2BBKH

Crystal structure of the quinoprotein methylamine dehydrogenase from paracoccus denitrificans at 1.75 angstroms
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
355
structure length
355
Chain Sequence
DEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords METHYLAMINE DEHYDROGENASE (HEAVY SUBUNIT)
publication title Refined crystal structure of methylamine dehydrogenase from Paracoccus denitrificans at 1.75 A resolution.
pubmed doi rcsb
source organism Paracoccus denitrificans
total genus 85
structure length 355
sequence length 355
chains with identical sequence J
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 1993-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2bbkH00
5CYKB 4GGCA 4PBZA 2J55H 4H5IA 1YFQA 3NVXA 3EWEA 4YVDA 5EARA 4FHLA 3UVNA 3RFHA 2P9KC 4CY2A 4HDJA 4JSNC 3U4YA 3UVKA 3JPXA 3OTTA 4X60B 4CZXA 4J87A 3I7LA 4A0BA 2J56H 2AGXA 4A2LA 3SLED 2OVQB 4X63B 3K26A 3VGZA 1TYQC 4FA5D 4A2MA 4GM8A 4PSWB 3ZWLB 5FLXg 3KRWB 4JT6C 3SMRA 5JWZA 3RRMC 2IWKA 4BH6A 4A11A 4Y7RA 4A11B 1FWXA 1JOFA 4QL1A 4CY3A 2UZXB 1N6DA 4J77A 3OKTA 2GC7A 2HESX 1OMWB 2IUPA 2QXVA 4X3EA 2XL3A 2OVPB 5EM2A 1GXRA 3CFSB 2YB8B 5I5JA 5FKQA 1MG2A 4A09A 2H68A 2G99A 2MTAH 4GM9A 3AL8B 2YNPA 3F3FA 2IUQA 4J73A 4ZOVA 4L3HD 2YMUA 1OLZA 1PI6A 5EAPA 3SFZA 1A0RB 3C99A 3MZLA 3F3PA 4AEZA 3BG1A 3FGBA 3SVWD 4CZVA 4GM3A 1NR0A 4PXWA 4XYHA 5HE1B 5I5IA 4ERZA 3IJ0A 1JMZB 4LG8A 2Z2PA 4D0KA 4L1QD 1MG3A 4JXMA 5IGQA 3DSMA 1PGUA 1PBYB 4QRJA 4G56B 4Z8LA 3V5WB 3I7KA 5GSAA 5AMSA 4NSXA 3P4FA 3UVMA 3IIYA 2OJYA 2W18A 3PSLA 2H9LA 1XIPA 3SHFA 5CXBA 4K3ID 3UKRC 4JSPC 5CYKA 2H3XA 3OKYB 1TBGA 2OK4A 2PM7B 2CN3A 5H14A 3BWSA 3PXSD 2XU7A 3SN6B 3L4OD 4E54A 3EI2A 4E54B 2HKRA 2H13A 2PBIB 3EI2B 3RFGA 4U7AA 2AGZA 4LG9A 2YNOA 3K27A 4O3UB 2Z2OA 1VYHC 2I0RA 3RN0D 3N0EA 2BCJB 3OL2A 3OL2B 5IT9g 5EMKB 1SHYB 3L4MD 4JSVC 4CY1A 3N0DA 2IUVA 4Y5RD 4BUJC 3DXMC 5EMMB 1Q47A 2H9PA 5HE3B 3VH0A 4J79A 5THAA 3MKQA 3VA6A 4GQ2P 3ULEC 5IGOA 4FAND 5A2Qg 1JMXB 4J0XA 5EALA 3C9CA 2IURA 2H47A 3AH8B 2I0SA 2XYIA 3SCYA 2B5LA 4J84A 3AL9A 3GREA 3SXTD 5FKTA 2B5MA 2EBSA 3AL8A 3GFCA 3I7PA 2AGLA 4J78A 4CI2A 3AFCA 2I3TA 3UR4A 3JZGA 3PXWD 5EMLB 2CO0A 1MDAH 3B7FA 2XL2A 3EMHA 2CE8A 1B9YA 4CI1A 5HYNB 2OK6A 3EI4A 4PNKB 2AH1A 3EI4B 4ZN4A 2J57G 3JB9L 3RN1D 4J0WA 5H17A 1ERJA 2P9IC 1K32A 4CZYA 1QNIA 4ZOYA 3SJLD 3MZKA 3NVQA 3PSCB 5CXCA 3W15A 3EI1B 5CXCB 3IKOA 2UZYB 4ZOXA 3C5MA 4L3GD 5K19A 1GOTB 5HQGA 4XEIC 3E0CA 3OW8A 4GGAA 4TZ4A 3UKUC 2HXCA 4EWRA 2QC5A 3I89A 4IMMA 4ERYA 4BL0A 5C9ZB 5TF2A 5GXIA 2P9PC 3I8CA 3CFVA 3DWLC 4KFMB 4L9OA 3MXXA 3PE7A 4I79A 4ERQA 2I3SA 1U4CA 1SQJA 2HJ4A 3I8EA 4PSXB 3JAMg 2B5NA 3OKYA 4A0AB 5TEFA 5H1MA 5EAMA 3IIWA 2B4EA 2TRCB 1L0QA 2OIZA 5FXYA 5GMKn 5FKRA 4E5ZB 2AH0A 2P9UC 1B9XA 3ORVD 3A0FA 3MKSB 4A08A 4A08B 4JT5C 5SXMA 2HYEA 5AJAA 4N14A 5GXHA 2YNNA 2CN2A 3FRXA 3V9FA 3EG6A 4GQBB 4O9DA 3UVLA 2HKMA 4PC0A 4FA1D 2H9NA 4H5JA 4J82A 2AQ5A 3C75H 3UVOA 4J8GA 2H6KA 1K8KC 4PBYA 4ES0A 5IC7A 4A0BB 3EI3A 2H6NA 4O45A 3EI3B 3SWSD 1PEVA 3DM0A 3OKWA 1GP2B 3I7HA 1SQ9A 3J80g 2OVRB 5IJ7E 2HJBA 4O1QD 3RMZD 2PM6B 1U2VC 2BBKH 2H14A 5C2WB 5TDHB 1XHMA 3PVWB 3IJ1A 2GNQA 4QQEA 4ZOZA 3JZNA 5C2VB 4FA4D 2AGYA 4X61B 4FA9D 4GQ1A 4JSXC 2CE9A 5AFU3 1R5MA 3HFQA 3JRPA 3MMYA 3CIKB 4CI3A 4CC9A 5B4WA 5HE0B 1GG2B 1JJUB 4IA9A 1N6EA 2H6QA 2H9MA 5FKSA 5EM2B 2I0TA 2G9AA 4FB1D 4GZ8A 4XYIA 2GC4A 4UI9R 2CO0C 4K3JB 4A09B 3IJCA 3JZHA 1P22A 3EI1A 5FA5B 3J81g 4A7JA 5K1CC 2YBAA 2PM9A 3JROA 4J8BA 3EU7A 3I7OA 5FQDA 3F3GA 2PM9B 5TEEA 3SBQA 1RI6A 4MK0B 5I5MA 4O3TB 4OWRA 2O9KA 4U1EI 2AGWA 1NEXB 2IWFA 3PXTD 1S4UX 4CI8A 3SBRA 3I7NA 3I2NA 2CNXA 4FAVD 4J86A 2P9SC 1XKSA 1N6FA 4JD2C 4AOWA 4A0AA 4GGDA 4D6VA 2IAAA 4QT8A 3BG0A 5KDOB 3KRXB 4J81A 3V7DB 4GMBA 3DXKC 2P9LC 3PVUB 4E5ZA 5EMJB 4FWWA 3ODTA 3RSEC 2Z2NA 4LGNA 4ESGA 4CY5A 2Q7QA 3NVNA 5IJ8E 2P9NC 5HE2B 3SBPA 4OZUA 4R7AB 3FM0A 3RLMD 5CXBB
