2BBKH

Crystal structure of the quinoprotein methylamine dehydrogenase from paracoccus denitrificans at 1.75 angstroms
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
355
structure length
355
Chain Sequence
DEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHYLAMINE DEHYDROGENASE (HEAVY SUBUNIT)
publication title Refined crystal structure of methylamine dehydrogenase from Paracoccus denitrificans at 1.75 A resolution.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
total genus 85
structure length 355
sequence length 355
chains with identical sequence J
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 1993-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2bbkH00
4O3UB 3SMRA 2AGLA 1VYHC 2YMUA 4AOWA 3AFCA 4CY5A 5HYNB 5GXIA 4A2LA 2Q7QA 4H5IA 5EMKB 1SHYB 3I7OA 2XU7A 2YNOA 3EU7A 1XHMA 3IJ0A 4ZN4A 3UVKA 4L3GD 2I3TA 2OJYA 3ODTA 3SBPA 2AQ5A 4PXWA 5EMJB 5JWZA 4UI9R 3IIWA 4J79A 1L0QA 2YB8B 4OWRA 5FKRA 3C9CA 2G9AA 3VGZA 4J81A 4PNKB 1TYQC 5AFU3 4ZOYA 4D0KA 4FA5D 2H3XA 5H17A 1JMZB 3AL8B 5IGOA 2H6QA 3IJCA 2OK6A 3MZKA 5IJ7E 2QXVA 3UVMA 3FRXA 3IJ1A 5C9ZB 3NVXA 3UR4A 2GNQA 1P22A 3RFGA 3PXTD 4FB1D 4G56B 2OIZA 2H9PA 5H14A 3DWLC 4O45A 4XYHA 5FQDA 3JZGA 4JD2C 4A7JA 5FLXg 2IUPA 4CY1A 4QL1A 2IUQA 5IGQA 3EWEA 2TRCB 4A0AA 2O9KA 4ZOZA 5TEEA 1MG3A 2YNPA 3K27A 4U7AA 5IT9g 1SQ9A 2H9LA 3RN0D 3PVUB 4ES0A 3DXMC 4L3HD 4A08B 4Y5RD 3UKRC 2CE9A 3ZWLB 4J82A 3HFQA 4K3JB 2OVRB 5AJAA 3SLED 5EMMB 3JB9L 3V5WB 1K8KC 1ERJA 3CIKB 3EI4B 5FA5B 3EI1A 1PEVA 4J0XA 3RSEC 3NVQA 4Y7RA 2I0SA 3RN1D 4QRJA 2PM9B 4CI3A 2HKRA 2G99A 4GQBB 2J55H 5GXHA 2HJ4A 3I7NA 3VA6A 2GC7A 3OKYA 2YNNA 3SCYA 3SFZA 1K32A 3JRPA 1N6FA 1TBGA 4A11A 1U2VC 2IAAA 5A2Qg 4BH6A 5CYKA 5EMLB 4GQ2P 3EI2A 3JZHA 4D6VA 3MMYA 4J8BA 4CI8A 2H13A 3I7PA 4XEIC 4GM8A 5EM2A 5HE0B 1OLZA 1RI6A 1JJUB 2H6NA 2H6KA 5CXBB 3B7FA 3UVOA 2P9SC 5IJ8E 2W18A 2OK4A 3SHFA 1MDAH 2CE8A 3K26A 2J56H 4FHLA 2EBSA 3J80g 4ERZA 2Z2PA 3AH8B 2UZXB 4PSWB 3DM0A 4U1EI 3I89A 2CN3A 5HE2B 3I7LA 4A0BB 4CI2A 1XKSA 3V7DB 4XYIA 4A09B 2OVPB 2CO0C 2H9NA 5B4WA 1QNIA 3CFVA 5CXCB 3OW8A 4CZVA 4JT5C 4J0WA 4ZOXA 5TEFA 3JPXA 5EAPA 2B4EA 2QC5A 3C75H 4EWRA 1PBYB 3OKWA 3CFSB 3OL2B 3VH0A 3UKUC 2XL3A 2BCJB 3JZNA 4PC0A 3I8EA 3EI3B 5GSAA 1GXRA 3JAMg 4E54B 2AGWA 2I0TA 5IC7A 2HKMA 4FA4D 4I79A 3RRMC 4QT8A 4ZOVA 3N0DA 3F3PA 4FAVD 4X60B 4ERQA 2H47A 4JSVC 5EARA 3SN6B 2I0RA 4LG8A 2H9MA 3I2NA 2IWFA 4J78A 1Q47A 2I3SA 3AL8A 1NEXB 4O3TB 3NVNA 4QQEA 3ORVD 2AH0A 3UVNA 5C2WB 3SBRA 1S4UX 4BL0A 1YFQA 4L9OA 4O9DA 5EAMA 4BUJC 4Z8LA 5HQGA 3BWSA 2Z2NA 3C5MA 3U4YA 5KDOB 4E5ZB 3FGBA 4X61B 5HE3B 3OTTA 2IWKA 3L4MD 2P9PC 4J86A 2PM6B 4JSXC 4PSXB 3W15A 2Z2OA 5TF2A 4IA9A 4NSXA 5AMSA 4A08A 2IURA 1B9XA 4JSNC 4K3ID 4CY3A 5I5JA 3BG1A 3V9FA 2P9NC 4GQ1A 1SQJA 4YVDA 5FKTA 3J81g 3KRXB 2XYIA 2AGZA 3L4OD 4GZ8A 1R5MA 5H1MA 3I8CA 3F3GA 1JMXB 3GFCA 5K1CC 4L1QD 3EI4A 4PBYA 4KFMB 2CNXA 3DSMA 3I7HA 2PM9A 2IUVA 5TDHB 1XIPA 5I5IA 2HJBA 4JXMA 4LGNA 4J77A 4AEZA 3UVLA 3GREA 4H5JA 5I5MA 4GMBA 4CZXA 3SWSD 4ESGA 4GM3A 5FKQA 3PSCB 4ERYA 5HE1B 3MKSB 2P9LC 4O1QD 3EMHA 4J87A 3SVWD 2J57G 3AL9A 5K19A 2B5LA 3PE7A 2OVQB 3PSLA 4GM9A 5CXBA 4JSPC 3C99A 4FA9D 1N6DA 2CN2A 4FAND 4A0AB 1GG2B 2CO0A 3SJLD 5C2VB 3IIYA 2PBIB 2H14A 2MTAH 4GGDA 2P9KC 2YBAA 4A0BA 4FWWA 3JROA 1MG2A 1NR0A 4IMMA 2XL2A 4J73A 3ULEC 4A09A 4J8GA 5FXYA 3EG6A 1PGUA 1U4CA 1B9YA 3F3FA 3RFHA 1JOFA 4X63B 1PI6A 5CXCA 4R7AB 3FM0A 4PBZA 4FA1D 4A2MA 3EI1B 5EALA 3MZLA 4JT6C 4CC9A 4J84A 3PXWD 4MK0B 5GMKn 3KRWB 3OL2A 2AH1A 3SBQA 3A0FA 3EI3A 4X3EA 3OKYB 4E54A 3N0EA 4A11B 3I7KA 5SXMA 3SXTD 5CYKB 4TZ4A 4CY2A 3E0CA 4GGAA 2HXCA 4HDJA 3EI2B 2AGYA 2B5NA 2BBKH 1A0RB 1GOTB 5EM2B 3DXKC 3OKTA 4GGCA 1OMWB 1GP2B 4CZYA 2P9IC 1FWXA 3IKOA 5THAA 4CI1A 2GC4A 3RMZD 2UZYB 2H68A 2B5MA 1N6EA 2HYEA 3P4FA 4OZUA 5FKSA 3PXSD 2PM7B 2AGXA 4E5ZA 3PVWB 4LG9A 3RLMD 3MKQA 2P9UC 2HESX 3MXXA 3BG0A 4N14A
