2BBKH

Crystal structure of the quinoprotein methylamine dehydrogenase from paracoccus denitrificans at 1.75 angstroms
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
355
structure length
355
Chain Sequence
DEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined crystal structure of methylamine dehydrogenase from Paracoccus denitrificans at 1.75 A resolution.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
molecule keywords METHYLAMINE DEHYDROGENASE (HEAVY SUBUNIT)
total genus 85
structure length 355
sequence length 355
chains with identical sequence J
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 1993-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2bbkH00
4PC0A 4O45A 4JSNC 5AJAA 4ZOYA 3I2NA 4OZUA 3JZGA 3NVXA 4A0AB 4BUJC 4J73A 2TRCB 1R5MA 3VA6A 4PBZA 3AH8B 3I7OA 1N6DA 2CN2A 3GFCA 4A11A 5IGQA 1JOFA 3IJ1A 4CY2A 3SWSD 2H6KA 1RI6A 2P9SC 2H9LA 4JT5C 3EI2B 3E0CA 1XHMA 4QQEA 2H14A 4J79A 5FLXg 4J8BA 3IJ0A 2G99A 3OW8A 5FKSA 2EBSA 4JT6C 1U2VC 3J80g 2G9AA 3UVNA 5KDOB 5H1MA 4FA5D 1N6FA 2AH1A 3C99A 4CI1A 3N0DA 2AGWA 2I0SA 3C75H 2J57G 2PBIB 3SBRA 4A2LA 4JSVC 1GP2B 1YFQA 3PE7A 1JMZB 4QRJA 2H68A 2YNOA 5EAPA 3EG6A 5CXCA 2BBKH 4CY3A 3ORVD 1K32A 4GM3A 1NR0A 2XYIA 3J81g 5EALA 4A09A 2H9MA 3AL8A 5EMJB 2B5MA 2HJ4A 5C2VB 3A0FA 1QNIA 5B4WA 3UKUC 3AL8B 3W15A 2GC4A 2AGLA 4IMMA 1XIPA 2P9IC 3SFZA 5AFU3 1OMWB 2CO0C 3GREA 3SBPA 1Q47A 5EARA 3EI3A 4CZYA 1MDAH 2HJBA 4J0XA 3CFVA 4AEZA 3IIYA 4NSXA 1GG2B 3AFCA 4N14A 3RMZD 4CY5A 3I8EA 4G56B 2PM7B 3SN6B 2B5NA 4K3ID 4U1EI 5FA5B 3PXSD 2IWFA 5AMSA 2AGZA 3MZLA 4K3JB 4J84A 2J56H 4E54A 4L3HD 3SJLD 3EI4A 3OKWA 2XU7A 5K19A 2OJYA 1PEVA 2B5LA 2OK6A 3EI2A 3V7DB 2PM6B 4H5IA 4JD2C 2I0TA 3JB9L 5K1CC 1MG3A 2YBAA 3UKRC 2GC7A 3EI1B 3OKTA 4X60B 3KRWB 4KFMB 3SBQA 5GXHA 2P9UC 5A2Qg 4OWRA 1XKSA 4J8GA 5EM2A 3OKYA 2J55H 1P22A 2CE8A 2P9NC 3OTTA 3NVQA 4ERZA 1S4UX 3DSMA 3BWSA 3I89A 2HYEA 4J86A 4GGCA 2P9KC 4GQ2P 2OK4A 3SMRA 3RFGA 3I7NA 5TF2A 5I5MA 4ERYA 2PM9B 3IJCA 4GQ1A 4ESGA 4FHLA 4GGAA 2XL2A 3MZKA 2I0RA 3JAMg 3P4FA 4FA4D 3EI1A 3I7LA 5GSAA 4XYIA 3VH0A 5CXCB 3PXTD 2AQ5A 3OL2B 4J0WA 5EAMA 5IJ7E 1JMXB 2W18A 1A0RB 4ES0A 3K26A 4GGDA 2CN3A 4YVDA 3MMYA 3KRXB 4CZXA 3EWEA 4O9DA 3NVNA 2PM9A 2H9NA 5HE1B 3SVWD 5CYKA 4I79A 3AL9A 4A7JA 5H14A 5IC7A 4E5ZB 3L4OD 2OVPB 5EMKB 2MTAH 4AOWA 5C9ZB 2HKMA 4FAND 4A2MA 4L9OA 2P9PC 5TEFA 3K27A 5GMKn 2GNQA 3C5MA 3JZNA 3IIWA 4A0AA 4GM8A 2H6QA 4CI2A 3DXKC 4X3EA 1SHYB 2QC5A 4FAVD 2CE9A 2OVRB 3RRMC 5TDHB 2CNXA 2UZXB 4ZOZA 5EMLB 3F3FA 3RLMD 4MK0B 2H47A 3SXTD 3V9FA 4J82A 4JSPC 5HQGA 1MG2A 3CFSB 1GOTB 2O9KA 3DXMC 3B7FA 4LG8A 3C9CA 4PXWA 4JXMA 4ZOVA 2OVQB 2Q7QA 4CC9A 3PVWB 1U4CA 3RFHA 2IURA 4CI3A 2H13A 4A08A 1GXRA 3UR4A 4J77A 1K8KC 2UZYB 1PBYB 2YNPA 3UVLA 1NEXB 4U7AA 3UVKA 2BCJB 3UVOA 2H9PA 5FKTA 5IGOA 5HE0B 4O1QD 5THAA 2HESX 3I7PA 2XL3A 5CYKB 4FWWA 5I5JA 4IA9A 1ERJA 3PVUB 4BL0A 3I8CA 5C2WB 4BH6A 3RSEC 3VGZA 2Z2OA 2OIZA 3V5WB 4FA1D 3BG1A 3FM0A 4ZOXA 5FQDA 3MXXA 4X63B 2AGXA 5EMMB 5IJ8E 3UVMA 4L3GD 2H6NA 5TEEA 3PSLA 2I3TA 4FA9D 4XYHA 5FXYA 4J87A 3F3PA 4X61B 4ZN4A 3SHFA 3CIKB 3MKSB 3I7HA 4Z8LA 3FRXA 5H17A 4D6VA 4PSWB 1TYQC 4CY1A 3F3GA 1N6EA 2Z2PA 1TBGA 2H3XA 4PBYA 2YNNA 4A09B 3EMHA 4CI8A 2IWKA 2IUPA 4HDJA 1OLZA 2IAAA 2HXCA 2IUQA 2Z2NA 3N0EA 3PSCB 4O3TB 1SQJA 4ERQA 3ULEC 5HYNB 2P9LC 3OKYB 4GMBA 5CXBA 4E5ZA 2B4EA 5EM2B 1SQ9A 5JWZA 2AH0A 4Y7RA 4PSXB 3EI4B 3SLED 4EWRA 4GQBB 3ODTA 4UI9R 3FGBA 1FWXA 4PNKB 4LGNA 1PI6A 4J81A 3IKOA 4JSXC 4TZ4A 5I5IA 3U4YA 2YMUA 3MKQA 3JROA 4L1QD 4R7AB 3DWLC 3JPXA 5FKRA 4CZVA 3RN1D 4QT8A 4LG9A 5CXBB 2HKRA 3L4MD 3HFQA 3EU7A 2QXVA 4O3UB 4QL1A 1VYHC 3OL2A 1L0QA 2YB8B 3EI3B 4A11B 1B9YA 4A08B 3RN0D 1B9XA 1PGUA 3DM0A 4E54B 4H5JA 3JZHA 4GM9A 3PXWD 2AGYA 4FB1D 3BG0A 5GXIA 4Y5RD 5FKQA 2CO0A 2I3SA 2IUVA 5IT9g 3SCYA 3ZWLB 4XEIC 3JRPA 5HE2B 5SXMA 1JJUB 4J78A 4GZ8A 4A0BA 4D0KA 5HE3B 3I7KA 4A0BB