chains in the Genus database with same CATH superfamily
4MMXA 5CYKB 4GGCA 1VZ3A 4PBZA 2J55H 5E6UA 3MUOA 4H5IA 1YFQA 3O4HA 3NVXA 3EWEA 4YVDA 3O4IA 5EARA 4AN0A 4FHLA 3UVNA 3RFHA 2P9KC 4CY2A 5M5VA 4HDJA 4JSNC 3U4YA 3UVKA 3JPXA 3OTTA 1E8MA 4X60B 4CZXA 4J87A 3I7LA 4A0BA 4Z7QA 2J56H 2AGXA 4A2LA 3SLED 5M5UA 2OVQB 4X63B 3K26A 3VGZA 1TYQC 4FA5D 4A2MA 4GM8A 4PSWB 3ZWLB 5FLXg 3KRWB 4JT6C 3SMRA 5JWZA 3RRMC 4NENA 2IWKA 4BH6A 3ZE1A 4A11A 4Y7RA 4A11B 1FWXA 1JOFA 4QL1A 4BCCA 4CY3A 2UZXB 3T3MA 1N6DA 4G55A 4J77A 3OKTA 3NIFA 2GC7A 3NIGA 3MVDK 4IRZA 2HESX 1YR2A 1OMWB 2IUPA 2QXVA 4X3EA 2XL3A 4BP8A 2OVPB 5EM2A 1GXRA 4Z7OA 3CFSB 2YB8B 5I5JA 5FKQA 1E5TA 1MG2A 4A09A 2H68A 2G99A 3GD1I 2MTAH 3O4GA 4GM9A 3AL8B 2YNPA 4BCBA 5M61A 3F3FA 2IUQA 3IJEA 4J73A 4ZOVA 4L3HD 2YMUA 1U8CA 4NC4A 4JHNA 1OLZA 4BCDA 4MMZA 3K71A 3T3PA 1PI6A 1UOQA 5EAPA 3SFZA 1A0RB 4NAAA 3C99A 3MZLA 3F3PA 4AEZA 3BG1A 3FGBA 3K72A 3SVWD 4CZVA 4GM3A 1NR0A 4WK0A 4PXWA 4XYHA 5HE1B 1E8NA 4Z7NA 4D9SA 5I5IA 1GOFA 4ERZA 3IJ0A 1JMZB 3ZE0A 4UM8A 4LG8A 2Z2PA 4D0KA 4L1QD 1MG3A 4JXMA 5IGQA 3DSMA 1PGUA 1PBYB 4QRJA 4G56B 4Z8LA 3V5WB 2EICA 3I7KA 5GSAA 3DDUA 3K6SA 5HDBA 3IUQA 3IUMA 5AMSA 4NSXA 3P4FA 3UVMA 3IIYA 3IULA 2OJYA 3IUJA 2W18A 3PSLA 2H9LA 1XIPA 3SHFA 5CXBA 4K3ID 3UKRC 4JSPC 5CYKA 2H3XA 3OKYB 1TBGA 2XDWA 1L5GA 2OK4A 2PM7B 2VZ1A 2CN3A 5H14A 3BWSA 3PXSD 2XU7A 3SN6B 3L4OD 4E54A 3EI2A 4E54B 2HKRA 2H13A 2PBIB 3EI2B 3RFGA 4U7AA 2AGZA 4JHPC 2YNOA 4LG9A 3K27A 4O3UB 2Z2OA 1VYHC 2I0RA 3RN0D 3N0EA 2BCJB 3OL2A 3FCUA 3OL2B 3QI0A 5IT9g 5EMKB 1SHYB 5FFOA 3L4MD 5E6RA 4JSVC 4CY1A 3N0DA 2IUVA 2VDNA 4Y5RD 3IUNA 4BUJC 3DXMC 5EMMB 1Q47A 2H9PA 5HE3B 5M5RA 3VH0A 4J79A 1UTCA 3MKQA 5THAA 3VA6A 4GQ2P 4AN1A 3ULEC 5IGOA 4FAND 5A2Qg 1JMXB 4J0XA 5EALA 4O02A 3C9CA 2IURA 1JV2A 2H47A 3ZDXA 3AH8B 1A12A 2I0SA 2XYIA 3SCYA 2HU8A 2B5LA 4J84A 3AL9A 3GREA 3SXTD 5FKTA 4UM9A 2B5MA 2EBSA 3AL8A 2VZ3A 3GFCA 3I7PA 2XZGA 3IVMA 2AGLA 4J78A 4CI2A 3AFCA 2I3TA 3UR4A 3JZGA 3PXWD 5C92A 5EMLB 2CO0A 1MDAH 3B7FA 2XL2A 3EMHA 2CE8A 1B9YA 4CI1A 5HYNB 2OK6A 4MMYA 2JKXA 3EI4A 1H2WA 4PNKB 2AH1A 3EI4B 4ZN4A 2BKLA 2J57G 3JB9L 3QHYB 3RN1D 4J0WA 4AMZA 5H17A 1I2MB 1ERJA 2P9IC 1K32A 4CZYA 3VI4A 1QNIA 4ZOYA 1UOPA 3SJLD 3MZKA 3NVQA 3PSCB 5CXCA 3W15A 3EI1B 3EQ8A 5CXCB 3IKOA 2UZYB 5FFGA 4RE6A 2XE4A 4ZOXA 3C5MA 4L3GD 5K19A 1GOTB 5HQGA 4XEIC 3E0CA 3OW8A 4GGAA 1VE7A 1K3IA 4TZ4A 3UKUC 2HXCA 4EWRA 2QC5A 3I89A 4IMMA 3V4PA 3MUNA 4ERYA 4BL0A 5C9ZB 5TF2A 5GXIA 1QFSA 2P9PC 3NIDA 3I8CA 3CFVA 3DWLC 4KFMB 3EQ7A 4L9OA 3FCSA 3MXXA 3PE7A 4I79A 4ERQA 2I3SA 1U4CA 1SQJA 2HJ4A 3I8EA 4PSXB 3JAMg 2B5NA 3OKYA 4A0AB 5TEFA 5H1MA 5EAMA 3IIWA 2B4EA 2TRCB 1L0QA 2OIZA 5FXYA 5GMKn 5FKRA 3OF7A 1M1XA 1JTDB 4E5ZB 2AH0A 2P9UC 1B9XA 3ORVD 3A0FA 2HU7A 3ZDYA 3MKSB 4A08A 4A08B 4JT5C 4DNWA 5SXMA 2HYEA 5AJAA 4N14A 5GXHA 2YNNA 4WJKA 2CN2A 3FRXA 3V9FA 3EG6A 4RE5A 4GQBB 4O9DA 4NBMA 2HKMA 4G1EA 4PC0A 2H9NA 3UVLA 4FA1D 4H5JA 4J82A 