2XL3A

Wdr5 in complex with an rbbp5 peptide and histone h3 peptide
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
303
structure length
303
Chain Sequence
KPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords WD REPEAT-CONTAINING PROTEIN 5
publication title Characterisation of a Novel Wdr5 Binding Site that Recruits Rbbp5 Through a Conserved Motif and Enhances Methylation of H3K4 by Mll1.
pubmed doi rcsb
source organism Mus musculus
total genus 94
structure length 303
sequence length 303
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2xl3A00
4JSXC 2AH0A 2HJ4A 4A2LA 4FAVD 3I7KA 2Z2OA 5EMMB 5EMKB 3SMRA 4O45A 4A09A 2J57G 3IKOA 3UKRC 3SLED 1FWXA 1K8KC 5H14A 2H14A 1PI6A 3CIKB 4GQBB 4IA9A 3PSLA 3BG0A 2GC7A 3ULEC 1MDAH 4XYIA 4PSWB 4GM3A 3V7DB 5TDHB 4QQEA 1JMZB 2Z2NA 2I0RA 5GXIA 4QL1A 3EI4B 4XEIC 4FAND 3PE7A 3N0EA 4GGAA 3K27A 1N6FA 2PBIB 2OIZA 2H6NA 4PBYA 4FA9D 2P9PC 5AJAA 4BH6A 3I7OA 2AH1A 1MG2A 2H6KA 2QC5A 4GGCA 2P9UC 2J56H 3V5WB 3V9FA 3UKUC 3DM0A 3ORVD 2P9LC 2AGWA 4FB1D 2OVRB 3MZLA 3BG1A 3MKQA 2HESX 5CXCB 2IUPA 4A7JA 4A2MA 3OW8A 4JXMA 5KDOB 3IIYA 4NSXA 3AL8A 1N6DA 1TYQC 2XU7A 1QNIA 1VYHC 2P9KC 4ZOVA 3OKTA 4J8GA 2B5NA 3F3PA 4A0AB 3P4FA 3K26A 4N14A 3PXTD 3PSCB 3HFQA 3I7HA 3RN0D 5HE2B 4BUJC 3JROA 4A0BB 5H1MA 4CI3A 3RSEC 1MG3A 5HE1B 1R5MA 4L9OA 1JMXB 3L4MD 2CE9A 4FA5D 5IGQA 1B9YA 3EI1A 3EWEA 3DXMC 2IURA 2H3XA 2UZXB 2YNPA 3DSMA 4D0KA 5TEEA 5CXCA 3IJ1A 3OKYB 4H5IA 4J0WA 2H9NA 3MMYA 4ERYA 4R7AB 3IIWA 3I7LA 5HYNB 1NEXB 1RI6A 3I8EA 5TF2A 4GMBA 4A0AA 3FGBA 4I79A 4H5JA 5AFU3 1TBGA 2AGYA 4JT6C 4TZ4A 5CXBB 4U1EI 1XIPA 2OK4A 3AH8B 3ODTA 4J8BA 5EMLB 2OJYA 3RFGA 4PC0A 2I0SA 4A0BA 3UVMA 2H9PA 2IWKA 4CY1A 5A2Qg 4FA4D 2H6QA 5EARA 2Z2PA 2YB8B 4LGNA 4ESGA 1PGUA 4ZOXA 3GREA 4KFMB 2P9NC 4XYHA 4CZXA 5FXYA 4IMMA 2AGXA 1N6EA 2HKRA 5HE0B 5THAA 3EG6A 4GQ1A 3EMHA 3OKYA 1OLZA 4CZVA 