chains in the Genus database with same CATH superfamily
4PC0A 4O45A 4RE6A 4JSNC 5AJAA 4ZOYA 3I2NA 4BCCA 4OZUA 3EQ9A 3JZGA 3NVXA 1BPOA 4A0AB 4BUJC 4J73A 2TRCB 4UM8A 1R5MA 3VA6A 4PBZA 3AH8B 3I7OA 1N6DA 2CN2A 4NENA 3GFCA 3T3MA 4A11A 5IGQA 1JOFA 3IJ1A 4CY2A 3SWSD 2H6KA 1RI6A 2P9SC 2H9LA 4JT5C 3EI2B 3E0CA 1XHMA 4QQEA 2H14A 4J79A 5FLXg 4J8BA 1K3IA 3IJ0A 2G99A 3ZDYA 3OW8A 5FKSA 2EBSA 4JT6C 1U2VC 1QFSA 5C86A 3J80g 2G9AA 3UVNA 5KDOB 1H2WA 5H1MA 4FA5D 1C9LA 1N6FA 3IUMA 2AH1A 3C99A 4CI1A 3N0DA 2AGWA 2I0SA 3C75H 2VDLA 4L1MA 1UOQA 2J57G 2PBIB 3SBRA 4A2LA 4JSVC 1GP2B 1YFQA 3PE7A 1JMZB 4QRJA 4AMYA 2H68A 2YNOA 5EAPA 3EG6A 5CXCA 2BBKH 4CY3A 3ORVD 1K32A 4GM3A 3KCIA 1NR0A 2XYIA 3J81g 5EALA 4A09A 2H9MA 4DNVA 4NBMA 2WQ8A 3AL8A 2B5MA 5EMJB 2HJ4A 5C2VB 3A0FA 2BKLA 1QNIA 5B4WA 3UKUC 3AL8B 3W15A 2GC4A 1VE7A 2AGLA 4IMMA 4JHPC 1XIPA 2P9IC 3SFZA 5AFU3 1JV2A 1OMWB 2CO0C 3GREA 3SBPA 1Q47A 5EARA 3EI3A 4CZYA 1MDAH 2HJBA 4J0XA 3CFVA 4AEZA 3IIYA 4NSXA 1VZ3A 1GG2B 3FCUA 5HDBA 3AFCA 4N14A 3RMZD 4CY5A 3I8EA 4G56B 5M5VA 2PM7B 3SN6B 4D9SA 3VI4A 2B5NA 4K3ID 4RE5A 5M61A 4U1EI 5FA5B 3PXSD 2IWFA 5AMSA 2AGZA 3MZLA 4K3JB 4Z7QA 4J84A 2J56H 3NIDA 4E54A 4L3HD 3SJLD 3EI4A 3OKWA 2XU7A 5K19A 2OJYA 1PEVA 2B5LA 2OK6A 3EI2A 3V7DB 3ZE2A 2EIEA 2PM6B 4H5IA 4JD2C 2I0TA 5M5TA 3JB9L 3IUQA 5K1CC 1MG3A 2YBAA 3UKRC 3O4IA 2GC7A 3EI1B 4UM9A 2VZ1A 3OKTA 4O02A 2VDPA 3IVMA 4X60B 3KRWB 4BCDA 4KFMB 3SBQA 5GXHA 2P9UC 4BCBA 4OWRA 5A2Qg 1XKSA 2XZGA 5E6SA 4J8GA 5EM2A 3OKYA 1GOFA 2J55H 1P22A 2CE8A 2P9NC 3OTTA 2EIBA 3NVQA 4ERZA 1S4UX 3DSMA 4G1MA 3BWSA 3I89A 2HU7A 2VDQA 5M5SA 2HYEA 4J86A 4GGCA 2P9KC 3K72A 4GQ2P 2OK4A 3SMRA 3RFGA 3I7NA 5TF2A 5I5MA 4ERYA 2PM9B 3IJCA 4GQ1A 4ESGA 4FHLA 4GGAA 3DDUA 2XL2A 1O6FA 3MZKA 2I0RA 3JAMg 3P4FA 4FA4D 4AX4A 3I7LA 5GSAA 4XYIA 3EI1A 3VH0A 5CXCB 3EQ8A 3PXTD 2AQ5A 3OL2B 3ZDXA 3O4HA 4J0WA 5EAMA 5IJ7E 1JMXB 2W18A 1A0RB 4ES0A 3K26A 4GGDA 2CN3A 4YVDA 3MMYA 3KRXB 4CZXA 2JKXA 3EWEA 5E6UA 4O9DA 2HU5A 3NIFA 2PM9A 1UOPA 3NVNA 2H9NA 4Z7OA 5HE1B 3SVWD 2XDWA 3FCSA 5CYKA 4I79A 3QI0A 3AL9A 4A7JA 2VC2A 5H14A 1UOOA 5IC7A 4E5ZB 1YR2A 3L4OD 3ZDZA 2OVPB 4G55A 5EMKB 2MTAH 4AOWA 5C9ZB 2HKMA 4FAND 4A2MA 4L9OA 2P9PC 5TEFA 3MUNA 3K27A 5GMKn 2GNQA 3C5MA 3JZNA 3IIWA 3VI3A 4A0AA 4GM8A 2H6QA 4CI2A 3DXKC 3GD1I 4X3EA 1SHYB 1TYEA 2QC5A 4FAVD 2CE9A 2OVRB 3RRMC 5TDHB 3ZE1A 2CNXA 2UZXB 3IUNA 4ZOZA 5EMLB 3F3FA 1T2XA 4BP8A 1E5TA 3RLMD 4MK0B 2H47A 1H2ZA 2VDOA 3SXTD 3V9FA 4J82A 4JSPC 5HQGA 1MG2A 3CFSB 2EICA 4DNUA 1GOTB 2O9KA 3DXMC 3IURA 3B7FA 3V4VA 4LG8A 2EIDA 3C9CA 4PXWA 4BP9A 1QFMA 4JXMA 4ZOVA 1GOHA 4O2WA 2OVQB 2Q7QA 2VDRA 4CC9A 3PVWB 4MMYA 1U4CA 3RFHA 2IURA 4G1EA 4CI3A 2H13A 4A08A 1GXRA 2VDMA 3ZE0A 3UR4A 4J77A 1K8KC 2UZYB 1PBYB 1H2YA 2YNPA 3UVLA 1NEXB 4U7AA 1C9IA 3UVKA 4WJKA 2BCJB 1O6GA 3UVOA 2H9PA 5FKTA 5IGOA 5HE0B 4O1QD 5THAA 2HESX 3I7PA 2XL3A 5CYKB 4FWWA 4AN0A 5I5JA 3O4GA 4IA9A 1ERJA 3PVUB 4BL0A 3I8CA 5C2WB 4BH6A 1JTDB 3RSEC 3VGZA 