chains in the Genus database with same CATH superfamily
1VZ3A 4WJKA 4O3UB 3SMRA 2AGLA 1VYHC 2YMUA 4AOWA 3AFCA 4CY5A 1GOHA 3VI3A 5HYNB 5GXIA 4A2LA 2Q7QA 4DNWA 4H5IA 5EMKB 1SHYB 4DNVA 3I7OA 3IJEA 2XU7A 3V4VA 2XZGA 2YNOA 4Z7QA 1C9LA 3EU7A 1XHMA 3IJ0A 4ZN4A 2XDWA 4L3GD 3UVKA 2I3TA 2OJYA 3ODTA 3SBPA 2AQ5A 5E6UA 4PXWA 5EMJB 5JWZA 4UI9R 5C86A 3IIWA 4J79A 1L0QA 2YB8B 3GC3B 4OWRA 5FKRA 3C9CA 2VDPA 2G9AA 3VGZA 4J81A 1VE6A 1TYQC 4PNKB 4Z7OA 5AFU3 4ZOYA 4D0KA 4FA5D 3ZE1A 2H3XA 5H17A 4AMYA 1JMZB 3AL8B 2XE4A 5IGOA 3IJCA 2H6QA 1JV2A 2OK6A 3MZKA 5IJ7E 2QXVA 3UVMA 3FRXA 3IJ1A 5C9ZB 3NVXA 3MUOA 3UR4A 2GNQA 1P22A 3RFGA 2VDOA 3PXTD 4FB1D 4G56B 2OIZA 2H9PA 5H14A 3DWLC 1UOOA 5E6RA 4O45A 4XYHA 5FQDA 3JZGA 4JD2C 3O4GA 4A7JA 5M5RA 4JHPC 2IUPA 3ZDZA 5FLXg 4CY1A 4QL1A 1GOGA 3K6SA 1T2XA 2HU7A 2IUQA 3IULA 5IGQA 4MMYA 3EWEA 2TRCB 4A0AA 1M1XA 5M61A 2O9KA 4ZOZA 5TEEA 1MG3A 2YNPA 3K27A 4U7AA 5IT9g 1SQ9A 2H9LA 3RN0D 3PVUB 4ES0A 3DXMC 4L3HD 4QAMA 4A08B 4AMZA 4Y5RD 3UKRC 2CE9A 3ZWLB 4J82A 3ZDYA 3HFQA 4K3JB 3ZE0A 1UOQA 4JHNA 2OVRB 5AJAA 2EICA 3SLED 5EMMB 3JB9L 5C92A 3V5WB 1K8KC 1ERJA 3CIKB 1JTDB 3EI4B 5HDBA 5FA5B 3EI1A 1PEVA 4J0XA 3RSEC 3NVQA 4Y7RA 2I0SA 3RN1D 4QRJA 2PM9B 4CI3A 2VDQA 2EIBA 1I2MB 1QFMA 2HKRA 2G99A 4GQBB 2J55H 5GXHA 2HJ4A 3I7NA 3VA6A 2GC7A 3OKYA 2YNNA 3SCYA 3SFZA 3JRPA 1K32A 1N6FA 3V4PA 1TBGA 4A11A 4BP9A 1U2VC 2IAAA 5A2Qg 4BH6A 5CYKA 5EMLB 4GQ2P 3EI2A 3JZHA 4D6VA 3MUNA 3MMYA 4J8BA 4CI8A 2WQ8A 5E6SA 2H13A 3I7PA 4XEIC 4GM8A 5EM2A 5HE0B 1OLZA 1RI6A 1JJUB 2VDRA 4D9SA 2H6NA 2H6KA 5CXBB 3B7FA 3UVOA 2P9SC 5IJ8E 2W18A 2VC2A 3K71A 4O2WA 2OK4A 3SHFA 3FCUA 1MDAH 2CE8A 3K26A 2J56H 2VZ3A 4FHLA 2EBSA 3J80g 4ERZA 2Z2PA 3AH8B 2UZXB 3O4IA 4PSWB 3DM0A 2BKLA 4U1EI 3I89A 2CN3A 3QHYB 5HE2B 4BCCA 3I7LA 3IUNA 1VZ2A 3NIGA 4A0BB 4CI2A 1XKSA 4G1EA 3V7DB 4XYIA 4A09B 2OVPB 3NIDA 2CO0C 2H9NA 4O02A 5B4WA 1QNIA 4AX4A 2VDKA 3CFVA 5CXCB 3OW8A 4BCDA 4CZVA 4JT5C 4J0WA 4ZOXA 5TEFA 3JPXA 5EAPA 2B4EA 2QC5A 3ZDXA 3C75H 4EWRA 3IUMA 1PBYB 3OKWA 3CFSB 3OL2B 4RE5A 3VH0A 3UKUC 2XL3A 2BCJB 3JZNA 4PC0A 3I8EA 3EI3B 5GSAA 1GXRA 3JAMg 4E54B 2AGWA 1K3IA 1C9IA 2I0TA 5IC7A 2HKMA 3FCSA 2QZPA 4FA4D 4I79A 3RRMC 4QT8A 4ZOVA 1UOPA 3IUQA 3N0DA 4MMZA 5FFOA 3F3PA 4FAVD 4X60B 1VE7A 4ERQA 3EQ8A 2H47A 4JSVC 5EARA 3T3PA 3K72A 3SN6B 1H2ZA 2I0RA 4LG8A 2H9MA 3I2NA 2IWFA 4J78A 1Q47A 2I3SA 3AL8A 1NEXB 4O3TB 3NVNA 4QQEA 3KCIA 3ORVD 2AH0A 1E8NA 3UVNA 5C2WB 3SBRA 1S4UX 3IVMA 4BL0A 3IUJA 1YFQA 3O4HA 4L9OA 4O9DA 5EAMA 2HU8A 4BUJC 4Z8LA 5HQGA 3BWSA 2VZ1A 2Z2NA 3C5MA 3U4YA 5KDOB 3EQ7A 4E5ZB 3FGBA 1A12A 1GOFA 4X61B 5FFGA 5HE3B 4NC4A 3OTTA 2IWKA 3EQ9A 2P9PC 3L4MD 4J86A 2PM6B 4JSXC 4PSXB 3W15A 2Z2OA 5TF2A 4IA9A 4NSXA 4G1MA 1QFSA 5AMSA 4A08A 2IURA 2JKXA 1B9XA 4JSNC 4K3ID 4CY3A 5I5JA 3BG1A 3V9FA 2P9NC 4GQ1A 1SQJA 4YVDA 5FKTA 3J81g 5M5UA 3KRXB 2XYIA 2AGZA 3L4OD 4UM9A 4WK2A 1O6GA 4GZ8A 4AN0A 1R5MA 5H1MA 3I8CA 3F3GA 1JMXB 1U8CA 3GFCA 5K1CC 4L1QD 3EI4A 4DNUA 