3IJ0A 4L3GD 3PVWB 3C99A 5FKTA 3MXXA 1S4UX 1SQ9A 5EM2B 1U2VC 3JZHA 2OVQB 5IJ7E 2CN3A 4A11B 2H9MA 4O3UB 2HYEA 3I89A 2CE8A 3JZNA 4J73A 5GMKn 3JAMg 2XL3A 3BWSA 5EAMA 3J81g 5FKRA 2I0TA 2J55H 4HDJA 3NVXA 2XL2A 2PM9B 1P22A 3I2NA 4JSNC 2IWFA 4PSXB 3CFSB 4J77A 5I5JA 4J86A 4JT5C 4E54B 3SWSD 3VGZA 4OZUA 1GP2B 2PM7B 4X60B 3EI4A 4J81A 3F3GA 3C75H 5FKSA 4A08B 3RMZD 2CO0C 2HJBA 3SFZA 4CZYA 5I5MA 1JOFA 3SXTD 3J80g 1GOTB 3JZGA 2PM9A 2YBAA 3DWLC 3JPXA 5TEFA 5C2WB 3RRMC 3SBQA 1GXRA 2CNXA 4D6VA 5C2VB 4CY3A 3KRXB 4J79A 4O1QD 5GXHA 1A0RB 4GM8A 4GGDA 3SCYA 4CI2A 3F3FA 3I7PA 5HE3B 3C5MA 4E5ZB 2HXCA 1PBYB 2B4EA 3EI3B 3ZWLB 5IGOA 3DXKC 2IUQA 4A09B 3C9CA 4CY5A 4FA1D 3UVKA 2G99A 2B5LA 3RN1D 2W18A 4ZN4A 3JB9L 1Q47A 4OWRA 4ZOZA 4CY2A 5B4WA 5JWZA 4Z8LA 4GZ8A 2AGZA 4J78A 2OVPB 4X63B 5EAPA 1XKSA 3E0CA 4EWRA 3VH0A 5IJ8E 3RLMD 4AOWA 1JJUB 3SBRA 5FLXg 1B9XA 3UVOA 4E5ZA 5AMSA 4GQ2P 3UVLA 3EI3A 3W15A 1OMWB 4L3HD 1XHMA 3A0FA 3OTTA 4CC9A 2AGLA 3IJCA 4QT8A 3OL2B 2HKMA 2XYIA 4QRJA 5CXBA 5EMJB 4UI9R 2H47A 2P9IC 2P9SC 4YVDA 1YFQA 4JSPC 2IUVA 2I3SA 4ZOYA 3KRWB 3CFVA 2QXVA 2H68A 4ERZA 4U7AA 2H13A 3AL8B 2BCJB 2MTAH 3OKWA 2B5MA 4J82A 4K3ID 2OK6A 3AFCA 1ERJA 5CYKB 4G56B 1NR0A 3PXWD 4FWWA 5C9ZB 3EI2B 1SQJA 3U4YA 3VA6A 3NVNA 4LG8A 5H17A 1SHYB 3GFCA 3SBPA 5EM2A 4MK0B 4Y5RD 4ERQA 2UZYB 3SVWD 3SN6B 4A11A 2IAAA 3OL2A 4ES0A 2EBSA 3UR4A 3EI1B 2CN2A 3I8CA 4LG9A 1GG2B 4FHLA 3FM0A 4PBZA 5I5IA 2TRCB 2YNOA 1K32A 4PNKB 5SXMA 3SJLD 3SHFA 4X61B 2YMUA 2AQ5A 4K3JB 5HQGA 5EALA 2H9LA 4J87A 5FQDA 5IT9g 1L0QA 3PVUB 5FKQA 5CYKA 5K19A 1U4CA 5K1CC 3NVQA 3MZKA 4E54A 1PEVA 3I7NA 4CI8A 3N0DA 3RFHA 3EI2A 2GNQA 3PXSD 2O9KA 3B7FA 4O9DA 4JD2C 4PXWA 2I3TA 3FRXA 4Y7RA 4A08A 3EU7A 5GSAA 5IC7A 4J84A 3UVNA 4GM9A 5FA5B 2G9AA 2GC4A 2CO0A 2YNNA 4JSVC 2PM6B 4AEZA 3MKSB 3JRPA 2Q7QA 4O3TB 4X3EA 4J0XA 2BBKH 3L4OD 4BL0A 3AL9A 4L1QD 4CI1A
