2BBKH

Crystal structure of the quinoprotein methylamine dehydrogenase from paracoccus denitrificans at 1.75 angstroms
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
355
structure length
355
Chain Sequence
DEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords METHYLAMINE DEHYDROGENASE (HEAVY SUBUNIT)
publication title Refined crystal structure of methylamine dehydrogenase from Paracoccus denitrificans at 1.75 A resolution.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
total genus 85
structure length 355
sequence length 355
chains with identical sequence J
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 1993-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2bbkH00
3CIKB 3OW8A 4D0KA 4PNKB 4FA9D 5B4WA 3UKUC 3RLMD 3L4OD 2PM6B 5GXIA 2G9AA 3UVNA 1U2VC 5SXMA 2IWKA 5CYKB 4GMBA 3DWLC 4BUJC 3L4MD 5HYNB 5HQGA 3I8EA 2CO0A 4K3ID 2AGZA 4FA5D 4OWRA 4CC9A 5HE2B 4JSXC 1S4UX 3GREA 4X60B 2YNNA 4GQ2P 4GQBB 2AH0A 1Q47A 3CFVA 3EWEA 3UVMA 3RN1D 5A2Qg 3OTTA 3OL2B 3C99A 4CY3A 3MKQA 2I0SA 1U4CA 3ZWLB 4U7AA 4GGCA 1ERJA 1GP2B 3IJ1A 2H3XA 5FQDA 2P9IC 4O45A 5H17A 5H1MA 5CXBA 4A11A 5K19A 2MTAH 4J87A 3PXTD 4ZOZA 2H13A 3SBPA 3ORVD 4XYIA 4CZXA 3I7KA 4A2MA 3ODTA 2QC5A 5GMKn 4A0AB 2B5MA 3E0CA 2GC4A 2H9NA 4A0BB 5GXHA 3F3PA 5HE3B 2P9LC 2HESX 2XU7A 3MMYA 3VH0A 5TDHB 3UR4A 4IA9A 3EI4B 4Y7RA 4J8BA 5CYKA 4IMMA 5JWZA 3AH8B 4L3HD 4FA4D 3IJ0A 4A08B 3V7DB 4MK0B 3NVQA 4JSVC 3C5MA 3SCYA 1PEVA 2AQ5A 3BG0A 3JZGA 3JRPA 2IAAA 3RFHA 4JT5C 2HYEA 2AH1A 1JMXB 3W15A 1PBYB 3FM0A 3AL8B 4KFMB 4QT8A 2H68A 2YBAA 3PVWB 4YVDA 5TEFA 2YMUA 5EM2B 1K32A 1YFQA 2CN3A 4L1QD 4CZVA 3I7LA 3HFQA 1MG3A 5AJAA 3OL2A 4PBYA 5EARA 3UVOA 1XIPA 1OMWB 2AGYA 1SHYB 3EI3B 5EMJB 5IGOA 4EWRA 4JXMA 2HJBA 3F3FA 1B9YA 1OLZA 2B5NA 3SN6B 3EI2A 1A0RB 1R5MA 2GC7A 2B4EA 2IUVA 2BBKH 2PM7B 4ERZA 3RN0D 3DM0A 3PE7A 4FA1D 5IC7A 3SHFA 3MXXA 4A2LA 3A0FA 4A0AA 1NEXB 2Z2PA 4LG9A 4GGDA 2H9MA 2PBIB 3RSEC 4ZOVA 4PXWA 3EI4A 4BL0A 1PGUA 3IJCA 3DXMC 1JOFA 3C9CA 4JD2C 1JMZB 4A08A 5FA5B 1VYHC 4CY5A 1N6EA 4O1QD 5C2VB 1XHMA 3F3GA 1L0QA 4J0WA 5EMKB 1QNIA 5FKRA 2PM9B 4JSNC 3K26A 4ZN4A 2J55H 2IWFA 3SXTD 3AL8A 2Z2NA 4ZOXA 4L9OA 2I0RA 2H6KA 5EM2A 3EG6A 2O9KA 4CI2A 5FLXg 2UZXB 3OKTA 4E5ZA 4A09A 5K1CC 3MZKA 3SBRA 4Y5RD 4GM8A 1GG2B 5EAPA 1GXRA 3EI3A 4FHLA 3J81g 2CNXA 2XYIA 4GM9A 3NVXA 3IIYA 1N6DA 1XKSA 3PXSD 1JJUB 3ULEC 1B9XA 2OVQB 3RMZD 4E54B 4U1EI 2P9PC 2I0TA 4LG8A 2XL3A 2HKRA 2H6NA 3JPXA 3RRMC 3U4YA 2TRCB 5FXYA 1SQJA 4ZOYA 5FKTA 2J57G 2H14A 4N14A 3KRWB 3UVLA 2H9LA 5I5IA 4CI8A 2YB8B 5TF2A 3I7OA 4CY1A 2AGWA 3I7HA 3FRXA 3I89A 5CXCB 4J79A 4J81A 2I3TA 4I79A 4PC0A 4GZ8A 3V5WB 4AEZA 4Z8LA 2P9UC 3N0DA 3I8CA 4FAVD 2P9KC 4TZ4A 1PI6A 2PM9A 4G56B 2CE8A 2IURA 2B5LA 3JROA 3SVWD 2AGXA 5IJ7E 1GOTB 4O9DA 2P9SC 3PSCB 3I7NA 2IUQA 4QL1A 2H6QA 5CXBB 4A11B 3K27A 3SMRA 3PVUB 2QXVA 5IGQA 1SQ9A 3PSLA 3EU7A 5HE1B 3DXKC 4PBZA 4FAND 2YNPA 4H5JA 1TBGA 2HKMA 1FWXA 4XYHA 2CE9A 2YNOA 4E54A 4A0BA 2CN2A 3EMHA 2H9PA 2UZYB 5FKSA 2OK4A 3V9FA 2AGLA 3EI1B 1MDAH 3J80g 3OKYB 4GQ1A 4QRJA 4QQEA 2OVRB 4ERYA 4PSWB 5IJ8E 4X3EA 2Q7QA 2GNQA 1P22A 5H14A 2HJ4A 5C2WB 3I2NA 2G99A 4ESGA 5CXCA 4L3GD 3IIWA 4ES0A 4XEIC 3C75H 4J73A 4OZUA 4R7AB 2IUPA 2HXCA 4FWWA 3JZHA 4O3TB 3OKWA 2H47A 3N0EA 3IKOA 3MZLA 4FB1D 4J77A 4O3UB 3EI2B 2P9NC 5AFU3 5IT9g 3I7PA 1MG2A 5I5MA 3BG1A 3JZNA 3GFCA 5I5JA 2J56H 4GGAA 4PSXB 4X61B 5HE0B 4LGNA 5EAMA 3AL9A 5GSAA 4J78A 1K8KC 3DSMA 4HDJA 5EMLB 2I3SA 3SWSD 3AFCA 4J0XA 2XL2A 5FKQA 4CY2A 5EMMB 1N6FA 3PXWD 3SLED 2EBSA 3BWSA 3EI1A 3SFZA 4CI3A 5AMSA 2OVPB 3OKYA 3VA6A 3FGBA 4A7JA 4UI9R 3JAMg 3NVNA 1NR0A 2BCJB 4J86A 1RI6A 3SBQA 5C9ZB 1TYQC 3CFSB 4J8GA 4CI1A 4NSXA 3JB9L 3VGZA 3MKSB 4JT6C 3KRXB 5EALA 4BH6A 5KDOB 4ERQA 5TEEA 3UVKA 3SJLD 4K3JB 2OK6A 2OJYA 4H5IA 4E5ZB 4A09B 3RFGA 4J82A 4GM3A 3P4FA 5THAA 2CO0C 4CZYA 2Z2OA 2OIZA 3B7FA 3UKRC 4AOWA 4D6VA 4JSPC 4J84A 4X63B 2W18A
