2BBKH

Crystal structure of the quinoprotein methylamine dehydrogenase from paracoccus denitrificans at 1.75 angstroms
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
355
structure length
355
Chain Sequence
DEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Refined crystal structure of methylamine dehydrogenase from Paracoccus denitrificans at 1.75 A resolution.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Electron transport
molecule keywords METHYLAMINE DEHYDROGENASE (HEAVY SUBUNIT)
total genus 85
structure length 355
sequence length 355
chains with identical sequence J
ec nomenclature ec 1.4.9.1: Methylamine dehydrogenase (amicyanin).
pdb deposition date 1993-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2bbkH00
3DWLC 3EI4A 2IAAA 4E54A 3DXMC 3U4YA 4U7AA 1NEXB 1GP2B 2CE9A 4GZ8A 4J8BA 1PGUA 4CC9A 3C5MA 2P9NC 5EM2A 2H6QA 1B9XA 3PSCB 3SJLD 1PEVA 2HKMA 4A11B 5EMKB 4J0WA 2BCJB 5C2VB 4JXMA 1NR0A 3IJ1A 2MTAH 3DXKC 4FAND 3AL8A 5TF2A 3MKQA 4J87A 5FKRA 3N0EA 3EU7A 3I8EA 5EARA 3W15A 5K1CC 3PVWB 2J56H 4O3UB 4CY2A 4BL0A 2H3XA 4JSPC 5C9ZB 1PBYB 2HKRA 4OZUA 1OLZA 4A09A 3FGBA 3MMYA 4CI2A 4X3EA 3OKWA 4X63B 2AGXA 3PXSD 4OWRA 5K19A 5EALA 3MZKA 3OKTA 4GGAA 3P4FA 4A2LA 2CE8A 5EMMB 3RRMC 4D0KA 4CZVA 4LGNA 5CXCB 4H5IA 1MG2A 3DM0A 3PE7A 4A7JA 4FA5D 5EMLB 3I7KA 5TDHB 4GQ2P 5IC7A 5THAA 3VH0A 3SBRA 3I7NA 2H13A 2I0TA 3JRPA 3IJ0A 1TYQC 1N6FA 1K32A 2HYEA 4J86A 4UI9R 5HE1B 4CZYA 3JAMg 1R5MA 4Y7RA 4QRJA 4XYIA 2CO0A 3NVQA 4GQBB 5A2Qg 5HYNB 4ZN4A 4CI8A 1JMZB 2GC7A 2Q7QA 3I8CA 4ZOZA 4AOWA 4L1QD 1N6EA 3SWSD 5GXIA 3UVKA 2H9NA 3EI2B 1YFQA 4AEZA 2AGLA 1GG2B 3IIWA 2UZYB 1SQ9A 4GGDA 4J77A 4PXWA 2UZXB 3EI3A 2IUVA 4CI1A 4CY5A 2Z2PA 5IGQA 4JD2C 3JROA 5B4WA 3SXTD 3I7OA 2PM9A 4X61B 4ERYA 2O9KA 3F3PA 3OW8A 4CY1A 4FA4D 4LG8A 4BUJC 3JB9L 5HQGA 5AMSA 1B9YA 4PNKB 2PM6B 3UVMA 1JMXB 4H5JA 4ERZA 4E54B 3UKUC 2CN2A 1XIPA 3EI1B 3MZLA 1FWXA 2XL2A 3OKYA 5GXHA 2OJYA 3UVOA 2YMUA 3GREA 4K3ID 3EI2A 1OMWB 5HE0B 3SBQA 3CFSB 2GNQA 5EMJB 3VGZA 4Z8LA 4XEIC 2HESX 4JSXC 2CO0C 3AL8B 5IGOA 4O45A 2OIZA 4PBYA 5I5IA 4PSWB 2XL3A 3I7LA 3RMZD 1A0RB 3UVLA 2AQ5A 2OVRB 4FHLA 3C99A 2H9LA 3IKOA 2P9UC 3A0FA 3BG1A 2H9MA 5AJAA 4GM8A 4GQ1A 5GSAA 2I0RA 4XYHA 3VA6A 4BH6A 4J84A 2XU7A 4NSXA 4FWWA 3V5WB 2J55H 2H9PA 2TRCB 3ZWLB 3I89A 4GM3A 2AH1A 4N14A 5HE3B 2P9SC 1SHYB 3IIYA 2Z2NA 2CNXA 3BWSA 1VYHC 2YBAA 5CXBA 2P9IC 4QT8A 2H47A 3J80g 4LG9A 3SLED 3L4MD 3JZNA 1RI6A 2CN3A 3UVNA 5CXCA 1U4CA 2IWKA 5CYKA 2OVPB 3SVWD 4E5ZA 4JSVC 3B7FA 5TEFA 3I2NA 2QXVA 5FKSA 3JZHA 2HJ4A 1GOTB 5FKTA 4IA9A 4L3GD 4YVDA 3K26A 4MK0B 3J81g 4O3TB 2Z2OA 3SHFA 2GC4A 3BG0A 3V7DB 4A0BA 3UR4A 3SBPA 3JPXA 4J82A 5I5JA 4FB1D 3AL9A 2G99A 5FQDA 4A0AA 4A08B 4O9DA 4PBZA 5FKQA 3NVXA 2AGZA 5H14A 3OTTA 5I5MA 2OK6A 2I0SA 3RLMD 5IJ8E 3EI4B 2J57G 1JOFA 3DSMA 3RN1D 3SCYA 5FA5B 4GMBA 3PXWD 3JZGA 4J78A 4X60B 1PI6A 2OK4A 2YB8B 3EWEA 2IUQA 5IT9g 2I3TA 4A0AB 4JT6C 3ULEC 3F3GA 4PC0A 2W18A 3AFCA 5H1MA 4ZOVA 4L3HD 4ESGA 4CI3A 3RFHA 4EWRA 5EAPA 4Y5RD 2BBKH 1JJUB 1QNIA 3OL2B 3V9FA 5HE2B 3SN6B 3E0CA 2HXCA 3CIKB 2H68A 2B5NA 2HJBA 3FM0A 3SMRA 4A0BB 5TEEA 2AGYA 4ES0A 3I7HA 2H14A 5KDOB 2XYIA 1K8KC 3N0DA 4FA9D 4ZOYA 2G9AA 2B4EA 5H17A 4A08A 3FRXA 3RSEC 1S4UX 1GXRA 4A2MA 1SQJA 3GFCA 3OL2A 4IMMA 4TZ4A 4CY3A 4O1QD 2H6KA 4L9OA 3I7PA 4JT5C 3ORVD 1N6DA 4PSXB 2B5LA 4J79A 5CXBB 4D6VA 4J81A 1P22A 4FA1D 2IURA 5FXYA 3SFZA 4JSNC 2IWFA 4G56B 