5M5VA 4PBYA 4KFMB 2CNXA 3DSMA 3I7HA 1E8MA 2PM9A 2IUVA 5TDHB 1XIPA 5I5IA 2HJBA 3QI0A 4JXMA 1H2XA 4NAAA 1E5TA 4LGNA 4J77A 2EIDA 4AEZA 3UVLA 3GREA 1H2YA 4H5JA 5I5MA 4GMBA 4CZXA 3SWSD 4ESGA 1YR2A 4BP8A 4GM3A 5FKQA 3PSCB 4WK4A 4ERYA 5HE1B 3MKSB 2P9LC 4O1QD 3EMHA 4J87A 4WK0A 3SVWD 2J57G 3AL9A 5K19A 2B5LA 3PE7A 1TYEA 2VDNA 2OVQB 3PSLA 4RE6A 4GM9A 1BPOA 1UTCA 5CXBA 3T3MA 4JSPC 3C99A 2VDLA 4FA9D 1N6DA 2CN2A 4FAND 4A0AB 3ZE2A 1GG2B 2CO0A 3SJLD 5C2VB 3IIYA 4NBMA 2PBIB 2H14A 2MTAH 1H2WA 2P9KC 4GGDA 4L1MA 2YBAA 4A0BA 4FWWA 3JROA 1MG2A 1NR0A 4IMMA 2XL2A 4J73A 3ULEC 4A09A 4J8GA 5M5SA 5FXYA 3EG6A 1PGUA 1U4CA 1B9YA 1L5GA 3F3FA 3RFHA 1JOFA 4X63B 1PI6A 5CXCA 4R7AB 3DDUA 3FM0A 4PBZA 4FA1D 4A2MA 3EI1B 5EALA 3MZLA 4JT6C 4CC9A 4G55A 3OF7A 4J84A 4MMXA 3PXWD 3VI4A 3O4JA 4MK0B 5M5TA 5GMKn 3KRWB 3OL2A 2QR5A 3GD1I 2AH1A 3SBQA 3A0FA 3EI3A 4X3EA 3OKYB 4E54A 1O6FA 3MVDK 3N0EA 4Z7NA 4A11B 3I7KA 4UM8A 5SXMA 3IURA 3SXTD 5CYKB 4TZ4A 4CY2A 3E0CA 4GGAA 2HXCA 4HDJA 3EI2B 2AGYA 2B5NA 2BBKH 2HU5A 1A0RB 1GOTB 4IRZA 5EM2B 3DXKC 3NIFA 3OKTA 4GGCA 2EIEA 1OMWB 2VDMA 1GP2B 4CZYA 2P9IC 1FWXA 3IKOA 5THAA 4CI1A 2GC4A 3RMZD 4BCBA 2UZYB 2H68A 2B5MA 1N6EA 2HYEA 3P4FA 4OZUA 5FKSA 3PXSD 2PM7B 2AGXA 4NENA 4E5ZA 3PVWB 4LG9A 3RLMD 3MKQA 2P9UC 2HESX 3MXXA 3BG0A 4AN1A 4N14A
chains in the Genus database with same CATH topology
4O3UB 3SMRA 2AGLA 1VYHC 2YMUA 4AOWA 3AFCA 4CY5A 5HYNB 5GXIA 4A2LA 2Q7QA 4H5IA 5EMKB 1SHYB 3I7OA 2XU7A 2YNOA 3EU7A 1XHMA 3IJ0A 4ZN4A 3UVKA 4L3GD 2I3TA 2OJYA 3ODTA 3SBPA 2AQ5A 4PXWA 5EMJB 5JWZA 4UI9R 3IIWA 4J79A 1L0QA 2YB8B 4OWRA 5FKRA 3C9CA 2G9AA 3VGZA 4J81A 4PNKB 1TYQC 5AFU3 4ZOYA 4D0KA 4FA5D 2H3XA 5H17A 1JMZB 3AL8B 5IGOA 2H6QA 3IJCA 2OK6A 3MZKA 5IJ7E 2QXVA 3UVMA 3FRXA 3IJ1A 5C9ZB 3NVXA 3UR4A 2GNQA 1P22A 3RFGA 3PXTD 4FB1D 4G56B 2OIZA 2H9PA 5H14A 3DWLC 4O45A 4XYHA 5FQDA 3JZGA 4JD2C 4A7JA 5FLXg 2IUPA 4CY1A 4QL1A 2IUQA 5IGQA 3EWEA 2TRCB 4A0AA 2O9KA 4ZOZA 5TEEA 1MG3A 2YNPA 3K27A 4U7AA 5IT9g 1SQ9A 2H9LA 3RN0D 3PVUB 4ES0A 3DXMC 4L3HD 4A08B 4Y5RD 3UKRC 2CE9A 3ZWLB 4J82A 3HFQA 4K3JB 2OVRB 5AJAA 3SLED 5EMMB 3JB9L 3V5WB 1K8KC 1ERJA 3CIKB 3EI4B 5FA5B 3EI1A 1PEVA 4J0XA 3RSEC 3NVQA 4Y7RA 2I0SA 3RN1D 4QRJA 2PM9B 4CI3A 2HKRA 2G99A 4GQBB 2J55H 5GXHA 2HJ4A 3I7NA 3VA6A 2GC7A 3OKYA 2YNNA 3SCYA 3SFZA 1K32A 3JRPA 1N6FA 1TBGA 4A11A 1U2VC 2IAAA 5A2Qg 4BH6A 5CYKA 5EMLB 4GQ2P 3EI2A 3JZHA 4D6VA 3MMYA 4J8BA 4CI8A 2H13A 3I7PA 4XEIC 4GM8A 5EM2A 5HE0B 1OLZA 1RI6A 1JJUB 2H6NA 2H6KA 5CXBB 3B7FA 3UVOA 2P9SC 5IJ8E 2W18A 2OK4A 3SHFA 1MDAH 2CE8A 3K26A 2J56H 4FHLA 2EBSA 3J80g 4ERZA 2Z2PA 3AH8B 2UZXB 4PSWB 3DM0A 4U1EI 3I89A 2CN3A 5HE2B 3I7LA 4A0BB 4CI2A 1XKSA 3V7DB 4XYIA 4A09B 2OVPB 2CO0C 2H9NA 5B4WA 1QNIA 3CFVA 5CXCB 3OW8A 4CZVA 4JT5C 4J0WA 4ZOXA 5TEFA 3JPXA 5EAPA 2B4EA 2QC5A 3C75H 4EWRA 1PBYB 3OKWA 3CFSB 3OL2B 3VH0A 3UKUC 2XL3A 2BCJB 3JZNA 4PC0A 3I8EA 3EI3B 5GSAA 1GXRA 3JAMg 4E54B 2AGWA 2I0TA 5IC7A 2HKMA 4FA4D 4I79A 3RRMC 4QT8A 4ZOVA 3N0DA 3F3PA 4FAVD 4X60B 4ERQA 2H47A 4JSVC 5EARA 3SN6B 2I0RA 4LG8A 2H9MA 3I2NA 2IWFA 4J78A 1Q47A 2I3SA 3AL8A 1NEXB 4O3TB 3NVNA 4QQEA 3ORVD 2AH0A 3UVNA 5C2WB 3SBRA 1S4UX 4BL0A 1YFQA 4L9OA 4O9DA 5EAMA 4BUJC 4Z8LA 5HQGA 3BWSA 2Z2NA 3C5MA 3U4YA 5KDOB 4E5ZB 3FGBA 4X61B 5HE3B 3OTTA 2IWKA 3L4MD 2P9PC 4J86A 2PM6B 4JSXC 4PSXB 3W15A 2Z2OA 5TF2A 4IA9A 4NSXA 5AMSA 4A08A 2IURA 1B9XA 4JSNC 4K3ID 4CY3A 5I5JA 3BG1A 3V9FA 2P9NC 4GQ1A 1SQJA 4YVDA 5FKTA 