2AQ5A 3C75H 3UVOA 4J8GA 2H6KA 4WK2A 1K8KC 2EIBA 4DNUA 2VDRA 4PBYA 4ES0A 5IC7A 4A0BB 4BP9A 3EI3A 1T2XA 2H6NA 4O45A 3EI3B 3SWSD 1PEVA 3DM0A 3OKWA 1GP2B 3I7HA 1SQ9A 3J80g 1H2ZA 1O6FA 1GOHA 2OVRB 3EQ9A 5IJ7E 2HJBA 3KCIA 4O1QD 3RMZD 2PM6B 1GOGA 1U2VC 2BBKH 2H14A 5C2WB 5TDHB 1VE6A 1XHMA 2WQ8A 2VDQA 3PVWB 3IJ1A 1BPOA 2GNQA 4QQEA 3JZNA 4ZOZA 5C2VB 4FA4D 2AGYA 4X61B 4FA9D 4GQ1A 2VDOA 1C9LA 2CE9A 2VC2A 4JSXC 5AFU3 1R5MA 3HFQA 3JRPA 3MMYA 3CIKB 2VDLA 4CI3A 4CC9A 5B4WA 5HE0B 1GG2B 1JJUB 5E6SA 4IA9A 1N6EA 2H6QA 2H9MA 5FKSA 5EM2B 2I0TA 5C86A 2G9AA 4FB1D 4GZ8A 4XYIA 2GC4A 4UI9R 2CO0C 1H2XA 2QR5A 4K3JB 4A09B 3IJCA 3JZHA 4L1MA 4O2WA 1P22A 3EI1A 4G1MA 5FA5B 3J81g 4A7JA 5K1CC 2YBAA 2PM9A 3JROA 3I7OA 3EU7A 4J8BA 5FQDA 3F3GA 2PM9B 2EIEA 5TEEA 5M5TA 3SBQA 1RI6A 1TYEA 3GC3B 4MK0B 5I5MA 4DNVA 4O3TB 4OWRA 2O9KA 1QFMA 4U1EI 2VDPA 2AGWA 1NEXB 2IWFA 3PXTD 1S4UX 4CI8A 3SBRA 3IURA 1O6GA 3I7NA 3ZDZA 3I2NA 5M5SA 2CNXA 4FAVD 4J86A 2P9SC 1XKSA 2EIDA 1N6FA 4JD2C 4AOWA 1H2YA 4A0AA 4GGDA 4D6VA 2IAAA 4QT8A 3BG0A 5KDOB 3KRXB 4J81A 3V7DB 4GMBA 3DXKC 2P9LC 3PVUB 1UOOA 5EMJB 3ZE2A 4FWWA 4E5ZA 1VZ2A 3ODTA 3RSEC 2QZPA 4WK4A 1C9IA 2HU5A 2Z2NA 4LGNA 4ESGA 4CY5A 2Q7QA 2VDKA 3NVNA 5IJ8E 2P9NC 3VI3A 3V4VA 5HE2B 4QAMA 2VDMA 3SBPA 4OZUA 4R7AB 3FM0A 3RLMD 5CXBB 4AMYA 3O4JA 4AX4A
chains in the Genus database with same CATH topology
5CYKB 4GGCA 4PBZA 2J55H 4H5IA 1YFQA 3NVXA 3EWEA 4YVDA 5EARA 4FHLA 3UVNA 3RFHA 2P9KC 4CY2A 4HDJA 4JSNC 3U4YA 3UVKA 3JPXA 3OTTA 4X60B 4CZXA 4J87A 3I7LA 4A0BA 2J56H 2AGXA 4A2LA 3SLED 2OVQB 4X63B 3K26A 3VGZA 1TYQC 4FA5D 4A2MA 4GM8A 4PSWB 3ZWLB 5FLXg 3KRWB 4JT6C 3SMRA 5JWZA 3RRMC 2IWKA 4BH6A 4A11A 4Y7RA 4A11B 1FWXA 1JOFA 4QL1A 4CY3A 2UZXB 1N6DA 4J77A 3OKTA 2GC7A 2HESX 1OMWB 2IUPA 2QXVA 4X3EA 2XL3A 2OVPB 5EM2A 1GXRA 3CFSB 2YB8B 5I5JA 5FKQA 1MG2A 4A09A 2H68A 2G99A 2MTAH 4GM9A 3AL8B 2YNPA 3F3FA 2IUQA 4J73A 4ZOVA 4L3HD 2YMUA 1OLZA 1PI6A 5EAPA 3SFZA 1A0RB 3C99A 3MZLA 3F3PA 4AEZA 3BG1A 3FGBA 3SVWD 4CZVA 4GM3A 1NR0A 4PXWA 4XYHA 5HE1B 5I5IA 4ERZA 3IJ0A 1JMZB 4LG8A 2Z2PA 4D0KA 4L1QD 1MG3A 4JXMA 5IGQA 3DSMA 1PGUA 1PBYB 4QRJA 4G56B 4Z8LA 3V5WB 3I7KA 5GSAA 5AMSA 4NSXA 3P4FA 3UVMA 3IIYA 2OJYA 2W18A 3PSLA 2H9LA 1XIPA 3SHFA 5CXBA 4K3ID 3UKRC 4JSPC 5CYKA 2H3XA 3OKYB 1TBGA 2OK4A 2PM7B 2CN3A 5H14A 3BWSA 3PXSD 2XU7A 3SN6B 3L4OD 4E54A 3EI2A 4E54B 2HKRA 2H13A 2PBIB 3EI2B 3RFGA 4U7AA 2AGZA 4LG9A 2YNOA 3K27A 4O3UB 2Z2OA 1VYHC 2I0RA 3RN0D 3N0EA 2BCJB 3OL2A 3OL2B 5IT9g 5EMKB 1SHYB 3L4MD 4JSVC 4CY1A 3N0DA 2IUVA 4Y5RD 4BUJC 3DXMC 5EMMB 1Q47A 2H9PA 5HE3B 3VH0A 4J79A 5THAA 3MKQA 3VA6A 4GQ2P 3ULEC 5IGOA 4FAND 5A2Qg 1JMXB 4J0XA 5EALA 3C9CA 2IURA 2H47A 3AH8B 2I0SA 2XYIA 3SCYA 2B5LA 4J84A 3AL9A 3GREA 3SXTD 5FKTA 2B5MA 2EBSA 3AL8A 3GFCA 3I7PA 2AGLA 4J78A 4CI2A 3AFCA 2I3TA 3UR4A 3JZGA 3PXWD 5EMLB 2CO0A 1MDAH 3B7FA 2XL2A 3EMHA 2CE8A 1B9YA 4CI1A 5HYNB 2OK6A 3EI4A 4PNKB 2AH1A 3EI4B 4ZN4A 2J57G 3JB9L 3RN1D 4J0WA 5H17A 1ERJA 2P9IC 1K32A 4CZYA 1QNIA 4ZOYA 3SJLD 3MZKA 3NVQA 3PSCB 5CXCA 3W15A 3EI1B 5CXCB 3IKOA 2UZYB 4ZOXA 3C5MA 4L3GD 5K19A 1GOTB 5HQGA 4XEIC 3E0CA 3OW8A 4GGAA 4TZ4A 3UKUC 2HXCA 4EWRA 2QC5A 3I89A 4IMMA 4ERYA 4BL0A 5C9ZB 5TF2A 5GXIA 2P9PC 3I8CA 3CFVA 3DWLC 4KFMB 4L9OA 3MXXA 3PE7A 4I79A 4ERQA 2I3SA 1U4CA 1SQJA 2HJ4A 3I8EA 4PSXB 3JAMg 2B5NA 3OKYA 4A0AB 5TEFA 5H1MA 5EAMA 3IIWA 2B4EA 2TRCB 1L0QA 2OIZA 5FXYA 5GMKn 5FKRA 4E5ZB 2AH0A 2P9UC 1B9XA 3ORVD 3A0FA 