chains in the Genus database with same CATH superfamily
5M5RA 3CIKB 3ZE0A 4IRZA 3OW8A 4D0KA 4PNKB 4FA9D 5B4WA 3UKUC 3RLMD 3L4OD 2HU7A 4WK4A 2PM6B 5GXIA 2G9AA 3UVNA 1U2VC 5SXMA 2IWKA 5CYKB 4NC4A 3MUNA 4GMBA 4D9SA 3DWLC 4BUJC 3L4MD 5HYNB 2VDOA 5HQGA 5M5SA 3ZDXA 3I8EA 2CO0A 4K3ID 1TYEA 3VI3A 2AGZA 4FA5D 5C92A 4OWRA 4CC9A 5HE2B 3QHYB 4JSXC 1M1XA 1H2YA 1S4UX 3GREA 4X60B 3K71A 4RE5A 2XE4A 2YNNA 3IUMA 4RE6A 4GQ2P 4GQBB 3ZE2A 2AH0A 1Q47A 3CFVA 3EWEA 4WK0A 2VDNA 4WK2A 3UVMA 3RN1D 2EIBA 4L1MA 5A2Qg 3OTTA 3OL2B 3C99A 4CY3A 3FCUA 3MKQA 2I0SA 1QFSA 3GD1I 1U4CA 3ZWLB 4U7AA 1VE6A 1H2ZA 4GGCA 1ERJA 1GP2B 3IJ1A 2H3XA 5FQDA 2P9IC 4O45A 5H17A 5H1MA 5CXBA 4A11A 5K19A 1O6GA 2MTAH 4J87A 4Z7QA 3PXTD 4ZOZA 4DNWA 2VC2A 2H13A 4JHNA 3SBPA 3IULA 3ORVD 4XYIA 4CZXA 1UOQA 3I7KA 4A2MA 3ODTA 2XZGA 2EIDA 4BP8A 1YR2A 2QC5A 4UM8A 5GMKn 4A0AB 2B5MA 3E0CA 2GC4A 2H9NA 4A0BB 5GXHA 3F3PA 5HE3B 2P9LC 2HESX 2XU7A 3MMYA 3VH0A 5TDHB 1VZ2A 4BCBA 3UR4A 4IA9A 3EI4B 4Y7RA 4J8BA 5CYKA 1A12A 4IMMA 5JWZA 1K3IA 3AH8B 4L3HD 4FA4D 3IJ0A 3IURA 4A08B 3V7DB 4JHPC 4MK0B 3NVQA 4JSVC 3C5MA 3SCYA 1PEVA 2AQ5A 3BG0A 3JZGA 3JRPA 2IAAA 3RFHA 4JT5C 2HYEA 2AH1A 1JMXB 3W15A 1PBYB 3FM0A 2VDMA 2VZ3A 3AL8B 4KFMB 4QT8A 2H68A 2YBAA 3PVWB 4YVDA 5TEFA 2YMUA 5EM2B 1K32A 1YFQA 2CN3A 4L1QD 2VDQA 4CZVA 3I7LA 3HFQA 1MG3A 5AJAA 3OL2A 4PBYA 5EARA 3T3MA 3UVOA 1XIPA 1OMWB 2AGYA 1SHYB 3EI3B 5EMJB 5IGOA 4EWRA 4MMXA 4JXMA 2HJBA 2JKXA 3F3FA 1VE7A 1B9YA 1OLZA 2B5NA 3SN6B 3EI2A 1A0RB 1R5MA 1JTDB 3IUQA 2GC7A 2B4EA 2IUVA 2BBKH 3V4PA 5FFGA 3MVDK 2PM7B 2HU5A 4ERZA 3RN0D 3DM0A 3PE7A 4FA1D 1UOPA 5IC7A 3SHFA 3MXXA 4A2LA 2EIEA 3A0FA 4A0AA 4QAMA 1NEXB 2Z2PA 4LG9A 2VDLA 2VZ1A 3NIDA 4GGDA 2H9MA 2PBIB 3NIGA 3RSEC 4ZOVA 4PXWA 1VZ3A 3EI4A 4BL0A 1PGUA 1GOHA 3IJCA 1BPOA 3DXMC 1JOFA 3C9CA 4JD2C 1JMZB 4A08A 5FA5B 1VYHC 4CY5A 1N6EA 4O1QD 5C2VB 1XHMA 3EQ8A 3F3GA 3MUOA 1L0QA 4J0WA 5EMKB 1QNIA 5FKRA 2PM9B 4WJKA 4JSNC 3K26A 4ZN4A 2J55H 2IWFA 3SXTD 5C86A 3AL8A 2Z2NA 4ZOXA 4L9OA 3V4VA 2I0RA 1GOFA 2H6KA 2HU8A 5EM2A 2QZPA 3EG6A 3OF7A 2O9KA 4CI2A 4G55A 5FLXg 2UZXB 3OKTA 4E5ZA 4A09A 5K1CC 3MZKA 3SBRA 1E8MA 4Y5RD 4GM8A 1GG2B 5EAPA 1GXRA 3EI3A 4UM9A 4FHLA 3J81g 2CNXA 3ZE1A 2XYIA 4GM9A 1JV2A 3NVXA 3IIYA 1N6DA 1XKSA 3PXSD 1JJUB 3ULEC 1B9XA 2OVQB 3RMZD 4E54B 4U1EI 2P9PC 3NIFA 2I0TA 4LG8A 2XL3A 1C9LA 2HKRA 2H6NA 3JPXA 4Z7OA 3RRMC 3U4YA 2TRCB 5FXYA 4AMYA 1SQJA 4ZOYA 5FKTA 2J57G 2H14A 3EQ9A 3IUNA 4N14A 3KRWB 3UVLA 2H9LA 5I5IA 4CI8A 4AN1A 2YB8B 5TF2A 3I7OA 4CY1A 1I2MB 2AGWA 4MMZA 3I7HA 3FRXA 3I89A 3IUJA 5CXCB 2VDPA 4J81A 4J79A 2I3TA 4I79A 4PC0A 4GZ8A 3V5WB 4Z7NA 4AEZA 4Z8LA 5M5VA 2P9UC 3N0DA 3I8CA 4FAVD 1L5GA 2P9KC 4TZ4A 1PI6A 2PM9A 2VDKA 4G56B 3O4JA 4AX4A 2CE8A 2IURA 2B5LA 3JROA 4DNUA 3SVWD 5E6RA 1H2XA 2AGXA 1T2XA 5IJ7E 1GOTB 4O9DA 2P9SC 3PSCB 4O2WA 3I7NA 2IUQA 4QL1A 2H6QA 5CXBB 5E6UA 3K27A 4A11B 3SMRA 4AMZA 3PVUB 2QXVA 3K72A 3GC3B 5IGQA 1SQ9A 3PSLA 3EU7A 5HE1B 3DXKC 4PBZA 