3J81g 3KRXB 2XYIA 2AGZA 3L4OD 4GZ8A 1R5MA 5H1MA 3I8CA 3F3GA 1JMXB 3GFCA 5K1CC 4L1QD 3EI4A 4PBYA 4KFMB 2CNXA 3DSMA 3I7HA 2PM9A 2IUVA 5TDHB 1XIPA 5I5IA 2HJBA 4JXMA 4LGNA 4J77A 4AEZA 3UVLA 3GREA 4H5JA 5I5MA 4GMBA 4CZXA 3SWSD 4ESGA 4GM3A 5FKQA 3PSCB 4ERYA 5HE1B 3MKSB 2P9LC 4O1QD 3EMHA 4J87A 3SVWD 2J57G 3AL9A 5K19A 2B5LA 3PE7A 2OVQB 3PSLA 4GM9A 5CXBA 4JSPC 3C99A 4FA9D 1N6DA 2CN2A 4FAND 4A0AB 1GG2B 2CO0A 3SJLD 5C2VB 3IIYA 2PBIB 2H14A 2MTAH 4GGDA 2P9KC 2YBAA 4A0BA 4FWWA 3JROA 1MG2A 1NR0A 4IMMA 2XL2A 4J73A 3ULEC 4A09A 4J8GA 5FXYA 3EG6A 1PGUA 1U4CA 1B9YA 3F3FA 3RFHA 1JOFA 4X63B 1PI6A 5CXCA 4R7AB 3FM0A 4PBZA 4FA1D 4A2MA 3EI1B 5EALA 3MZLA 4JT6C 4CC9A 4J84A 3PXWD 4MK0B 5GMKn 3KRWB 3OL2A 2AH1A 3SBQA 3A0FA 3EI3A 4X3EA 3OKYB 4E54A 3N0EA 4A11B 3I7KA 5SXMA 3SXTD 5CYKB 4TZ4A 4CY2A 3E0CA 4GGAA 2HXCA 4HDJA 3EI2B 2AGYA 2B5NA 2BBKH 1A0RB 1GOTB 5EM2B 3DXKC 3OKTA 4GGCA 1OMWB 1GP2B 4CZYA 2P9IC 1FWXA 3IKOA 5THAA 4CI1A 2GC4A 3RMZD 2UZYB 2H68A 2B5MA 1N6EA 2HYEA 3P4FA 4OZUA 5FKSA 3PXSD 2PM7B 2AGXA 4E5ZA 3PVWB 4LG9A 3RLMD 3MKQA 2P9UC 2HESX 3MXXA 3BG0A 4N14A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O3U B;  3SMR A;  2AGL A;  1VYH C;  2YMU A;  4AOW A;  3AFC A;  4CY5 A;  5HYN B;  5GXI A;  4A2L A;  2Q7Q A;  4H5I A;  5EMK B;  1SHY B;  3I7O A;  2XU7 A;  2YNO A;  3EU7 A;  1XHM A;  3IJ0 A;  4ZN4 A;  3UVK A;  4L3G D;  2I3T A;  2OJY A;  3ODT A;  3SBP A;  2AQ5 A;  4PXW A;  5EMJ B;  5JWZ A;  4UI9 R;  3IIW A;  4J79 A;  1L0Q A;  2YB8 B;  4OWR A;  5FKR A;  3C9C A;  2G9A A;  3VGZ A;  4J81 A;  4PNK B;  1TYQ C;  5AFU 3;  4ZOY A;  4D0K A;  4FA5 D;  2H3X A;  5H17 A;  1JMZ B;  3AL8 B;  5IGO A;  2H6Q A;  3IJC A;  2OK6 A;  3MZK A;  5IJ7 E;  2QXV A;  3UVM A;  3FRX A;  3IJ1 A;  5C9Z B;  3NVX A;  3UR4 A;  2GNQ A;  1P22 A;  3RFG A;  3PXT D;  4FB1 D;  4G56 B;  2OIZ A;  2H9P A;  5H14 A;  3DWL C;  4O45 A;  4XYH A;  5FQD A;  3JZG A;  4JD2 C;  4A7J A;  5FLX g;  2IUP A;  4CY1 A;  4QL1 A;  2IUQ A;  5IGQ A;  3EWE A;  2TRC B;  4A0A A;  2O9K A;  4ZOZ A;  5TEE A;  1MG3 A;  2YNP A;  3K27 A;  4U7A A;  5IT9 g;  1SQ9 A;  2H9L A;  3RN0 D;  3PVU B;  4ES0 A;  3DXM C;  4L3H D;  4A08 B;  4Y5R D;  3UKR C;  2CE9 A;  3ZWL B;  4J82 A;  3HFQ A;  4K3J B;  2OVR B;  5AJA A;  3SLE D;  5EMM B;  3JB9 L;  3V5W B;  1K8K C;  1ERJ A;  3CIK B;  3EI4 B;  5FA5 B;  3EI1 A;  1PEV A;  4J0X A;  3RSE C;  3NVQ A;  4Y7R A;  2I0S A;  3RN1 D;  4QRJ A;  2PM9 B;  4CI3 A;  2HKR A;  2G99 A;  4GQB B;  2J55 H;  5GXH A;  2HJ4 A;  3I7N A;  3VA6 A;  2GC7 A;  3OKY A;  2YNN A;  3SCY A;  3SFZ A;  1K32 A;  3JRP A;  1N6F A;  1TBG A;  4A11 A;  1U2V C;  2IAA A;  5A2Q g;  4BH6 A;  5CYK A;  5EML B;  4GQ2 P;  3EI2 A;  3JZH A;  4D6V A;  3MMY A;  4J8B A;  4CI8 A;  2H13 A;  3I7P A;  4XEI C;  4GM8 A;  5EM2 A;  5HE0 B;  1OLZ A;  1RI6 A;  1JJU B;  2H6N A;  2H6K A;  5CXB B;  3B7F A;  3UVO A;  2P9S C;  5IJ8 E;  2W18 A;  2OK4 A;  3SHF A;  1MDA H;  2CE8 A;  3K26 A;  2J56 H;  4FHL A;  2EBS A;  3J80 g;  4ERZ A;  2Z2P A;  3AH8 B;  2UZX B;  4PSW B;  3DM0 A;  4U1E I;  3I89 A;  2CN3 A;  5HE2 B;  3I7L A;  4A0B B;  4CI2 A;  1XKS A;  3V7D B;  4XYI A;  4A09 B;  2OVP B;  2CO0 C;  2H9N A;  5B4W A;  1QNI A;  3CFV A;  5CXC B;  3OW8 A;  4CZV A;  4JT5 C;  4J0W A;  4ZOX A;  5TEF A;  3JPX A;  5EAP A;  2B4E A;  2QC5 A;  3C75 H;  4EWR A;  1PBY B;  3OKW A;  3CFS B;  3OL2 B;  3VH0 A;  3UKU C;  2XL3 A;  2BCJ B;  3JZN A;  4PC0 A;  