4GM9A 1XKSA 3CFVA 4FAVD 5JWZA 1TBGA 3KRXB 2YNOA 5IJ7E 2I3SA 1MG3A 3IJCA 2AGWA 3C75H 5FLXg 3EI3B 4ZOXA 2PM7B 3RFGA 4CZXA 3EMHA 2P9LC 2YNNA 4J0XA 2PBIB 4J73A 4R7AB 3UKRC 3C9CA 4ERQA 2EBSA 4GGCA 5EM2B 2QC5A 4J8GA 3F3FA 4KFMB 5EAMA 1L0QA 2B5MA 2YNPA 3AH8B 3L4OD 5SXMA 3EG6A 3ODTA 3MKSB 2AH0A 2P9PC 2PM9B 1Q47A 1XHMA 3MXXA 5CYKB 5GMKn 2H6NA 3K27A 4E5ZB 3HFQA 4QL1A 1U2VC 3PXTD 5C2WB 3RN0D 4U1EI 4A09B 1MDAH 4QQEA 2IUPA 4I79A 4A11A 4HDJA 3EI1A 3OKYB 3PVUB 1ERJA 4K3JB 2P9KC 3NVNA 3KRWB 2OVQB 3PSLA 5AFU3
chains in the Genus database with same CATH superfamily
3DWLC 3EI4A 2IAAA 2HU8A 4QAMA 4E54A 3DXMC 3U4YA 4U7AA 3T3MA 4DNWA 1NEXB 3MUNA 5E6RA 3MVDK 1GP2B 2CE9A 4GZ8A 2XDWA 4J8BA 4L1MA 5M5TA 1YR2A 1PGUA 4CC9A 3C5MA 2P9NC 5EM2A 2H6QA 1B9XA 3PSCB 3SJLD 1C9LA 1PEVA 2HKMA 4A11B 3IUNA 5EMKB 1TYEA 3IURA 4J0WA 5FFGA 2BCJB 5C2VB 4JXMA 3QHYB 1NR0A 3IJ1A 2MTAH 3DXKC 4FAND 3AL8A 1JV2A 5TF2A 3MKQA 3K71A 4J87A 5FKRA 5C86A 1T2XA 3N0EA 1QFMA 4IRZA 3EU7A 3I8EA 5EARA 3W15A 1O6FA 5K1CC 3PVWB 2J56H 4O3UB 4CY2A 4BL0A 2H3XA 4JSPC 5C9ZB 3ZE2A 1PBYB 2HKRA 4OZUA 1OLZA 4WK0A 4Z7QA 4A09A 3FGBA 3MMYA 4CI2A 4X3EA 3OKWA 2QZPA 4G1EA 2VDPA 4X63B 2AGXA 3PXSD 4OWRA 1VZ2A 5K19A 5EALA 3MZKA 3OKTA 3K6SA 4GGAA 3P4FA 4A2LA 4UM8A 2CE8A 5EMMB 3RRMC 4AMZA 4CZVA 4D0KA 4LGNA 5CXCB 4UM9A 4H5IA 1MG2A 5C92A 3DM0A 3GD1I 3PE7A 4A7JA 4FA5D 5EMLB 3I7KA 5TDHB 4BCBA 4GQ2P 5IC7A 5THAA 3VH0A 3SBRA 3I7NA 2H13A 2HU5A 4DNUA 2I0TA 3JRPA 1VE6A 3IJ0A 1TYQC 1N6FA 1K32A 2HYEA 4J86A 4UI9R 1UOPA 5HE1B 4CZYA 3JAMg 1R5MA 4Y7RA 4QRJA 4XYIA 5M61A 4BCCA 3ZE1A 5M5VA 2CO0A 3NVQA 4GQBB 5A2Qg 5HYNB 4ZN4A 4CI8A 1JMZB 2GC7A 2Q7QA 3I8CA 4Z7NA 4ZOZA 4JHNA 4AOWA 4RE5A 4L1QD 1N6EA 3SWSD 5GXIA 3UVKA 3K72A 2H9NA 3EI2B 1YFQA 4AEZA 2AGLA 5E6UA 1GG2B 3IIWA 2UZYB 1SQ9A 4GGDA 2QR5A 4J77A 4PXWA 2UZXB 3EI3A 2IUVA 4CI1A 4CY5A 3IVMA 2Z2PA 5IGQA 3VI3A 4JD2C 3JROA 5B4WA 3SXTD 3NIFA 3I7OA 2PM9A 4X61B 4ERYA 3ZE0A 2O9KA 3F3PA 3OW8A 1H2ZA 4CY1A 4FA4D 4LG8A 4BUJC 3JB9L 5HQGA 5AMSA 1B9YA 4PNKB 2PM6B 3UVMA 4AX4A 1JMXB 4H5JA 4ERZA 4E54B 2VZ3A 2WQ8A 3UKUC 4RE6A 2CN2A 1XIPA 3IUMA 3EI1B 3MZLA 3IULA 1FWXA 2XL2A 3KCIA 3O4GA 3OKYA 1H2YA 5GXHA 2OJYA 3UVOA 2YMUA 3GREA 4K3ID 3EI2A 5E6SA 1OMWB 5HE0B 2EIDA 3SBQA 3CFSB 4MMYA 2GNQA 3FCUA 5EMJB 1C9IA 4Z8LA 3VGZA 4XEIC 2HESX 4JSXC 2CO0C 3AL8B 5IGOA 4O45A 2OIZA 4PBYA 5I5IA 4PSWB 2XL3A 3V4PA 3I7LA 3RMZD 1A0RB 3UVLA 2AQ5A 2OVRB 4FHLA 3C99A 2H9LA 3IKOA 4DNVA 2P9UC 3A0FA 2EIEA 3BG1A 2H9MA 4GQ1A 4GM8A 5AJAA 5GSAA 2I0RA 4XYHA 2XE4A 3VA6A 4BH6A 4J84A 2XU7A 3O4JA 4NSXA 1O6GA 4FWWA 3V5WB 2J55H 2H9PA 2TRCB 1JTDB 3V4VA 3ZWLB 1GOHA 3I89A 4GM3A 2AH1A 4N14A 5HE3B 2EIBA 2P9SC 1SHYB 3IIYA 2Z2NA 2CNXA 3BWSA 1VYHC 2YBAA 5CXBA 2P9IC 4QT8A 2H47A 3J80g 4LG9A 3SLED 3L4MD 2EICA 3JZNA 1RI6A 2BKLA 2CN3A 5M5UA 3UVNA 5CXCA 1U4CA 2IWKA 5CYKA 2OVPB 3ZDZA 3SVWD 5FFOA 4E5ZA 4NC4A 4JSVC 1UOOA 3B7FA 4WK4A 2VDLA 3I2NA 2QXVA 3O4IA 3JZHA 4JHPC 5FKSA 5TEFA 2HJ4A 4AN1A 1GOTB 3EQ7A 5FKTA 4IA9A 4L3GD 4MMXA 4YVDA 3ZDXA 3GC3B 3K26A 4MK0B 5M5SA 3J81g 4O3TB 3IUJA 2Z2OA 3SHFA 2GC4A 3BG0A 3V7DB 4A0BA 2VDQA 4AN0A 1E8NA 3UR4A 3SBPA 3EQ9A 3JPXA 4J82A 4G55A 5I5JA 4FB1D 3AL9A 1GOFA 2VDOA 2G99A 5FQDA 4A0AA 3OF7A 1QFSA 4A08B 1K3IA 4O9DA 4PBZA 4MMZA 5FKQA 3NVXA 3VI4A 2AGZA 5H14A 3OTTA 5I5MA 2OK6A 2I0SA 3RLMD 5IJ8E 3EI4B 2J57G 1JOFA 3FCSA 4AMYA 1L5GA 3DSMA 4WJKA 3RN1D 1UOQA 3SCYA 4D9SA 1VZ3A 5FA5B 4GMBA 3PXWD 3ZDYA 3JZGA 4J78A 4X60B 