QMJA 2DPKA 2XI9A 4U1HB 3ZE2E 3SKOA 3T3PB 1MCSA 1WAEA 1M2VB 5C3TA 3UIYA 2EDRA 1NUFA 3IBEA 4MZ2A 2AK4B 2DICA 1LEKA 2XPZA 5F7EH 1NGWA 4N9GA 3L2NA 4QRTB 4ENZA 3FT1A 5DHEA 3SPCA 2A0LC 1AFVH 2BHZA 4MCMA 1JGVH 5HHNB 2LABA 4XVSH 1QBBA 2AGLA 3EGDA 1VKXA 4PTUA 1DO5A 1KBBA 2F54D 2R0WH 4NCDA 1F02I 5CCKH 5HHMD 5BS0A 5C0JA 1A9BB 1AO7B 1PEVA 5IUSA 4XAWH 1QABA 2MNUA 4AC2A 1OAZL 1X5GA 3F62A 3GRWL 3GJFA 3L1EA 4OM1L 2NQCA 4B9CA 3WUZA 4ZSOE 1QYGL 3HG5A 4P23C 1TENA 1ADQA 3SDXB 1I7UA 4EI0A 4UM8B 5D2LA 4JY4B 4JVPA 5K33A 4CILA 3N0AA 2D2CC 4UNIA 5IEKB 1RK0B 3ZE1A 1S7RB 2GJJA 2BFVL 1AKPA 1L7TL 3MQIA 3ES6B 2I24N 2RGSA 3C08L 1G43A 3ZR6A 4XI5C 3DXMC 4WO4D 1M1XA 4PBWD 3GLAA 1XCQB 5IB3A 4QQEA 2QQKL 3VRJA 3UTTA 4U7SA 1FBIL 4LLDB 3B8SA 1E2WA 1VFUA 4PJAA 1OW0A 1U3NA 3VG0L 1I1YA 5H2BA 4ECNA 5K93A 2FT6A 5FS5A 3DC0A 3WN5B 4X4YA 4U7AA 5C0IB 4RRPG 2H47A 4QIRA 2KQMA 3JTSB 4GP8B 4OZFB 2NYKA 4LEOA 4PSPA 2Z65C 1ACZA 3QS2A 2F5BL 3EUDA 4KWUA 4X9HA 3LRHA 4Z3GA 2IWKA 4PYGA 1QR1A 2P46B 5KYWA 2NY5H 3EGXB 3NSXA 1UACL 5LCVA 1U2HA 3NESA 1E6OH 1EEYA 4KK6D 3BC9A 3QPXL 3WOVA 3MO1A 1WVZA 4Q74A 2A9NH 2ZX5A 4JG5A 5FO8A 1BPOA 1B6UA 5DJYB 2FX9L 1CD1B 1GGCL 1RUML 4HK3J 3S37L 4JFFA 3QEUB 3UO1H 4JGUA 3C8KA 1F3DH 1N3NB 2GSIA 2OMUB 1YHPA 2FECL 1FFNA 5F1NA 2DQCL 2A9CA 4N2IA 3V7AG 1JDAA 4APXA 1H2WA 2PM7B 5LNGA 1T6VN 3FUDA 2KC0A 1AHMA 2N7BA 3MODH 3DX9B 3JYBA 4NXSA 4WEUD 3KYNA 4DEPC 2GAZB 2UZPA 2F54E 3DVFA 4AQAA 2NCMA 3A21A 3HNVL 2GITA 2ZYIA 3KXFD 4AYGA 2NLJA 4FFYL 1GGBL 4NBMA 5KOMC 2HP4A 3PHAA 4PCTA 2WZAA 3S3JA 3SQOL 3V6OE 4JDZA 4XPFH 1P4LB 2DOCA 3NCEB 3CGTA 4Q9RL 5A6LA 4XMKH 5JQ6H 1D6EB 4FTDA 2VIRB 2VDQL 3MUOA 1U8KB 3NEOA 5INDB 3BCFA 2GABA 2XV6B 5D7JB 4QRSA 4CW1A 1YY9D 3BVVA 3EO1A 3CU1A 4RX4D 1C1EL 2EE3A 2CIIA 4OUUB 4GFXA 5AZ2H 1OKEA 5GZOA 1C08A 1MFBH 4H88H 2Z91A 43C9B 2NSQA 1I8AA 1JWSB 3MNWA 3GSNA 1AGEA 3TT3H 2EXWC 4DETA 2NY6D 4BCXA 4G42B 3KEDA 5E1IA 2O5YL 2WUCH 4KDVA 3PPSA 3HC4L 3CVHA 1ZAGA 3RTQB 2EDDA 3C5SA 4UAHA 4WJ5B 3I2CH 2WUBH 5C0FA 1K3ZA 4PJIA 3ZY7A 1R3HB 4EOWL 2VH5L 2VL5A 3D05A 3GXIA 2FK9A 2ZKXA 3D09A 1OGAE 3AACA 1AG0A 1K9TA 3V4UH 3L1FA 5KBLA 5TTRA 1VADA 3QJHA 5GHWH 3N42B 3JV5A 3T0VA 1E0OB 3AU1B 5D2NE 4GGAA 3RN1D 1F2QA 4DZ8A 3QHZL 4G9DB 2PP7A 5AAPA 1E9OB 2L7JA 2Y22A 3RVUD 1ETA1 3HPJB 3NCJL 4JRFA 2QHRH 2QQLL 3PDDA 4MQTB 2A6JA 4P5KB 2DF3A 2QEJA 4XWGL 4LLUB 5DZJA 4QRPB 1QPPA 1HC1A 3OHXB 4KTGA 3N40P 3VFPA 2R4SL 3S88L 3EFOB 1T1WA 3BLPX 2V7HB 4Z7WB 4M93B 1X3DA 1U8MB 1BJ8A 5H35B 3O4LB 1T04A 4K5NA 4U0QB 1SRDA 3NABL 1JZ6A 3ESMA 4WEEA 2WTRB 3FU7B 1Z9NA 3ULAB 2QGCA 5TE6L 4K3EH 4QO1A 3KLAA 5HI5C 3OKTA 3IAPA 1YNTB 1F2XK 2Z8SA 4UI9R 1L6ZA 1A4KB 4AE1A 1PZBA 3BXNA 3QO1B 4HKBB 4ZMZA 1UYWL 2WJ5A 1I7RB 1S9XB 5FGCB 1FVDB 1MCIA 3DX8B 2P5ED 4FA6A 4LFHD 4MZ3A 3RA7L 5ITBL 5IQMA 4OGXL 3T3PF 2OMZA 4MCYB 2ROYA 3TN0B 1QA9B 4PD4J 5IEHB 1FI8C 4R96A 4MYWB 1IVTA 3KPTA 3DIFB 4LVHC 1BZ8A 1E4KC 2YK1L 3GMPB 2BIQA 1DUYA 2X9ZA 1MCHA 1TTRA 5AKVA 2BM3A 1EXUB 3NIFE 5EZIL 1D5MA 5CP7B 4HPYH 3NZHL 2OCCB 1SM3L 3FT2B 4R7NA 5EBWA 4E0RA 4DAGH 4PJGB 3TT1L 4P3DA 3GKWH 2NNAA 3LQZA 4OM0L 1PF3A 3JWDC 4B9KC 2EXWD 4U1MA 1KG0A 1NC4D 4IM8A 1KLGA 4XCYB 3PABA 4QRAA 5D7KE 3ARGB 2PXYB 2OMVB 1V27A 1QMUA 4GO8A 1QPKA 4IBZA 1L0XA 5BUAA 1QSVA 4X6CA 1UUNA 4JZNA 1MCWM 2A9DA 2X42A 1YYLL 4QGYA 4UI2A 4UMSA 3C60C 1ND0A 5AVXB 4QXUH 5AVYB 3SDXF 2Z31B 1DQTA 1F4AA 3KS0J 4U2YA 1E28B 4LCWE 4AEFA 2Z2NA 4KI5C 4ELDA 1PZ5B 1TZHB 2H32B 3R7QA 5J1TC 3GMLA 3Q2VA 1HQRA 3IM1A 1KGCD 2AJ3B 2QADB 3IWUA 2ZG1A 4GW4A 3X13A 4C59B 3BT2H 3MLZH 3MDJA 3WKPA 1INDL 3V0GA 4K3JH 1K8KC 3GGWA 1XIWC 2BSTA 1F45A 1ED3B 3PIQA 4R26H 2ZKHL 4KKCD 1FN4B 1WCBA 1PLBA 4JFVA 3OMZA 1BAGA 3RU8L 2FR4B 5BXFA 5C09B 1E67A 5FKQA 5AW2B 2WJ7A 5CWSB 4PNKB 4HUWA 4J6RL 3U0WH 4L8SA 4K07A 3BGFC 2P5EE 2ZD0A 3CJJA 4MRBA 3IDMB 5LXGL 2LAAA 3ATDA 1VE7A 2XPGB 1I85A 1RJLB 3CZGA 1FA4A 4XCNB 2F19L 2GTZB 5FLUA 5F0JB 3LPOA 4H8UA 1I1FB 3MI6A 3MV9B 2BCKB 4XZUB 2P9NC 1MXDA 4K8RC 3U7WH 4FQCH 1WSST 1HSAA 2AEWA 3FRPA 3L3JB 3PWLB 3TIDA 5HI5D 3CE1A 1QLRA 4HJJH 3W9EA 3IDYC 1M6UA 3HE6A 4MB4A 4QRRD 5I24A 1XXFC 2X4QB 5HHOA 4UQAA 1IJNA 2YFOA 4Q4IA 3TBYA 3K2UH 3LQMA 4JKLA 4PIBA 4NC1C 2QPEB 2CO6A 2XYIA 3TPUA 3TEUA 2L0DA 4GXVL 3DBXA 3VI4E 3MV11 4IBTA 3N55A 1C8PA 3F7LA 