3MKSB 4A08A 4A08B 4JT5C 5SXMA 2HYEA 5AJAA 4N14A 5GXHA 2YNNA 2CN2A 3FRXA 3V9FA 3EG6A 4GQBB 4O9DA 3UVLA 2HKMA 4PC0A 4FA1D 2H9NA 4H5JA 4J82A 2AQ5A 3C75H 3UVOA 4J8GA 2H6KA 1K8KC 4PBYA 4ES0A 5IC7A 4A0BB 3EI3A 2H6NA 4O45A 3EI3B 3SWSD 1PEVA 3DM0A 3OKWA 1GP2B 3I7HA 1SQ9A 3J80g 2OVRB 5IJ7E 2HJBA 4O1QD 3RMZD 2PM6B 1U2VC 2BBKH 2H14A 5C2WB 5TDHB 1XHMA 3PVWB 3IJ1A 2GNQA 4QQEA 4ZOZA 3JZNA 5C2VB 4FA4D 2AGYA 4X61B 4FA9D 4GQ1A 4JSXC 2CE9A 5AFU3 1R5MA 3HFQA 3JRPA 3MMYA 3CIKB 4CI3A 4CC9A 5B4WA 5HE0B 1GG2B 1JJUB 4IA9A 1N6EA 2H6QA 2H9MA 5FKSA 5EM2B 2I0TA 2G9AA 4FB1D 4GZ8A 4XYIA 2GC4A 4UI9R 2CO0C 4K3JB 4A09B 3IJCA 3JZHA 1P22A 3EI1A 5FA5B 3J81g 4A7JA 5K1CC 2YBAA 2PM9A 3JROA 4J8BA 3EU7A 3I7OA 5FQDA 3F3GA 2PM9B 5TEEA 3SBQA 1RI6A 4MK0B 5I5MA 4O3TB 4OWRA 2O9KA 4U1EI 2AGWA 1NEXB 2IWFA 3PXTD 1S4UX 4CI8A 3SBRA 3I7NA 3I2NA 2CNXA 4FAVD 4J86A 2P9SC 1XKSA 1N6FA 4JD2C 4AOWA 4A0AA 4GGDA 4D6VA 2IAAA 4QT8A 3BG0A 5KDOB 3KRXB 4J81A 3V7DB 4GMBA 3DXKC 2P9LC 3PVUB 4E5ZA 5EMJB 4FWWA 3ODTA 3RSEC 2Z2NA 4LGNA 4ESGA 4CY5A 2Q7QA 3NVNA 5IJ8E 2P9NC 5HE2B 3SBPA 4OZUA 4R7AB 3FM0A 3RLMD 5CXBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CYK B;  4GGC A;  4PBZ A;  2J55 H;  4H5I A;  1YFQ A;  3NVX A;  3EWE A;  4YVD A;  5EAR A;  4FHL A;  3UVN A;  3RFH A;  2P9K C;  4CY2 A;  4HDJ A;  4JSN C;  3U4Y A;  3UVK A;  3JPX A;  3OTT A;  4X60 B;  4CZX A;  4J87 A;  3I7L A;  4A0B A;  2J56 H;  2AGX A;  4A2L A;  3SLE D;  2OVQ B;  4X63 B;  3K26 A;  3VGZ A;  1TYQ C;  4FA5 D;  4A2M A;  4GM8 A;  4PSW B;  3ZWL B;  5FLX g;  3KRW B;  4JT6 C;  3SMR A;  5JWZ A;  3RRM C;  2IWK A;  4BH6 A;  4A11 A;  4Y7R A;  4A11 B;  1FWX A;  1JOF A;  4QL1 A;  4CY3 A;  2UZX B;  1N6D A;  4J77 A;  3OKT A;  2GC7 A;  2HES X;  1OMW B;  2IUP A;  2QXV A;  4X3E A;  2XL3 A;  2OVP B;  5EM2 A;  1GXR A;  3CFS B;  2YB8 B;  5I5J A;  5FKQ A;  1MG2 A;  4A09 A;  2H68 A;  2G99 A;  2MTA H;  4GM9 A;  3AL8 B;  2YNP A;  3F3F A;  2IUQ A;  4J73 A;  4ZOV A;  4L3H D;  2YMU A;  1OLZ A;  1PI6 A;  5EAP A;  3SFZ A;  1A0R B;  3C99 A;  3MZL A;  3F3P A;  4AEZ A;  3BG1 A;  3FGB A;  3SVW D;  4CZV A;  4GM3 A;  1NR0 A;  4PXW A;  4XYH A;  5HE1 B;  5I5I A;  4ERZ A;  3IJ0 A;  1JMZ B;  4LG8 A;  2Z2P A;  4D0K A;  4L1Q D;  1MG3 A;  4JXM A;  5IGQ A;  3DSM A;  1PGU A;  1PBY B;  4QRJ A;  4G56 B;  4Z8L A;  3V5W B;  3I7K A;  5GSA A;  5AMS A;  4NSX A;  3P4F A;  3UVM A;  3IIY A;  2OJY A;  2W18 A;  3PSL A;  2H9L A;  1XIP A;  3SHF A;  5CXB A;  4K3I D;  3UKR C;  4JSP C;  5CYK A;  2H3X A;  3OKY B;  1TBG A;  2OK4 A;  2PM7 B;  2CN3 A;  5H14 A;  3BWS A;  3PXS D;  2XU7 A;  3SN6 B;  3L4O D;  4E54 A;  3EI2 A;  4E54 B;  2HKR A;  2H13 A;  2PBI B;  3EI2 B;  3RFG A;  4U7A A;  2AGZ A;  4LG9 A;  2YNO A;  3K27 A;  4O3U B;  2Z2O A;  1VYH C;  2I0R A;  3RN0 D;  3N0E A;  2BCJ B;  3OL2 A;  3OL2 B;  5IT9 g;  5EMK B;  1SHY B;  3L4M D;  4JSV C;  4CY1 A;  3N0D A;  2IUV A;  4Y5R D;  4BUJ C;  3DXM C;  5EMM B;  1Q47 A;  2H9P A;  5HE3 B;  3VH0 A;  4J79 A;  5THA A;  3MKQ A;  3VA6 A;  4GQ2 P;  3ULE C;  5IGO A;  4FAN D;  5A2Q g;  1JMX B;  4J0X A;  5EAL A;  3C9C A;  2IUR A;  2H47 A;  3AH8 B;  2I0S A;  2XYI A;  3SCY A;  2B5L A;  4J84 A;  3AL9 A;  3GRE A;  3SXT D;  5FKT A;  2B5M A;  2EBS A;  3AL8 A;  3GFC A;  3I7P A;  2AGL A;  4J78 A;  4CI2 A;  3AFC A;  2I3T A;  3UR4 A;  3JZG A;  3PXW D;  5EML B;  2CO0 A;  1MDA H;  3B7F A;  2XL2 A;  3EMH A;  2CE8 A;  1B9Y A;  4CI1 A;  5HYN