2VC2A 1PI6A 2OK4A 2YB8B 3EWEA 2IUQA 5IT9g 2I3TA 4A0AB 4O02A 2HU7A 4JT6C 3ULEC 3F3GA 3QI0A 4PC0A 2W18A 3AFCA 5H1MA 4ZOVA 4L3HD 4ESGA 4BCDA 4BP8A 4CI3A 3RFHA 4EWRA 5EAPA 4Y5RD 2BBKH 1JJUB 1QNIA 1UTCA 3OL2B 1BPOA 3O4HA 1U8CA 3V9FA 5M5RA 5HE2B 3SN6B 3E0CA 2HXCA 3CIKB 4O2WA 2H68A 2B5NA 2HJBA 1M1XA 3FM0A 3SMRA 4A0BB 5TEEA 4NAAA 1H2WA 1H2XA 1E8MA 2AGYA 4ES0A 3I7HA 2H14A 5KDOB 2XYIA 1K8KC 3N0DA 4FA9D 1GOGA 4ZOYA 2G9AA 2B4EA 5H17A 4A08A 3T3PA 3FRXA 3RSEC 4NBMA 1S4UX 1GXRA 4A2MA 2XZGA 1SQJA 3GFCA 3OL2A 4IMMA 4TZ4A 4CY3A 4O1QD 4NENA 2H6KA 4L9OA 5HDBA 3I7PA 4JT5C 3ORVD 1N6DA 4PSXB 2B5LA 4J79A 2VDKA 3MUOA 5CXBB 4D6VA 4J81A 3NIDA 1P22A 2VDRA 4FA1D 2IURA 5FXYA 3SFZA 4JSNC 2IWFA 4G56B 4GM9A 1XKSA 3CFVA 4FAVD 5JWZA 1TBGA 3KRXB 2YNOA 5IJ7E 1E5TA 2VDMA 2I3SA 4BP9A 1MG3A 3IJCA 2AGWA 3C75H 5FLXg 3NIGA 3EI3B 4ZOXA 2PM7B 3RFGA 3EQ8A 4CZXA 3EMHA 3IUQA 2P9LC 2YNNA 4J0XA 2PBIB 4J73A 4R7AB 3UKRC 3C9CA 4ERQA 2EBSA 4GGCA 5EM2B 2QC5A 4J8GA 3F3FA 4KFMB 5EAMA 1L0QA 2B5MA 2VDNA 2YNPA 3AH8B 3L4OD 5SXMA 2VZ1A 3EG6A 3ODTA 3MKSB 2AH0A 2P9PC 2PM9B 1Q47A 1XHMA 3MXXA 5CYKB 5GMKn 3IJEA 2H6NA 3K27A 4E5ZB 4Z7OA 4G1MA 3HFQA 4QL1A 1A12A 1U2VC 3PXTD 5C2WB 2JKXA 3RN0D 4U1EI 4A09B 3DDUA 1MDAH 4QQEA 2IUPA 4I79A 4A11A 1I2MB 4HDJA 3EI1A 1VE7A 3OKYB 3PVUB 1ERJA 4K3JB 2P9KC 4WK2A 3NVNA 3KRWB 2OVQB 3PSLA 5AFU3
chains in the Genus database with same CATH topology
3DWLC 3EI4A 2IAAA 4E54A 3DXMC 3U4YA 4U7AA 1NEXB 1GP2B 2CE9A 4GZ8A 4J8BA 1PGUA 4CC9A 3C5MA 2P9NC 5EM2A 2H6QA 1B9XA 3PSCB 3SJLD 1PEVA 2HKMA 4A11B 5EMKB 4J0WA 2BCJB 5C2VB 4JXMA 1NR0A 3IJ1A 2MTAH 3DXKC 4FAND 3AL8A 5TF2A 3MKQA 4J87A 5FKRA 3N0EA 3EU7A 3I8EA 5EARA 3W15A 5K1CC 3PVWB 2J56H 4O3UB 4CY2A 4BL0A 2H3XA 4JSPC 5C9ZB 1PBYB 2HKRA 4OZUA 1OLZA 4A09A 3FGBA 3MMYA 4CI2A 4X3EA 3OKWA 4X63B 2AGXA 3PXSD 4OWRA 5K19A 5EALA 3MZKA 3OKTA 4GGAA 3P4FA 4A2LA 2CE8A 5EMMB 3RRMC 4D0KA 4CZVA 4LGNA 5CXCB 4H5IA 1MG2A 3DM0A 3PE7A 4A7JA 4FA5D 5EMLB 3I7KA 5TDHB 4GQ2P 5IC7A 5THAA 3VH0A 3SBRA 3I7NA 2H13A 2I0TA 3JRPA 3IJ0A 1TYQC 1N6FA 1K32A 2HYEA 4J86A 4UI9R 5HE1B 4CZYA 3JAMg 1R5MA 4Y7RA 4QRJA 4XYIA 2CO0A 3NVQA 4GQBB 5A2Qg 5HYNB 4ZN4A 4CI8A 1JMZB 2GC7A 2Q7QA 3I8CA 4ZOZA 4AOWA 4L1QD 1N6EA 3SWSD 5GXIA 3UVKA 2H9NA 3EI2B 1YFQA 4AEZA 2AGLA 1GG2B 3IIWA 2UZYB 1SQ9A 4GGDA 4J77A 4PXWA 2UZXB 3EI3A 2IUVA 4CI1A 4CY5A 2Z2PA 5IGQA 4JD2C 3JROA 5B4WA 3SXTD 3I7OA 2PM9A 4X61B 4ERYA 2O9KA 3F3PA 3OW8A 4CY1A 4FA4D 4LG8A 4BUJC 3JB9L 5HQGA 5AMSA 1B9YA 4PNKB 2PM6B 3UVMA 1JMXB 4H5JA 4ERZA 4E54B 3UKUC 2CN2A 1XIPA 3EI1B 3MZLA 1FWXA 2XL2A 3OKYA 5GXHA 2OJYA 3UVOA 2YMUA 3GREA 4K3ID 3EI2A 1OMWB 5HE0B 3SBQA 3CFSB 2GNQA 5EMJB 3VGZA 4Z8LA 4XEIC 2HESX 4JSXC 2CO0C 3AL8B 5IGOA 4O45A 2OIZA 4PBYA 5I5IA 4PSWB 2XL3A 3I7LA 3RMZD 1A0RB 3UVLA 2AQ5A 2OVRB 4FHLA 3C99A 2H9LA 3IKOA 2P9UC 3A0FA 3BG1A 2H9MA 5AJAA 4GM8A 4GQ1A 5GSAA 2I0RA 4XYHA 3VA6A 4BH6A 4J84A 2XU7A 4NSXA 4FWWA 3V5WB 2J55H 2H9PA 2TRCB 3ZWLB 3I89A 4GM3A 2AH1A 4N14A 5HE3B 2P9SC 1SHYB 3IIYA 2Z2NA 2CNXA 3BWSA 1VYHC 2YBAA 5CXBA 2P9IC 4QT8A 2H47A 3J80g 4LG9A 3SLED 3L4MD 3JZNA 1RI6A 2CN3A 3UVNA 5CXCA 1U4CA 2IWKA 5CYKA 2OVPB 3SVWD 4E5ZA 4JSVC 3B7FA 5TEFA 3I2NA 2QXVA 5FKSA 3JZHA 2HJ4A 1GOTB 5FKTA 4IA9A 4L3GD 4YVDA 3K26A 4MK0B 3J81g 4O3TB 2Z2OA 3SHFA 2GC4A 3BG0A 3V7DB 4A0BA 3UR4A 3SBPA 3JPXA 4J82A 5I5JA 4FB1D 3AL9A 2G99A 5FQDA 4A0AA 4A08B 4O9DA 4PBZA 5FKQA 3NVXA 2AGZA 5H14A 3OTTA 5I5MA 2OK6A 2I0SA 3RLMD 5IJ8E 3EI4B 