2WLLB 1KLUB 2A1WH 4I48A 1XB6A 1TVBB 2YUVA 3INOA 4J3VA 2H26A 2MHAA 3TZVA 3VTMA 3LH9A 1T21B 4DNWA 3US1A 32C2B 4WTQA 3EG9A 1F13A 1Q1JL 5ICZA 4PHXA 4OJCA 3ZT5A 4LLYA 4MJID 3TWYA 4H8WH 4K3GA 1A3ZA 1OWRM 4LO9A 1DQQB 1LNUB 5A2FA 2AQQA 4Z76B 2BWQA 4BWUA 4TQEL 1MELA 4WK2B 4FXGB 3V4PH 1KGCE 2CLZA 4LIQH 4P4KB 2VDRH 4S1QH 5EC2B 4NKQB 4OGYH 3U4BL 3LX9A 1WFMA 1J1XL 1GKOA 3DSFH 4NQXB 4YXHH 5I6XB 3NVXA 4J82A 2YMUA 2FEEI 1MCNA 1BD2B 1NA8A 2FQFA 3HZVA 3IU3B 3C60D 3N44B 2ZOWA 3DHPA 1KXTA 4NZTL 1A6UH 5F7FA 3BQUD 4BQCA 1YAIA 3D85A 3L2MA 4LCVA 4OSUH 2D7PA 2YJQA 3MBEC 1WBZA 1HXYB 3RMZD 1OIOA 2PPDA 3AITA 3ZE0B 1HEHC 1HSBA 1NQBA 4NFCA 3SY0B 4AUUA 5I8CA 1SDDB 3DETD 3HZYA 1ORQB 1QD0A 4HHGA 3B2VH 2XZAH 4IMKC 5GRVK 4QHLB 4UV7L 5EWIL 1YZZA 2VM4A 3JZGA 4ZSOA 2BHYA 3VQMA 4IMMA 3ULVC 5L4FA 1MRDH 1A65A 3PXJA 4U0RC 5HGGS 4UT7L 4ZX5A 4Z6AT 1BZQK 5KS9B 1XIWD 2B2XL 4NKOA 3RY6C 4NUPA 4ADIA 2V2WB 43CAB 2P24B 4AMKH 5EU6D 1I3VA 2F74A 5AEAA 1I1AD 2CZNA 3L3OB 4OZGE 1ZRUA 1K3IA 1Q0YH 1P1ZB 1S4UX 1IAIL 4EI5A 4OJYA 3RIAK 1M57B 3BH9B 2AJVL 3D3VB 1T0MA 1V7MH 2NXZB 2X4PA 3MGTB 4JPSA 2XPYA 3ARUA 5CJOL 3VNZA 3KZ8A 1ECZA 2CCLA 2RALA 1KCUH 4A2FA 1GTFA 5FYJH 1FL5B 3CXHK 4N6QA 5I1DA 3QI0A 1WUNT 1PL3A 5F8QC 4Z7WF 2DQIL 4AQ8A 4MS8C 4K8RD 5H14A 1X9RA 5FM5M 1KB5L 3W9DB 1M7IA 1MW1A 1HI6A 1UT2A 2D7MA 2HJKA 5CU9A 2G3MA 1LO0L 3SDAA 1YNTF 1IT9H 1RUQL 1UD4A 2AHIA 4AXWA 2HFGH 1RJZA 4W70A 1DUZB 3MRNB 4HT1L 1KOAA 4MNGB 3RWDB 3QEQD 2IGFH 3LS5H 1KEML 4JZJB 2XWJA 3GSWA 4ODUA 3VGEA 4NQUA 3DM0A 1F1GA 3K8LA 4FGMA 1UA6H 3RZCD 1SEQH 1NBQA 3P40A 4U6VL 1G0XA 1I7ZA 3GJFH 4TRPL 1KTCA 2XXCB 5FYKL 4YXLL 4GKSB 2ZNWA 4JLRA 3KGUA 2EADA 4XR8C 1ADQH 3VH8B 3PGCB 3L4WA 1LO5A 4CZYA 1RJYB 3UG4A 2GJZA 2F54A 1CYWA 2O30A 4YFLF 4KI5E 1YLBB 4HP5A 5GRUH 1VYHC 3FOMA 4PJGF 5IW3A 2JMRA 3GPSA 5ID0A 2X6VA 3V6OA 4JPQA 2WSKA 2I26N 4WUUE 5C08E 5ICYB 4P9HH 1JHLH 3EI3A 5I30H 5H17A 1RUAL 1OGTB 5EZLA 5MEPB 5K69A 3BFWA 4M6NL 1FGNH 3CFVA 2IG2H 4C54A 2VXUH 5F7EL 3RPIA 2NY2C 2K9UA 1HXMB 4YBHA 2CMRL 3SPVB 1W0VB 1A6PA 5MEND 1LL1A 4KV5F 4YHMH 1P4BH 4E9YA 4HDJA 4ZXBA 4Y2LA 3NJKA 2Q1EA 5DZVA 3I3EA 2YD7A 3MRIB 5DFWH 3ZYOA 1NZRA 2R0WL 4WO4A 5FGBC 3WN6A 1JERA 5HJDA 1BBDL 2HMIC 5I76A 1DSFL 5E5RB 1T2JA 3UP1A 5LCVH 1D2PA 2BY1A 4S2SB 4XAWL 3S8GB 4FE9A 4S1SL 2V2XA 3ESVF 1PNDA 5JR1L 3MLPA 2COVD 3V0HA 3QGVA 2HVBA 1DSYA 1NL0L 4OIIL 3WEBA 1CFQA 2QZ5A 3H7LA 3HR5A 3PWNB 2IAMC 3BLBA 5ETUB 1ETB1 2Y0SA 3JTBA 2DD8H 5B1BB 4B9FA 1N2RB 1E3ZA 5LXVA 1CF8H 2FJUB 1I4FA 4ZW7A 2DLEA 1TTBA 3SBQA 1OGAA 4K3ID 1MAML 2Y07L 1Z7JA 2J1ZA 2IQ9L 5IHUH 1BREA 1DO6A 3QI9C 4TLTA 3QEQE 2YAMA 4IGBA 3SO3B 5D2NA 4NO3B 4YGVB 5FWQA 1UZ6F 4XN5A 4AV5A 3BYYA 3DTXA 5K9OA 1N5AA 1MG2A 3Q6FA 2JKTM 3UVNA 4U1GC 5DEFA 3MV8D 3ZT6A 1CCZA 4BM7A 5JLZA 2H6NA 5C0CA 1JIBA 1I3GH 1I9RH 4MS8D 4RMRA 1F97A 2XZCH 3BRFA 1EXHA 3QCTL 4JUSA 3EJYC 1S5IH 1B90A 3U6RA 1XT5A 3KNBB 4ZX3A 3RB5A 2WZ0A 3CBRA 2EECA 2JF1A 3ZWLB 3P0VL 4KRMB 4L29A 4R0LB 3KRWB 2QKIB 5T1KD 1A25A 1ZXKA 1RZKL 1C16B 3VCLA 1TTAA 3I74A 4D9QD 3GSNH 5J6GA 3TYFA 5DZPA 5K1VA 4QOKA 2BMKA 4LNRA 1THCA 3WFDH 3QNXA 1OXYA 2P7TA 4ZDHA 5A7BA 4Y1SA 3T4YA 3MRKB 1CQYA 5AKTA 3CVHH 3FQUA 1X7QB 1PEZA 4B96A 1TJHH 3AB0C 1G7PB 1E5YA 1TU2A 1QZ1A 1MY7A 5E8DH 1U8NA 2ZXQA 1IAKB 1BGXL 3POCA 4LK4A 4RISH 5IBUG 2JWYA 4KTDH 4HPOH 4LKXB 3RDTD 1BQHB 4GLRH 3K2MC 1JV2A 2J21A 2R1XB 1NIDA 4WVRA 3I02A 5HGAB 3EDJA 4I1NB 1V3KA 1MIMH 4P23A 3RFZC 4G82A 1TITA 2VUOA 1I8LC 3WKNA 1RIHH 5KBDA 2PF6A 1Q9WB 2COQA 3GB7A 5HHVL 4DPRA 5ILTH 3NIFA 3BKML 4JFXA 4PRBB 3UTSB 2G9HB 2OI9B 3N44F 5I9QB 4UYQA 2VKWA 2VLJB 1EXGA 3MJ7A 2FJGA 3OVUB 4LVEA 4CZVA 1UWYA 3IKKA 4GXUM 5CZXC 2O4EA 1MCOL 2WBWB 1ZK5A 5DGQA 4QXGL 5B1CA 3ZE0F 3MFFB 4U1JB 4HMDA 3HI1B 1Q9OB 1RULL 2X0UA 1RCYA 4H7VA 4KAQH 5IJDC 4YPGA 3UVLA 4P59L 1WFTA 5IB4B 2EDBA 4RDQG 5I71B 3RWEA 2AZAA 3I6GA 2Q76B 3NACL 3G08B 4XOEA 3UGXA 1YEEH 4LCWA 3VXUE 4AQ1C 5KS9F 1S7UA 3HG4A 2X3CA 3MLVH 2VZUA 4JSNC 4TNVF 2V6HA 2XWTB 4L1DA 3FTGA 3KPRD 3WIIL 5IF0A 4X60B 2MOQA 3JRPA 4FNPA 2D0GA 1AP2A 3FQXB 2DWXA 2Z92B 1DVFB 4OLYL 3R18A 3SGEI 3A24A 4XNBA 3NJVA 1B0IA 2MPAH 4IRJC 3IURA 3HG1B 5DQDL 1WEJH 3BP5A 1XEDA 4HBCL 5LAXB 2FWLB 2JKLA 4G6ML 1A2YA 4ABVA 2AV7A 5E24E 1AD9B 2DMBA 3NRFA 4QT8A 3LYRA 2RBLA 3PWPB 5KYYB 