2Z2OA 5FFGA 2OIZA 3V5WB 4FA1D 3BG1A 1A12A 4Z7NA 3FM0A 4ZOXA 5FQDA 3MXXA 4X63B 2AGXA 2VDKA 5EMMB 2QR5A 5IJ8E 3UVMA 4L3GD 5M5RA 2H6NA 4JHNA 5TEEA 2VZ3A 1GOGA 3PSLA 2I3TA 4FA9D 4MMXA 4XYHA 5FXYA 4J87A 3F3PA 4X61B 1VZ2A 4ZN4A 3K71A 3SHFA 4MMZA 3CIKB 3MKSB 3NIGA 3I7HA 4QAMA 4Z8LA 3FRXA 5H17A 1E8NA 4D6VA 4PSWB 1TYQC 4CY1A 3F3GA 1N6EA 2XE4A 1TBGA 2H3XA 2Z2PA 4PBYA 4AMZA 2YNNA 4A09B 3EMHA 4CI8A 2IWKA 4WK0A 1I2MB 2IUPA 4HDJA 4WK4A 1L5GA 1OLZA 2IAAA 2HXCA 3IULA 2IUQA 5FFOA 3V4PA 2Z2NA 3N0EA 3PSCB 3K6SA 4O3TB 1SQJA 3QHYB 3ULEC 4ERQA 5HYNB 2P9LC 3OKYB 4GMBA 5CXBA 3T3PA 4E5ZA 2B4EA 5EM2B 4IRZA 1SQ9A 5E6RA 5JWZA 2AH0A 4Y7RA 2HU8A 4PSXB 1VE6A 3EI4B 3SLED 4EWRA 4GQBB 3ODTA 4UI9R 3O4JA 3IJEA 4NC4A 1UTCA 4NAAA 3FGBA 1FWXA 4PNKB 4LGNA 1E8MA 5M5UA 1PI6A 4J81A 3IKOA 4JSXC 4TZ4A 5I5IA 3U4YA 3EQ7A 2YMUA 3MKQA 3JROA 4L1QD 4R7AB 3DWLC 3JPXA 5FKRA 4CZVA 3RN1D 4QT8A 4LG9A 5CXBB 4AN1A 2HKRA 3L4MD 3HFQA 3EU7A 4WK2A 2QXVA 1VYHC 3OL2A 4O3UB 4QL1A 1L0QA 2YB8B 3EI3B 3GC3B 4A11B 1B9YA 4A08B 3RN0D 1B9XA 1PGUA 3DM0A 4E54B 4H5JA 3JZHA 3MVDK 4GM9A 3PXWD 2AGYA 3IUJA 4FB1D 3BG0A 5GXIA 3OF7A 4Y5RD 5FKQA 2CO0A 2I3SA 2IUVA 5IT9g 3SCYA 3ZWLB 4XEIC 1M1XA 3JRPA 5HE2B 5SXMA 1JJUB 4J78A 4GZ8A 2VDNA 4DNWA 4A0BA 4D0KA 5HE3B 3I7KA 5C92A 1H2XA 2QZPA 1U8CA 3MUOA 4A0BB
chains in the Genus database with same CATH topology
4PC0A 4O45A 4JSNC 5AJAA 4ZOYA 3I2NA 4OZUA 3JZGA 3NVXA 4A0AB 4BUJC 4J73A 2TRCB 1R5MA 3VA6A 4PBZA 3AH8B 3I7OA 1N6DA 2CN2A 3GFCA 4A11A 5IGQA 1JOFA 3IJ1A 4CY2A 3SWSD 2H6KA 1RI6A 2P9SC 2H9LA 4JT5C 3EI2B 3E0CA 1XHMA 4QQEA 2H14A 4J79A 5FLXg 4J8BA 3IJ0A 2G99A 3OW8A 5FKSA 2EBSA 4JT6C 1U2VC 3J80g 2G9AA 3UVNA 5KDOB 5H1MA 4FA5D 1N6FA 2AH1A 3C99A 4CI1A 3N0DA 2AGWA 2I0SA 3C75H 2J57G 2PBIB 3SBRA 4A2LA 4JSVC 1GP2B 1YFQA 3PE7A 1JMZB 4QRJA 2H68A 2YNOA 5EAPA 3EG6A 5CXCA 2BBKH 4CY3A 3ORVD 1K32A 4GM3A 1NR0A 2XYIA 3J81g 5EALA 4A09A 2H9MA 3AL8A 5EMJB 2B5MA 2HJ4A 5C2VB 3A0FA 1QNIA 5B4WA 3UKUC 3AL8B 3W15A 2GC4A 2AGLA 4IMMA 1XIPA 2P9IC 3SFZA 5AFU3 1OMWB 2CO0C 3GREA 3SBPA 1Q47A 5EARA 3EI3A 4CZYA 1MDAH 2HJBA 4J0XA 3CFVA 4AEZA 3IIYA 4NSXA 1GG2B 3AFCA 4N14A 3RMZD 4CY5A 3I8EA 4G56B 2PM7B 3SN6B 2B5NA 4K3ID 4U1EI 5FA5B 3PXSD 2IWFA 5AMSA 2AGZA 3MZLA 4K3JB 4J84A 2J56H 4E54A 4L3HD 3SJLD 3EI4A 3OKWA 2XU7A 5K19A 2OJYA 1PEVA 2B5LA 2OK6A 3EI2A 3V7DB 2PM6B 4H5IA 4JD2C 2I0TA 3JB9L 5K1CC 1MG3A 2YBAA 3UKRC 2GC7A 3EI1B 3OKTA 4X60B 3KRWB 4KFMB 3SBQA 5GXHA 2P9UC 5A2Qg 4OWRA 1XKSA 4J8GA 5EM2A 3OKYA 2J55H 1P22A 2CE8A 2P9NC 3OTTA 3NVQA 4ERZA 1S4UX 3DSMA 3BWSA 3I89A 2HYEA 4J86A 4GGCA 2P9KC 4GQ2P 2OK4A 3SMRA 3RFGA 3I7NA 5TF2A 5I5MA 4ERYA 2PM9B 3IJCA 4GQ1A 4ESGA 4FHLA 4GGAA 2XL2A 3MZKA 2I0RA 3JAMg 3P4FA 4FA4D 3EI1A 3I7LA 5GSAA 4XYIA 3VH0A 5CXCB 3PXTD 2AQ5A 3OL2B 4J0WA 5EAMA 5IJ7E 1JMXB 2W18A 1A0RB 4ES0A 3K26A 4GGDA 2CN3A 4YVDA 3MMYA 3KRXB 4CZXA 3EWEA 4O9DA 3NVNA 2PM9A 2H9NA 5HE1B 3SVWD 5CYKA 4I79A 3AL9A 4A7JA 5H14A 5IC7A 4E5ZB 3L4OD 2OVPB 5EMKB 2MTAH 4AOWA 5C9ZB 2HKMA 4FAND 4A2MA 4L9OA 2P9PC 5TEFA 3K27A 5GMKn 2GNQA 3C5MA 3JZNA 3IIWA 4A0AA 4GM8A 2H6QA 4CI2A 3DXKC 4X3EA 1SHYB 2QC5A 4FAVD 2CE9A 2OVRB 3RRMC 5TDHB 2CNXA 2UZXB 4ZOZA 5EMLB 3F3FA 3RLMD 4MK0B 2H47A 3SXTD 3V9FA 4J82A 4JSPC 5HQGA 1MG2A 3CFSB 1GOTB 2O9KA 3DXMC 3B7FA 4LG8A 3C9CA 4PXWA 4JXMA 4ZOVA 2OVQB 2Q7QA 4CC9A 3PVWB 1U4CA 3RFHA 2IURA 4CI3A 2H13A 4A08A 1GXRA 3UR4A 4J77A 1K8KC 2UZYB 1PBYB 2YNPA 3UVLA 1NEXB 4U7AA 3UVKA 2BCJB 