2J57G 1JOFA 3DSMA 3RN1D 3SCYA 5FA5B 4GMBA 3PXWD 3JZGA 4J78A 4X60B 1PI6A 2OK4A 2YB8B 3EWEA 2IUQA 5IT9g 2I3TA 4A0AB 4JT6C 3ULEC 3F3GA 4PC0A 2W18A 3AFCA 5H1MA 4ZOVA 4L3HD 4ESGA 4CI3A 3RFHA 4EWRA 5EAPA 4Y5RD 2BBKH 1JJUB 1QNIA 3OL2B 3V9FA 5HE2B 3SN6B 3E0CA 2HXCA 3CIKB 2H68A 2B5NA 2HJBA 3FM0A 3SMRA 4A0BB 5TEEA 2AGYA 4ES0A 3I7HA 2H14A 5KDOB 2XYIA 1K8KC 3N0DA 4FA9D 4ZOYA 2G9AA 2B4EA 5H17A 4A08A 3FRXA 3RSEC 1S4UX 1GXRA 4A2MA 1SQJA 3GFCA 3OL2A 4IMMA 4TZ4A 4CY3A 4O1QD 2H6KA 4L9OA 3I7PA 4JT5C 3ORVD 1N6DA 4PSXB 2B5LA 4J79A 5CXBB 4D6VA 4J81A 1P22A 4FA1D 2IURA 5FXYA 3SFZA 4JSNC 2IWFA 4G56B 4GM9A 1XKSA 3CFVA 4FAVD 5JWZA 1TBGA 3KRXB 2YNOA 5IJ7E 2I3SA 1MG3A 3IJCA 2AGWA 3C75H 5FLXg 3EI3B 4ZOXA 2PM7B 3RFGA 4CZXA 3EMHA 2P9LC 2YNNA 4J0XA 2PBIB 4J73A 4R7AB 3UKRC 3C9CA 4ERQA 2EBSA 4GGCA 5EM2B 2QC5A 4J8GA 3F3FA 4KFMB 5EAMA 1L0QA 2B5MA 2YNPA 3AH8B 3L4OD 5SXMA 3EG6A 3ODTA 3MKSB 2AH0A 2P9PC 2PM9B 1Q47A 1XHMA 3MXXA 5CYKB 5GMKn 2H6NA 3K27A 4E5ZB 3HFQA 4QL1A 1U2VC 3PXTD 5C2WB 3RN0D 4U1EI 4A09B 1MDAH 4QQEA 2IUPA 4I79A 4A11A 4HDJA 3EI1A 3OKYB 3PVUB 1ERJA 4K3JB 2P9KC 3NVNA 3KRWB 2OVQB 3PSLA 5AFU3
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DWL C;  3EI4 A;  2IAA A;  4E54 A;  3DXM C;  3U4Y A;  4U7A A;  1NEX B;  1GP2 B;  2CE9 A;  4GZ8 A;  4J8B A;  1PGU A;  4CC9 A;  3C5M A;  2P9N C;  5EM2 A;  2H6Q A;  1B9X A;  3PSC B;  3SJL D;  1PEV A;  2HKM A;  4A11 B;  5EMK B;  4J0W A;  2BCJ B;  5C2V B;  4JXM A;  1NR0 A;  3IJ1 A;  2MTA H;  3DXK C;  4FAN D;  3AL8 A;  5TF2 A;  3MKQ A;  4J87 A;  5FKR A;  3N0E A;  3EU7 A;  3I8E A;  5EAR A;  3W15 A;  5K1C C;  3PVW B;  2J56 H;  4O3U B;  4CY2 A;  4BL0 A;  2H3X A;  4JSP C;  5C9Z B;  1PBY B;  2HKR A;  4OZU A;  1OLZ A;  4A09 A;  3FGB A;  3MMY A;  4CI2 A;  4X3E A;  3OKW A;  4X63 B;  2AGX A;  3PXS D;  4OWR A;  5K19 A;  5EAL A;  3MZK A;  3OKT A;  4GGA A;  3P4F A;  4A2L A;  2CE8 A;  5EMM B;  3RRM C;  4D0K A;  4CZV A;  4LGN A;  5CXC B;  4H5I A;  1MG2 A;  3DM0 A;  3PE7 A;  4A7J A;  4FA5 D;  5EML B;  3I7K A;  5TDH B;  4GQ2 P;  5IC7 A;  5THA A;  3VH0 A;  3SBR A;  3I7N A;  2H13 A;  2I0T A;  3JRP A;  3IJ0 A;  1TYQ C;  1N6F A;  1K32 A;  2HYE A;  4J86 A;  4UI9 R;  5HE1 B;  4CZY A;  3JAM g;  1R5M A;  4Y7R A;  4QRJ A;  4XYI A;  2CO0 A;  3NVQ A;  4GQB B;  5A2Q g;  5HYN B;  4ZN4 A;  4CI8 A;  1JMZ B;  2GC7 A;  2Q7Q A;  3I8C A;  4ZOZ A;  4AOW A;  4L1Q D;  1N6E A;  3SWS D;  5GXI A;  3UVK A;  2H9N A;  3EI2 B;  1YFQ A;  4AEZ A;  2AGL A;  1GG2 B;  3IIW A;  2UZY B;  1SQ9 A;  4GGD A;  4J77 A;  4PXW A;  2UZX B;  3EI3 A;  2IUV A;  4CI1 A;  4CY5 A;  2Z2P A;  5IGQ A;  4JD2 C;  3JRO A;  5B4W A;  3SXT D;  3I7O A;  2PM9 A;  4X61 B;  4ERY A;  2O9K A;  3F3P A;  3OW8 A;  4CY1 A;  4FA4 D;  4LG8 A;  4BUJ C;  3JB9 L;  5HQG A;  5AMS A;  1B9Y A;  4PNK B;  2PM6 B;  3UVM A;  1JMX B;  4H5J A;  4ERZ A;  4E54 B;  3UKU C;  2CN2 A;  1XIP A;  3EI1 B;  3MZL A;  1FWX A;  2XL2 A;  3OKY A;  5GXH A;  2OJY A;  3UVO A;  2YMU A;  3GRE A;  4K3I D;  3EI2 A;  1OMW B;  5HE0 B;  3SBQ A;  3CFS B;  2GNQ A;  5EMJ B;  3VGZ A;  4Z8L A;  4XEI C;  2HES X;  4JSX C;  2CO0 C;  3AL8 B;  5IGO A;  4O45 A;  2OIZ A;  4PBY A;  5I5I A;  4PSW B;  2XL3 A;  3I7L A;  3RMZ D;  1A0R B;  3UVL A;  2AQ5 A;  2OVR B;  4FHL A;  3C99 A;  2H9L A;  3IKO A;  2P9U C;  3A0F A;  3BG1 A;  2H9M A;  5AJA A;  4GM8 A;  4GQ1 A;  5GSA A;  2I0R A;  4XYH A;  3VA6 A;  4BH6 A;  4J84 A;  2XU7 A;  4NSX A;  