4D9SA 3HE7A 1XH3B 5A2IH 2YRZA 4WWID 5J1AA 4IK7A 3FRPG 4UINL 1BG1A 3WD5L 2VLKB 2YGNA 5CD3A 2DQHH 3RI5K 4B97A 2P5EA 5E2VH 3QCUH 1ZOXA 3VVWA 1BZ7A 3HJEA 2FQGA 4JCWA 4IDJH 5C0DA 5BW7C 4WENB 5KYXB 4M62L 5EMLB 2J5LB 3MVDK 3OLEA 4HKJA 1I9JL 4NAMA 4NDMA 5F9DC 2UX7A 5GS0L 1Q9LA 4ONOA 2R8SH 1MF2L 4P2RD 1Y07A 1GSKA 4P9ML 3WXVL 4CMHB 3FB5A 2TSAA 4KUCF 4ZMOA 1FAIH 3DVNB 4WI7A 3K1DA 2O6EA 1GPOL 1R6VA 5F88A 2NMSA 3NPSB 1DBBH 5AW1B 4OD3H 4E5ZA 2NQ3A 4BSJA 1X5HA 1BOGA 1G9MC 3MRMA 3MV7D 3BO8A 4MD5A 3TGXA 4YBLC 4Y16B 1DQVA 1U3HD 3VGGA 1A7PH 1YY8B 3IJYB 2ARWA 2Z8RA 1GC1C 3AREC 3M86A 3BDBA 5AOLA 1K8DB 2XA8L 4IK6A 4X7EC 4DN4H 2WVVB 5FFGA 4H4NA 5T5NG 4XPTL 2N4IA 3WGVB 2MTPA 3DHUA 1HYRC 1RJCA 3H9HB 5F7DA 4KXZH 5E9NA 1HCFX 4X98B 4HJ0D 4NO5A 2X1PA 4MLIA 1NBZA 2ZUUA 3BGAA 2VT0A 4HPYL 3UYRL 3D0AA 2PNDA 3BE1H 1RZJC 5CZXD 1E27A 4HCRL 1MVUB 4GOSA 1A7QH 1OARH 4CNIB 2H9GB 2QPDB 4QTFA 1CBVH 1SJEA 2IDFA 4K71C 1JNLH 2ZUVA 4DSYA 3T77B 5BV7B 1M1SA 4NO2B 4ZO6A 1RVFH 5T3ZH 3WNKA 4PH8A 5E51A 4F57H 4N3TA 3IVKB 2W80C 4PRIB 4F15B 3RB7A 1ZS8A 4LPVA 3S5LA 4ODXB 2N3JA 4QXUL 5DQJB 2VJ0A 3DO3A 1BAFH 4NHCL 1G0DA 3B2PA 4GM3A 2DQTH 3II2A 4YSSA 5DJDB 4HG4J 3T4AB 3TIEB 4F58L 2X4SB 3FT9A 5M95B 2B39A 4ZUUB 2AK4D 3KLSA 3STZA 3RWJB 1TZ8A 3ZTDC 2CDEB 4H25B 1U4CA 3EYQC 3BD3A 2OW6A 2HH0H 4HJSA 5G55A 2DY2A 2WIMA 3IUNA 3SDYL 1P7QA 4OD1H 4D0CA 4OFKA 3HFMH 1OSEA 1RHHB 2XVKA 3PJSA 1J9SA 1PAZA 3L4ZA 4FN0A 4P2RE 4DTGH 5B38B 4OZGA 4JO5A 3FO2A 5CHNA 2P5WB 5DMYA 3EU7A 1DTUA 3I75B 4JKMA 3RBSA 3TCTA 1AO7D 3DOHA 2DLIA 2EIMB 3I89A 4K94H 1UB6A 3UAJC 4DZBB 3JUYA 2F2HA 3V5KA 1M7UA 3FAXA 3U0WL 3ZRFC 3OKMA 1CFSA 1F11B 4S10A 3WLBB 1KUMA 5ICUA 3EFDL 5CZVL 2CHXA 5FUZL 4E9XA 4ZPTA 3T8XB 3JV6A 4H5IA 1OAQH 3TWCH 4BFOA 4L37B 2AQ1A 4ZMPA 3RLSA 5J6HA 2H9MA 1E4KA 2FATL 3GINA 4YSCA 3L4VA 5T8IA 5F93C 5TFSL 1PZUB 4DP8X 1LO4H 4HJJL 2N0MA 1QLFB 2D3JA 4R2GB 4WK0A 1CF1A 2UY7B 2ZAHA 1S9YB 2NY4B 2WO3B 2DTML 5E7BA 2YARA 3EJJX 3DWLC 1HWGB 5E99H 3BRDA 1JD9A 1EO8H 3MUGB 1NAMB 4F8PA 3O2WL 2ETWA 2FB4H 3JWOL 3M6DA 4WV1C 3P4LA 5AKSA 3RPBA 3TA3C 3V7MA 3C60A 4B9YA 3ERXA 1SYSA 4XNMB 1KC5L 1ZT1A 1OZUA 2J1KA 3B9KB 2DJMA 5IZ7A 1F4XL 3OHXC 2W9DH 4R3SA 5ENWB 4A09B 1BVLB 3ASOB 2C9RA 3T3PE 4BQ9A 4OIFA 1CGUA 2JKJA 1PVHA 4V1DA 2AXGB 3DX0A 1HILB 4H8WL 4M93C 4R7DA 3IJEB 2R2BB 5SWZA 4BE5A 5CXBA 1A6TA 2AK4E 2WINA 4NUJB 4KTYA 4WUUA 5C08A 5IQ7L 1JMZB 1BQ5A 4JB9H 5DA0B 4S1DC 5DRWB 2O93L 4X5PA 2VDRL 2DWDB 3HTLX 3WSQH 4E42B 3B9VA 1JHTB 4I18B 1E8MA 3GSOA 3C5MA 1N68A 5EO1B 1XIWA 3CC1A 5DS2A 2E8YA 3CDYA 4ZUTB 2A83B 3EJSA 2BSBA 1QI4A 3ARBB 5AVQB 4GKLA 4IKIA 3FCSB 5LBSA 3VGHA 3ZTJG 1NOLA 5I5JA 2OK4A 4PWGA 4IS6B 3FQWA 2D8KA 3O3EB 4YO0B 1JDDA 1AO7E 3U83A 5LVEA 3UBGA 4QWWC 4YDJB 3TN0C 2OTWA 3CZEA 5FV1L 5DK0A 4EEEA 3DROA 3SDXE 3VRLF 2WXNA 1F41A 2CIKA 5D7JD 5JIMA 1MZZA 3ZTEA 2FECI 1SOKA 1CICB 3T04D 2WMPB 1CYXA 1SY6L 2AI0H 1TTUA 3WL9B 5D1ZC 2YBAA 3QIWB 5A2CA 3ARGC 1U8QB 2PXYC 2L7EA 3FSOA 1I53A 3L3IB 3QEQA 1CGWA 2ZYRA 3ZKQD 1E8XA 3C12A 3LIZL 4NRZA 4P07A 1CZ8H 3IU4H 4JM4L 3RTQD 2Y9RT 4GKOA 5EBMB 3ETTA 2Z31C 1OL0A 3B2UD 5IHBA 1NFIA 3N1GC 1AE6H 1J11A 2C1PA 3BLKA 3L6FB 3IF1B 3O4GA 3FTZA 3GFUA 4ANXA 3NRPA 4GT0A 4HJ1A 4NXKA 4DT2A 3SE9H 2QADC 5CJ8A 3T6QC 1DDHA 3LRLA 5FA5B 1JGEA 5AWNH 3BT0A 2K3TA 3TBTB 2P8LA 3BH8A 3EJQA 4J3OF 3SCMD 1PI6A 1IBGL 1PJ9A 2F5AL 4ATTA 4H8HA 3GMNA 4CY3A 1SEQL 3LQAC 5JHMA 3HPLA 4HJUA 3BZ4B 4F93B 4ZD3H 2FQDA 3ZTJH 1HHIA 4X0NA 5DEZA 1QSEB 2NY1B 4B0MM 1ADQL 3TCXA 2J2ZB 3ECBA 2WWKO 3MBEA 3NK4A 4EXKA 1IZJA 1ZWIB 3MAWA 3U1SH 5EMMB 3LZNA 2VMEA 4PJHB 4H20H 1FL3A 4QJ4B 3BDYL 2CHDA 2X4NA 1VGEL 3G6JB 2DBJA 4IMKA 3F65A 3H3BC 3MHZA 4S1DD 4QJ3B 5PCYA 4APQB 4J5VA 4XNQB 4WHDA 2I9TB 4G6AC 4HUUB 2YGPA 4K23H 1JE6A 2GTWA 2FWOA 1E6JL 1BZ9A 4HS8H 2IG2L 3RY6A 3VFRB 4XCFH 4BKLB 5HPMA 1JZ3A 1EAPA 1F1DA 4IJ3C 1D7DA 2YMTA 3CHQA 2QJDA 5I8OL 4HFWA 3O45B 3VXSB 4JANA 1JPFB 1X9LA 2HVKA 4LAQH 1K8IA 3EDKA 3P9WB 1KYDA 4N20A 3SY6A 4WFED 1YNLH 4ELMA 3E0CA 1NCOA 2UUDH 2K1MA 2Y1VA 3TN0D 4AJWA 5DLLA 1HEZA 3LH2H 5IHZA 4IQHA 4Z3TA 2LU4A 2ATKB 4XN8A 5CU5A 2CN3A 4AEIH 4HIIA 1DZBA 1GZPB 2O5ZL 3A0OA 4KITB 1QKZH 1HK6A 3L9EA 3AG4B 3VXUA 4F2MB 3W39B 3ZKNC 3ZYZA 3GSUA 5E2WH 3MLXL 4L2YA 3OSVA 5D72H 4LKCA 4ZFZA 2P8MB 4W93A 2XX1A 