3UVOA 2H9PA 5FKTA 5IGOA 5HE0B 4O1QD 5THAA 2HESX 3I7PA 2XL3A 5CYKB 4FWWA 5I5JA 4IA9A 1ERJA 3PVUB 4BL0A 3I8CA 5C2WB 4BH6A 3RSEC 3VGZA 2Z2OA 2OIZA 3V5WB 4FA1D 3BG1A 3FM0A 4ZOXA 5FQDA 3MXXA 4X63B 2AGXA 5EMMB 5IJ8E 3UVMA 4L3GD 2H6NA 5TEEA 3PSLA 2I3TA 4FA9D 4XYHA 5FXYA 4J87A 3F3PA 4X61B 4ZN4A 3SHFA 3CIKB 3MKSB 3I7HA 4Z8LA 3FRXA 5H17A 4D6VA 4PSWB 1TYQC 4CY1A 3F3GA 1N6EA 2Z2PA 1TBGA 2H3XA 4PBYA 2YNNA 4A09B 3EMHA 4CI8A 2IWKA 2IUPA 4HDJA 1OLZA 2IAAA 2HXCA 2IUQA 2Z2NA 3N0EA 3PSCB 4O3TB 1SQJA 4ERQA 3ULEC 5HYNB 2P9LC 3OKYB 4GMBA 5CXBA 4E5ZA 2B4EA 5EM2B 1SQ9A 5JWZA 2AH0A 4Y7RA 4PSXB 3EI4B 3SLED 4EWRA 4GQBB 3ODTA 4UI9R 3FGBA 1FWXA 4PNKB 4LGNA 1PI6A 4J81A 3IKOA 4JSXC 4TZ4A 5I5IA 3U4YA 2YMUA 3MKQA 3JROA 4L1QD 4R7AB 3DWLC 3JPXA 5FKRA 4CZVA 3RN1D 4QT8A 4LG9A 5CXBB 2HKRA 3L4MD 3HFQA 3EU7A 2QXVA 4O3UB 4QL1A 1VYHC 3OL2A 1L0QA 2YB8B 3EI3B 4A11B 1B9YA 4A08B 3RN0D 1B9XA 1PGUA 3DM0A 4E54B 4H5JA 3JZHA 4GM9A 3PXWD 2AGYA 4FB1D 3BG0A 5GXIA 4Y5RD 5FKQA 2CO0A 2I3SA 2IUVA 5IT9g 3SCYA 3ZWLB 4XEIC 3JRPA 5HE2B 5SXMA 1JJUB 4J78A 4GZ8A 4A0BA 4D0KA 5HE3B 3I7KA 4A0BB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PC0 A;  4O45 A;  4JSN C;  5AJA A;  4ZOY A;  3I2N A;  4OZU A;  3JZG A;  3NVX A;  4A0A B;  4BUJ C;  4J73 A;  2TRC B;  1R5M A;  3VA6 A;  4PBZ A;  3AH8 B;  3I7O A;  1N6D A;  2CN2 A;  3GFC A;  4A11 A;  5IGQ A;  1JOF A;  3IJ1 A;  4CY2 A;  3SWS D;  2H6K A;  1RI6 A;  2P9S C;  2H9L A;  4JT5 C;  3EI2 B;  3E0C A;  1XHM A;  4QQE A;  2H14 A;  4J79 A;  5FLX g;  4J8B A;  3IJ0 A;  2G99 A;  3OW8 A;  5FKS A;  2EBS A;  4JT6 C;  1U2V C;  3J80 g;  2G9A A;  3UVN A;  5KDO B;  5H1M A;  4FA5 D;  1N6F A;  2AH1 A;  3C99 A;  4CI1 A;  3N0D A;  2AGW A;  2I0S A;  3C75 H;  2J57 G;  2PBI B;  3SBR A;  4A2L A;  4JSV C;  1GP2 B;  1YFQ A;  3PE7 A;  1JMZ B;  4QRJ A;  2H68 A;  2YNO A;  5EAP A;  3EG6 A;  5CXC A;  2BBK H;  4CY3 A;  3ORV D;  1K32 A;  4GM3 A;  1NR0 A;  2XYI A;  3J81 g;  5EAL A;  4A09 A;  2H9M A;  3AL8 A;  5EMJ B;  2B5M A;  2HJ4 A;  5C2V B;  3A0F A;  1QNI A;  5B4W A;  3UKU C;  3AL8 B;  3W15 A;  2GC4 A;  2AGL A;  4IMM A;  1XIP A;  2P9I C;  3SFZ A;  5AFU 3;  1OMW B;  2CO0 C;  3GRE A;  3SBP A;  1Q47 A;  5EAR A;  3EI3 A;  4CZY A;  1MDA H;  2HJB A;  4J0X A;  3CFV A;  4AEZ A;  3IIY A;  4NSX A;  1GG2 B;  3AFC A;  4N14 A;  3RMZ D;  4CY5 A;  3I8E A;  4G56 B;  2PM7 B;  3SN6 B;  2B5N A;  4K3I D;  4U1E I;  5FA5 B;  3PXS D;  2IWF A;  5AMS A;  2AGZ A;  3MZL A;  4K3J B;  4J84 A;  2J56 H;  4E54 A;  4L3H D;  3SJL D;  3EI4 A;  3OKW A;  2XU7 A;  5K19 A;  2OJY A;  1PEV A;  2B5L A;  2OK6 A;  3EI2 A;  3V7D B;  2PM6 B;  4H5I A;  4JD2 C;  2I0T A;  3JB9 L;  5K1C C;  1MG3 A;  2YBA A;  3UKR C;  2GC7 A;  3EI1 B;  3OKT A;  4X60 B;  3KRW B;  4KFM B;  3SBQ A;  5GXH A;  2P9U C;  5A2Q g;  4OWR A;  1XKS A;  4J8G A;  5EM2 A;  3OKY A;  2J55 H;  1P22 A;  2CE8 A;  2P9N C;  3OTT A;  3NVQ A;  4ERZ A;  1S4U X;  3DSM A;  3BWS A;  3I89 A;  2HYE A;  4J86 A;  4GGC A;  2P9K C;  4GQ2 P;  2OK4 A;  3SMR A;  3RFG A;  3I7N A;  5TF2 A;  5I5M A;  4ERY A;  2PM9 B;  3IJC A;  4GQ1 A;  4ESG A;  4FHL A;  4GGA A;  2XL2 A;  3MZK A;  2I0R A;  3JAM g;  3P4F A;  4FA4 D;  3EI1 A;  3I7L A;  5GSA A;  4XYI A;  3VH0 A;  5CXC B;  3PXT D;  2AQ5 A;  3OL2 B;  4J0W A;  5EAM A;  5IJ7 E;  1JMX B;  2W18 A;  1A0R B;  4ES0 A;  3K26 A;  4GGD A;  2CN3 A;  4YVD A;  3MMY A;  3KRX B;  4CZX A;  3EWE A;  4O9D A;  3NVN A;  