4DNVA 4FAND 2YNPA 4H5JA 2XDWA 1TBGA 2HKMA 1FWXA 4XYHA 2CE9A 2YNOA 4E54A 4A0BA 2CN2A 1E8NA 3EMHA 3KCIA 3FCSA 4MMYA 2H9PA 2UZYB 4BCDA 5FKSA 2OK4A 5M61A 3V9FA 2AGLA 3EI1B 3K6SA 1MDAH 3T3PA 3J80g 3DDUA 3OKYB 4GQ1A 4QRJA 4QQEA 2OVRB 4ERYA 4PSWB 5IJ8E 4X3EA 2Q7QA 2GNQA 3IJEA 2BKLA 2EICA 1P22A 5H14A 2HJ4A 5C2WB 3I2NA 2G99A 1C9IA 4ESGA 5CXCA 4L3GD 3IIWA 3O4HA 4NAAA 4ES0A 1U8CA 4XEIC 3C75H 3ZDZA 4J73A 4OZUA 4R7AB 2IUPA 2HXCA 3O4IA 4FWWA 3JZHA 5M5TA 4O3TB 3ZDYA 3OKWA 5HDBA 2H47A 3N0EA 3IKOA 3IVMA 3MZLA 3VI4A 4FB1D 1O6FA 4J77A 4O3UB 3EI2B 2P9NC 5AFU3 5IT9g 3I7PA 5M5UA 1MG2A 5I5MA 1GOGA 3BG1A 3JZNA 3GFCA 5I5JA 2J56H 3QI0A 4GGAA 4PSXB 4X61B 5HE0B 4LGNA 5EAMA 3AL9A 5GSAA 4J78A 1K8KC 3DSMA 4G1MA 3O4GA 4HDJA 1E5TA 5EMLB 2I3SA 3SWSD 2WQ8A 3AFCA 4J0XA 2XL2A 5FKQA 4CY2A 5EMMB 1N6FA 3PXWD 3SLED 2EBSA 3BWSA 3EI1A 3SFZA 4CI3A 5AMSA 2OVPB 3OKYA 3VA6A 1UOOA 3FGBA 4A7JA 4UI9R 4BCCA 3JAMg 3NVNA 4G1EA 1NR0A 2BCJB 4J86A 4O02A 2VDRA 1RI6A 3SBQA 5C9ZB 1TYQC 3CFSB 1UTCA 4J8GA 4CI1A 4NSXA 5E6SA 3JB9L 3VGZA 3MKSB 4JT6C 3KRXB 2QR5A 5EALA 4BH6A 5KDOB 4ERQA 5TEEA 3UVKA 3SJLD 3EQ7A 4K3JB 2OK6A 2OJYA 4H5IA 4AN0A 4NENA 4E5ZB 4A09B 3RFGA 4J82A 4GM3A 3P4FA 5THAA 1H2WA 2CO0C 4CZYA 2Z2OA 2OIZA 3B7FA 1QFMA 3UKRC 4AOWA 4BP9A 5FFOA 4D6VA 4NBMA 4JSPC 4J84A 4X63B 2W18A
chains in the Genus database with same CATH topology
3CIKB 3OW8A 4D0KA 4PNKB 4FA9D 5B4WA 3UKUC 3RLMD 3L4OD 2PM6B 5GXIA 2G9AA 3UVNA 1U2VC 5SXMA 2IWKA 5CYKB 4GMBA 3DWLC 4BUJC 3L4MD 5HYNB 5HQGA 3I8EA 2CO0A 4K3ID 2AGZA 4FA5D 4OWRA 4CC9A 5HE2B 4JSXC 1S4UX 3GREA 4X60B 2YNNA 4GQ2P 4GQBB 2AH0A 1Q47A 3CFVA 3EWEA 3UVMA 3RN1D 5A2Qg 3OTTA 3OL2B 3C99A 4CY3A 3MKQA 2I0SA 1U4CA 3ZWLB 4U7AA 4GGCA 1ERJA 1GP2B 3IJ1A 2H3XA 5FQDA 2P9IC 4O45A 5H17A 5H1MA 5CXBA 4A11A 5K19A 2MTAH 4J87A 3PXTD 4ZOZA 2H13A 3SBPA 3ORVD 4XYIA 4CZXA 3I7KA 4A2MA 3ODTA 2QC5A 5GMKn 4A0AB 2B5MA 3E0CA 2GC4A 2H9NA 4A0BB 5GXHA 3F3PA 5HE3B 2P9LC 2HESX 2XU7A 3MMYA 3VH0A 5TDHB 3UR4A 4IA9A 3EI4B 4Y7RA 4J8BA 5CYKA 4IMMA 5JWZA 3AH8B 4L3HD 4FA4D 3IJ0A 4A08B 3V7DB 4MK0B 3NVQA 4JSVC 3C5MA 3SCYA 1PEVA 2AQ5A 3BG0A 3JZGA 3JRPA 2IAAA 3RFHA 4JT5C 2HYEA 2AH1A 1JMXB 3W15A 1PBYB 3FM0A 3AL8B 4KFMB 4QT8A 2H68A 2YBAA 3PVWB 4YVDA 5TEFA 2YMUA 5EM2B 1K32A 1YFQA 2CN3A 4L1QD 4CZVA 3I7LA 3HFQA 1MG3A 5AJAA 3OL2A 4PBYA 5EARA 3UVOA 1XIPA 1OMWB 2AGYA 1SHYB 3EI3B 5EMJB 5IGOA 4EWRA 4JXMA 2HJBA 3F3FA 1B9YA 1OLZA 2B5NA 3SN6B 3EI2A 1A0RB 1R5MA 2GC7A 2B4EA 2IUVA 2BBKH 2PM7B 4ERZA 3RN0D 3DM0A 3PE7A 4FA1D 5IC7A 3SHFA 3MXXA 4A2LA 3A0FA 4A0AA 1NEXB 2Z2PA 4LG9A 4GGDA 2H9MA 2PBIB 3RSEC 4ZOVA 4PXWA 3EI4A 4BL0A 1PGUA 3IJCA 3DXMC 1JOFA 3C9CA 4JD2C 1JMZB 4A08A 5FA5B 1VYHC 4CY5A 1N6EA 4O1QD 5C2VB 1XHMA 3F3GA 1L0QA 4J0WA 5EMKB 1QNIA 5FKRA 2PM9B 4JSNC 3K26A 4ZN4A 2J55H 2IWFA 3SXTD 3AL8A 2Z2NA 4ZOXA 4L9OA 2I0RA 2H6KA 5EM2A 3EG6A 2O9KA 4CI2A 5FLXg 2UZXB 3OKTA 4E5ZA 4A09A 5K1CC 3MZKA 3SBRA 4Y5RD 4GM8A 1GG2B 5EAPA 1GXRA 3EI3A 4FHLA 3J81g 2CNXA 2XYIA 4GM9A 3NVXA 3IIYA 1N6DA 1XKSA 3PXSD 1JJUB 3ULEC 1B9XA 2OVQB 3RMZD 4E54B 4U1EI 2P9PC 2I0TA 4LG8A 2XL3A 2HKRA 2H6NA 3JPXA 3RRMC 3U4YA 2TRCB 5FXYA 1SQJA 4ZOYA 5FKTA 2J57G 2H14A 4N14A 3KRWB 3UVLA 2H9LA 5I5IA 4CI8A 2YB8B 5TF2A 3I7OA 4CY1A 2AGWA 3I7HA 3FRXA 3I89A 5CXCB 4J79A 4J81A 2I3TA 4I79A 4PC0A 4GZ8A 3V5WB 4AEZA 4Z8LA 2P9UC 3N0DA 3I8CA 4FAVD 2P9KC 4TZ4A 1PI6A 2PM9A 4G56B 2CE8A 2IURA 2B5LA 3JROA 3SVWD 2AGXA 5IJ7E 1GOTB 4O9DA 2P9SC 3PSCB 