B;  2OK6 A;  3EI4 A;  4PNK B;  2AH1 A;  3EI4 B;  4ZN4 A;  2J57 G;  3JB9 L;  3RN1 D;  4J0W A;  5H17 A;  1ERJ A;  2P9I C;  1K32 A;  4CZY A;  1QNI A;  4ZOY A;  3SJL D;  3MZK A;  3NVQ A;  3PSC B;  5CXC A;  3W15 A;  3EI1 B;  5CXC B;  3IKO A;  2UZY B;  4ZOX A;  3C5M A;  4L3G D;  5K19 A;  1GOT B;  5HQG A;  4XEI C;  3E0C A;  3OW8 A;  4GGA A;  4TZ4 A;  3UKU C;  2HXC A;  4EWR A;  2QC5 A;  3I89 A;  4IMM A;  4ERY A;  4BL0 A;  5C9Z B;  5TF2 A;  5GXI A;  2P9P C;  3I8C A;  3CFV A;  3DWL C;  4KFM B;  4L9O A;  3MXX A;  3PE7 A;  4I79 A;  4ERQ A;  2I3S A;  1U4C A;  1SQJ A;  2HJ4 A;  3I8E A;  4PSX B;  3JAM g;  2B5N A;  3OKY A;  4A0A B;  5TEF A;  5H1M A;  5EAM A;  3IIW A;  2B4E A;  2TRC B;  1L0Q A;  2OIZ A;  5FXY A;  5GMK n;  5FKR A;  4E5Z B;  2AH0 A;  2P9U C;  1B9X A;  3ORV D;  3A0F A;  3MKS B;  4A08 A;  4A08 B;  4JT5 C;  5SXM A;  2HYE A;  5AJA A;  4N14 A;  5GXH A;  2YNN A;  2CN2 A;  3FRX A;  3V9F A;  3EG6 A;  4GQB B;  4O9D A;  3UVL A;  2HKM A;  4PC0 A;  4FA1 D;  2H9N A;  4H5J A;  4J82 A;  2AQ5 A;  3C75 H;  3UVO A;  4J8G A;  2H6K A;  1K8K C;  4PBY A;  4ES0 A;  5IC7 A;  4A0B B;  3EI3 A;  2H6N A;  4O45 A;  3EI3 B;  3SWS D;  1PEV A;  3DM0 A;  3OKW A;  1GP2 B;  3I7H A;  1SQ9 A;  3J80 g;  2OVR B;  5IJ7 E;  2HJB A;  4O1Q D;  3RMZ D;  2PM6 B;  1U2V C;  2BBK H;  2H14 A;  5C2W B;  5TDH B;  1XHM A;  3PVW B;  3IJ1 A;  2GNQ A;  4QQE A;  4ZOZ A;  3JZN A;  5C2V B;  4FA4 D;  2AGY A;  4X61 B;  4FA9 D;  4GQ1 A;  4JSX C;  2CE9 A;  5AFU 3;  1R5M A;  3HFQ A;  3JRP A;  3MMY A;  3CIK B;  4CI3 A;  4CC9 A;  5B4W A;  5HE0 B;  1GG2 B;  1JJU B;  4IA9 A;  1N6E A;  2H6Q A;  2H9M A;  5FKS A;  5EM2 B;  2I0T A;  2G9A A;  4FB1 D;  4GZ8 A;  4XYI A;  2GC4 A;  4UI9 R;  2CO0 C;  4K3J B;  4A09 B;  3IJC A;  3JZH A;  1P22 A;  3EI1 A;  5FA5 B;  3J81 g;  4A7J A;  5K1C C;  2YBA A;  2PM9 A;  3JRO A;  4J8B A;  3EU7 A;  3I7O A;  5FQD A;  3F3G A;  2PM9 B;  5TEE A;  3SBQ A;  1RI6 A;  4MK0 B;  5I5M A;  4O3T B;  4OWR A;  2O9K A;  4U1E I;  2AGW A;  1NEX B;  2IWF A;  3PXT D;  1S4U X;  4CI8 A;  3SBR A;  3I7N A;  3I2N A;  2CNX A;  4FAV D;  4J86 A;  2P9S C;  1XKS A;  1N6F A;  4JD2 C;  4AOW A;  4A0A A;  4GGD A;  4D6V A;  2IAA A;  4QT8 A;  3BG0 A;  5KDO B;  3KRX B;  4J81 A;  3V7D B;  4GMB A;  3DXK C;  2P9L C;  3PVU B;  4E5Z A;  5EMJ B;  4FWW A;  3ODT A;  3RSE C;  2Z2N A;  4LGN A;  4ESG A;  4CY5 A;  2Q7Q A;  3NVN A;  5IJ8 E;  2P9N C;  5HE2 B;  3SBP A;  4OZU A;  4R7A B;  3FM0 A;  3RLM D;  5CXB B; 
#chains in the Genus database with same CATH topology
 4MMX A;  5CYK B;  4GGC A;  1VZ3 A;  4PBZ A;  2J55 H;  5E6U A;  3MUO A;  4H5I A;  1YFQ A;  3O4H A;  3NVX A;  3EWE A;  4YVD A;  3O4I A;  5EAR A;  4AN0 A;  4FHL A;  3UVN A;  3RFH A;  2P9K C;  4CY2 A;  5M5V A;  4HDJ A;  4JSN C;  3U4Y A;  3UVK A;  3JPX A;  3OTT A;  1E8M A;  4X60 B;  4CZX A;  4J87 A;  3I7L A;  4A0B A;  4Z7Q A;  2J56 H;  2AGX A;  4A2L A;  3SLE D;  5M5U A;  2OVQ B;  4X63 B;  3K26 A;  3VGZ A;  1TYQ C;  4FA5 D;  4A2M A;  4GM8 A;  4PSW B;  3ZWL B;  5FLX g;  3KRW B;  4JT6 C;  3SMR A;  5JWZ A;  3RRM C;  4NEN A;  2IWK A;  4BH6 A;  3ZE1 A;  4A11 A;  4Y7R A;  4A11 B;  1FWX A;  1JOF A;  4QL1 A;  4BCC A;  4CY3 A;  2UZX B;  3T3M A;  1N6D A;  4G55 A;  4J77 A;  3OKT A;  3NIF A;  2GC7 A;  3NIG A;  3MVD K;  4IRZ A;  2HES X;  1YR2 A;  1OMW B;  2IUP A;  2QXV A;  4X3E A;  2XL3 A;  4BP8 A;  2OVP B;  5EM2 A;  1GXR A;  4Z7O A;  3CFS