2PM9 A;  2H9N A;  5HE1 B;  3SVW D;  5CYK A;  4I79 A;  3AL9 A;  4A7J A;  5H14 A;  5IC7 A;  4E5Z B;  3L4O D;  2OVP B;  5EMK B;  2MTA H;  4AOW A;  5C9Z B;  2HKM A;  4FAN D;  4A2M A;  4L9O A;  2P9P C;  5TEF A;  3K27 A;  5GMK n;  2GNQ A;  3C5M A;  3JZN A;  3IIW A;  4A0A A;  4GM8 A;  2H6Q A;  4CI2 A;  3DXK C;  4X3E A;  1SHY B;  2QC5 A;  4FAV D;  2CE9 A;  2OVR B;  3RRM C;  5TDH B;  2CNX A;  2UZX B;  4ZOZ A;  5EML B;  3F3F A;  3RLM D;  4MK0 B;  2H47 A;  3SXT D;  3V9F A;  4J82 A;  4JSP C;  5HQG A;  1MG2 A;  3CFS B;  1GOT B;  2O9K A;  3DXM C;  3B7F A;  4LG8 A;  3C9C A;  4PXW A;  4JXM A;  4ZOV A;  2OVQ B;  2Q7Q A;  4CC9 A;  3PVW B;  1U4C A;  3RFH A;  2IUR A;  4CI3 A;  2H13 A;  4A08 A;  1GXR A;  3UR4 A;  4J77 A;  1K8K C;  2UZY B;  1PBY B;  2YNP A;  3UVL A;  1NEX B;  4U7A A;  3UVK A;  2BCJ B;  3UVO A;  2H9P A;  5FKT A;  5IGO A;  5HE0 B;  4O1Q D;  5THA A;  2HES X;  3I7P A;  2XL3 A;  5CYK B;  4FWW A;  5I5J A;  4IA9 A;  1ERJ A;  3PVU B;  4BL0 A;  3I8C A;  5C2W B;  4BH6 A;  3RSE C;  3VGZ A;  2Z2O A;  2OIZ A;  3V5W B;  4FA1 D;  3BG1 A;  3FM0 A;  4ZOX A;  5FQD A;  3MXX A;  4X63 B;  2AGX A;  5EMM B;  5IJ8 E;  3UVM A;  4L3G D;  2H6N A;  5TEE A;  3PSL A;  2I3T A;  4FA9 D;  4XYH A;  5FXY A;  4J87 A;  3F3P A;  4X61 B;  4ZN4 A;  3SHF A;  3CIK B;  3MKS B;  3I7H A;  4Z8L A;  3FRX A;  5H17 A;  4D6V A;  4PSW B;  1TYQ C;  4CY1 A;  3F3G A;  1N6E A;  2Z2P A;  1TBG A;  2H3X A;  4PBY A;  2YNN A;  4A09 B;  3EMH A;  4CI8 A;  2IWK A;  2IUP A;  4HDJ A;  1OLZ A;  2IAA A;  2HXC A;  2IUQ A;  2Z2N A;  3N0E A;  3PSC B;  4O3T B;  1SQJ A;  4ERQ A;  3ULE C;  5HYN B;  2P9L C;  3OKY B;  4GMB A;  5CXB A;  4E5Z A;  2B4E A;  5EM2 B;  1SQ9 A;  5JWZ A;  2AH0 A;  4Y7R A;  4PSX B;  3EI4 B;  3SLE D;  4EWR A;  4GQB B;  3ODT A;  4UI9 R;  3FGB A;  1FWX A;  4PNK B;  4LGN A;  1PI6 A;  4J81 A;  3IKO A;  4JSX C;  4TZ4 A;  5I5I A;  3U4Y A;  2YMU A;  3MKQ A;  3JRO A;  4L1Q D;  4R7A B;  3DWL C;  3JPX A;  5FKR A;  4CZV A;  3RN1 D;  4QT8 A;  4LG9 A;  5CXB B;  2HKR A;  3L4M D;  3HFQ A;  3EU7 A;  2QXV A;  4O3U B;  4QL1 A;  1VYH C;  3OL2 A;  1L0Q A;  2YB8 B;  3EI3 B;  4A11 B;  1B9Y A;  4A08 B;  3RN0 D;  1B9X A;  1PGU A;  3DM0 A;  4E54 B;  4H5J A;  3JZH A;  4GM9 A;  3PXW D;  2AGY A;  4FB1 D;  3BG0 A;  5GXI A;  4Y5R D;  5FKQ A;  2CO0 A;  2I3S A;  2IUV A;  5IT9 g;  3SCY A;  3ZWL B;  4XEI C;  3JRP A;  5HE2 B;  5SXM A;  1JJU B;  4J78 A;  4GZ8 A;  4A0B A;  4D0K A;  5HE3 B;  3I7K A;  4A0B B; 
#chains in the Genus database with same CATH topology
 4PC0 A;  4O45 A;  4RE6 A;  4JSN C;  5AJA A;  4ZOY A;  3I2N A;  4BCC A;  4OZU A;  3EQ9 A;  3JZG A;  3NVX A;  1BPO A;  4A0A B;  4BUJ C;  4J73 A;  2TRC B;  4UM8 A;  1R5M A;  3VA6 A;  4PBZ A;  3AH8 B;  3I7O A;  1N6D A;  2CN2 A;  4NEN A;  3GFC A;  3T3M A;  4A11 A;  5IGQ A;  1JOF A;  3IJ1 A;  4CY2 A;  3SWS D;  2H6K A;  1RI6 A;  2P9S C;  2H9L A;  4JT5 C;  3EI2 B;  3E0C A;  1XHM A;  4QQE A;  2H14 A;  4J79 A;  5FLX g;  4J8B A;  1K3I A;  3IJ0 A;  2G99 A;  3ZDY A;  3OW8 A;  5FKS A;  2EBS A;  4JT6 C;  1U2V C;  1QFS A;  5C86 A;  3J80 g;  2G9A A;  3UVN A;  5KDO B;  1H2W A;  5H1M A;  4FA5 D;  1C9L A;  1N6F A;  3IUM A;  2AH1 A;  3C99 A;  4CI1 A;  3N0D A;  2AGW A;  2I0S A;  3C75 H;  2VDL A;  4L1M A;  1UOQ A;  2J57 G;  2PBI B;  3SBR A;  4A2L A;  4JSV C;  1GP2 B;  1YFQ A;  3PE7 A;  1JMZ B;  4QRJ A;  4AMY A;  2H68 A;  2YNO A;  5EAP A;  3EG6 A;  5CXC