3I7NA 2IUQA 4QL1A 2H6QA 5CXBB 4A11B 3K27A 3SMRA 3PVUB 2QXVA 5IGQA 1SQ9A 3PSLA 3EU7A 5HE1B 3DXKC 4PBZA 4FAND 2YNPA 4H5JA 1TBGA 2HKMA 1FWXA 4XYHA 2CE9A 2YNOA 4E54A 4A0BA 2CN2A 3EMHA 2H9PA 2UZYB 5FKSA 2OK4A 3V9FA 2AGLA 3EI1B 1MDAH 3J80g 3OKYB 4GQ1A 4QRJA 4QQEA 2OVRB 4ERYA 4PSWB 5IJ8E 4X3EA 2Q7QA 2GNQA 1P22A 5H14A 2HJ4A 5C2WB 3I2NA 2G99A 4ESGA 5CXCA 4L3GD 3IIWA 4ES0A 4XEIC 3C75H 4J73A 4OZUA 4R7AB 2IUPA 2HXCA 4FWWA 3JZHA 4O3TB 3OKWA 2H47A 3N0EA 3IKOA 3MZLA 4FB1D 4J77A 4O3UB 3EI2B 2P9NC 5AFU3 5IT9g 3I7PA 1MG2A 5I5MA 3BG1A 3JZNA 3GFCA 5I5JA 2J56H 4GGAA 4PSXB 4X61B 5HE0B 4LGNA 5EAMA 3AL9A 5GSAA 4J78A 1K8KC 3DSMA 4HDJA 5EMLB 2I3SA 3SWSD 3AFCA 4J0XA 2XL2A 5FKQA 4CY2A 5EMMB 1N6FA 3PXWD 3SLED 2EBSA 3BWSA 3EI1A 3SFZA 4CI3A 5AMSA 2OVPB 3OKYA 3VA6A 3FGBA 4A7JA 4UI9R 3JAMg 3NVNA 1NR0A 2BCJB 4J86A 1RI6A 3SBQA 5C9ZB 1TYQC 3CFSB 4J8GA 4CI1A 4NSXA 3JB9L 3VGZA 3MKSB 4JT6C 3KRXB 5EALA 4BH6A 5KDOB 4ERQA 5TEEA 3UVKA 3SJLD 4K3JB 2OK6A 2OJYA 4H5IA 4E5ZB 4A09B 3RFGA 4J82A 4GM3A 3P4FA 5THAA 2CO0C 4CZYA 2Z2OA 2OIZA 3B7FA 3UKRC 4AOWA 4D6VA 4JSPC 4J84A 4X63B 2W18A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CIK B;  3OW8 A;  4D0K A;  4PNK B;  4FA9 D;  5B4W A;  3UKU C;  3RLM D;  3L4O D;  2PM6 B;  5GXI A;  2G9A A;  3UVN A;  1U2V C;  5SXM A;  2IWK A;  5CYK B;  4GMB A;  3DWL C;  4BUJ C;  3L4M D;  5HYN B;  5HQG A;  3I8E A;  2CO0 A;  4K3I D;  2AGZ A;  4FA5 D;  4OWR A;  4CC9 A;  5HE2 B;  4JSX C;  1S4U X;  3GRE A;  4X60 B;  2YNN A;  4GQ2 P;  4GQB B;  2AH0 A;  1Q47 A;  3CFV A;  3EWE A;  3UVM A;  3RN1 D;  5A2Q g;  3OTT A;  3OL2 B;  3C99 A;  4CY3 A;  3MKQ A;  2I0S A;  1U4C A;  3ZWL B;  4U7A A;  4GGC A;  1ERJ A;  1GP2 B;  3IJ1 A;  2H3X A;  5FQD A;  2P9I C;  4O45 A;  5H17 A;  5H1M A;  5CXB A;  4A11 A;  5K19 A;  2MTA H;  4J87 A;  3PXT D;  4ZOZ A;  2H13 A;  3SBP A;  3ORV D;  4XYI A;  4CZX A;  3I7K A;  4A2M A;  3ODT A;  2QC5 A;  5GMK n;  4A0A B;  2B5M A;  3E0C A;  2GC4 A;  2H9N A;  4A0B B;  5GXH A;  3F3P A;  5HE3 B;  2P9L C;  2HES X;  2XU7 A;  3MMY A;  3VH0 A;  5TDH B;  3UR4 A;  4IA9 A;  3EI4 B;  4Y7R A;  4J8B A;  5CYK A;  4IMM A;  5JWZ A;  3AH8 B;  4L3H D;  4FA4 D;  3IJ0 A;  4A08 B;  3V7D B;  4MK0 B;  3NVQ A;  4JSV C;  3C5M A;  3SCY A;  1PEV A;  2AQ5 A;  3BG0 A;  3JZG A;  3JRP A;  2IAA A;  3RFH A;  4JT5 C;  2HYE A;  2AH1 A;  1JMX B;  3W15 A;  1PBY B;  3FM0 A;  3AL8 B;  4KFM B;  4QT8 A;  2H68 A;  2YBA A;  3PVW B;  4YVD A;  5TEF A;  2YMU A;  5EM2 B;  1K32 A;  1YFQ A;  2CN3 A;  4L1Q D;  4CZV A;  3I7L A;  3HFQ A;  1MG3 A;  5AJA A;  3OL2 A;  4PBY A;  5EAR A;  3UVO A;  1XIP A;  1OMW B;  2AGY A;  1SHY B;  3EI3 B;  5EMJ B;  5IGO A;  4EWR A;  4JXM A;  2HJB A;  3F3F A;  1B9Y A;  1OLZ A;  2B5N A;  3SN6 B;  3EI2 A;  1A0R B;  1R5M A;  2GC7 A;  2B4E A;  2IUV A;  2BBK H;  2PM7 B;  4ERZ A;  3RN0 D;  3DM0 A;  3PE7 A;  4FA1 D;  5IC7 A;  3SHF A;  3MXX A;  4A2L A;  3A0F A;  4A0A A;  1NEX B;  2Z2P A;  4LG9 A;  4GGD A;  2H9M A;  2PBI B;  3RSE C;  4ZOV A;  4PXW A;  3EI4 A;  4BL0 A;  1PGU A;  3IJC A;  3DXM C;  1JOF A;  3C9C A;  4JD2 C;  1JMZ B;  4A08 A;  5FA5 B;  1VYH C;  4CY5 A;  1N6E A;  4O1Q D;  5C2V B;  1XHM A;  3F3G A;  1L0Q A;  4J0W A;  5EMK B;  1QNI A;  5FKR A;  2PM9 B;  4JSN C;  3K26 A;  4ZN4 A;  2J55 H;  2IWF A;  3SXT D;  3AL8 A;  2Z2N A;  4ZOX A;  4L9O A;  2I0R A;  2H6K A;  5EM2 A;  3EG6 A;  2O9K A;  4CI2 A;  5FLX g;  2UZX B;  3OKT A;  4E5Z