B;  2YB8 B;  5I5J A;  5FKQ A;  1E5T A;  1MG2 A;  4A09 A;  2H68 A;  2G99 A;  3GD1 I;  2MTA H;  3O4G A;  4GM9 A;  3AL8 B;  2YNP A;  4BCB A;  5M61 A;  3F3F A;  2IUQ A;  3IJE A;  4J73 A;  4ZOV A;  4L3H D;  2YMU A;  1U8C A;  4NC4 A;  4JHN A;  1OLZ A;  4BCD A;  4MMZ A;  3K71 A;  3T3P A;  1PI6 A;  1UOQ A;  5EAP A;  3SFZ A;  1A0R B;  4NAA A;  3C99 A;  3MZL A;  3F3P A;  4AEZ A;  3BG1 A;  3FGB A;  3K72 A;  3SVW D;  4CZV A;  4GM3 A;  1NR0 A;  4WK0 A;  4PXW A;  4XYH A;  5HE1 B;  1E8N A;  4Z7N A;  4D9S A;  5I5I A;  1GOF A;  4ERZ A;  3IJ0 A;  1JMZ B;  3ZE0 A;  4UM8 A;  4LG8 A;  2Z2P A;  4D0K A;  4L1Q D;  1MG3 A;  4JXM A;  5IGQ A;  3DSM A;  1PGU A;  1PBY B;  4QRJ A;  4G56 B;  4Z8L A;  3V5W B;  2EIC A;  3I7K A;  5GSA A;  3DDU A;  3K6S A;  5HDB A;  3IUQ A;  3IUM A;  5AMS A;  4NSX A;  3P4F A;  3UVM A;  3IIY A;  3IUL A;  2OJY A;  3IUJ A;  2W18 A;  3PSL A;  2H9L A;  1XIP A;  3SHF A;  5CXB A;  4K3I D;  3UKR C;  4JSP C;  5CYK A;  2H3X A;  3OKY B;  1TBG A;  2XDW A;  1L5G A;  2OK4 A;  2PM7 B;  2VZ1 A;  2CN3 A;  5H14 A;  3BWS A;  3PXS D;  2XU7 A;  3SN6 B;  3L4O D;  4E54 A;  3EI2 A;  4E54 B;  2HKR A;  2H13 A;  2PBI B;  3EI2 B;  3RFG A;  4U7A A;  2AGZ A;  4JHP C;  2YNO A;  4LG9 A;  3K27 A;  4O3U B;  2Z2O A;  1VYH C;  2I0R A;  3RN0 D;  3N0E A;  2BCJ B;  3OL2 A;  3FCU A;  3OL2 B;  3QI0 A;  5IT9 g;  5EMK B;  1SHY B;  5FFO A;  3L4M D;  5E6R A;  4JSV C;  4CY1 A;  3N0D A;  2IUV A;  2VDN A;  4Y5R D;  3IUN A;  4BUJ C;  3DXM C;  5EMM B;  1Q47 A;  2H9P A;  5HE3 B;  5M5R A;  3VH0 A;  4J79 A;  1UTC A;  3MKQ A;  5THA A;  3VA6 A;  4GQ2 P;  4AN1 A;  3ULE C;  5IGO A;  4FAN D;  5A2Q g;  1JMX B;  4J0X A;  5EAL A;  4O02 A;  3C9C A;  2IUR A;  1JV2 A;  2H47 A;  3ZDX A;  3AH8 B;  1A12 A;  2I0S A;  2XYI A;  3SCY A;  2HU8 A;  2B5L A;  4J84 A;  3AL9 A;  3GRE A;  3SXT D;  5FKT A;  4UM9 A;  2B5M A;  2EBS A;  3AL8 A;  2VZ3 A;  3GFC A;  3I7P A;  2XZG A;  3IVM A;  2AGL A;  4J78 A;  4CI2 A;  3AFC A;  2I3T A;  3UR4 A;  3JZG A;  3PXW D;  5C92 A;  5EML B;  2CO0 A;  1MDA H;  3B7F A;  2XL2 A;  3EMH A;  2CE8 A;  1B9Y A;  4CI1 A;  5HYN B;  2OK6 A;  4MMY A;  2JKX A;  3EI4 A;  1H2W A;  4PNK B;  2AH1 A;  3EI4 B;  4ZN4 A;  2BKL A;  2J57 G;  3JB9 L;  3QHY B;  3RN1 D;  4J0W A;  4AMZ A;  5H17 A;  1I2M B;  1ERJ A;  2P9I C;  1K32 A;  4CZY A;  3VI4 A;  1QNI A;  4ZOY A;  1UOP A;  3SJL D;  3MZK A;  3NVQ A;  3PSC B;  5CXC A;  3W15 A;  3EI1 B;  3EQ8 A;  5CXC B;  3IKO A;  2UZY B;  5FFG A;  4RE6 A;  2XE4 A;  4ZOX A;  3C5M A;  4L3G D;  5K19 A;  1GOT B;  5HQG A;  4XEI C;  3E0C A;  3OW8 A;  4GGA A;  1VE7 A;  1K3I A;  4TZ4 A;  3UKU C;  2HXC A;  4EWR A;  2QC5 A;  3I89 A;  4IMM A;  3V4P A;  3MUN A;  4ERY A;  4BL0 A;  5C9Z B;  5TF2 A;  5GXI A;  1QFS A;  2P9P C;  3NID A;  3I8C A;  3CFV A;  3DWL C;  4KFM B;  3EQ7 A;  4L9O A;  3FCS A;  3MXX A;  3PE7 A;  4I79 A;  4ERQ A;  2I3S A;  1U4C A;  1SQJ A;  2HJ4 A;  3I8E A;  4PSX B;  3JAM g;  2B5N A;  3OKY A;  4A0A B;  5TEF A;  5H1M A;  5EAM A;  3IIW A;  2B4E A;  2TRC B;  1L0Q A;  2OIZ A;  5FXY A;  5GMK n;  5FKR A;  3OF7 A;  1M1X A;  1JTD B;  4E5Z B;  2AH0 A;  2P9U C;  1B9X A;  3ORV D;  3A0F A;  2HU7 A;  3ZDY A;  3MKS B;  4A08 A;  4A08 B;  4JT5 C;  4DNW A;  5SXM A;  2HYE A;  5AJA A;  4N14 A;  5GXH A;  2YNN A;  4WJK A;  2CN2 A;  3FRX A;  3V9F A;  3EG6 A;  4RE5 A;  4GQB B;  4O9D A;  4NBM A;  2HKM A;  4G1E A;  4PC0 A;  2H9N A;  3UVL A;  4FA1 D;  