A;  2BBK H;  4CY3 A;  3ORV D;  1K32 A;  4GM3 A;  3KCI A;  1NR0 A;  2XYI A;  3J81 g;  5EAL A;  4A09 A;  2H9M A;  4DNV A;  4NBM A;  2WQ8 A;  3AL8 A;  2B5M A;  5EMJ B;  2HJ4 A;  5C2V B;  3A0F A;  2BKL A;  1QNI A;  5B4W A;  3UKU C;  3AL8 B;  3W15 A;  2GC4 A;  1VE7 A;  2AGL A;  4IMM A;  4JHP C;  1XIP A;  2P9I C;  3SFZ A;  5AFU 3;  1JV2 A;  1OMW B;  2CO0 C;  3GRE A;  3SBP A;  1Q47 A;  5EAR A;  3EI3 A;  4CZY A;  1MDA H;  2HJB A;  4J0X A;  3CFV A;  4AEZ A;  3IIY A;  4NSX A;  1VZ3 A;  1GG2 B;  3FCU A;  5HDB A;  3AFC A;  4N14 A;  3RMZ D;  4CY5 A;  3I8E A;  4G56 B;  5M5V A;  2PM7 B;  3SN6 B;  4D9S A;  3VI4 A;  2B5N A;  4K3I D;  4RE5 A;  5M61 A;  4U1E I;  5FA5 B;  3PXS D;  2IWF A;  5AMS A;  2AGZ A;  3MZL A;  4K3J B;  4Z7Q A;  4J84 A;  2J56 H;  3NID A;  4E54 A;  4L3H D;  3SJL D;  3EI4 A;  3OKW A;  2XU7 A;  5K19 A;  2OJY A;  1PEV A;  2B5L A;  2OK6 A;  3EI2 A;  3V7D B;  3ZE2 A;  2EIE A;  2PM6 B;  4H5I A;  4JD2 C;  2I0T A;  5M5T A;  3JB9 L;  3IUQ A;  5K1C C;  1MG3 A;  2YBA A;  3UKR C;  3O4I A;  2GC7 A;  3EI1 B;  4UM9 A;  2VZ1 A;  3OKT A;  4O02 A;  2VDP A;  3IVM A;  4X60 B;  3KRW B;  4BCD A;  4KFM B;  3SBQ A;  5GXH A;  2P9U C;  4BCB A;  4OWR A;  5A2Q g;  1XKS A;  2XZG A;  5E6S A;  4J8G A;  5EM2 A;  3OKY A;  1GOF A;  2J55 H;  1P22 A;  2CE8 A;  2P9N C;  3OTT A;  2EIB A;  3NVQ A;  4ERZ A;  1S4U X;  3DSM A;  4G1M A;  3BWS A;  3I89 A;  2HU7 A;  2VDQ A;  5M5S A;  2HYE A;  4J86 A;  4GGC A;  2P9K C;  3K72 A;  4GQ2 P;  2OK4 A;  3SMR A;  3RFG A;  3I7N A;  5TF2 A;  5I5M A;  4ERY A;  2PM9 B;  3IJC A;  4GQ1 A;  4ESG A;  4FHL A;  4GGA A;  3DDU A;  2XL2 A;  1O6F A;  3MZK A;  2I0R A;  3JAM g;  3P4F A;  4FA4 D;  4AX4 A;  3I7L A;  5GSA A;  4XYI A;  3EI1 A;  3VH0 A;  5CXC B;  3EQ8 A;  3PXT D;  2AQ5 A;  3OL2 B;  3ZDX A;  3O4H A;  4J0W A;  5EAM A;  5IJ7 E;  1JMX B;  2W18 A;  1A0R B;  4ES0 A;  3K26 A;  4GGD A;  2CN3 A;  4YVD A;  3MMY A;  3KRX B;  4CZX A;  2JKX A;  3EWE A;  5E6U A;  4O9D A;  2HU5 A;  3NIF A;  2PM9 A;  1UOP A;  3NVN A;  2H9N A;  4Z7O A;  5HE1 B;  3SVW D;  2XDW A;  3FCS A;  5CYK A;  4I79 A;  3QI0 A;  3AL9 A;  4A7J A;  2VC2 A;  5H14 A;  1UOO A;  5IC7 A;  4E5Z B;  1YR2 A;  3L4O D;  3ZDZ A;  2OVP B;  4G55 A;  5EMK B;  2MTA H;  4AOW A;  5C9Z B;  2HKM A;  4FAN D;  4A2M A;  4L9O A;  2P9P C;  5TEF A;  3MUN A;  3K27 A;  5GMK n;  2GNQ A;  3C5M A;  3JZN A;  3IIW A;  3VI3 A;  4A0A A;  4GM8 A;  2H6Q A;  4CI2 A;  3DXK C;  3GD1 I;  4X3E A;  1SHY B;  1TYE A;  2QC5 A;  4FAV D;  2CE9 A;  2OVR B;  3RRM C;  5TDH B;  3ZE1 A;  2CNX A;  2UZX B;  3IUN A;  4ZOZ A;  5EML B;  3F3F A;  1T2X A;  4BP8 A;  1E5T A;  3RLM D;  4MK0 B;  2H47 A;  1H2Z A;  2VDO A;  3SXT D;  3V9F A;  4J82 A;  4JSP C;  5HQG A;  1MG2 A;  3CFS B;  2EIC A;  4DNU A;  1GOT B;  2O9K A;  3DXM C;  3IUR A;  3B7F A;  3V4V A;  4LG8 A;  2EID A;  3C9C A;  4PXW A;  4BP9 A;  1QFM A;  4JXM A;  4ZOV A;  1GOH A;  4O2W A;  2OVQ B;  2Q7Q A;  2VDR A;  4CC9 A;  3PVW B;  4MMY A;  1U4C A;  3RFH A;  2IUR A;  4G1E A;  4CI3 A;  2H13 A;  4A08 A;  1GXR A;  2VDM A;  3ZE0 A;  3UR4 A;  4J77 A;  1K8K C;  2UZY B;  1PBY B;  1H2Y A;  2YNP A;  3UVL A;  1NEX B;  4U7A A;  1C9I A;  3UVK A;  4WJK A;  2BCJ B;  1O6G A;  3UVO A;  2H9P A;  5FKT A;  5IGO A;  5HE0 B;  4O1Q D;  5THA A;  2HES X;  3I7P A;  2XL3 A;  5CYK B;  4FWW A;  4AN0 A;  5I5J A;  3O4G A;  4IA9 A;  1ERJ A;  3PVU B;  4BL0 A;  3I8C A;  5C2W B;  4BH6 