4FWW A;  3V5W B;  2J55 H;  2H9P A;  2TRC B;  3ZWL B;  3I89 A;  4GM3 A;  2AH1 A;  4N14 A;  5HE3 B;  2P9S C;  1SHY B;  3IIY A;  2Z2N A;  2CNX A;  3BWS A;  1VYH C;  2YBA A;  5CXB A;  2P9I C;  4QT8 A;  2H47 A;  3J80 g;  4LG9 A;  3SLE D;  3L4M D;  3JZN A;  1RI6 A;  2CN3 A;  3UVN A;  5CXC A;  1U4C A;  2IWK A;  5CYK A;  2OVP B;  3SVW D;  4E5Z A;  4JSV C;  3B7F A;  5TEF A;  3I2N A;  2QXV A;  5FKS A;  3JZH A;  2HJ4 A;  1GOT B;  5FKT A;  4IA9 A;  4L3G D;  4YVD A;  3K26 A;  4MK0 B;  3J81 g;  4O3T B;  2Z2O A;  3SHF A;  2GC4 A;  3BG0 A;  3V7D B;  4A0B A;  3UR4 A;  3SBP A;  3JPX A;  4J82 A;  5I5J A;  4FB1 D;  3AL9 A;  2G99 A;  5FQD A;  4A0A A;  4A08 B;  4O9D A;  4PBZ A;  5FKQ A;  3NVX A;  2AGZ A;  5H14 A;  3OTT A;  5I5M A;  2OK6 A;  2I0S A;  3RLM D;  5IJ8 E;  3EI4 B;  2J57 G;  1JOF A;  3DSM A;  3RN1 D;  3SCY A;  5FA5 B;  4GMB A;  3PXW D;  3JZG A;  4J78 A;  4X60 B;  1PI6 A;  2OK4 A;  2YB8 B;  3EWE A;  2IUQ A;  5IT9 g;  2I3T A;  4A0A B;  4JT6 C;  3ULE C;  3F3G A;  4PC0 A;  2W18 A;  3AFC A;  5H1M A;  4ZOV A;  4L3H D;  4ESG A;  4CI3 A;  3RFH A;  4EWR A;  5EAP A;  4Y5R D;  2BBK H;  1JJU B;  1QNI A;  3OL2 B;  3V9F A;  5HE2 B;  3SN6 B;  3E0C A;  2HXC A;  3CIK B;  2H68 A;  2B5N A;  2HJB A;  3FM0 A;  3SMR A;  4A0B B;  5TEE A;  2AGY A;  4ES0 A;  3I7H A;  2H14 A;  5KDO B;  2XYI A;  1K8K C;  3N0D A;  4FA9 D;  4ZOY A;  2G9A A;  2B4E A;  5H17 A;  4A08 A;  3FRX A;  3RSE C;  1S4U X;  1GXR A;  4A2M A;  1SQJ A;  3GFC A;  3OL2 A;  4IMM A;  4TZ4 A;  4CY3 A;  4O1Q D;  2H6K A;  4L9O A;  3I7P A;  4JT5 C;  3ORV D;  1N6D A;  4PSX B;  2B5L A;  4J79 A;  5CXB B;  4D6V A;  4J81 A;  1P22 A;  4FA1 D;  2IUR A;  5FXY A;  3SFZ A;  4JSN C;  2IWF A;  4G56 B;  4GM9 A;  1XKS A;  3CFV A;  4FAV D;  5JWZ A;  1TBG A;  3KRX B;  2YNO A;  5IJ7 E;  2I3S A;  1MG3 A;  3IJC A;  2AGW A;  3C75 H;  5FLX g;  3EI3 B;  4ZOX A;  2PM7 B;  3RFG A;  4CZX A;  3EMH A;  2P9L C;  2YNN A;  4J0X A;  2PBI B;  4J73 A;  4R7A B;  3UKR C;  3C9C A;  4ERQ A;  2EBS A;  4GGC A;  5EM2 B;  2QC5 A;  4J8G A;  3F3F A;  4KFM B;  5EAM A;  1L0Q A;  2B5M A;  2YNP A;  3AH8 B;  3L4O D;  5SXM A;  3EG6 A;  3ODT A;  3MKS B;  2AH0 A;  2P9P C;  2PM9 B;  1Q47 A;  1XHM A;  3MXX A;  5CYK B;  5GMK n;  2H6N A;  3K27 A;  4E5Z B;  3HFQ A;  4QL1 A;  1U2V C;  3PXT D;  5C2W B;  3RN0 D;  4U1E I;  4A09 B;  1MDA H;  4QQE A;  2IUP A;  4I79 A;  4A11 A;  4HDJ A;  3EI1 A;  3OKY B;  3PVU B;  1ERJ A;  4K3J B;  2P9K C;  3NVN A;  3KRW B;  2OVQ B;  3PSL A;  5AFU 3; 
#chains in the Genus database with same CATH topology
 3DWL C;  3EI4 A;  2IAA A;  2HU8 A;  4QAM A;  4E54 A;  3DXM C;  3U4Y A;  4U7A A;  3T3M A;  4DNW A;  1NEX B;  3MUN A;  5E6R A;  3MVD K;  1GP2 B;  2CE9 A;  4GZ8 A;  2XDW A;  4J8B A;  4L1M A;  5M5T A;  1YR2 A;  1PGU A;  4CC9 A;  3C5M A;  2P9N C;  5EM2 A;  2H6Q A;  1B9X A;  3PSC B;  3SJL D;  1C9L A;  1PEV A;  2HKM A;  4A11 B;  3IUN A;  5EMK B;  1TYE A;  3IUR A;  4J0W A;  5FFG A;  2BCJ B;  5C2V B;  4JXM A;  3QHY B;  1NR0 A;  3IJ1 A;  2MTA H;  3DXK C;  4FAN D;  3AL8 A;  1JV2 A;  5TF2 A;  3MKQ A;  3K71 A;  4J87 A;  5FKR A;  5C86 A;  1T2X A;  3N0E A;  1QFM A;  4IRZ A;  3EU7 A;  3I8E A;  5EAR A;  3W15 A;  1O6F A;  5K1C C;  3PVW B;  2J56 H;  4O3U B;  4CY2 A;  4BL0 A;  2H3X A;  4JSP C;  5C9Z B;  3ZE2 A;  1PBY B;  2HKR A;  4OZU A;  1OLZ A;  4WK0 A;  4Z7Q A;  4A09 A;  3FGB A;  3MMY A;  4CI2 A;  4X3E A;  3OKW A;  2QZP A;  