4H5J A;  4J82 A;  2AQ5 A;  3C75 H;  3UVO A;  4J8G A;  2H6K A;  4WK2 A;  1K8K C;  2EIB A;  4DNU A;  2VDR A;  4PBY A;  4ES0 A;  5IC7 A;  4A0B B;  4BP9 A;  3EI3 A;  1T2X A;  2H6N A;  4O45 A;  3EI3 B;  3SWS D;  1PEV A;  3DM0 A;  3OKW A;  1GP2 B;  3I7H A;  1SQ9 A;  3J80 g;  1H2Z A;  1O6F A;  1GOH A;  2OVR B;  3EQ9 A;  5IJ7 E;  2HJB A;  3KCI A;  4O1Q D;  3RMZ D;  2PM6 B;  1GOG A;  1U2V C;  2BBK H;  2H14 A;  5C2W B;  5TDH B;  1VE6 A;  1XHM A;  2WQ8 A;  2VDQ A;  3PVW B;  3IJ1 A;  1BPO A;  2GNQ A;  4QQE A;  3JZN A;  4ZOZ A;  5C2V B;  4FA4 D;  2AGY A;  4X61 B;  4FA9 D;  4GQ1 A;  2VDO A;  1C9L A;  2CE9 A;  2VC2 A;  4JSX C;  5AFU 3;  1R5M A;  3HFQ A;  3JRP A;  3MMY A;  3CIK B;  2VDL A;  4CI3 A;  4CC9 A;  5B4W A;  5HE0 B;  1GG2 B;  1JJU B;  5E6S A;  4IA9 A;  1N6E A;  2H6Q A;  2H9M A;  5FKS A;  5EM2 B;  2I0T A;  5C86 A;  2G9A A;  4FB1 D;  4GZ8 A;  4XYI A;  2GC4 A;  4UI9 R;  2CO0 C;  1H2X A;  2QR5 A;  4K3J B;  4A09 B;  3IJC A;  3JZH A;  4L1M A;  4O2W A;  1P22 A;  3EI1 A;  4G1M A;  5FA5 B;  3J81 g;  4A7J A;  5K1C C;  2YBA A;  2PM9 A;  3JRO A;  3I7O A;  3EU7 A;  4J8B A;  5FQD A;  3F3G A;  2PM9 B;  2EIE A;  5TEE A;  5M5T A;  3SBQ A;  1RI6 A;  1TYE A;  3GC3 B;  4MK0 B;  5I5M A;  4DNV A;  4O3T B;  4OWR A;  2O9K A;  1QFM A;  4U1E I;  2VDP A;  2AGW A;  1NEX B;  2IWF A;  3PXT D;  1S4U X;  4CI8 A;  3SBR A;  3IUR A;  1O6G A;  3I7N A;  3ZDZ A;  3I2N A;  5M5S A;  2CNX A;  4FAV D;  4J86 A;  2P9S C;  1XKS A;  2EID A;  1N6F A;  4JD2 C;  4AOW A;  1H2Y A;  4A0A A;  4GGD A;  4D6V A;  2IAA A;  4QT8 A;  3BG0 A;  5KDO B;  3KRX B;  4J81 A;  3V7D B;  4GMB A;  3DXK C;  2P9L C;  3PVU B;  1UOO A;  5EMJ B;  3ZE2 A;  4FWW A;  4E5Z A;  1VZ2 A;  3ODT A;  3RSE C;  2QZP A;  4WK4 A;  1C9I A;  2HU5 A;  2Z2N A;  4LGN A;  4ESG A;  4CY5 A;  2Q7Q A;  2VDK A;  3NVN A;  5IJ8 E;  2P9N C;  3VI3 A;  3V4V A;  5HE2 B;  4QAM A;  2VDM A;  3SBP A;  4OZU A;  4R7A B;  3FM0 A;  3RLM D;  5CXB B;  4AMY A;  3O4J A;  4AX4 A; 
#chains in the Genus database with same CATH homology
 5CYK B;  4GGC A;  4PBZ A;  2J55 H;  4H5I A;  1YFQ A;  3NVX A;  3EWE A;  4YVD A;  5EAR A;  4FHL A;  3UVN A;  3RFH A;  2P9K C;  4CY2 A;  4HDJ A;  4JSN C;  3U4Y A;  3UVK A;  3JPX A;  3OTT A;  4X60 B;  4CZX A;  4J87 A;  3I7L A;  4A0B A;  2J56 H;  2AGX A;  4A2L A;  3SLE D;  2OVQ B;  4X63 B;  3K26 A;  3VGZ A;  1TYQ C;  4FA5 D;  4A2M A;  4GM8 A;  4PSW B;  3ZWL B;  5FLX g;  3KRW B;  4JT6 C;  3SMR A;  5JWZ A;  3RRM C;  2IWK A;  4BH6 A;  4A11 A;  4Y7R A;  4A11 B;  1FWX A;  1JOF A;  4QL1 A;  4CY3 A;  2UZX B;  1N6D A;  4J77 A;  3OKT A;  2GC7 A;  2HES X;  1OMW B;  2IUP A;  2QXV A;  4X3E A;  2XL3 A;  2OVP B;  5EM2 A;  1GXR A;  3CFS B;  2YB8 B;  5I5J A;  5FKQ A;  1MG2 A;  4A09 A;  2H68 A;  2G99 A;  2MTA H;  4GM9 A;  3AL8 B;  2YNP A;  3F3F A;  2IUQ A;  4J73 A;  4ZOV A;  4L3H D;  2YMU A;  1OLZ A;  1PI6 A;  5EAP A;  3SFZ A;  1A0R B;  3C99 A;  3MZL A;  3F3P A;  4AEZ A;  3BG1 A;  3FGB A;  3SVW D;  4CZV A;  4GM3 A;  1NR0 A;  4PXW A;  4XYH A;  5HE1 B;  5I5I A;  4ERZ A;  3IJ0 A;  1JMZ B;  4LG8 A;  2Z2P A;  4D0K A;  4L1Q D;  1MG3 A;  4JXM A;  5IGQ A;  3DSM A;  1PGU A;  1PBY B;  4QRJ A;  4G56 B;  4Z8L A;  3V5W B;  3I7K A;  5GSA A;  5AMS A;  4NSX A;  3P4F A;  3UVM A;  3IIY A;  2OJY A;  2W18 A;  3PSL A;  2H9L A;  1XIP A;  3SHF A;  5CXB A;  4K3I D;  3UKR C;  4JSP C;  5CYK A;  2H3X A;  3OKY B;  1TBG A;  2OK4 A;  2PM7 