A;  1JTD B;  3RSE C;  3VGZ A;  2Z2O A;  5FFG A;  2OIZ A;  3V5W B;  4FA1 D;  3BG1 A;  1A12 A;  4Z7N A;  3FM0 A;  4ZOX A;  5FQD A;  3MXX A;  4X63 B;  2AGX A;  2VDK A;  5EMM B;  2QR5 A;  5IJ8 E;  3UVM A;  4L3G D;  5M5R A;  2H6N A;  4JHN A;  5TEE A;  2VZ3 A;  1GOG A;  3PSL A;  2I3T A;  4FA9 D;  4MMX A;  4XYH A;  5FXY A;  4J87 A;  3F3P A;  4X61 B;  1VZ2 A;  4ZN4 A;  3K71 A;  3SHF A;  4MMZ A;  3CIK B;  3MKS B;  3NIG A;  3I7H A;  4QAM A;  4Z8L A;  3FRX A;  5H17 A;  1E8N A;  4D6V A;  4PSW B;  1TYQ C;  4CY1 A;  3F3G A;  1N6E A;  2XE4 A;  1TBG A;  2H3X A;  2Z2P A;  4PBY A;  4AMZ A;  2YNN A;  4A09 B;  3EMH A;  4CI8 A;  2IWK A;  4WK0 A;  1I2M B;  2IUP A;  4HDJ A;  4WK4 A;  1L5G A;  1OLZ A;  2IAA A;  2HXC A;  3IUL A;  2IUQ A;  5FFO A;  3V4P A;  2Z2N A;  3N0E A;  3PSC B;  3K6S A;  4O3T B;  1SQJ A;  3QHY B;  3ULE C;  4ERQ A;  5HYN B;  2P9L C;  3OKY B;  4GMB A;  5CXB A;  3T3P A;  4E5Z A;  2B4E A;  5EM2 B;  4IRZ A;  1SQ9 A;  5E6R A;  5JWZ A;  2AH0 A;  4Y7R A;  2HU8 A;  4PSX B;  1VE6 A;  3EI4 B;  3SLE D;  4EWR A;  4GQB B;  3ODT A;  4UI9 R;  3O4J A;  3IJE A;  4NC4 A;  1UTC A;  4NAA A;  3FGB A;  1FWX A;  4PNK B;  4LGN A;  1E8M A;  5M5U A;  1PI6 A;  4J81 A;  3IKO A;  4JSX C;  4TZ4 A;  5I5I A;  3U4Y A;  3EQ7 A;  2YMU A;  3MKQ A;  3JRO A;  4L1Q D;  4R7A B;  3DWL C;  3JPX A;  5FKR A;  4CZV A;  3RN1 D;  4QT8 A;  4LG9 A;  5CXB B;  4AN1 A;  2HKR A;  3L4M D;  3HFQ A;  3EU7 A;  4WK2 A;  2QXV A;  1VYH C;  3OL2 A;  4O3U B;  4QL1 A;  1L0Q A;  2YB8 B;  3EI3 B;  3GC3 B;  4A11 B;  1B9Y A;  4A08 B;  3RN0 D;  1B9X A;  1PGU A;  3DM0 A;  4E54 B;  4H5J A;  3JZH A;  3MVD K;  4GM9 A;  3PXW D;  2AGY A;  3IUJ A;  4FB1 D;  3BG0 A;  5GXI A;  3OF7 A;  4Y5R D;  5FKQ A;  2CO0 A;  2I3S A;  2IUV A;  5IT9 g;  3SCY A;  3ZWL B;  4XEI C;  1M1X A;  3JRP A;  5HE2 B;  5SXM A;  1JJU B;  4J78 A;  4GZ8 A;  2VDN A;  4DNW A;  4A0B A;  4D0K A;  5HE3 B;  3I7K A;  5C92 A;  1H2X A;  2QZP A;  1U8C A;  3MUO A;  4A0B B; 
#chains in the Genus database with same CATH homology
 4PC0 A;  4O45 A;  4JSN C;  5AJA A;  4ZOY A;  3I2N A;  4OZU A;  3JZG A;  3NVX A;  4A0A B;  4BUJ C;  4J73 A;  2TRC B;  1R5M A;  3VA6 A;  4PBZ A;  3AH8 B;  3I7O A;  1N6D A;  2CN2 A;  3GFC A;  4A11 A;  5IGQ A;  1JOF A;  3IJ1 A;  4CY2 A;  3SWS D;  2H6K A;  1RI6 A;  2P9S C;  2H9L A;  4JT5 C;  3EI2 B;  3E0C A;  1XHM A;  4QQE A;  2H14 A;  4J79 A;  5FLX g;  4J8B A;  3IJ0 A;  2G99 A;  3OW8 A;  5FKS A;  2EBS A;  4JT6 C;  1U2V C;  3J80 g;  2G9A A;  3UVN A;  5KDO B;  5H1M A;  4FA5 D;  1N6F A;  2AH1 A;  3C99 A;  4CI1 A;  3N0D A;  2AGW A;  2I0S A;  3C75 H;  2J57 G;  2PBI B;  3SBR A;  4A2L A;  4JSV C;  1GP2 B;  1YFQ A;  3PE7 A;  1JMZ B;  4QRJ A;  2H68 A;  2YNO A;  5EAP A;  3EG6 A;  5CXC A;  2BBK H;  4CY3 A;  3ORV D;  1K32 A;  4GM3 A;  1NR0 A;  2XYI A;  3J81 g;  5EAL A;  4A09 A;  2H9M A;  3AL8 A;  5EMJ B;  2B5M A;  2HJ4 A;  5C2V B;  3A0F A;  1QNI A;  5B4W A;  3UKU C;  3AL8 B;  3W15 A;  2GC4 A;  2AGL A;  4IMM A;  1XIP A;  2P9I C;  3SFZ A;  5AFU 3;  1OMW B;  2CO0 C;  3GRE A;  3SBP A;  1Q47 A;  5EAR A;  3EI3 A;  4CZY A;  1MDA H;  2HJB A;  4J0X A;  3CFV A;  4AEZ A;  3IIY A;  4NSX A;  1GG2 B;  3AFC A;  4N14 A;  3RMZ D;  4CY5 A;  3I8E A;  4G56 B;  2PM7 B;  3SN6 B;  2B5N A;  4K3I D;  4U1E I;  5FA5 B;  3PXS D;  2IWF A;  5AMS A;  2AGZ A;  3MZL A;  4K3J B;  4J84 A;  2J56 H;  4E54 A;  4L3H D;  3SJL D;  3EI4 A;  3OKW