A;  4A09 A;  5K1C C;  3MZK A;  3SBR A;  4Y5R D;  4GM8 A;  1GG2 B;  5EAP A;  1GXR A;  3EI3 A;  4FHL A;  3J81 g;  2CNX A;  2XYI A;  4GM9 A;  3NVX A;  3IIY A;  1N6D A;  1XKS A;  3PXS D;  1JJU B;  3ULE C;  1B9X A;  2OVQ B;  3RMZ D;  4E54 B;  4U1E I;  2P9P C;  2I0T A;  4LG8 A;  2XL3 A;  2HKR A;  2H6N A;  3JPX A;  3RRM C;  3U4Y A;  2TRC B;  5FXY A;  1SQJ A;  4ZOY A;  5FKT A;  2J57 G;  2H14 A;  4N14 A;  3KRW B;  3UVL A;  2H9L A;  5I5I A;  4CI8 A;  2YB8 B;  5TF2 A;  3I7O A;  4CY1 A;  2AGW A;  3I7H A;  3FRX A;  3I89 A;  5CXC B;  4J79 A;  4J81 A;  2I3T A;  4I79 A;  4PC0 A;  4GZ8 A;  3V5W B;  4AEZ A;  4Z8L A;  2P9U C;  3N0D A;  3I8C A;  4FAV D;  2P9K C;  4TZ4 A;  1PI6 A;  2PM9 A;  4G56 B;  2CE8 A;  2IUR A;  2B5L A;  3JRO A;  3SVW D;  2AGX A;  5IJ7 E;  1GOT B;  4O9D A;  2P9S C;  3PSC B;  3I7N A;  2IUQ A;  4QL1 A;  2H6Q A;  5CXB B;  4A11 B;  3K27 A;  3SMR A;  3PVU B;  2QXV A;  5IGQ A;  1SQ9 A;  3PSL A;  3EU7 A;  5HE1 B;  3DXK C;  4PBZ A;  4FAN D;  2YNP A;  4H5J A;  1TBG A;  2HKM A;  1FWX A;  4XYH A;  2CE9 A;  2YNO A;  4E54 A;  4A0B A;  2CN2 A;  3EMH A;  2H9P A;  2UZY B;  5FKS A;  2OK4 A;  3V9F A;  2AGL A;  3EI1 B;  1MDA H;  3J80 g;  3OKY B;  4GQ1 A;  4QRJ A;  4QQE A;  2OVR B;  4ERY A;  4PSW B;  5IJ8 E;  4X3E A;  2Q7Q A;  2GNQ A;  1P22 A;  5H14 A;  2HJ4 A;  5C2W B;  3I2N A;  2G99 A;  4ESG A;  5CXC A;  4L3G D;  3IIW A;  4ES0 A;  4XEI C;  3C75 H;  4J73 A;  4OZU A;  4R7A B;  2IUP A;  2HXC A;  4FWW A;  3JZH A;  4O3T B;  3OKW A;  2H47 A;  3N0E A;  3IKO A;  3MZL A;  4FB1 D;  4J77 A;  4O3U B;  3EI2 B;  2P9N C;  5AFU 3;  5IT9 g;  3I7P A;  1MG2 A;  5I5M A;  3BG1 A;  3JZN A;  3GFC A;  5I5J A;  2J56 H;  4GGA A;  4PSX B;  4X61 B;  5HE0 B;  4LGN A;  5EAM A;  3AL9 A;  5GSA A;  4J78 A;  1K8K C;  3DSM A;  4HDJ A;  5EML B;  2I3S A;  3SWS D;  3AFC A;  4J0X A;  2XL2 A;  5FKQ A;  4CY2 A;  5EMM B;  1N6F A;  3PXW D;  3SLE D;  2EBS A;  3BWS A;  3EI1 A;  3SFZ A;  4CI3 A;  5AMS A;  2OVP B;  3OKY A;  3VA6 A;  3FGB A;  4A7J A;  4UI9 R;  3JAM g;  3NVN A;  1NR0 A;  2BCJ B;  4J86 A;  1RI6 A;  3SBQ A;  5C9Z B;  1TYQ C;  3CFS B;  4J8G A;  4CI1 A;  4NSX A;  3JB9 L;  3VGZ A;  3MKS B;  4JT6 C;  3KRX B;  5EAL A;  4BH6 A;  5KDO B;  4ERQ A;  5TEE A;  3UVK A;  3SJL D;  4K3J B;  2OK6 A;  2OJY A;  4H5I A;  4E5Z B;  4A09 B;  3RFG A;  4J82 A;  4GM3 A;  3P4F A;  5THA A;  2CO0 C;  4CZY A;  2Z2O A;  2OIZ A;  3B7F A;  3UKR C;  4AOW A;  4D6V A;  4JSP C;  4J84 A;  4X63 B;  2W18 A; 
#chains in the Genus database with same CATH topology
 5M5R A;  3CIK B;  3ZE0 A;  4IRZ A;  3OW8 A;  4D0K A;  4PNK B;  4FA9 D;  5B4W A;  3UKU C;  3RLM D;  3L4O D;  2HU7 A;  4WK4 A;  2PM6 B;  5GXI A;  2G9A A;  3UVN A;  1U2V C;  5SXM A;  2IWK A;  5CYK B;  4NC4 A;  3MUN A;  4GMB A;  4D9S A;  3DWL C;  4BUJ C;  3L4M D;  5HYN B;  2VDO A;  5HQG A;  5M5S A;  3ZDX A;  3I8E A;  2CO0 A;  4K3I D;  1TYE A;  3VI3 A;  2AGZ A;  4FA5 D;  5C92 A;  4OWR A;  4CC9 A;  5HE2 B;  3QHY B;  4JSX C;  1M1X A;  1H2Y A;  1S4U X;  3GRE A;  4X60 B;  3K71 A;  4RE5 A;  2XE4 A;  2YNN A;  3IUM A;  4RE6 A;  4GQ2 P;  4GQB B;  3ZE2 A;  2AH0 A;  1Q47 A;  3CFV A;  3EWE A;  4WK0 A;  2VDN A;  4WK2 A;  3UVM A;  3RN1 D;  2EIB A;  4L1M A;  5A2Q g;  3OTT A;  3OL2 B;  3C99 A;  4CY3 A;  3FCU A;  3MKQ A;  2I0S A;  1QFS A;  3GD1 I;  1U4C A;  3ZWL B;  4U7A A;  1VE6 A;  1H2Z A;  4GGC A;  1ERJ A;  1GP2 B;  3IJ1 A;  2H3X A;  5FQD A;  