B;  2CN3 A;  5H14 A;  3BWS A;  3PXS D;  2XU7 A;  3SN6 B;  3L4O D;  4E54 A;  3EI2 A;  4E54 B;  2HKR A;  2H13 A;  2PBI B;  3EI2 B;  3RFG A;  4U7A A;  2AGZ A;  4LG9 A;  2YNO A;  3K27 A;  4O3U B;  2Z2O A;  1VYH C;  2I0R A;  3RN0 D;  3N0E A;  2BCJ B;  3OL2 A;  3OL2 B;  5IT9 g;  5EMK B;  1SHY B;  3L4M D;  4JSV C;  4CY1 A;  3N0D A;  2IUV A;  4Y5R D;  4BUJ C;  3DXM C;  5EMM B;  1Q47 A;  2H9P A;  5HE3 B;  3VH0 A;  4J79 A;  5THA A;  3MKQ A;  3VA6 A;  4GQ2 P;  3ULE C;  5IGO A;  4FAN D;  5A2Q g;  1JMX B;  4J0X A;  5EAL A;  3C9C A;  2IUR A;  2H47 A;  3AH8 B;  2I0S A;  2XYI A;  3SCY A;  2B5L A;  4J84 A;  3AL9 A;  3GRE A;  3SXT D;  5FKT A;  2B5M A;  2EBS A;  3AL8 A;  3GFC A;  3I7P A;  2AGL A;  4J78 A;  4CI2 A;  3AFC A;  2I3T A;  3UR4 A;  3JZG A;  3PXW D;  5EML B;  2CO0 A;  1MDA H;  3B7F A;  2XL2 A;  3EMH A;  2CE8 A;  1B9Y A;  4CI1 A;  5HYN B;  2OK6 A;  3EI4 A;  4PNK B;  2AH1 A;  3EI4 B;  4ZN4 A;  2J57 G;  3JB9 L;  3RN1 D;  4J0W A;  5H17 A;  1ERJ A;  2P9I C;  1K32 A;  4CZY A;  1QNI A;  4ZOY A;  3SJL D;  3MZK A;  3NVQ A;  3PSC B;  5CXC A;  3W15 A;  3EI1 B;  5CXC B;  3IKO A;  2UZY B;  4ZOX A;  3C5M A;  4L3G D;  5K19 A;  1GOT B;  5HQG A;  4XEI C;  3E0C A;  3OW8 A;  4GGA A;  4TZ4 A;  3UKU C;  2HXC A;  4EWR A;  2QC5 A;  3I89 A;  4IMM A;  4ERY A;  4BL0 A;  5C9Z B;  5TF2 A;  5GXI A;  2P9P C;  3I8C A;  3CFV A;  3DWL C;  4KFM B;  4L9O A;  3MXX A;  3PE7 A;  4I79 A;  4ERQ A;  2I3S A;  1U4C A;  1SQJ A;  2HJ4 A;  3I8E A;  4PSX B;  3JAM g;  2B5N A;  3OKY A;  4A0A B;  5TEF A;  5H1M A;  5EAM A;  3IIW A;  2B4E A;  2TRC B;  1L0Q A;  2OIZ A;  5FXY A;  5GMK n;  5FKR A;  4E5Z B;  2AH0 A;  2P9U C;  1B9X A;  3ORV D;  3A0F A;  3MKS B;  4A08 A;  4A08 B;  4JT5 C;  5SXM A;  2HYE A;  5AJA A;  4N14 A;  5GXH A;  2YNN A;  2CN2 A;  3FRX A;  3V9F A;  3EG6 A;  4GQB B;  4O9D A;  3UVL A;  2HKM A;  4PC0 A;  4FA1 D;  2H9N A;  4H5J A;  4J82 A;  2AQ5 A;  3C75 H;  3UVO A;  4J8G A;  2H6K A;  1K8K C;  4PBY A;  4ES0 A;  5IC7 A;  4A0B B;  3EI3 A;  2H6N A;  4O45 A;  3EI3 B;  3SWS D;  1PEV A;  3DM0 A;  3OKW A;  1GP2 B;  3I7H A;  1SQ9 A;  3J80 g;  2OVR B;  5IJ7 E;  2HJB A;  4O1Q D;  3RMZ D;  2PM6 B;  1U2V C;  2BBK H;  2H14 A;  5C2W B;  5TDH B;  1XHM A;  3PVW B;  3IJ1 A;  2GNQ A;  4QQE A;  4ZOZ A;  3JZN A;  5C2V B;  4FA4 D;  2AGY A;  4X61 B;  4FA9 D;  4GQ1 A;  4JSX C;  2CE9 A;  5AFU 3;  1R5M A;  3HFQ A;  3JRP A;  3MMY A;  3CIK B;  4CI3 A;  4CC9 A;  5B4W A;  5HE0 B;  1GG2 B;  1JJU B;  4IA9 A;  1N6E A;  2H6Q A;  2H9M A;  5FKS A;  5EM2 B;  2I0T A;  2G9A A;  4FB1 D;  4GZ8 A;  4XYI A;  2GC4 A;  4UI9 R;  2CO0 C;  4K3J B;  4A09 B;  3IJC A;  3JZH A;  1P22 A;  3EI1 A;  5FA5 B;  3J81 g;  4A7J A;  5K1C C;  2YBA A;  2PM9 A;  3JRO A;  4J8B A;  3EU7 A;  3I7O A;  5FQD A;  3F3G A;  2PM9 B;  5TEE A;  3SBQ A;  1RI6 A;  4MK0 B;  5I5M A;  4O3T B;  4OWR A;  2O9K A;  4U1E I;  2AGW A;  1NEX B;  2IWF A;  3PXT D;  1S4U X;  4CI8 A;  3SBR A;  3I7N A;  3I2N A;  2CNX A;  4FAV D;  4J86 A;  2P9S C;  1XKS A;  1N6F A;  4JD2 C;  4AOW A;  4A0A A;  4GGD A;  4D6V A;  2IAA A;  4QT8 A;  3BG0 A;  5KDO B;  3KRX B;  4J81 A;  3V7D B;  4GMB A;  3DXK C;  2P9L C;  3PVU B;  4E5Z A;  5EMJ B;  4FWW A;  3ODT A;  3RSE C;  2Z2N A;  4LGN A;  4ESG A;  4CY5 A;  2Q7Q A;  3NVN A;  5IJ8 E;  2P9N C;  5HE2 B;  3SBP A;  4OZU A;  4R7A B;  3FM0 A;  3RLM D;  5CXB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...