A;  2XU7 A;  5K19 A;  2OJY A;  1PEV A;  2B5L A;  2OK6 A;  3EI2 A;  3V7D B;  2PM6 B;  4H5I A;  4JD2 C;  2I0T A;  3JB9 L;  5K1C C;  1MG3 A;  2YBA A;  3UKR C;  2GC7 A;  3EI1 B;  3OKT A;  4X60 B;  3KRW B;  4KFM B;  3SBQ A;  5GXH A;  2P9U C;  5A2Q g;  4OWR A;  1XKS A;  4J8G A;  5EM2 A;  3OKY A;  2J55 H;  1P22 A;  2CE8 A;  2P9N C;  3OTT A;  3NVQ A;  4ERZ A;  1S4U X;  3DSM A;  3BWS A;  3I89 A;  2HYE A;  4J86 A;  4GGC A;  2P9K C;  4GQ2 P;  2OK4 A;  3SMR A;  3RFG A;  3I7N A;  5TF2 A;  5I5M A;  4ERY A;  2PM9 B;  3IJC A;  4GQ1 A;  4ESG A;  4FHL A;  4GGA A;  2XL2 A;  3MZK A;  2I0R A;  3JAM g;  3P4F A;  4FA4 D;  3EI1 A;  3I7L A;  5GSA A;  4XYI A;  3VH0 A;  5CXC B;  3PXT D;  2AQ5 A;  3OL2 B;  4J0W A;  5EAM A;  5IJ7 E;  1JMX B;  2W18 A;  1A0R B;  4ES0 A;  3K26 A;  4GGD A;  2CN3 A;  4YVD A;  3MMY A;  3KRX B;  4CZX A;  3EWE A;  4O9D A;  3NVN A;  2PM9 A;  2H9N A;  5HE1 B;  3SVW D;  5CYK A;  4I79 A;  3AL9 A;  4A7J A;  5H14 A;  5IC7 A;  4E5Z B;  3L4O D;  2OVP B;  5EMK B;  2MTA H;  4AOW A;  5C9Z B;  2HKM A;  4FAN D;  4A2M A;  4L9O A;  2P9P C;  5TEF A;  3K27 A;  5GMK n;  2GNQ A;  3C5M A;  3JZN A;  3IIW A;  4A0A A;  4GM8 A;  2H6Q A;  4CI2 A;  3DXK C;  4X3E A;  1SHY B;  2QC5 A;  4FAV D;  2CE9 A;  2OVR B;  3RRM C;  5TDH B;  2CNX A;  2UZX B;  4ZOZ A;  5EML B;  3F3F A;  3RLM D;  4MK0 B;  2H47 A;  3SXT D;  3V9F A;  4J82 A;  4JSP C;  5HQG A;  1MG2 A;  3CFS B;  1GOT B;  2O9K A;  3DXM C;  3B7F A;  4LG8 A;  3C9C A;  4PXW A;  4JXM A;  4ZOV A;  2OVQ B;  2Q7Q A;  4CC9 A;  3PVW B;  1U4C A;  3RFH A;  2IUR A;  4CI3 A;  2H13 A;  4A08 A;  1GXR A;  3UR4 A;  4J77 A;  1K8K C;  2UZY B;  1PBY B;  2YNP A;  3UVL A;  1NEX B;  4U7A A;  3UVK A;  2BCJ B;  3UVO A;  2H9P A;  5FKT A;  5IGO A;  5HE0 B;  4O1Q D;  5THA A;  2HES X;  3I7P A;  2XL3 A;  5CYK B;  4FWW A;  5I5J A;  4IA9 A;  1ERJ A;  3PVU B;  4BL0 A;  3I8C A;  5C2W B;  4BH6 A;  3RSE C;  3VGZ A;  2Z2O A;  2OIZ A;  3V5W B;  4FA1 D;  3BG1 A;  3FM0 A;  4ZOX A;  5FQD A;  3MXX A;  4X63 B;  2AGX A;  5EMM B;  5IJ8 E;  3UVM A;  4L3G D;  2H6N A;  5TEE A;  3PSL A;  2I3T A;  4FA9 D;  4XYH A;  5FXY A;  4J87 A;  3F3P A;  4X61 B;  4ZN4 A;  3SHF A;  3CIK B;  3MKS B;  3I7H A;  4Z8L A;  3FRX A;  5H17 A;  4D6V A;  4PSW B;  1TYQ C;  4CY1 A;  3F3G A;  1N6E A;  2Z2P A;  1TBG A;  2H3X A;  4PBY A;  2YNN A;  4A09 B;  3EMH A;  4CI8 A;  2IWK A;  2IUP A;  4HDJ A;  1OLZ A;  2IAA A;  2HXC A;  2IUQ A;  2Z2N A;  3N0E A;  3PSC B;  4O3T B;  1SQJ A;  4ERQ A;  3ULE C;  5HYN B;  2P9L C;  3OKY B;  4GMB A;  5CXB A;  4E5Z A;  2B4E A;  5EM2 B;  1SQ9 A;  5JWZ A;  2AH0 A;  4Y7R A;  4PSX B;  3EI4 B;  3SLE D;  4EWR A;  4GQB B;  3ODT A;  4UI9 R;  3FGB A;  1FWX A;  4PNK B;  4LGN A;  1PI6 A;  4J81 A;  3IKO A;  4JSX C;  4TZ4 A;  5I5I A;  3U4Y A;  2YMU A;  3MKQ A;  3JRO A;  4L1Q D;  4R7A B;  3DWL C;  3JPX A;  5FKR A;  4CZV A;  3RN1 D;  4QT8 A;  4LG9 A;  5CXB B;  2HKR A;  3L4M D;  3HFQ A;  3EU7 A;  2QXV A;  4O3U B;  4QL1 A;  1VYH C;  3OL2 A;  1L0Q A;  2YB8 B;  3EI3 B;  4A11 B;  1B9Y A;  4A08 B;  3RN0 D;  1B9X A;  1PGU A;  3DM0 A;  4E54 B;  4H5J A;  3JZH A;  4GM9 A;  3PXW D;  2AGY A;  4FB1 D;  3BG0 A;  5GXI A;  4Y5R D;  5FKQ A;  2CO0 A;  2I3S A;  2IUV A;  5IT9 g;  3SCY A;  3ZWL B;  4XEI C;  3JRP A;  5HE2 B;  5SXM A;  1JJU B;  4J78 A;  4GZ8 A;  4A0B A;  4D0K A;  5HE3 B;  3I7K A;  4A0B B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...