4G1E A;  2VDP A;  4X63 B;  2AGX A;  3PXS D;  4OWR A;  1VZ2 A;  5K19 A;  5EAL A;  3MZK A;  3OKT A;  3K6S A;  4GGA A;  3P4F A;  4A2L A;  4UM8 A;  2CE8 A;  5EMM B;  3RRM C;  4AMZ A;  4CZV A;  4D0K A;  4LGN A;  5CXC B;  4UM9 A;  4H5I A;  1MG2 A;  5C92 A;  3DM0 A;  3GD1 I;  3PE7 A;  4A7J A;  4FA5 D;  5EML B;  3I7K A;  5TDH B;  4BCB A;  4GQ2 P;  5IC7 A;  5THA A;  3VH0 A;  3SBR A;  3I7N A;  2H13 A;  2HU5 A;  4DNU A;  2I0T A;  3JRP A;  1VE6 A;  3IJ0 A;  1TYQ C;  1N6F A;  1K32 A;  2HYE A;  4J86 A;  4UI9 R;  1UOP A;  5HE1 B;  4CZY A;  3JAM g;  1R5M A;  4Y7R A;  4QRJ A;  4XYI A;  5M61 A;  4BCC A;  3ZE1 A;  5M5V A;  2CO0 A;  3NVQ A;  4GQB B;  5A2Q g;  5HYN B;  4ZN4 A;  4CI8 A;  1JMZ B;  2GC7 A;  2Q7Q A;  3I8C A;  4Z7N A;  4ZOZ A;  4JHN A;  4AOW A;  4RE5 A;  4L1Q D;  1N6E A;  3SWS D;  5GXI A;  3UVK A;  3K72 A;  2H9N A;  3EI2 B;  1YFQ A;  4AEZ A;  2AGL A;  5E6U A;  1GG2 B;  3IIW A;  2UZY B;  1SQ9 A;  4GGD A;  2QR5 A;  4J77 A;  4PXW A;  2UZX B;  3EI3 A;  2IUV A;  4CI1 A;  4CY5 A;  3IVM A;  2Z2P A;  5IGQ A;  3VI3 A;  4JD2 C;  3JRO A;  5B4W A;  3SXT D;  3NIF A;  3I7O A;  2PM9 A;  4X61 B;  4ERY A;  3ZE0 A;  2O9K A;  3F3P A;  3OW8 A;  1H2Z A;  4CY1 A;  4FA4 D;  4LG8 A;  4BUJ C;  3JB9 L;  5HQG A;  5AMS A;  1B9Y A;  4PNK B;  2PM6 B;  3UVM A;  4AX4 A;  1JMX B;  4H5J A;  4ERZ A;  4E54 B;  2VZ3 A;  2WQ8 A;  3UKU C;  4RE6 A;  2CN2 A;  1XIP A;  3IUM A;  3EI1 B;  3MZL A;  3IUL A;  1FWX A;  2XL2 A;  3KCI A;  3O4G A;  3OKY A;  1H2Y A;  5GXH A;  2OJY A;  3UVO A;  2YMU A;  3GRE A;  4K3I D;  3EI2 A;  5E6S A;  1OMW B;  5HE0 B;  2EID A;  3SBQ A;  3CFS B;  4MMY A;  2GNQ A;  3FCU A;  5EMJ B;  1C9I A;  4Z8L A;  3VGZ A;  4XEI C;  2HES X;  4JSX C;  2CO0 C;  3AL8 B;  5IGO A;  4O45 A;  2OIZ A;  4PBY A;  5I5I A;  4PSW B;  2XL3 A;  3V4P A;  3I7L A;  3RMZ D;  1A0R B;  3UVL A;  2AQ5 A;  2OVR B;  4FHL A;  3C99 A;  2H9L A;  3IKO A;  4DNV A;  2P9U C;  3A0F A;  2EIE A;  3BG1 A;  2H9M A;  4GQ1 A;  4GM8 A;  5AJA A;  5GSA A;  2I0R A;  4XYH A;  2XE4 A;  3VA6 A;  4BH6 A;  4J84 A;  2XU7 A;  3O4J A;  4NSX A;  1O6G A;  4FWW A;  3V5W B;  2J55 H;  2H9P A;  2TRC B;  1JTD B;  3V4V A;  3ZWL B;  1GOH A;  3I89 A;  4GM3 A;  2AH1 A;  4N14 A;  5HE3 B;  2EIB A;  2P9S C;  1SHY B;  3IIY A;  2Z2N A;  2CNX A;  3BWS A;  1VYH C;  2YBA A;  5CXB A;  2P9I C;  4QT8 A;  2H47 A;  3J80 g;  4LG9 A;  3SLE D;  3L4M D;  2EIC A;  3JZN A;  1RI6 A;  2BKL A;  2CN3 A;  5M5U A;  3UVN A;  5CXC A;  1U4C A;  2IWK A;  5CYK A;  2OVP B;  3ZDZ A;  3SVW D;  5FFO A;  4E5Z A;  4NC4 A;  4JSV C;  1UOO A;  3B7F A;  4WK4 A;  2VDL A;  3I2N A;  2QXV A;  3O4I A;  3JZH A;  4JHP C;  5FKS A;  5TEF A;  2HJ4 A;  4AN1 A;  1GOT B;  3EQ7 A;  5FKT A;  4IA9 A;  4L3G D;  4MMX A;  4YVD A;  3ZDX A;  3GC3 B;  3K26 A;  4MK0 B;  5M5S A;  3J81 g;  4O3T B;  3IUJ A;  2Z2O A;  3SHF A;  2GC4 A;  3BG0 A;  3V7D B;  4A0B A;  2VDQ A;  4AN0 A;  1E8N A;  3UR4 A;  3SBP A;  3EQ9 A;  3JPX A;  4J82 A;  4G55 A;  5I5J A;  4FB1 D;  3AL9 A;  1GOF A;  2VDO A;  2G99 A;  5FQD A;  4A0A A;  3OF7 A;  1QFS A;  4A08 B;  1K3I A;  4O9D A;  4PBZ A;  4MMZ A;  5FKQ A;  3NVX A;  3VI4 A;  2AGZ A;  5H14 A;  3OTT A;  5I5M A;  2OK6 A;  2I0S A;  3RLM D;  5IJ8 E;  3EI4 B;  2J57 G;  1JOF A;  3FCS A;  4AMY A;  1L5G A;  3DSM A;  4WJK A;  3RN1 D;  1UOQ A;  3SCY A;  4D9S A;  1VZ3 A;  5FA5 B;  4GMB A;  3PXW D;  3ZDY A;  3JZG A;  4J78 A;  4X60 B;  2VC2 A;  1PI6 A;  