3I8E A;  3EI3 B;  5GSA A;  1GXR A;  3JAM g;  4E54 B;  2AGW A;  2I0T A;  5IC7 A;  2HKM A;  4FA4 D;  4I79 A;  3RRM C;  4QT8 A;  4ZOV A;  3N0D A;  3F3P A;  4FAV D;  4X60 B;  4ERQ A;  2H47 A;  4JSV C;  5EAR A;  3SN6 B;  2I0R A;  4LG8 A;  2H9M A;  3I2N A;  2IWF A;  4J78 A;  1Q47 A;  2I3S A;  3AL8 A;  1NEX B;  4O3T B;  3NVN A;  4QQE A;  3ORV D;  2AH0 A;  3UVN A;  5C2W B;  3SBR A;  1S4U X;  4BL0 A;  1YFQ A;  4L9O A;  4O9D A;  5EAM A;  4BUJ C;  4Z8L A;  5HQG A;  3BWS A;  2Z2N A;  3C5M A;  3U4Y A;  5KDO B;  4E5Z B;  3FGB A;  4X61 B;  5HE3 B;  3OTT A;  2IWK A;  3L4M D;  2P9P C;  4J86 A;  2PM6 B;  4JSX C;  4PSX B;  3W15 A;  2Z2O A;  5TF2 A;  4IA9 A;  4NSX A;  5AMS A;  4A08 A;  2IUR A;  1B9X A;  4JSN C;  4K3I D;  4CY3 A;  5I5J A;  3BG1 A;  3V9F A;  2P9N C;  4GQ1 A;  1SQJ A;  4YVD A;  5FKT A;  3J81 g;  3KRX B;  2XYI A;  2AGZ A;  3L4O D;  4GZ8 A;  1R5M A;  5H1M A;  3I8C A;  3F3G A;  1JMX B;  3GFC A;  5K1C C;  4L1Q D;  3EI4 A;  4PBY A;  4KFM B;  2CNX A;  3DSM A;  3I7H A;  2PM9 A;  2IUV A;  5TDH B;  1XIP A;  5I5I A;  2HJB A;  4JXM A;  4LGN A;  4J77 A;  4AEZ A;  3UVL A;  3GRE A;  4H5J A;  5I5M A;  4GMB A;  4CZX A;  3SWS D;  4ESG A;  4GM3 A;  5FKQ A;  3PSC B;  4ERY A;  5HE1 B;  3MKS B;  2P9L C;  4O1Q D;  3EMH A;  4J87 A;  3SVW D;  2J57 G;  3AL9 A;  5K19 A;  2B5L A;  3PE7 A;  2OVQ B;  3PSL A;  4GM9 A;  5CXB A;  4JSP C;  3C99 A;  4FA9 D;  1N6D A;  2CN2 A;  4FAN D;  4A0A B;  1GG2 B;  2CO0 A;  3SJL D;  5C2V B;  3IIY A;  2PBI B;  2H14 A;  2MTA H;  4GGD A;  2P9K C;  2YBA A;  4A0B A;  4FWW A;  3JRO A;  1MG2 A;  1NR0 A;  4IMM A;  2XL2 A;  4J73 A;  3ULE C;  4A09 A;  4J8G A;  5FXY A;  3EG6 A;  1PGU A;  1U4C A;  1B9Y A;  3F3F A;  3RFH A;  1JOF A;  4X63 B;  1PI6 A;  5CXC A;  4R7A B;  3FM0 A;  4PBZ A;  4FA1 D;  4A2M A;  3EI1 B;  5EAL A;  3MZL A;  4JT6 C;  4CC9 A;  4J84 A;  3PXW D;  4MK0 B;  5GMK n;  3KRW B;  3OL2 A;  2AH1 A;  3SBQ A;  3A0F A;  3EI3 A;  4X3E A;  3OKY B;  4E54 A;  3N0E A;  4A11 B;  3I7K A;  5SXM A;  3SXT D;  5CYK B;  4TZ4 A;  4CY2 A;  3E0C A;  4GGA A;  2HXC A;  4HDJ A;  3EI2 B;  2AGY A;  2B5N A;  2BBK H;  1A0R B;  1GOT B;  5EM2 B;  3DXK C;  3OKT A;  4GGC A;  1OMW B;  1GP2 B;  4CZY A;  2P9I C;  1FWX A;  3IKO A;  5THA A;  4CI1 A;  2GC4 A;  3RMZ D;  2UZY B;  2H68 A;  2B5M A;  1N6E A;  2HYE A;  3P4F A;  4OZU A;  5FKS A;  3PXS D;  2PM7 B;  2AGX A;  4E5Z A;  3PVW B;  4LG9 A;  3RLM D;  3MKQ A;  2P9U C;  2HES X;  3MXX A;  3BG0 A;  4N14 A; 
#chains in the Genus database with same CATH topology
 1VZ3 A;  4WJK A;  4O3U B;  3SMR A;  2AGL A;  1VYH C;  2YMU A;  4AOW A;  3AFC A;  4CY5 A;  1GOH A;  3VI3 A;  5HYN B;  5GXI A;  4A2L A;  2Q7Q A;  4DNW A;  4H5I A;  5EMK B;  1SHY B;  4DNV A;  3I7O A;  3IJE A;  2XU7 A;  3V4V A;  2XZG A;  2YNO A;  4Z7Q A;  1C9L A;  3EU7 A;  1XHM A;  3IJ0 A;  4ZN4 A;  2XDW A;  4L3G D;  3UVK A;  2I3T A;  2OJY A;  3ODT A;  3SBP A;  2AQ5 A;  5E6U A;  4PXW A;  5EMJ B;  5JWZ A;  4UI9 R;  5C86 A;  3IIW A;  4J79 A;  1L0Q A;  2YB8 B;  3GC3 B;  4OWR A;  5FKR A;  3C9C A;  2VDP A;  2G9A A;  3VGZ A;  4J81 A;  1VE6 A;  1TYQ C;  4PNK B;  4Z7O A;  5AFU 3;  4ZOY A;  4D0K A;  4FA5 D;  3ZE1 A;  2H3X A;  5H17 A;  4AMY A;  1JMZ B;  3AL8 B;  2XE4 A;  5IGO A;  3IJC A;  2H6Q A;  1JV2 A;  2OK6 A;  3MZK A;  5IJ7 E;  2QXV A;  3UVM A;  3FRX A;  3IJ1 A;  5C9Z B;  3NVX A;  3MUO A;  3UR4 A;  2GNQ A;  1P22 A;  3RFG A;  2VDO A;  3PXT