2P9I C;  4O45 A;  5H17 A;  5H1M A;  5CXB A;  4A11 A;  5K19 A;  1O6G A;  2MTA H;  4J87 A;  4Z7Q A;  3PXT D;  4ZOZ A;  4DNW A;  2VC2 A;  2H13 A;  4JHN A;  3SBP A;  3IUL A;  3ORV D;  4XYI A;  4CZX A;  1UOQ A;  3I7K A;  4A2M A;  3ODT A;  2XZG A;  2EID A;  4BP8 A;  1YR2 A;  2QC5 A;  4UM8 A;  5GMK n;  4A0A B;  2B5M A;  3E0C A;  2GC4 A;  2H9N A;  4A0B B;  5GXH A;  3F3P A;  5HE3 B;  2P9L C;  2HES X;  2XU7 A;  3MMY A;  3VH0 A;  5TDH B;  1VZ2 A;  4BCB A;  3UR4 A;  4IA9 A;  3EI4 B;  4Y7R A;  4J8B A;  5CYK A;  1A12 A;  4IMM A;  5JWZ A;  1K3I A;  3AH8 B;  4L3H D;  4FA4 D;  3IJ0 A;  3IUR A;  4A08 B;  3V7D B;  4JHP C;  4MK0 B;  3NVQ A;  4JSV C;  3C5M A;  3SCY A;  1PEV A;  2AQ5 A;  3BG0 A;  3JZG A;  3JRP A;  2IAA A;  3RFH A;  4JT5 C;  2HYE A;  2AH1 A;  1JMX B;  3W15 A;  1PBY B;  3FM0 A;  2VDM A;  2VZ3 A;  3AL8 B;  4KFM B;  4QT8 A;  2H68 A;  2YBA A;  3PVW B;  4YVD A;  5TEF A;  2YMU A;  5EM2 B;  1K32 A;  1YFQ A;  2CN3 A;  4L1Q D;  2VDQ A;  4CZV A;  3I7L A;  3HFQ A;  1MG3 A;  5AJA A;  3OL2 A;  4PBY A;  5EAR A;  3T3M A;  3UVO A;  1XIP A;  1OMW B;  2AGY A;  1SHY B;  3EI3 B;  5EMJ B;  5IGO A;  4EWR A;  4MMX A;  4JXM A;  2HJB A;  2JKX A;  3F3F A;  1VE7 A;  1B9Y A;  1OLZ A;  2B5N A;  3SN6 B;  3EI2 A;  1A0R B;  1R5M A;  1JTD B;  3IUQ A;  2GC7 A;  2B4E A;  2IUV A;  2BBK H;  3V4P A;  5FFG A;  3MVD K;  2PM7 B;  2HU5 A;  4ERZ A;  3RN0 D;  3DM0 A;  3PE7 A;  4FA1 D;  1UOP A;  5IC7 A;  3SHF A;  3MXX A;  4A2L A;  2EIE A;  3A0F A;  4A0A A;  4QAM A;  1NEX B;  2Z2P A;  4LG9 A;  2VDL A;  2VZ1 A;  3NID A;  4GGD A;  2H9M A;  2PBI B;  3NIG A;  3RSE C;  4ZOV A;  4PXW A;  1VZ3 A;  3EI4 A;  4BL0 A;  1PGU A;  1GOH A;  3IJC A;  1BPO A;  3DXM C;  1JOF A;  3C9C A;  4JD2 C;  1JMZ B;  4A08 A;  5FA5 B;  1VYH C;  4CY5 A;  1N6E A;  4O1Q D;  5C2V B;  1XHM A;  3EQ8 A;  3F3G A;  3MUO A;  1L0Q A;  4J0W A;  5EMK B;  1QNI A;  5FKR A;  2PM9 B;  4WJK A;  4JSN C;  3K26 A;  4ZN4 A;  2J55 H;  2IWF A;  3SXT D;  5C86 A;  3AL8 A;  2Z2N A;  4ZOX A;  4L9O A;  3V4V A;  2I0R A;  1GOF A;  2H6K A;  2HU8 A;  5EM2 A;  2QZP A;  3EG6 A;  3OF7 A;  2O9K A;  4CI2 A;  4G55 A;  5FLX g;  2UZX B;  3OKT A;  4E5Z A;  4A09 A;  5K1C C;  3MZK A;  3SBR A;  1E8M A;  4Y5R D;  4GM8 A;  1GG2 B;  5EAP A;  1GXR A;  3EI3 A;  4UM9 A;  4FHL A;  3J81 g;  2CNX A;  3ZE1 A;  2XYI A;  4GM9 A;  1JV2 A;  3NVX A;  3IIY A;  1N6D A;  1XKS A;  3PXS D;  1JJU B;  3ULE C;  1B9X A;  2OVQ B;  3RMZ D;  4E54 B;  4U1E I;  2P9P C;  3NIF A;  2I0T A;  4LG8 A;  2XL3 A;  1C9L A;  2HKR A;  2H6N A;  3JPX A;  4Z7O A;  3RRM C;  3U4Y A;  2TRC B;  5FXY A;  4AMY A;  1SQJ A;  4ZOY A;  5FKT A;  2J57 G;  2H14 A;  3EQ9 A;  3IUN A;  4N14 A;  3KRW B;  3UVL A;  2H9L A;  5I5I A;  4CI8 A;  4AN1 A;  2YB8 B;  5TF2 A;  3I7O A;  4CY1 A;  1I2M B;  2AGW A;  4MMZ A;  3I7H A;  3FRX A;  3I89 A;  3IUJ A;  5CXC B;  2VDP A;  4J81 A;  4J79 A;  2I3T A;  4I79 A;  4PC0 A;  4GZ8 A;  3V5W B;  4Z7N A;  4AEZ A;  4Z8L A;  5M5V A;  2P9U C;  3N0D A;  3I8C A;  4FAV D;  1L5G A;  2P9K C;  4TZ4 A;  1PI6 A;  2PM9 A;  2VDK A;  4G56 B;  3O4J A;  4AX4 A;  2CE8 A;  2IUR A;  2B5L A;  3JRO A;  4DNU A;  3SVW D;  5E6R A;  1H2X A;  2AGX A;  1T2X A;  5IJ7 E;  1GOT B;  4O9D A;  2P9S C;  3PSC B;  4O2W A;  3I7N A;  2IUQ A;  4QL1 A;  2H6Q A;  5CXB B;  5E6U A;  3K27 A;  4A11 B;  3SMR A;  4AMZ A;  3PVU B;  2QXV A;  3K72 A;  3GC3 B;  5IGQ A;  1SQ9 A;  3PSL A;  3EU7 A;  