2OK4 A;  2YB8 B;  3EWE A;  2IUQ A;  5IT9 g;  2I3T A;  4A0A B;  4O02 A;  2HU7 A;  4JT6 C;  3ULE C;  3F3G A;  3QI0 A;  4PC0 A;  2W18 A;  3AFC A;  5H1M A;  4ZOV A;  4L3H D;  4ESG A;  4BCD A;  4BP8 A;  4CI3 A;  3RFH A;  4EWR A;  5EAP A;  4Y5R D;  2BBK H;  1JJU B;  1QNI A;  1UTC A;  3OL2 B;  1BPO A;  3O4H A;  1U8C A;  3V9F A;  5M5R A;  5HE2 B;  3SN6 B;  3E0C A;  2HXC A;  3CIK B;  4O2W A;  2H68 A;  2B5N A;  2HJB A;  1M1X A;  3FM0 A;  3SMR A;  4A0B B;  5TEE A;  4NAA A;  1H2W A;  1H2X A;  1E8M A;  2AGY A;  4ES0 A;  3I7H A;  2H14 A;  5KDO B;  2XYI A;  1K8K C;  3N0D A;  4FA9 D;  1GOG A;  4ZOY A;  2G9A A;  2B4E A;  5H17 A;  4A08 A;  3T3P A;  3FRX A;  3RSE C;  4NBM A;  1S4U X;  1GXR A;  4A2M A;  2XZG A;  1SQJ A;  3GFC A;  3OL2 A;  4IMM A;  4TZ4 A;  4CY3 A;  4O1Q D;  4NEN A;  2H6K A;  4L9O A;  5HDB A;  3I7P A;  4JT5 C;  3ORV D;  1N6D A;  4PSX B;  2B5L A;  4J79 A;  2VDK A;  3MUO A;  5CXB B;  4D6V A;  4J81 A;  3NID A;  1P22 A;  2VDR A;  4FA1 D;  2IUR A;  5FXY A;  3SFZ A;  4JSN C;  2IWF A;  4G56 B;  4GM9 A;  1XKS A;  3CFV A;  4FAV D;  5JWZ A;  1TBG A;  3KRX B;  2YNO A;  5IJ7 E;  1E5T A;  2VDM A;  2I3S A;  4BP9 A;  1MG3 A;  3IJC A;  2AGW A;  3C75 H;  5FLX g;  3NIG A;  3EI3 B;  4ZOX A;  2PM7 B;  3RFG A;  3EQ8 A;  4CZX A;  3EMH A;  3IUQ A;  2P9L C;  2YNN A;  4J0X A;  2PBI B;  4J73 A;  4R7A B;  3UKR C;  3C9C A;  4ERQ A;  2EBS A;  4GGC A;  5EM2 B;  2QC5 A;  4J8G A;  3F3F A;  4KFM B;  5EAM A;  1L0Q A;  2B5M A;  2VDN A;  2YNP A;  3AH8 B;  3L4O D;  5SXM A;  2VZ1 A;  3EG6 A;  3ODT A;  3MKS B;  2AH0 A;  2P9P C;  2PM9 B;  1Q47 A;  1XHM A;  3MXX A;  5CYK B;  5GMK n;  3IJE A;  2H6N A;  3K27 A;  4E5Z B;  4Z7O A;  4G1M A;  3HFQ A;  4QL1 A;  1A12 A;  1U2V C;  3PXT D;  5C2W B;  2JKX A;  3RN0 D;  4U1E I;  4A09 B;  3DDU A;  1MDA H;  4QQE A;  2IUP A;  4I79 A;  4A11 A;  1I2M B;  4HDJ A;  3EI1 A;  1VE7 A;  3OKY B;  3PVU B;  1ERJ A;  4K3J B;  2P9K C;  4WK2 A;  3NVN A;  3KRW B;  2OVQ B;  3PSL A;  5AFU 3; 
#chains in the Genus database with same CATH homology
 3DWL C;  3EI4 A;  2IAA A;  4E54 A;  3DXM C;  3U4Y A;  4U7A A;  1NEX B;  1GP2 B;  2CE9 A;  4GZ8 A;  4J8B A;  1PGU A;  4CC9 A;  3C5M A;  2P9N C;  5EM2 A;  2H6Q A;  1B9X A;  3PSC B;  3SJL D;  1PEV A;  2HKM A;  4A11 B;  5EMK B;  4J0W A;  2BCJ B;  5C2V B;  4JXM A;  1NR0 A;  3IJ1 A;  2MTA H;  3DXK C;  4FAN D;  3AL8 A;  5TF2 A;  3MKQ A;  4J87 A;  5FKR A;  3N0E A;  3EU7 A;  3I8E A;  5EAR A;  3W15 A;  5K1C C;  3PVW B;  2J56 H;  4O3U B;  4CY2 A;  4BL0 A;  2H3X A;  4JSP C;  5C9Z B;  1PBY B;  2HKR A;  4OZU A;  1OLZ A;  4A09 A;  3FGB A;  3MMY A;  4CI2 A;  4X3E A;  3OKW A;  4X63 B;  2AGX A;  3PXS D;  4OWR A;  5K19 A;  5EAL A;  3MZK A;  3OKT A;  4GGA A;  3P4F A;  4A2L A;  2CE8 A;  5EMM B;  3RRM C;  4D0K A;  4CZV A;  4LGN A;  5CXC B;  4H5I A;  1MG2 A;  3DM0 A;  3PE7 A;  4A7J A;  4FA5 D;  5EML B;  3I7K A;  5TDH B;  4GQ2 P;  5IC7 A;  5THA A;  3VH0 A;  3SBR A;  3I7N A;  2H13 A;  2I0T A;  3JRP A;  3IJ0 A;  1TYQ C;  1N6F A;  1K32 A;  2HYE A;  4J86 A;  4UI9 R;  5HE1 B;  4CZY A;  3JAM g;  1R5M A;  4Y7R A;  4QRJ A;  4XYI A;  2CO0 A;  3NVQ A;  4GQB B;  5A2Q g;  5HYN B;  4ZN4 A;  4CI8 A;  1JMZ B;  2GC7 A;  2Q7Q A;  3I8C A;  4ZOZ A;  4AOW A;  4L1Q D;  1N6E A;  3SWS D;  5GXI A;  3UVK A;  2H9N A;  3EI2 B;  1YFQ A;  4AEZ A;  2AGL A;  1GG2 B;  3IIW A;  2UZY B;  1SQ9 A;  4GGD A;  4J77 A;  4PXW A;  2UZX B;  3EI3 A;  