D;  4FB1 D;  4G56 B;  2OIZ A;  2H9P A;  5H14 A;  3DWL C;  1UOO A;  5E6R A;  4O45 A;  4XYH A;  5FQD A;  3JZG A;  4JD2 C;  3O4G A;  4A7J A;  5M5R A;  4JHP C;  2IUP A;  3ZDZ A;  5FLX g;  4CY1 A;  4QL1 A;  1GOG A;  3K6S A;  1T2X A;  2HU7 A;  2IUQ A;  3IUL A;  5IGQ A;  4MMY A;  3EWE A;  2TRC B;  4A0A A;  1M1X A;  5M61 A;  2O9K A;  4ZOZ A;  5TEE A;  1MG3 A;  2YNP A;  3K27 A;  4U7A A;  5IT9 g;  1SQ9 A;  2H9L A;  3RN0 D;  3PVU B;  4ES0 A;  3DXM C;  4L3H D;  4QAM A;  4A08 B;  4AMZ A;  4Y5R D;  3UKR C;  2CE9 A;  3ZWL B;  4J82 A;  3ZDY A;  3HFQ A;  4K3J B;  3ZE0 A;  1UOQ A;  4JHN A;  2OVR B;  5AJA A;  2EIC A;  3SLE D;  5EMM B;  3JB9 L;  5C92 A;  3V5W B;  1K8K C;  1ERJ A;  3CIK B;  1JTD B;  3EI4 B;  5HDB A;  5FA5 B;  3EI1 A;  1PEV A;  4J0X A;  3RSE C;  3NVQ A;  4Y7R A;  2I0S A;  3RN1 D;  4QRJ A;  2PM9 B;  4CI3 A;  2VDQ A;  2EIB A;  1I2M B;  1QFM A;  2HKR A;  2G99 A;  4GQB B;  2J55 H;  5GXH A;  2HJ4 A;  3I7N A;  3VA6 A;  2GC7 A;  3OKY A;  2YNN A;  3SCY A;  3SFZ A;  3JRP A;  1K32 A;  1N6F A;  3V4P A;  1TBG A;  4A11 A;  4BP9 A;  1U2V C;  2IAA A;  5A2Q g;  4BH6 A;  5CYK A;  5EML B;  4GQ2 P;  3EI2 A;  3JZH A;  4D6V A;  3MUN A;  3MMY A;  4J8B A;  4CI8 A;  2WQ8 A;  5E6S A;  2H13 A;  3I7P A;  4XEI C;  4GM8 A;  5EM2 A;  5HE0 B;  1OLZ A;  1RI6 A;  1JJU B;  2VDR A;  4D9S A;  2H6N A;  2H6K A;  5CXB B;  3B7F A;  3UVO A;  2P9S C;  5IJ8 E;  2W18 A;  2VC2 A;  3K71 A;  4O2W A;  2OK4 A;  3SHF A;  3FCU A;  1MDA H;  2CE8 A;  3K26 A;  2J56 H;  2VZ3 A;  4FHL A;  2EBS A;  3J80 g;  4ERZ A;  2Z2P A;  3AH8 B;  2UZX B;  3O4I A;  4PSW B;  3DM0 A;  2BKL A;  4U1E I;  3I89 A;  2CN3 A;  3QHY B;  5HE2 B;  4BCC A;  3I7L A;  3IUN A;  1VZ2 A;  3NIG A;  4A0B B;  4CI2 A;  1XKS A;  4G1E A;  3V7D B;  4XYI A;  4A09 B;  2OVP B;  3NID A;  2CO0 C;  2H9N A;  4O02 A;  5B4W A;  1QNI A;  4AX4 A;  2VDK A;  3CFV A;  5CXC B;  3OW8 A;  4BCD A;  4CZV A;  4JT5 C;  4J0W A;  4ZOX A;  5TEF A;  3JPX A;  5EAP A;  2B4E A;  2QC5 A;  3ZDX A;  3C75 H;  4EWR A;  3IUM A;  1PBY B;  3OKW A;  3CFS B;  3OL2 B;  4RE5 A;  3VH0 A;  3UKU C;  2XL3 A;  2BCJ B;  3JZN A;  4PC0 A;  3I8E A;  3EI3 B;  5GSA A;  1GXR A;  3JAM g;  4E54 B;  2AGW A;  1K3I A;  1C9I A;  2I0T A;  5IC7 A;  2HKM A;  3FCS A;  2QZP A;  4FA4 D;  4I79 A;  3RRM C;  4QT8 A;  4ZOV A;  1UOP A;  3IUQ A;  3N0D A;  4MMZ A;  5FFO A;  3F3P A;  4FAV D;  4X60 B;  1VE7 A;  4ERQ A;  3EQ8 A;  2H47 A;  4JSV C;  5EAR A;  3T3P A;  3K72 A;  3SN6 B;  1H2Z A;  2I0R A;  4LG8 A;  2H9M A;  3I2N A;  2IWF A;  4J78 A;  1Q47 A;  2I3S A;  3AL8 A;  1NEX B;  4O3T B;  3NVN A;  4QQE A;  3KCI A;  3ORV D;  2AH0 A;  1E8N A;  3UVN A;  5C2W B;  3SBR A;  1S4U X;  3IVM A;  4BL0 A;  3IUJ A;  1YFQ A;  3O4H A;  4L9O A;  4O9D A;  5EAM A;  2HU8 A;  4BUJ C;  4Z8L A;  5HQG A;  3BWS A;  2VZ1 A;  2Z2N A;  3C5M A;  3U4Y A;  5KDO B;  3EQ7 A;  4E5Z B;  3FGB A;  1A12 A;  1GOF A;  4X61 B;  5FFG A;  5HE3 B;  4NC4 A;  3OTT A;  2IWK A;  3EQ9 A;  2P9P C;  3L4M D;  4J86 A;  2PM6 B;  4JSX C;  4PSX B;  3W15 A;  2Z2O A;  5TF2 A;  4IA9 A;  4NSX A;  4G1M A;  1QFS A;  5AMS A;  4A08 A;  2IUR A;  2JKX A;  1B9X A;  4JSN C;  4K3I D;  4CY3 A;  5I5J A;  3BG1 A;  3V9F A;  2P9N C;  4GQ1 A;  1SQJ A;  4YVD A;  5FKT A;  3J81 g;  5M5U A;  3KRX B;  2XYI A;  2AGZ A;  3L4O D;  4UM9 A;  4WK2 A;  1O6G A;  4GZ8 A;  4AN0 A;  1R5M A;  5H1M A;  3I8C A;  3F3G A;  1JMX B;  1U8C A;  3GFC A;  5K1C