1KYFA 1OAKH 4P4KC 3VH0A 5T1KA 1AVAA 3G6DH 4RESB 1U41A 1OP3K 5I6XC 4R9HA 4MXWH 3OQRA 2WKOF 1GTNA 4PLKC 5AALA 3EOTL 4YDMA 2QR5A 5DWUL 2AVGA 3EYSL 3TO4B 4YH6A 5GGVY 4PRHB 1H2ZA 5F70A 2I27N 3L3DB 3K6IA 1W0WB 4DPAX 3KR3L 2EIZA 2EUWA 3AC0A 1E8WA 1M6OA 2R0ZL 1EVTC 3GIZL 3MLUH 4GRMB 1IGFH 2Z9TA 3S35H 5KYUB 3TS8A 3GMQB 4AWJC 1UB5A 1XL6A 2H3XC 4QRPE 2BY0A 2NX5B 4F7TA 5I8EB 1YEJH 4GRLB 5TPWL 4L2LA 3U25A 4YSOA 1U92A 1MFVA 3LNHA 1XR8B 4Z7WE 4LESA 4XBGA 5M61A 3HRPA 3GO1H 3OKDB 4TVSa 3O4LE 4P4RB 3ULSA 3ZKXC 5JXEC 1IC7H 3ZIYA 1KF9B 4BA8A 3V9CA 2Y1AA 5IK3B 2K45A 5EBLA 5C09D 4D2NA 4M48L 4MSWB 4AENB 3FO1B 1E9PB 5CMAB 5AB1A 3EZJB 4EUPA 3EHBD 3F5WB 4Z8FH 5FGCE 5DHMC 3L3GB 3WMPA 1BMGA 1ZEAH 3EH3B 1DVSA 1T5KA 5FGBA 3U2JA 4KK8C 4WFEE 3MOQA 3DHMA 3J81g 1KTKE 5CD5D 2FJSA 4RISL 1B9XA 5IBLC 3WAKA 4L3CA 5I1JH 3F01A 4G5ZL 4M6AA 2A38A 1JGIA 1MLCB 1MIML 4BK5C 1XBDA 2ENQA 2MEJB 4H0GA 1AR2A 1J8HB 3OKYA 4UDTA 1AXSB 2BY3A 4CVXA 4G3YL 2IAMA 2J3SA 2YHGA 5IJCC 4PJGE 1KGIA 1ZV2A 4FP8L 4NP4H 3S5LG 5BRZB 2XETA 5GRVL 1DVZA 1S3RA 3DGGA 1X4ZA 3D4GA 3QNYB 2JKWA 5AW4B 4JZJC 2EDTA 1YMMA 1QFUL 1R3KB 3VTAA 4GW1B 4JO1L 4LLWA 5F8RC 4DO4A 4HSAC 5B22A 2XV0A 3QI9A 1CU4H 4XOBA 3VXQB 3JT2A 4F92B 2AEQH 4KV5E 5I0WA 2WLIB 5AMSA 1CR9L 5JW3H 1R47A 1OY3B 3PGDA 3MTXA 2UZIL 3MRCB 5ALBL 5A2KH 2OR9H 1RMFL 3ZKND 4G80B 1A02N 1OP5H 3NA9L 5E6SA 2MMXA 4DUVA 3WTWA 3QWQB 3B1UA 3BKYH 3P30H 4U7MA 3OZ9H 1OPOA 2J8UB 5ADPL 1PY0A 3DMMD 2QLVB 1VE6A 3GBNL 4N85A 4UQBA 1DQKA 4QHMA 2V3FA 4GUCA 2WCPA 4N26A 1KIUB 1E90A 4P2RA 3QNFA 4OVVA 2WXPA 5DTFB 4ODHH 5C09E 3MX0B 3O6LH 1WH0A 4ZPVB 2UV3A 2ZCLL 1NMAL 2EDKA 3LKQA 5HDWA 4QGTA 4KKPA 2OULB 5EU4A 4PJ7B 1DSWA 1LE5B 1UZ6E 1E8NA 4OIBA 2WSPA 2YBGA 1J5OH 3IJHB 2DQHL 2VDQB 2LE9A 2Y7QB 5E2VL 3W2DH 5I82A 4XNUL 1S9VB 3O2VH 4IDJL 3MV9E 4A0AB 3QP3A 4I3RH 3IN2A 2YPVA 2GJ6D 3GSQB 3KWWB 3RFZA 1I8LA 1RZ7L 2GUOB 3QQDA 4KKNA 2AJZB 4N8VB 4AIXA 5JPNB 4TS6A 2G3NA 2GT9B 4J0XA 1FAIL 5IW1A 2NXZD 4BH6A 1LDPH 2IANB 3KPQB 4ZMLA 3S6CA 4Y4HB 5HGBB 4TOYH 5FC9A 4A7GF 1HE8A 1DBBL 4RCAA 3VFNB 4XMTA 1NCDH 4WHTA 3SO3C 3BJ91 2WLYA 3MJ8A 5BNXD 4PJHF 3AXHA 1A7PL 2WYIA 5DJ8B 5E00A 2H6QA 5EUOB 3SYCA 5EN3A 1OF2A 4Y7OC 5IBLD 3G6JF 1U8OA 3N50A 1YYCA 4LCUB 4D6VA 5K1JA 5D1XC 3U7YH 1XF2A 4FI8A 2BWIA 3ETSA 3K2KA 4LCCB 2BC4A 3QG7L 1IM3B 5FK9B 4AQ1A 1A9EB 4ZTEA 2ARJB 1IAII 5TDOB 4PI2A 1D5XB 4KJWC 4GRWB 5EORH 1NCGA 4JZOB 3SE8H 5KJRH 4Z7QA 3S36L 2EE0A 3CXHJ 1MIEL 2F7RA 1JZFA 1A7QL 1BM3H 5AW3B 5C92A 1JPSL 3WFHB 1PPIA 2WXOA 2H1XA 3F7KA 3H6AA 4IRJA 5HDLA 2YBRB 5FDWB 5CILL 3PU7A 4KY2A 1PZ2A 4L3HD 1BD2E 1S7XB 2BERA 2NW2B 1J9CT 1SJVA 2BP0A 3SN6N 2BLFA 4HXBL 4JFHD 5HHNA 2ZUSA 1YN7B 3M7OA 1MWOA 1R24B 5JMRA 2Y72A 2O5NA 3ZE0E 3H4FA 1BAFL 3LRGA 4BFKA 1A9BA 3SO5A 1AO7A 5ITFB 4J1UB 1CC3A 5L7XH 4KVCH 1BIIB 1HH6B 3SBRA 2BNUB 3UTZA 2VQ1A 3EFFB 3SDXA 5BW7A 4M1CD 4JL1A 4G8EB 2WQ8A 4JY4A 4ZO9A 5KS9E 1JZDC 3ZZLA 3JWDH 1RK0A 3DDGA 1CDHA 4OD1L 4GYBA 1QW8A 1AANA 2OMXB 1BFSA 3BMVA 1JPST 4BFFA 1RI8A 4D9RD 3D8MA 5KSAD 5J89A 4M7KH 3VXNB 4M5YH 3D3VE 3HHMA 4JDVB 3U4KA 4LEEA 2ITCB 3BSHA 1XCQA 3FUJA 2OIZA 3VFVB 2X70A 2PCYA 1MJ8H 2G9AA 1DLFH 3U4EA 3QUKA 1F4YH 1A4BA 4DEWA 5ERWB 5I71C 4FG6C 4IEFB 2R69A 2AJXL 3AREA 2VXQL 4X4KA 5EZOH 2OMBA 5BO0D 5C0IA 4AGPA 5J11B 1OCZB 3X14B 4LNVA 2GPZA 1G7JB 4BBWA 4ZMYA 1OAQL 4JFQB 4KJQD 2RH0A 3EGXA 1M4KA 2OLDA 5F44A 4HDIB 5L8LB 1L5GB 1SZNA 3VDAA 1EAJA 1MREL 3Q01A 2NY7H 4UOJA 5DJYA 1FJ1B 4MNGE 5LBSH 1UHVA 4AVKA 2APBA 4XC1L 3TOPA 3O0RH 3BX7C 4NQSB 4WTXA 2Y7NA 4XH2A 3T65B 3PVWB 1PW3A 2X4OB 4XMPL 4R7LA 1N3NA 1KCRH 1ZJBA 2OMUA 3DX4A 5EPMB 2QDWA 2SODB 3GI8H 1BF5A 1KFAH 3ZDXB 1KACB 1QFMA 4NSKB 5B1JC 3V0EA 4I77L 4KHXH 2BNRA 1IKFH 5CLWA 5EULV 2HTLD 2X88A 4WWNA 4ZQTA 2F7PA 5GSRB 3ZDWA 2FO8A 3CQQA 4K8RH 3RFRA 2W9DL 2IDSA 4LPWA 4BH8B 5IFAL 3FFOA 4NN5B 1QLEH 2DAVA 1P4LA 2J5LC 2UXFA 4KKBC 2BS9A 4U6HB 2VIRA 1DLHB 1U8KA 5INDA 5DMKA 2WLZA 4QUOA 4FYRA 5BZXA 1PKOA 4OUUA 3NPSC 1J1PL 1UUSA 5DZOA 3CFTA 4RZCA 3Q6GL 4D9RE 3D69B 4IBWA 3KCPB 1XDTT 5DQ9B 1S7SB 1DL7H 1G9NC 4HGWB 5CR8A 3GLZA 4GAGL 1B4RA 2OCJA 4AG4L 1WUZA 4BH7B 3UAJA 3I3DA 3ZRCC 2W07B 3P4NB 4PJ5B 3QEHB 4WUKH 5D7IF 3F3HA 3KJ6H 2J8UF 1PD1A 2VDMA 4JFPB 2X41A 3T2QA 1BAWA 4JO4H 4WJ5A 3VNYA 4AIOA 3NAAH 2JCCB 3UTSD 1HKFA 5E6RB 1R3HA 4OU3A 2XN9B 5I66B 3F64A 4OF5A 2V17H 4R5TA 5K9JL 2J6EL 2P42B 4K7PY 3H56A 3N3EA 1UA7A 4LQ1A 5CINH 5GGQL 3FB6A 5GIRA 3HN3A 5KANG 1FNGB 5BV7C 3WDJA 3AU1A 3DURB 3GS4A 1TYJA 4PJ7F 4O3TB 2XTJB 4XP1H 5FHBH 4X4ME 3E8UL 5C7ZA 3HIZA 5K5YA 4F15C 1ODUA 1E9OA 3HMWL 3OKOA 1BWMA 4G11A 3MGOB 2CJTA 3HPJA 3LKPB 4ZT1A 2BOLA 2AXWA 5FFLA 3FCTB 4WV1A 3TA3A 5F72S 3OLGA 4NO0B 2JELH 3ULVH 5BPPA 4UZGA 1TETH 4LLUA 5FGSA 4QRPA 4P3CH 3HNSL 2ESVD 3OHXA 4P2AA 2B5NA 4M7ZB 3PGFL 1DVFD 3QHFL 5BJTB 4Q52A 1U3YA 4IBSA 3LEXA 3O6MH 2EUXA 3EFOA 4ERQA 3HG1D 2V7HA 3FUEA 3GZPA 4Z7WA 3GMRB 1JK8B 2EH7L 3MXXA 4L1SA 1U8MA 3RGVB 4CU8A 4NUGL 5H35A 3O4LA 5IT2L 2O6PA 3PFQA 3MXVL 2Z35B 2H1PL 4LQFH 3FUNA 4JHBA 1UOVA 2WTRA 3FU7A 2X10A 3PWPD 1T4WA 5EUOF 3FCUB 1UWXH 3FHEA 2Q87A 3V0FA 4LLAA 3WFBH 4Z77B 5TE7H 1A4KA 3BUYB 1MCJA 3C6LC 2WOBA 4HKBA 5FUOL 2K0RA 1ZGLP 4M4RB 1PX8A 4PW9A 1I7RA 1S9XA 1FVDA 1XWVA 1EPFA 3DX8A 3ZHFA 4QNPF 1CE6A 4DVBB 1VACA 3BVNB 3DYOA 5JUEH 3KGRA 1S7VA 3MXWH 4ZOAA 2IPKB 5BOJA 1CGXA 3L1OL 1B2YA 1M3JA 3HZ3A 4MCYA 3TN0A 2CWRA 4GRWF 1QA9A 1UM4L 1MHHB 5IEHA 2B15A 4LE8A 1Z3GH 3TXAA 3D0LA 4XHJD 4NJAL 2MOVA 3GMPA 4HD9A 2XKNB 4K23L 1EX0A 5FO2A 1EXUA 2K8QA 5CP7A 3UTSE 4R2GC 5F6IB 3FT2A 3BYTA 2VLJE 4PJGA 1J0KA 3D7PA 1CLOL 3RVVC 2R56H 4Y9CA 5C9ZB 4Y16D 5IV2B 2H7WA 4RNRA 5D1ZA 4J3OD 3QHTC 3O6KH 3WKML 1NDMB 3ARGA 2PXYA 4G1EB 4NFDA 5I5RA 1YNLL 3N0EA 2GK2A 2WW8A 1P5VB 3OR7B 1KB5B 2DQFB 3AFLA 3LH2L 2OJZL 3AXIA 2F58L 2ZKMX 2ZAGA 4G59C 2VDPH 1MRFH 2Z31A 3B9KC 4QAWA 1LK2B 1E28A 4ZMVA 4AEIL 4K2UH 1KJ3L 5FOBB 1MUJB 4DESA 1PZ5A 4KZEH 1TZHA 2H32A 5FYLD 4JHAH 5HHPB 4IBQA 3CCHB 3JZ7A 4ODSL 4G7YH 3WIHH 3VRLE 5DFAA 4N0YH 3KPLB 4EUPH 1T1YB 5TQ0H 3HG1E 4D0DB 4I18C 5ABZA 1FCGA 1JI2A 2Q7YB 3DJZA 4MXWL 2P1YA 2VXSH 3FOLB 1UOOA 4PRID 3IIYA 1ED3A 3ARBC 4ZMNA 5FB8A 3SKJH 1AH1A 3PWPE 1VCBC 1BPVA 1A4CA 2FR4A 1C5BL 1VB9A 2R83A 5E1HB 3P2TA 5IG7A 5CWSA 1PIFA 5D4QA 5KAQG 2D0HA 1P22A 8FABB 3D6GA 2VLKE 4L1MA 5D7LB 1LEGB 1KN2H 3IDMA 1U6AL 4GUPB 2IJ0C 4RFOL 3II1A 3C09B 4FOMA 4OCXH 2XPGA 1Q9KB 2Z64C 1RJLA 2XIBA 4AK2A 5GS1B 4XCNA 2X28A 1A0RB 2GTZA 2XWZA 4GMSH 2HLAB 4GINA 3MV9A 2BCKA 4XZUA 2BRRH 1D9KD 1QRNB 4NQCB 1TMCB 1JGLH 2EEBA 3ILQC 3L3JA 3PWLA 3SGDH 5SWSD 3RZWA 2NRDA 3EYOA 1Y0LB 3BWUF 3U4YA 3ZDXF 4NN6B 3VXRB 4YOKA 4I0PB 3QIWC 2XIDA 2X4QA 3HFFA 3MACL 3ARFC 3ULUL 3IPFA 3UP6A 5E95B 1F8TL 5JOPE 1QQDB 4J3WA 3EI1B 5A2LH 1IGJB 1ZEAL 2XIIA 3D25A 4O4YL 3GREA 5C8JB 2F7IA 5I1KL 1HXKA 5L0QB 2WLLA 1KLUA 1AS7A 4IMLA 3WLWD 1TVBA 3N06B 3I8CA 2F7OA 1G87A 1XHHA 1YMHB 32C2A 4N22A 5I19L 2KT6A 4TNGA 4X5QA 1DQIA 3LXCA 3RL2B 4TTGA 4R2GD 3WMQA 5DFTA 3T0DA 4WHYG 4WKZA 4N8PA 1HCVA 2J1WA 1LNUA 2IPTH 3E38A 1BBJB 2NY4D 1SGKA 2E74C 4MMZC 1KPUB 2X1QA 2W95A 4P4KA 4YDKL 4ODTH 1KWKA 5EC2A 5LO7A 2WO2B 4NQXA 4KO5A 3DXAD 1DJXA 2QVMA 1LK3H 2IALB 4HOXA 4ONGL 2V3DA 2B8OT 1V8HA 1BD2A 4E36A 4PRIE 4MQSB 5FKAB 6FABH 2YLHA 1NOFA 1JYXA 1GAFL 3SDCB 1AY1H 2NY1C 3OR6B 5KVDE 1HXYA 4BP8A 1XAKA 3WJJC 3ZE0A 4MASA 1JI1A 2JCCF 4BCZA 2YPVH 3SY0A 5KJ7E 3M45A 1SDDA 1ORQA 2H3XA 4KOBA 5M7QA 1CD0A 2D4DA 1XSJA 4QHLA 4U4BA 3BKYL 2VDKL 4APQC 2AQ3A 2DLHA 5B7EA 3FONB 5EEYA 5KS9A 2A9ML 4GXUN 3RBGA 5D70H 43CAA 5JXEA 2P24A 1CG9A 1BSIA 4LB8A 2IXQB 1CGSH 4ZOEA 2WZPA 3ZMNA 1DANT 2MNJB 4CC9A 5D4IA 2P5WE 4PV8B 5E94B 2AGJH 4ZN4A 1CQKA 2NZ9C 3S96B 2VSKB 3QRGL 1N8OE 1UD5A 3BH9A 3D3VA 3D51A 4WI0A 1CDBA 4UNTA 3MGTA 1EDQA 3HS9A 5F7KC 1U8LB 4H26B 2VUKA 4F8NA 2A9BA 3VVVA 3ZOAA 2QFRA 2CUIA 4EN3D 3J07A 1XEUA 2OM5A 1SJHA 5G4NA 5IGXH 1OP4A 4M29A 4OCSH 3RAJH 3VE0B 4KZDH 1CICD 4OW6A 5JXAL 5FFOA 2P49B 1QO3B 4P5TC 5F7MC 4ZMXA 3UPCA 1CTOA 1TG8A 3GXPA 3W9DA 4BK5A 3OF7A 2QR0A 5F6HJ 2EIDA 4WHYH 1IGYB 1N70A 5CEXB 1DUZA 3MRNA 4ZUVB 1UJ3B 2PM9B 2DLFH 1JUFB 2PTTB 3I9GL 1HHHB 4AL8C 1XB3A 3TO4C 3VU2A 2PCFB 3Q9PA 4JZJA 3TCLB 1LO3H 2FX7H 3NMEA 1YYMH 2C7UB 4KROB 1RIVH 3CZNA 4QXVA 1MW2A 4YAQB 3VW3H 3W15A 1IE5A 1UWEL 3PGCA 1QACA 3PFUA 2Q8AL 1RJYA 5BVJB 3MPCA 4GRLC 1SLWA 1PU0A 4DCQB 1T20B 4J8BA 4C4KT 4I8DA 1FRGH 4RAUB 1U95B 2X2JA 5TJWK 4AYFB 5ICYA 1RHFA 2MH4A 3NFNB 1IGMH 6CGTA 4RVBA 1OGTA 3F7YB 4WTWA 3T6VA 2CKBL 2ZP0T 1G9MH 1OE2A 3SPVA 1HXMA 3TEWA 3GXUB 1W0VA 5T1DH 1U8HB 2YQ3A 4PGBA 5TF1H 2R69H 1ZGLM 4OZUA 1GC1H 5I6NA 1QSED 