5HE1 B;  3DXK C;  4PBZ A;  4DNV A;  4FAN D;  2YNP A;  4H5J A;  2XDW A;  1TBG A;  2HKM A;  1FWX A;  4XYH A;  2CE9 A;  2YNO A;  4E54 A;  4A0B A;  2CN2 A;  1E8N A;  3EMH A;  3KCI A;  3FCS A;  4MMY A;  2H9P A;  2UZY B;  4BCD A;  5FKS A;  2OK4 A;  5M61 A;  3V9F A;  2AGL A;  3EI1 B;  3K6S A;  1MDA H;  3T3P A;  3J80 g;  3DDU A;  3OKY B;  4GQ1 A;  4QRJ A;  4QQE A;  2OVR B;  4ERY A;  4PSW B;  5IJ8 E;  4X3E A;  2Q7Q A;  2GNQ A;  3IJE A;  2BKL A;  2EIC A;  1P22 A;  5H14 A;  2HJ4 A;  5C2W B;  3I2N A;  2G99 A;  1C9I A;  4ESG A;  5CXC A;  4L3G D;  3IIW A;  3O4H A;  4NAA A;  4ES0 A;  1U8C A;  4XEI C;  3C75 H;  3ZDZ A;  4J73 A;  4OZU A;  4R7A B;  2IUP A;  2HXC A;  3O4I A;  4FWW A;  3JZH A;  5M5T A;  4O3T B;  3ZDY A;  3OKW A;  5HDB A;  2H47 A;  3N0E A;  3IKO A;  3IVM A;  3MZL A;  3VI4 A;  4FB1 D;  1O6F A;  4J77 A;  4O3U B;  3EI2 B;  2P9N C;  5AFU 3;  5IT9 g;  3I7P A;  5M5U A;  1MG2 A;  5I5M A;  1GOG A;  3BG1 A;  3JZN A;  3GFC A;  5I5J A;  2J56 H;  3QI0 A;  4GGA A;  4PSX B;  4X61 B;  5HE0 B;  4LGN A;  5EAM A;  3AL9 A;  5GSA A;  4J78 A;  1K8K C;  3DSM A;  4G1M A;  3O4G A;  4HDJ A;  1E5T A;  5EML B;  2I3S A;  3SWS D;  2WQ8 A;  3AFC A;  4J0X A;  2XL2 A;  5FKQ A;  4CY2 A;  5EMM B;  1N6F A;  3PXW D;  3SLE D;  2EBS A;  3BWS A;  3EI1 A;  3SFZ A;  4CI3 A;  5AMS A;  2OVP B;  3OKY A;  3VA6 A;  1UOO A;  3FGB A;  4A7J A;  4UI9 R;  4BCC A;  3JAM g;  3NVN A;  4G1E A;  1NR0 A;  2BCJ B;  4J86 A;  4O02 A;  2VDR A;  1RI6 A;  3SBQ A;  5C9Z B;  1TYQ C;  3CFS B;  1UTC A;  4J8G A;  4CI1 A;  4NSX A;  5E6S A;  3JB9 L;  3VGZ A;  3MKS B;  4JT6 C;  3KRX B;  2QR5 A;  5EAL A;  4BH6 A;  5KDO B;  4ERQ A;  5TEE A;  3UVK A;  3SJL D;  3EQ7 A;  4K3J B;  2OK6 A;  2OJY A;  4H5I A;  4AN0 A;  4NEN A;  4E5Z B;  4A09 B;  3RFG A;  4J82 A;  4GM3 A;  3P4F A;  5THA A;  1H2W A;  2CO0 C;  4CZY A;  2Z2O A;  2OIZ A;  3B7F A;  1QFM A;  3UKR C;  4AOW A;  4BP9 A;  5FFO A;  4D6V A;  4NBM A;  4JSP C;  4J84 A;  4X63 B;  2W18 A; 
#chains in the Genus database with same CATH homology
 3CIK B;  3OW8 A;  4D0K A;  4PNK B;  4FA9 D;  5B4W A;  3UKU C;  3RLM D;  3L4O D;  2PM6 B;  5GXI A;  2G9A A;  3UVN A;  1U2V C;  5SXM A;  2IWK A;  5CYK B;  4GMB A;  3DWL C;  4BUJ C;  3L4M D;  5HYN B;  5HQG A;  3I8E A;  2CO0 A;  4K3I D;  2AGZ A;  4FA5 D;  4OWR A;  4CC9 A;  5HE2 B;  4JSX C;  1S4U X;  3GRE A;  4X60 B;  2YNN A;  4GQ2 P;  4GQB B;  2AH0 A;  1Q47 A;  3CFV A;  3EWE A;  3UVM A;  3RN1 D;  5A2Q g;  3OTT A;  3OL2 B;  3C99 A;  4CY3 A;  3MKQ A;  2I0S A;  1U4C A;  3ZWL B;  4U7A A;  4GGC A;  1ERJ A;  1GP2 B;  3IJ1 A;  2H3X A;  5FQD A;  2P9I C;  4O45 A;  5H17 A;  5H1M A;  5CXB A;  4A11 A;  5K19 A;  2MTA H;  4J87 A;  3PXT D;  4ZOZ A;  2H13 A;  3SBP A;  3ORV D;  4XYI A;  4CZX A;  3I7K A;  4A2M A;  3ODT A;  2QC5 A;  5GMK n;  4A0A B;  2B5M A;  3E0C A;  2GC4 A;  2H9N A;  4A0B B;  5GXH A;  3F3P A;  5HE3 B;  2P9L C;  2HES X;  2XU7 A;  3MMY A;  3VH0 A;  5TDH B;  3UR4 A;  4IA9 A;  3EI4 B;  4Y7R A;  4J8B A;  5CYK A;  4IMM A;  5JWZ A;  3AH8 B;  4L3H D;  4FA4 D;  3IJ0 A;  4A08 B;  3V7D B;  4MK0 B;  3NVQ A;  4JSV C;  3C5M A;  3SCY A;  1PEV A;  2AQ5 A;  3BG0 A;  3JZG A;  3JRP A;  2IAA A;  3RFH A;  4JT5 C;  2HYE A;  2AH1 A;  1JMX B;  3W15 A;  1PBY B;  3FM0 A;  3AL8 B;  4KFM B;  4QT8 A;  2H68 A;  2YBA A;  3PVW B;  4YVD A;  5TEF A;  2YMU A;  5EM2 B;  1K32 A;  1YFQ A;  2CN3 A;  4L1Q D;  4CZV A;  3I7L A;  3HFQ A;  1MG3 A;  5AJA A;  3OL2 A;  4PBY A;  5EAR A;  3UVO A;  1XIP A;  1OMW B;  2AGY A;  1SHY B;  3EI3 B;  5EMJ B;  5IGO A;  4EWR A;  4JXM A;  2HJB A;  3F3F A;  1B9Y A;  1OLZ A;  2B5N A;  3SN6 B;  3EI2 A;  1A0R B;  1R5M A;  2GC7 A;  2B4E A;  2IUV A;  2BBK H;  2PM7 B;  4ERZ A;  3RN0 D;  3DM0 A;  3PE7 A;  4FA1 D;  5IC7 A;  3SHF A;  3MXX A;  4A2L A;  3A0F A;  4A0A A;  1NEX B;  2Z2P A;  4LG9 A;  4GGD A;  2H9M A;  2PBI B;  3RSE C;  4ZOV A;  4PXW A;  3EI4 A;  4BL0 A;  1PGU A;  3IJC A;  3DXM C;  1JOF A;  3C9C A;  4JD2 C;  1JMZ B;  4A08 A;  5FA5 B;  1VYH C;  4CY5 A;  1N6E A;  4O1Q D;  5C2V B;  1XHM A;  3F3G A;  1L0Q A;  4J0W A;  5EMK B;  1QNI A;  5FKR A;  2PM9 B;  4JSN C;  3K26 A;  4ZN4 A;  2J55 H;  2IWF A;  3SXT D;  3AL8 A;  2Z2N A;  4ZOX A;  4L9O A;  2I0R A;  2H6K A;  5EM2 A;  3EG6 A;  2O9K A;  4CI2 A;  5FLX g;  2UZX B;  3OKT A;  4E5Z A;  4A09 A;  5K1C C;  3MZK A;  3SBR A;  4Y5R D;  4GM8 A;  1GG2 B;  5EAP A;  1GXR A;  3EI3 A;  4FHL A;  3J81 g;  2CNX A;  2XYI A;  4GM9 A;  3NVX A;  3IIY A;  1N6D A;  1XKS A;  3PXS D;  1JJU B;  3ULE C;  1B9X A;  2OVQ B;  3RMZ D;  4E54 B;  4U1E I;  2P9P C;  2I0T A;  4LG8 A;  2XL3 A;  2HKR A;  2H6N A;  3JPX A;  3RRM C;  3U4Y A;  2TRC B;  5FXY A;  1SQJ A;  4ZOY A;  5FKT A;  2J57 G;  2H14 A;  4N14 A;  3KRW B;  3UVL A;  2H9L A;  5I5I A;  4CI8 A;  2YB8 B;  5TF2 A;  3I7O A;  4CY1 A;  2AGW A;  3I7H A;  3FRX A;  3I89 A;  5CXC B;  4J79 A;  4J81 A;  2I3T A;  4I79 A;  4PC0 A;  4GZ8 A;  3V5W B;  4AEZ A;  4Z8L A;  2P9U C;  3N0D A;  3I8C A;  4FAV D;  2P9K C;  4TZ4 A;  1PI6 A;  2PM9 A;  4G56 B;  2CE8 A;  2IUR A;  2B5L A;  3JRO A;  3SVW D;  2AGX A;  5IJ7 E;  1GOT B;  4O9D A;  2P9S C;  3PSC B;  3I7N A;  2IUQ A;  4QL1 A;  2H6Q A;  5CXB B;  4A11 B;  3K27 A;  3SMR A;  3PVU B;  2QXV A;  5IGQ A;  1SQ9 A;  3PSL A;  3EU7 A;  5HE1 B;  3DXK C;  4PBZ A;  4FAN D;  2YNP A;  4H5J A;  1TBG A;  2HKM A;  1FWX A;  4XYH A;  2CE9 A;  2YNO A;  4E54 A;  4A0B A;  2CN2 A;  3EMH A;  2H9P A;  2UZY B;  5FKS A;  2OK4 A;  3V9F A;  2AGL A;  3EI1 B;  1MDA H;  3J80 g;  3OKY B;  4GQ1 A;  4QRJ A;  4QQE A;  2OVR B;  4ERY A;  4PSW B;  5IJ8 E;  4X3E A;  2Q7Q A;  2GNQ A;  1P22 A;  5H14 A;  2HJ4 A;  5C2W B;  3I2N A;  2G99 A;  4ESG A;  5CXC A;  4L3G D;  3IIW A;  4ES0 A;  4XEI C;  3C75 H;  4J73 A;  4OZU A;  4R7A B;  2IUP A;  2HXC A;  4FWW A;  3JZH A;  4O3T B;  3OKW A;  2H47 A;  3N0E A;  3IKO A;  3MZL A;  4FB1 D;  4J77 A;  4O3U B;  3EI2 B;  2P9N C;  5AFU 3;  5IT9 g;  3I7P A;  1MG2 A;  5I5M A;  3BG1 A;  3JZN A;  3GFC A;  5I5J A;  2J56 H;  4GGA A;  4PSX B;  4X61 B;  5HE0 B;  4LGN A;  5EAM A;  3AL9 A;  5GSA A;  4J78 A;  1K8K C;  3DSM A;  4HDJ A;  5EML B;  2I3S A;  3SWS D;  3AFC A;  4J0X A;  2XL2 A;  5FKQ A;  4CY2 A;  5EMM B;  1N6F A;  3PXW D;  3SLE D;  2EBS A;  3BWS A;  3EI1 A;  3SFZ A;  4CI3 A;  5AMS A;  2OVP B;  3OKY A;  3VA6 A;  3FGB A;  4A7J A;  4UI9 R;  3JAM g;  3NVN A;  1NR0 A;  2BCJ B;  4J86 A;  1RI6 A;  3SBQ A;  5C9Z B;  1TYQ C;  3CFS B;  4J8G A;  4CI1 A;  4NSX A;  3JB9 L;  3VGZ A;  3MKS B;  4JT6 C;  3KRX B;  5EAL A;  4BH6 A;  5KDO B;  4ERQ A;  5TEE A;  3UVK A;  3SJL D;  4K3J B;  2OK6 A;  2OJY A;  4H5I A;  4E5Z B;  4A09 B;  3RFG A;  4J82 A;  4GM3 A;  3P4F A;  5THA A;  2CO0 C;  4CZY A;  2Z2O A;  2OIZ A;  3B7F A;  3UKR C;  4AOW A;  4D6V A;  4JSP C;  4J84 A;  4X63 B;  2W18 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...