C;  4L1Q D;  3EI4 A;  4DNU A;  5M5V A;  4PBY A;  4KFM B;  2CNX A;  3DSM A;  3I7H A;  1E8M A;  2PM9 A;  2IUV A;  5TDH B;  1XIP A;  5I5I A;  2HJB A;  3QI0 A;  4JXM A;  1H2X A;  4NAA A;  1E5T A;  4LGN A;  4J77 A;  2EID A;  4AEZ A;  3UVL A;  3GRE A;  1H2Y A;  4H5J A;  5I5M A;  4GMB A;  4CZX A;  3SWS D;  4ESG A;  1YR2 A;  4BP8 A;  4GM3 A;  5FKQ A;  3PSC B;  4WK4 A;  4ERY A;  5HE1 B;  3MKS B;  2P9L C;  4O1Q D;  3EMH A;  4J87 A;  4WK0 A;  3SVW D;  2J57 G;  3AL9 A;  5K19 A;  2B5L A;  3PE7 A;  1TYE A;  2VDN A;  2OVQ B;  3PSL A;  4RE6 A;  4GM9 A;  1BPO A;  1UTC A;  5CXB A;  3T3M A;  4JSP C;  3C99 A;  2VDL A;  4FA9 D;  1N6D A;  2CN2 A;  4FAN D;  4A0A B;  3ZE2 A;  1GG2 B;  2CO0 A;  3SJL D;  5C2V B;  3IIY A;  4NBM A;  2PBI B;  2H14 A;  2MTA H;  1H2W A;  2P9K C;  4GGD A;  4L1M A;  2YBA A;  4A0B A;  4FWW A;  3JRO A;  1MG2 A;  1NR0 A;  4IMM A;  2XL2 A;  4J73 A;  3ULE C;  4A09 A;  4J8G A;  5M5S A;  5FXY A;  3EG6 A;  1PGU A;  1U4C A;  1B9Y A;  1L5G A;  3F3F A;  3RFH A;  1JOF A;  4X63 B;  1PI6 A;  5CXC A;  4R7A B;  3DDU A;  3FM0 A;  4PBZ A;  4FA1 D;  4A2M A;  3EI1 B;  5EAL A;  3MZL A;  4JT6 C;  4CC9 A;  4G55 A;  3OF7 A;  4J84 A;  4MMX A;  3PXW D;  3VI4 A;  3O4J A;  4MK0 B;  5M5T A;  5GMK n;  3KRW B;  3OL2 A;  2QR5 A;  3GD1 I;  2AH1 A;  3SBQ A;  3A0F A;  3EI3 A;  4X3E A;  3OKY B;  4E54 A;  1O6F A;  3MVD K;  3N0E A;  4Z7N A;  4A11 B;  3I7K A;  4UM8 A;  5SXM A;  3IUR A;  3SXT D;  5CYK B;  4TZ4 A;  4CY2 A;  3E0C A;  4GGA A;  2HXC A;  4HDJ A;  3EI2 B;  2AGY A;  2B5N A;  2BBK H;  2HU5 A;  1A0R B;  1GOT B;  4IRZ A;  5EM2 B;  3DXK C;  3NIF A;  3OKT A;  4GGC A;  2EIE A;  1OMW B;  2VDM A;  1GP2 B;  4CZY A;  2P9I C;  1FWX A;  3IKO A;  5THA A;  4CI1 A;  2GC4 A;  3RMZ D;  4BCB A;  2UZY B;  2H68 A;  2B5M A;  1N6E A;  2HYE A;  3P4F A;  4OZU A;  5FKS A;  3PXS D;  2PM7 B;  2AGX A;  4NEN A;  4E5Z A;  3PVW B;  4LG9 A;  3RLM D;  3MKQ A;  2P9U C;  2HES X;  3MXX A;  3BG0 A;  4AN1 A;  4N14 A; 
#chains in the Genus database with same CATH homology
 4O3U B;  3SMR A;  2AGL A;  1VYH C;  2YMU A;  4AOW A;  3AFC A;  4CY5 A;  5HYN B;  5GXI A;  4A2L A;  2Q7Q A;  4H5I A;  5EMK B;  1SHY B;  3I7O A;  2XU7 A;  2YNO A;  3EU7 A;  1XHM A;  3IJ0 A;  4ZN4 A;  3UVK A;  4L3G D;  2I3T A;  2OJY A;  3ODT A;  3SBP A;  2AQ5 A;  4PXW A;  5EMJ B;  5JWZ A;  4UI9 R;  3IIW A;  4J79 A;  1L0Q A;  2YB8 B;  4OWR A;  5FKR A;  3C9C A;  2G9A A;  3VGZ A;  4J81 A;  4PNK B;  1TYQ C;  5AFU 3;  4ZOY A;  4D0K A;  4FA5 D;  2H3X A;  5H17 A;  1JMZ B;  3AL8 B;  5IGO A;  2H6Q A;  3IJC A;  2OK6 A;  3MZK A;  5IJ7 E;  2QXV A;  3UVM A;  3FRX A;  3IJ1 A;  5C9Z B;  3NVX A;  3UR4 A;  2GNQ A;  1P22 A;  3RFG A;  3PXT D;  4FB1 D;  4G56 B;  2OIZ A;  2H9P A;  5H14 A;  3DWL C;  4O45 A;  4XYH A;  5FQD A;  3JZG A;  4JD2 C;  4A7J A;  5FLX g;  2IUP A;  4CY1 A;  4QL1 A;  2IUQ A;  5IGQ A;  3EWE A;  2TRC B;  4A0A A;  2O9K A;  4ZOZ A;  5TEE A;  1MG3 A;  2YNP A;  3K27 A;  4U7A A;  5IT9 g;  1SQ9 A;  2H9L A;  3RN0 D;  3PVU B;  4ES0 A;  3DXM C;  4L3H D;  4A08 B;  4Y5R D;  3UKR C;  2CE9 A;  3ZWL B;  4J82 A;  3HFQ A;  4K3J B;  2OVR B;  5AJA A;  3SLE D;  5EMM B;  3JB9 L;  3V5W B;  1K8K C;  1ERJ A;  3CIK B;  3EI4 B;  5FA5 B;  3EI1 A;  1PEV A;  4J0X A;  3RSE C;  3NVQ A;  4Y7R A;  2I0S A;  3RN1 D;  4QRJ A;  2PM9 B;  4CI3 A;  2HKR A;  2G99 A;  4GQB B;  2J55 H;  5GXH A;  2HJ4 A;  3I7N A;  3VA6 A;  2GC7 A;  3OKY