4X63B 5DC9B 5T3XL 1JVLA 3MRIA 4WWPA 1ITCA 3B9DA 3ZQXA 1ERNA 1VRSA 2LU5A 2ICES 4IRZL 5GGVH 4E2OA 4ZOXA 4ZFFB 3Q3GB 2NOYA 2VAJA 4GMTL 3OC8A 4KJYB 2R7EB 3BEWB 4S2SA 4YHIB 5FKTA 4DPCX 2ZP9A 5J1SC 4K7FA 2RD0A 1RZJH 1E43A 3QH3A 3QYCA 3L95B 5AZEH 3PP4L 3PWNA 4KPHH 5ETUA 2DYPB 2EIKB 1UM5H 2A6IB 4M03A 3VXSD 2WHVA 5HDBB 1Z9SB 4ZG1A 5G5DB 3B9AA 4O2FB 5I18H 5I1CL 4K5LA 5EZJB 2GK0B 5L6YH 2KZ1B 4KHTH 2X87A 2ZUXA 2BS71 4N9OB 1OOAA 1FO0L 4F7MB 5CZRA 4N0FB 4YGVA 4PRAB 4BFJA 2JQMA 3BAXA 2CM6A 2QL1A 4X4MA 4FL4B 3KBHE 4UAOB 1B4TA 4WJG3 3ZL1A 4L8BB 1B0GB 3UGUA 4E9QA 2HU8A 3QUYB 3T0ED 5L4MA 3LS4H 5D1XA 1XCXA 2XG5B 3KNBA 2ZIDA 4FNUA 4ODWB 5HYQB 1JXGA 2AQNA 1W15A 4U33A 2R0KL 1H0DB 3DI3B 4PS3A 2JB6B 1NEPA 4JJHA 1X6NA 2B5IB 2ZF9A 2Q6WB 3PXHA 1UOQA 3H42L 1C5DB 1C16A 2NY7L 1FH5L 3DPDA 2UX6A 3O6FB 5LBSL 3TO4D 5F1OB 1QI5A 4PRHD 2G75B 1QEWB 3O0RL 4YE0A 3NDZE 1OQXA 4NUMA 1V3MA 4FTVD 1T2QL 5HYEA 2FTAA 3MRKA 1X7QA 4OLVL 2WWMC 1G7PA 4QHUB 3JSSA 4KHXL 1QSEE 5LJYH 4ZI8A 2HAZA 5IOPA 1AAJA 1IKFL 2DV6A 4W6XB 4MAYD 1FNLA 3UXFA 4PJHE 1JZ5A 1D5BB 1SYVB 4QY8B 1BQHA 3G6JE 4AKPA 1JZ7A 1QHPA 3MCG1 5F2FA 1AGFB 2WQRA 4D9LL 4M8QB 1AIZA 1KN4H 2AJUH 2UWEB 3OF6A 3R1GL 3VQ1C 2XQYA 2JIXB 5JPNC 2XWBB 4FFZA 1Q9WA 2VE6B 4AW4A 1T80A 2Y36H 3A4EA 2EIBA 1HHKB 3UTSA 2G9HA 4ZW6A 4ICXA 2V9RA 2GC4C 1EO5A 4XOCA 2VLJA 2QVKA 4QEGA 3VXSE 4XXDB 1TVDA 3US9A 1FNEB 2CDGA 1H3UA 3WHXB 4F37F 2HT3D 3CC5A 1KWGA 1ACXA 3HI1A 1Q9OA 4HD5A 2WTPA 2CGZA 2WO4A 3QIBC 3JB9L 3F6JA 3MBXH 4K7PX 4ZZFA 1N64H 1P2CB 4L9LB 5IB4A 4WUKL 2FBOJ 3KJ6L 3QUXB 2K7PA 3QDAA 4LCCC 2Q76A 4JRXD 4JR9L 3G08A 4F2ME 3H3PL 5EOQL 5D1QB 1KLFB 3UPRB 4EIBA 2XWTA 2KPNA 1ZE3C 4M5SA 4N2CA 3RUGB 3EQ7A 3U2SB 3CX5K 4QKTA 3FQXA 3O2DL 2BCMA 2Z92A 5T33L 4LARH 1TEFA 2Y2WA 3HG1A 4FG4A 2ZJSH 5GRZA 1WPCA 1WHOA 4DP6X 3KGTA 4PRHE 5LAXA 5J6SA 1RPKA 4GLRI 5IJ8E 1AD9A 2GYSA 2HFEB 4JN2B 5EH1A 2HT2D 4NPKA 3PDGA 5GISH 2NSXA 5CGYC 3B2XA 3LRSA 3PWPA 5B1JA 3WXWH 5KYYA 5J13B 4JFTA 4P46C 3KPMB 1XH3A 4HISA 3FW6A 3MLSH 4IHOA 5GGTA 1H8NA 2CNXA 2NX5E 3ULVL 2VLKA 1I9EA 1TETL 2VDRB 3OAZK 1PG7H 4Q9QL 3HI6H 1T1ZB 8PAZA 3E9UA 5KYXA 3LEVH 1QG3A 3O6ML 5E6YA 5J5EA 3FH8A 3C2AL 4BWWA 1JZGA 4MNHB 2FD6L 5GSAA 3GLEA 5E2UL 1H2YA 2D03H 3CUPA 1NMBH 1J9TA 4JPWH 5C71A 1N6EA 4I79A 3S0PA 3DVNA 1RLWA 4PGZA 3LJ3A 4JPVH 4WI5A 5AYQA 4ZAKC 2AANA 4OF0A 5TE7L 2BDNH 2NTFA 3IAGC 3MJ9L 3QARA 1TJIH 2DWEB 4IOSD 2B9BA 4HS6B 3MRPB 4WSJA 4X5XA 4YHKL 3SYPA 2H32H 1N8ZA 5JUEL 3DI2B 2X2YA 4LSTL 1K8DA 1M3IA 3C5ZB 3AQZA 1XF4B 2J57A 2JJSC 3EBGA 2XZQL 4R4FH 3LY6A 2WVVA 3I7HA 3MA9L 1A1NB 1ACYH 3UJIH 2ZSVB 2SEBB 1JZ2A 3FSWA 1OB1B 3OAWA 5E8EB 3IWVA 5CSGA 2VR9A 1J8HE 3H9HA 3L3KB 2WBXA 3HUJB 4X98A 2WBKA 2OVQB 4JKPL 4Y4HD 3U2IA 4KJPC 4JSPC 2EVIA 2MJWA 35C8L 1MVUA 5BRZE 4A04A 1J86A 2VMCA 3IJ7A 3CLEH 4MJ4A 3GBDA 4CNIA 3LNEA 3LQAH 3S8WA 2XYBA 4XB7A 4G1MA 1BXXA 5DJXA 3NVNA 3VFGL 3T77A 2R2CA 5DF0A 4PW3A 3W57A 4NO2A 2AKRB 2YD2A 1VEMA 4ZX4A 2FJFB 4ETYA 3EUUA 4PB0L 3NGBB 4PRIA 4ODXA 1J9RA 4NIKB 4J3XA 5DFVD 4J0WA 5DQJA 2NY3D 4OFYD 1IM3D 3EH1A 3K8MA 3MOAL 4M56A 2IPUG 2IUVA 1RU9L 4K2UL 4NQDA 3TIEA 4F8QA 1DR9A 3IDXL 4NN5C 2YNNA 3T2OA 4HX1B 4JGJA 4PTUB 3P1VA 4ZUUA 2WNGA 2J8UE 5HDBF 4LSQL 1QFOA 1RH8A 2CDEA 4XN7A 3L8QA 1R5IA 4J2QA 4OF7A 3S4SB 3S98A 4KVNH 4N0YL 2F1EA 4ETQA 5TQ0L 1TEYA 2BNQD 4PCYA 1A3QA 4O2EB 1RHHA 1VAHA 1J8KA 3RFHA 5D2LB 3PL6B 5AKRA 3B6SB 3U9UA 5T1LB 3HG0A 2P5WA 3U6XS 3C6LA 3ZL4L 3HS0B 1TJGL 1DQMH 4YHOL 1RLBA 4PJ7E 1FHGA 3ATAA 4KXZI 3TVMD 4DZBA 1IBZA 3VD3A 2DQUH 3A22A 5BCAA 4U1NA 3NCWA 3GRBA 5JOEA 3BAJA 4P06A 5E8NA 2CK0H 5IB3B 5A2JH 2EXTA 4LOVA 2BVYA 3UTTB 5B4WA 2R29L 3DYPA 4AI7A 4PJAB 4TUKL 3T8XA 4GMSL 2CG9X 4YN3A 1B3IA 4L37A 3L4MD 2YMXL 3U79A 4TSAH 1AC6A 2FEJA 2R2HB 5ALCL 3SE3C 4X3EA 3CDZB 1A14H 1V3LA 3O3AA 2P47B 3D4ZA 1OT1A 4F3FA 1ZY9A 1GL4B 3S2AA 2IANE 4G56B 2Q20A 4O5LH 1QR1B 1OHZA 2AJSH 2UY7A 1S9YA 3KBFA 5KYWB 5EEWA 4LHQB 3ZKSD 1F42A 1AZRA 1EEYB 2XTJC 5IY5B 2C3HA 4HGKC 4W1TA 1DBMH 1NAKH 5FO8B 4YSPA 2LVEA 5EUOE 4WSGA 3MUGA 1NAMA 4Q14A 4RAHA 3MOBL 4JFFB 1H5BB 4WCYH 1JSYA 3C8KB 4RMBA 3VD9A 4XNMA 2UWEF 4XPAL 2AZUA 1J0JA 2WLJA 3B9KA 4QI3A 5ENWA 2ITEA 1ORSA 4I89A 1BVLA 1RK1B 3KW7A 3K5RA 5IQNA 3UX9B 3VA6A 3EYUH 3L08A 4GRWE 1UOKA 2R2BA 3IJEA 4G6JH 4G9FB 