2IUV A;  4CI1 A;  4CY5 A;  2Z2P A;  5IGQ A;  4JD2 C;  3JRO A;  5B4W A;  3SXT D;  3I7O A;  2PM9 A;  4X61 B;  4ERY A;  2O9K A;  3F3P A;  3OW8 A;  4CY1 A;  4FA4 D;  4LG8 A;  4BUJ C;  3JB9 L;  5HQG A;  5AMS A;  1B9Y A;  4PNK B;  2PM6 B;  3UVM A;  1JMX B;  4H5J A;  4ERZ A;  4E54 B;  3UKU C;  2CN2 A;  1XIP A;  3EI1 B;  3MZL A;  1FWX A;  2XL2 A;  3OKY A;  5GXH A;  2OJY A;  3UVO A;  2YMU A;  3GRE A;  4K3I D;  3EI2 A;  1OMW B;  5HE0 B;  3SBQ A;  3CFS B;  2GNQ A;  5EMJ B;  3VGZ A;  4Z8L A;  4XEI C;  2HES X;  4JSX C;  2CO0 C;  3AL8 B;  5IGO A;  4O45 A;  2OIZ A;  4PBY A;  5I5I A;  4PSW B;  2XL3 A;  3I7L A;  3RMZ D;  1A0R B;  3UVL A;  2AQ5 A;  2OVR B;  4FHL A;  3C99 A;  2H9L A;  3IKO A;  2P9U C;  3A0F A;  3BG1 A;  2H9M A;  5AJA A;  4GM8 A;  4GQ1 A;  5GSA A;  2I0R A;  4XYH A;  3VA6 A;  4BH6 A;  4J84 A;  2XU7 A;  4NSX A;  4FWW A;  3V5W B;  2J55 H;  2H9P A;  2TRC B;  3ZWL B;  3I89 A;  4GM3 A;  2AH1 A;  4N14 A;  5HE3 B;  2P9S C;  1SHY B;  3IIY A;  2Z2N A;  2CNX A;  3BWS A;  1VYH C;  2YBA A;  5CXB A;  2P9I C;  4QT8 A;  2H47 A;  3J80 g;  4LG9 A;  3SLE D;  3L4M D;  3JZN A;  1RI6 A;  2CN3 A;  3UVN A;  5CXC A;  1U4C A;  2IWK A;  5CYK A;  2OVP B;  3SVW D;  4E5Z A;  4JSV C;  3B7F A;  5TEF A;  3I2N A;  2QXV A;  5FKS A;  3JZH A;  2HJ4 A;  1GOT B;  5FKT A;  4IA9 A;  4L3G D;  4YVD A;  3K26 A;  4MK0 B;  3J81 g;  4O3T B;  2Z2O A;  3SHF A;  2GC4 A;  3BG0 A;  3V7D B;  4A0B A;  3UR4 A;  3SBP A;  3JPX A;  4J82 A;  5I5J A;  4FB1 D;  3AL9 A;  2G99 A;  5FQD A;  4A0A A;  4A08 B;  4O9D A;  4PBZ A;  5FKQ A;  3NVX A;  2AGZ A;  5H14 A;  3OTT A;  5I5M A;  2OK6 A;  2I0S A;  3RLM D;  5IJ8 E;  3EI4 B;  2J57 G;  1JOF A;  3DSM A;  3RN1 D;  3SCY A;  5FA5 B;  4GMB A;  3PXW D;  3JZG A;  4J78 A;  4X60 B;  1PI6 A;  2OK4 A;  2YB8 B;  3EWE A;  2IUQ A;  5IT9 g;  2I3T A;  4A0A B;  4JT6 C;  3ULE C;  3F3G A;  4PC0 A;  2W18 A;  3AFC A;  5H1M A;  4ZOV A;  4L3H D;  4ESG A;  4CI3 A;  3RFH A;  4EWR A;  5EAP A;  4Y5R D;  2BBK H;  1JJU B;  1QNI A;  3OL2 B;  3V9F A;  5HE2 B;  3SN6 B;  3E0C A;  2HXC A;  3CIK B;  2H68 A;  2B5N A;  2HJB A;  3FM0 A;  3SMR A;  4A0B B;  5TEE A;  2AGY A;  4ES0 A;  3I7H A;  2H14 A;  5KDO B;  2XYI A;  1K8K C;  3N0D A;  4FA9 D;  4ZOY A;  2G9A A;  2B4E A;  5H17 A;  4A08 A;  3FRX A;  3RSE C;  1S4U X;  1GXR A;  4A2M A;  1SQJ A;  3GFC A;  3OL2 A;  4IMM A;  4TZ4 A;  4CY3 A;  4O1Q D;  2H6K A;  4L9O A;  3I7P A;  4JT5 C;  3ORV D;  1N6D A;  4PSX B;  2B5L A;  4J79 A;  5CXB B;  4D6V A;  4J81 A;  1P22 A;  4FA1 D;  2IUR A;  5FXY A;  3SFZ A;  4JSN C;  2IWF A;  4G56 B;  4GM9 A;  1XKS A;  3CFV A;  4FAV D;  5JWZ A;  1TBG A;  3KRX B;  2YNO A;  5IJ7 E;  2I3S A;  1MG3 A;  3IJC A;  2AGW A;  3C75 H;  5FLX g;  3EI3 B;  4ZOX A;  2PM7 B;  3RFG A;  4CZX A;  3EMH A;  2P9L C;  2YNN A;  4J0X A;  2PBI B;  4J73 A;  4R7A B;  3UKR C;  3C9C A;  4ERQ A;  2EBS A;  4GGC A;  5EM2 B;  2QC5 A;  4J8G A;  3F3F A;  4KFM B;  5EAM A;  1L0Q A;  2B5M A;  2YNP A;  3AH8 B;  3L4O D;  5SXM A;  3EG6 A;  3ODT A;  3MKS B;  2AH0 A;  2P9P C;  2PM9 B;  1Q47 A;  1XHM A;  3MXX A;  5CYK B;  5GMK n;  2H6N A;  3K27 A;  4E5Z B;  3HFQ A;  4QL1 A;  1U2V C;  3PXT D;  5C2W B;  3RN0 D;  4U1E I;  4A09 B;  1MDA H;  4QQE A;  2IUP A;  4I79 A;  4A11 A;  4HDJ A;  3EI1 A;  3OKY B;  3PVU B;  1ERJ A;  4K3J B;  2P9K C;  3NVN A;  3KRW B;  2OVQ B;  3PSL A;  5AFU 3; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...