A;  2YNN A;  3SCY A;  3SFZ A;  1K32 A;  3JRP A;  1N6F A;  1TBG A;  4A11 A;  1U2V C;  2IAA A;  5A2Q g;  4BH6 A;  5CYK A;  5EML B;  4GQ2 P;  3EI2 A;  3JZH A;  4D6V A;  3MMY A;  4J8B A;  4CI8 A;  2H13 A;  3I7P A;  4XEI C;  4GM8 A;  5EM2 A;  5HE0 B;  1OLZ A;  1RI6 A;  1JJU B;  2H6N A;  2H6K A;  5CXB B;  3B7F A;  3UVO A;  2P9S C;  5IJ8 E;  2W18 A;  2OK4 A;  3SHF A;  1MDA H;  2CE8 A;  3K26 A;  2J56 H;  4FHL A;  2EBS A;  3J80 g;  4ERZ A;  2Z2P A;  3AH8 B;  2UZX B;  4PSW B;  3DM0 A;  4U1E I;  3I89 A;  2CN3 A;  5HE2 B;  3I7L A;  4A0B B;  4CI2 A;  1XKS A;  3V7D B;  4XYI A;  4A09 B;  2OVP B;  2CO0 C;  2H9N A;  5B4W A;  1QNI A;  3CFV A;  5CXC B;  3OW8 A;  4CZV A;  4JT5 C;  4J0W A;  4ZOX A;  5TEF A;  3JPX A;  5EAP A;  2B4E A;  2QC5 A;  3C75 H;  4EWR A;  1PBY B;  3OKW A;  3CFS B;  3OL2 B;  3VH0 A;  3UKU C;  2XL3 A;  2BCJ B;  3JZN A;  4PC0 A;  3I8E A;  3EI3 B;  5GSA A;  1GXR A;  3JAM g;  4E54 B;  2AGW A;  2I0T A;  5IC7 A;  2HKM A;  4FA4 D;  4I79 A;  3RRM C;  4QT8 A;  4ZOV A;  3N0D A;  3F3P A;  4FAV D;  4X60 B;  4ERQ A;  2H47 A;  4JSV C;  5EAR A;  3SN6 B;  2I0R A;  4LG8 A;  2H9M A;  3I2N A;  2IWF A;  4J78 A;  1Q47 A;  2I3S A;  3AL8 A;  1NEX B;  4O3T B;  3NVN A;  4QQE A;  3ORV D;  2AH0 A;  3UVN A;  5C2W B;  3SBR A;  1S4U X;  4BL0 A;  1YFQ A;  4L9O A;  4O9D A;  5EAM A;  4BUJ C;  4Z8L A;  5HQG A;  3BWS A;  2Z2N A;  3C5M A;  3U4Y A;  5KDO B;  4E5Z B;  3FGB A;  4X61 B;  5HE3 B;  3OTT A;  2IWK A;  3L4M D;  2P9P C;  4J86 A;  2PM6 B;  4JSX C;  4PSX B;  3W15 A;  2Z2O A;  5TF2 A;  4IA9 A;  4NSX A;  5AMS A;  4A08 A;  2IUR A;  1B9X A;  4JSN C;  4K3I D;  4CY3 A;  5I5J A;  3BG1 A;  3V9F A;  2P9N C;  4GQ1 A;  1SQJ A;  4YVD A;  5FKT A;  3J81 g;  3KRX B;  2XYI A;  2AGZ A;  3L4O D;  4GZ8 A;  1R5M A;  5H1M A;  3I8C A;  3F3G A;  1JMX B;  3GFC A;  5K1C C;  4L1Q D;  3EI4 A;  4PBY A;  4KFM B;  2CNX A;  3DSM A;  3I7H A;  2PM9 A;  2IUV A;  5TDH B;  1XIP A;  5I5I A;  2HJB A;  4JXM A;  4LGN A;  4J77 A;  4AEZ A;  3UVL A;  3GRE A;  4H5J A;  5I5M A;  4GMB A;  4CZX A;  3SWS D;  4ESG A;  4GM3 A;  5FKQ A;  3PSC B;  4ERY A;  5HE1 B;  3MKS B;  2P9L C;  4O1Q D;  3EMH A;  4J87 A;  3SVW D;  2J57 G;  3AL9 A;  5K19 A;  2B5L A;  3PE7 A;  2OVQ B;  3PSL A;  4GM9 A;  5CXB A;  4JSP C;  3C99 A;  4FA9 D;  1N6D A;  2CN2 A;  4FAN D;  4A0A B;  1GG2 B;  2CO0 A;  3SJL D;  5C2V B;  3IIY A;  2PBI B;  2H14 A;  2MTA H;  4GGD A;  2P9K C;  2YBA A;  4A0B A;  4FWW A;  3JRO A;  1MG2 A;  1NR0 A;  4IMM A;  2XL2 A;  4J73 A;  3ULE C;  4A09 A;  4J8G A;  5FXY A;  3EG6 A;  1PGU A;  1U4C A;  1B9Y A;  3F3F A;  3RFH A;  1JOF A;  4X63 B;  1PI6 A;  5CXC A;  4R7A B;  3FM0 A;  4PBZ A;  4FA1 D;  4A2M A;  3EI1 B;  5EAL A;  3MZL A;  4JT6 C;  4CC9 A;  4J84 A;  3PXW D;  4MK0 B;  5GMK n;  3KRW B;  3OL2 A;  2AH1 A;  3SBQ A;  3A0F A;  3EI3 A;  4X3E A;  3OKY B;  4E54 A;  3N0E A;  4A11 B;  3I7K A;  5SXM A;  3SXT D;  5CYK B;  4TZ4 A;  4CY2 A;  3E0C A;  4GGA A;  2HXC A;  4HDJ A;  3EI2 B;  2AGY A;  2B5N A;  2BBK H;  1A0R B;  1GOT B;  5EM2 B;  3DXK C;  3OKT A;  4GGC A;  1OMW B;  1GP2 B;  4CZY A;  2P9I C;  1FWX A;  3IKO A;  5THA A;  4CI1 A;  2GC4 A;  3RMZ D;  2UZY B;  2H68 A;  2B5M A;  1N6E A;  2HYE A;  3P4F A;  4OZU A;  5FKS A;  3PXS D;  2PM7 B;  2AGX A;  4E5Z A;  3PVW B;  4LG9 A;  3RLM D;  3MKQ A;  2P9U C;  2HES X;  3MXX A;  3BG0 A;  4N14 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...