3RGVC 3ORVD 5JHAA 2GITB 2GB2A 4U1LB 5DRWA 2NLJB 5I6KA 1RY7B 2PM9A 2DWDA 4UTAA 5D96B 4HWEH 3CHXA 1JHTA 4JDZB 4N1EA 2FT8A 1IB5A 1JTOA 4FQJL 5ABDE 4PJ8B 4XX1E 3MRLA 4NKDB 4ZUTA 4H40A 5LN4A 3ARBA 4PS7A 1UATA 1BLNB 1FV1B 4G8FA 2MPVA 1ZLWH 3EO1B 3PXTD 4XPHL 4YO0A 1MCEA 3QC5X 1P4UA 3CXDH 5IROD 4UTBA 5HGDB 3RUGF 5IT9g 4M02A 1DYZA 4PYHA 4JQIL 1FHNA 3B37A 3VWKB 4N0RA 2GEEA 3MLYH 2P44B 3ZX1A 4L8DB 3VSTA 3I50H 4TVUA 4ZO8A 1EO7A 2YA0A 3SXTD 1A6VH 2WQWA 1OT4A 1ECYA 1M71B 2XRAL 4OT1L 5H37A 4YX2L 4AZUA 2WMPA 4RFNC 4O9DA 2O1AA 4WY7H 4XP5L 5DR5H 5AW9B 4PJIB 1AZBA 1F90L 4XX5A 3EO9L 3WL9A 4ERSL 5ADOH 2AGJL 3QIWA 3QFJB 4TLUA 3AS2A 3ARFA 1P1VA 3K72B 4NNYB 1IUZA 1MVFA 1CLCA 3L3IA 5C2BH 4HQQL 1OOWA 1DQDL 1U8IA 2UVFA 4H8VA 3IJ0A 5EBMA 2XY2A 4DZ8B 4HWUA 2XN9D 4OCSL 3W0WB 3L6FA 4KZDL 3IF1A 2H2SD 5EALA 4BYHA 3DWTA 4OWRA 4ZFOL 3IFLL 1NFDB 4WWKC 2XTLA 2E9IA 1KTLB 4WQOA 2A6JB 2OMYA 4UIKH 5GJSH 1SNRA 4MMZA 4JJOA 3TBTA 3NVQA 4MCZA 5EO0A 3UABA 4P49A 4POYA 3ZDXE 4OGAD 1BQHG 3LV3B 1AJ7H 1FNAA 3TV8A 4NO0D 4ZS7H 5AZUA 4FI7A 5A40E 3VW3L 4GIOA 3K5SA 4A7GA 25C8L 2ZCHL 1QSEA 4QO1B 3SFZA 2OYKA 5DUBA 2XQYG 3TA4D 3WJJA 2AEPL 5INCB 2AK1L 3HUJF 3IFNH 1A64A 4PQXA 1ZWIA 3BXNB 4PJHA 3F05A 5GS1C 2WQSA 3QPQC 2XXFA 3QNZB 4FJ6A 1WTLA 2JI1A 3N85H 5AB0A 1OCWL 4APQA 3I85A 2E46A 3ENEA 4NBYB 4FLQA 2I9TA 1IGML 4TSCL 1OSPL 2OMZB 4NM8L 2IBGA 4E9RA 5F7NC 4NN6C 4R96B 3VFRA 1BYOA 4BKLA 4NOFA 4I0PC 1Z9OA 2X7LB 5KJ4A 4UOW1 3O45A 3EWEA 4HF5H 3VXSA 3QZBA 1GC1L 1JPFA 3AWEA 4M6MH 4GSUA 3BAWA 1EEUA 1SN2A 3AS1A 3FB7A 2I69A 3ZZ1A 5I1HL 4R7NB 2YPLD 2JV6A 5DD3H 4QTHB 5GGVL 3RWHB 1L0PA 3AZUA 4PJ5E 4TSBL 5L0QC 1CXIA 1KV7A 4POZC 2ATKA 4X99B 1IC5H 4FEIA 4R97C 5HI3D 3FF7A 4GBXC 1FH2A 3MMEB 4O58L 1GZPA 2JCCE 4NJ9H 4NERA 5JOFA 3JAMg 4JZNB 3N9GL 2XN9E 3RVTD 3W39A 3ZGHA 4F2MA 4GI6A 5B3JF 1ND0B 5LGHL 4KPHL 4BELD 4P5TA 4GQPH 4M7LH 1XIPA 1UM5L 2P8MA 1MLBA 1F1AA 5D2LF 3FN3A 1N6QL 4J8RB 1IGIL 5AVUB 5GXBB 3THML 4JO2H 1G7LB 5EB9A 1JV5B 5AOJA 1EZUA 5IVZB 4B60A 4DJMA 2XTJE 1MW3A 1FSKC 2XVBA 3TO4A 2IFGA 1OAUL 1JNHB 3L3DA 1XR9B 1WWAX 3SDCC 1CB4A 1CIUA 1XGRB 3GGWB 2WK2A 4D94A 4AN0A 1RZKC 4PJAF 3TX4A 2W9EH 4X80L 1E40A 4GRMA 4YIQB 4MA8H 4TQHA 5IUCA 5KYUA 1NCNA 3GMQA 4M7JL 4AC4A 1WCBB 4FFZH 4LU5H 2NX5A 1CWVA 5BXFB 5I8EA 4GRLA 5C0AA 3FZUC 2X6AA 4D0BB 4BJLA 3SDDB 5FYKD 4GQ2P 1QUNB 3OKDA 1BXUA 3B2MA 1WO2A 4DGYH 3NSJA 5A1AA 3QUZB 4AMYA 5E9DB 2ATPB 4BCBA 2X89D 4UQ3A 3WG7B 5AD0A 2LOEA 5SX5H 4LG9A 1LXMA 5IK3A 3WY4A 4FZ8L 4EDWH 3K6SB 4MSWA 1ZKAA 1AQMA 1Z32X 4Z7OB 1E65A 1E9PA 5CMAA 4J7RA 3FRPB 2I5YH 4GP5B 4IOFC 4WU5B 2VDML 5JIIA 3F5WA 4PIRF 1NCJA 3IDJB 1QLRB 3GRWA 5D7LD 3SPHA 3L3GA 2B5MA 3HE6B 2KZKA 3M1BB 4W9FC 2BHUA 2LGNA 3RURA 2I9LB 1WAPA 4ENEC 3GFCA 3QPQD 4AW7A 3L4XA 3AH8B 1TCRB 3QRLA 4JY6A 2CLVB 5BVPL 3APFA 3C9CA 4NQCD 2BSDA 1HWWA 1MLCA 3DBXB 3QXUA 1CFVL 1KN4L 1REIA 2B4CL 1KXHA 2ZICA 4DFHA 4DP5X 1J8HA 3VXRD 1AXSA 4U1EI 3EF4A 5TQ2L 4QLWA 1NCWH 2MFNA 4I48B 3IJ1A 2Y36L 5AYUH 2P4AB 2MHAB 3MR9B 4WFFE 1NBYB 4NQEB 4FNTA 4DGIL 4HWBH 1YPZA 2ZX6A 1UJ3C 4HOWA 3EG9B 4JK0D 5I1IL 5BRZA 3UMNA 2M2DA 1L7IL 3O4HA 3QNYA 2JI2A 5CEZL 2J4WH 4GW1A 1U91A 4PAZA 5GGTH 4KROC 3VXQA 3TURA 2UZXB 4POZD 4QAMB 3RSEC 2WLIA 1FZMB 3IETB 1N64L 4XRCB 1IV8A 1JG9A 3HNTH 4BFGA 3BAEH 3MRCA 4GMBA 5JQHC 1GR7A 4G80A 1EDYA 3MUY1 4WEBH 3S3BB 4GG6B 2B1AL 4O2WA 2J88H 4JKWA 1O6GA 2J8UA 4EZLA 2HJBA 2XCMC 3TJHD 3IRZA 4PJIF 1HSBB 5I8CB 1AOZA 2YEZB 3KPOB 1A0QH 1ZIAA 3U36B 1UH4A 5FYKE 2VDOL 4BFRA 4EKXA 1FGVH 3QC6X 5C0NC 1UCTA 1G9NH 1KIUA 2Y1ZA 5KTEH 3SDCD 4AM0A 3U1PA 4TTDC 1J10A 3OHMB 4JG1H 3QRFM 5DTFA 4X5RA 2ZXWB 3MX0A 4NKOB 4FFYA 1X5KA 3RKDD 4BDVB 4ZPVA 1TZOA 2A6DB 4JREB 3PDOB 2CHNA 4PJ7A 2IH8A 5D7LE 5F6HI 1LE5A 1ZD6A 4EI5B 2JLPA 1ZXQA 2C5DC 5GS0C 3FZUD 4IOSA 3IJHA 3QE5A 1NFDF 4LL4A 1P7BA 3LZOA 2Y7QA 2X4PB 5KW9H 5DRNB 2DQGL 1S9VA 1NBVL 3QXDB 4OCLC 3TJPA 3LEVL 3MNDA 4A0AA 4MB3A 3FJTA 2Q3AA 1QRNE 4NQCE 1UWGL 4PJ9B 3GSQA 5CYKB 5I1DB 3KWWA 1GHFH 4POUB 4FQ1L 4PS4H 5BV7H 5JPNA 2AJZA 1UKTA 3GZQA 3UDWC 1WD8A 3OGCB 2HKFL 3VXRE 3RIAF 4JPWL 1YAZA 2VR5A 1NCAL 4JFZH 4P5MB 2GC4A 4AEEA 2IANA 1CDUA 3KPQA 4XN2A 4JPVL 2APTA 2XKUA 5HGBA 5JO5A 2PO6C 3BIKB 4FA1D 1HI6B 3CG8A 3VFNA 1LP9B 4OD2B 1DFBH 1VFBB 1JF1B 5C07B 5KVDH 4YDLB 3WJLC 3V5HA 2R1YA 3QDGB 4K73A 2HESX 4N2GA 1Y1UA 1Z66A 1BVOA 4UAOC 3QIBA 4TQPA 5EUOA 4L4VB 3C99A 5C7XL 3QUYC 1UXSB 4LCUA 1X5LA 1HKLL 2VR6A 2FGWH 3N04A 4X6DB 2PMZA 3K6FA 2I7SA 2PWHA 3UJIL 4PB9L 1Z0NA 4LCCA 2WP3T 4Y8DC 1CDCA 3UJJH 5IVNA 2P43B 5FK9A 3H2WA 3I7KA 1A9EA 2B5IC 2X5PA 4FQLH 5F1SA 3SN6B 5TDOA 3VDCA 1D5XA 1FYTB 2EEAA 3H9ZA 4JZOA 5FYKU 2VXVL 1CGYA 4JVWA 3GPEA 1IBFA 3L48A 4NZUH 4AJVA 2Z2PA 4JT5C 4KQ0A 3WFHA 2DDQL 1IM9B 3FOMB 4KROD 3V8OA 4HC1L 5FDWA 2VN4A 3GKZA 5FECB 3EI3B 1I8KB 1FNSL 4KKAD 4HIEB 2NW2A 3LH8A 5EZLB 1ZVNA 3D9AH 4W9ZA 2OZ4L 4G43A 3CZLA 3UAEA 4KMTH 1R24A 1C7SA 1W8OA 1SF5A 1MOEA 5DVMA 2E7DA 1F6AB 2WC7A 4P46A 4C56B 1YEKH 1B9ZA 2QV2A 3QO0B 2QPSA 3LSOB 5H37G 3M1CA 5ID1B 4OLXL 1WS8A 1BIIA 1HH6A 3SPGA 3QWNA 2BNUA 3VWJC 2NXYC 4HZLB 1CGVA 3EFFA 5I76B 2PPEA 2WXMA 1H2XA 4CKVX 1XZ0B 2KBGA 3BWSA 4Y5YB 4ZTPH 3HEIB 2GW5A 4RDQF 5C0ND 1JWUB 2BJMH 5CN3A 2OMXA 4OCWH 1CTMA 1NAMH 5KVFL 1CFQB 1MCCA 3VXNA 4EQ2A 2XVGA 4NOBA 4JDVA 2P9UC 4ZAKA 2X2IA 5HTSA 3VB9A 2HFFB 1ZDSA 1DQML 5HHQB 4A11A 5BQ7A 5HYJA 1KCBA 4KTEH 3UJTH 4IEFA 4L3ED 4NM4H 4N8CH 3L4OD 3MRQB 1R3IL 4R4ND 4IKKA 2JJSA 3X14A 5I0VA 1G7JA 2DKMA 3L4CA 1N5AB 1XF5B 2ZKYA 3LB6D 2V7NB 4HFUH 4Q0XH 4JFQA 2CAKA 3QBTB 1NPJA 4QXWA 3ZSTA 2VAAB 1ZT7B 4X42A 4UTAH 5C0CB 4QXTA 1XXDC 5ANMA 4HDIA 3CDGA 5THAA 4CU7A 2EDMA 4M4PA 2E9BA 3T2PA 1MHCB 4Z7OF 2FZ3B 3U6RB 2W0KA 1PSKH 3ZXAC 1FJ1A 1FL6B 2X38A 3JWOC 2AJSL 4A63A 4NQSA 3T65A 4D0KA 4AQOA 4B6ZA 4DWHA 5DD6B 1GYWA 5F9OL 2JJUA 4UTBH 1DBML 1GJIA 4PUBL 1NKGA 2CH8A 4NSKA 3LN4B 3ZDXA 1BYPA 4FYQA 3BRGC 3GBML 5J13C 4QOKB 3QHYB 4WCYL 5C9JB 2EYTA 1GGIL 4HZAA 4LNRB 4AGQA 3QNXB 4Y7RA 3BJLA 4WI9A 4F1SA 2HG5B 4TNWK 2P7TB 4ZDHB 1HIML 4J2XA 2KZBA 5DS8A 4GEJA 4NNPH 4UWQB 1TQCB 3FQUB 1ZMYA 5H37H 4WU7B 4YNYB 1KELL 1XGTA 3D0VB 3IDGB 1TKWB 4JHWH 3O6FD 2IURA 3DTDA 4IOIB 3RVWC 2VW4A 3FCBA 4OZ4A 4N3UA 3V7AE 4JKKA 3HA0A 4U6HA 1DLHA 1HINH 1JV2B 1YJDL 4JFSA 5K19A 4N2AA 5DZNA 5T5NF 4FKHA 4HEME 4Y1TA 1GMEA 3QUML 4K7PL 3CK0H 3S3SA 4DVRL 3VGAB 2OMNA 3BI9X 3DX1A 2K6WA 3KCPA 2MQGA 1S7SA 2XLLA 1YEFL 5E2TH 2FX8L 4QHPA 5LNDA 5GRJH 4RLDA 4OQTL 3C5ZC 3A47A 4GG6F 2W07A 3P4NA 4PJ5A 1DVXA 3P3RA 3QEHA 2EO9A 3K80A 1TVHA 4YHPA 1HHGA 1NJ9A 3ELAT 1OEZW 5HD8C 3BIBX 4JFPA 4JN1H 1Z9MA 2JIXD 4L3EE 1T89C 3SPIA 4AT6B 3W5NA 1WG3A 1VZ2A 3MLYL 5HJ3B 2JCCA 4IKLA 3I50L 1ET7A 5E6RA 5I66A 3RWEB 2W92A 5L2JA 5B4MC 2EXYC 3SE3A 5HDBE 3G9AB 3IS0X 4JPIB 4G72B 1XBRA 4F1ZA 3P69A 4JFDD 2K9FB 3AXLB 2I3TA 1SXBA 4LVOB 3VM7A 1KBKA 3BIAX 4KNUA 3ZLQC 4AJYV 1FNGA 4YLCA 2P48B 3BG1A 3DURA 3IGFA 5EF1A 4S0HA 2NPLX 3L13A 4NLAA 3PSCB 4XC3L 2RFXB 3NGBC 5C2BL 3QUXD 3E8VA 3BUQA 4YXKL 1RZFL 3GXDA 1PIGA 3MGOA 3EAKA 1NLDL 3N6YA 1JJUA 3FCTA 5D1QD 4F9LC 5KSBB 2ZPKL 2AV7B 1XGYL 4UT9H 3TEYA 3EJZD 5IBTL 1NLBL 1Q38A 3HE7B 5BJTA 3IRCA 4UUJA 2J20A 2LU7A 4LSUH 4NFBA 4JE4B 2H0EA 1ZT4B 4KO6A 3GMRA 1MNUH 4PCKA 3RGVA 1LP9F 4PMFA 2Z35A 3STLA 3ZPDA 2EYRA 5E70A 5JYLA 1RZIB 1GIGH 4FG0A 1IFHL 4K9JA 1U3ZA 3PL6C 5B1KA 1OF0A 1E7VA 1TO4A 2VZTA 1I1CA 4NDMB 3BUYA 1GOHA 1Q9LB 3HS0C 4X6DF 4HUXA 4M4RA 4FA4D 2VDKB 1E42A 3RI5F 1S3KH 1NGPH 4DVBA 1CXEA 3BVNA 3MRBB 4PJCB 5FM5O 1EHKB 3IFNL 2IPKA 1MCBA 1KTDA 4XZ4A 1BOGB 3L5XH 3FO9B 3ODTA 1MHHA 3S97C 1OW0C 4NZ8A 4QTIL 3COOA 3LHPH 2UWEE 2BOBA 1ZLEA 2PP9A 4ORGA 2JB5L 3LAFA 1SVZA 2XKNA 5GMKn 1CVRA 1MCPH 4AL8H 4XTRC 2X1OA 3I9IA 1AXTL 1TTFA 1WA0X 1CD8A 1W72L 5IV2A 4M6ML 3K6NA 3P9MB 1NBZB 1TNNA 4N0UB 3BESR 4DP0X 3C5ZD 3VRIB 4BK4A 1T1XB 3IXTA 4HJEA 3P2BA 2MQCA 2BSCA 1TZGL 1P5VA 1H5BC 3DJSA 1I8IA 1KB5A 1V54B 2DQFA 2PCXA 3OR7A 1R3LA 5HD8D 4MMXB 1GZQA 2H2PD 2NY0C 1F58L 4JCLA 1AIFB 1LK2A 3KWUA 4DQAA 5FOBA 5D1QE 4OZIA 3N1PC 1AS8A 4CVZB 2E6PA 5HHPA 3RUGE 3VD5A 3FU0A 1I75A 4C4KO 1EVUA 3CCHA 3X1FA 3DDUA 3UYOD 2X1WL 4OFPA 1KXQE 2ZTBA 2F08A 3D33A 1A9VA 3KPLA 4WWKA 2DIEA 1VLXA 1WTGT 1OAZH 2IDQA 4D0DA 3GRWH 1RIUL 3CFDB 4JO2L 4OM1H 4PJ8C 1YQ2A 1QYGH 3FOLA 4MD0B 3V6FB 3HBZA 3MRJA 4ZMAT 3QQ3B 1JXJA 2WLHA 1XF3A 2BFVH 1CIDA 1L7TH 3BSZL 5C6TL 3PF2A 1FLTX 2W9EL 1XF1A 4MA8L 4A2EA 4X2UA 8FABA 4B53A 1LEGA 4FFZL 1UH3A 3PUUA 4MJHA 5BS0D 4GUPA 3VWKC 2QQKH 2FIRT 3ZO9A 3ORJA 2CKBB 5GS1A 3GTNA 1FBIH 1BVZA 2CDFA 2AJYL 3VG0H 2HLAA 3MN8A 3RFGA 5KANI 1CFSB 4W9JC 1WYJA 3RRQA 4TQ8A 1QRNA 4NQCA