chains in the Genus database with same CATH superfamily
4JSXC 2AH0A 2HJ4A 2EIDA 1UOQA 4BP9A 4A2LA 4FAVD 3I7KA 2Z2OA 5EMMB 5EMKB 3SMRA 4O45A 4A09A 2J57G 3IKOA 3UKRC 3SLED 1FWXA 2XE4A 1K8KC 4MMXA 5H14A 2H14A 4Z7OA 1PI6A 3CIKB 3IUNA 4GQBB 1TYEA 4IA9A 3PSLA 3BG0A 2GC7A 3O4JA 3ULEC 1MDAH 4XYIA 4PSWB 4GM3A 3V7DB 4WJKA 5TDHB 4QQEA 4NAAA 1JMZB 2Z2NA 2I0RA 5GXIA 4QL1A 3EI4B 3NIFA 4XEIC 4FAND 2VDRA 3PE7A 3N0EA 1VZ3A 4GGAA 3K27A 1N6FA 1JV2A 2PBIB 2OIZA 2H6NA 4PBYA 1E8NA 4FA9D 2QR5A 2P9PC 5AJAA 3IULA 4BH6A 2XZGA 3I7OA 2AH1A 1MG2A 2H6KA 2QC5A 4GGCA 2P9UC 4WK2A 2J56H 3V5WB 3V9FA 3UKUC 3DM0A 3MUNA 3ORVD 2P9LC 2AGWA 4FB1D 2OVRB 3MZLA 1L5GA 3GC3B 4G1MA 3BG1A 3MKQA 2HESX 5CXCB 2IUPA 4A7JA 4A2MA 3OW8A 4JXMA 5KDOB 3IIYA 2HU8A 4NSXA 3AL8A 1N6DA 1C9IA 1TYQC 2XU7A 1QNIA 1VYHC 2P9KC 4ZOVA 3OKTA 4J8GA 2B5NA 3F3PA 4A0AB 3P4FA 3K26A 4QAMA 4N14A 3PXTD 3PSCB 3HFQA 3I7HA 3RN0D 5HE2B 4BUJC 3JROA 4A0BB 5H1MA 4CI3A 2VZ1A 3RSEC 1MG3A 5HE1B 1R5MA 1JMXB 4L9OA 3L4MD 2CE9A 3O4GA 4FA5D 3IUJA 5IGQA 1GOGA 1B9YA 3VI4A 3EI1A 3EWEA 3DXMC 2IURA 2H3XA 2UZXB 2YNPA 3DSMA 4D0KA 5M61A 5TEEA 1C9LA 3O4IA 5CXCA 4AMZA 3IJ1A 3OKYB 4H5IA 4J0WA 2H9NA 3MMYA 4ERYA 1UOOA 4R7AB 3IIWA 3I7LA 4RE5A 5HYNB 4MMZA 1NEXB 1RI6A 3I8EA 5TF2A 4GMBA 4A0AA 3FGBA 3NIDA 4I79A 4H5JA 2VC2A 5AFU3 1TBGA 2AGYA 2XDWA 4JT6C 4TZ4A 5CXBB 3GD1I 1XIPA 2OK4A 3AH8B 3ODTA 4U1EI 4J8BA 5EMLB 2OJYA 3RFGA 4PC0A 2I0SA 4A0BA 3UVMA 2H9PA 2IWKA 3T3MA 4CY1A 5A2Qg 3IJEA 4FA4D 2H6QA 5EARA 2Z2PA 2YB8B 4LGNA 4ESGA 1PGUA 4ZOXA 4AX4A 3ZDYA 3GREA 4KFMB 2P9NC 4XYHA 4CZXA 5FXYA 4IMMA 2AGXA 1N6EA 2HKRA 5HE0B 5THAA 3EG6A 4GQ1A 3EMHA 3OKYA 1H2XA 1OLZA 4CZVA 3IJ0A 4L3GD 3PVWB 3V4PA 5E6RA 3C99A 5FKTA 3MXXA 1S4UX 1SQ9A 2QZPA 5EM2B 1U2VC 3JZHA 3ZDZA 3OF7A 2OVQB 1JTDB 2EICA 5IJ7E 2CN3A 4A11B 2H9MA 4O3UB 2HYEA 5M5UA 3I89A 2CE8A 3JZNA 4J73A 5GMKn 3JAMg 2XL3A 3BWSA 5EAMA 4BCBA 3J81g 5FKRA 2I0TA 2J55H 4HDJA 3NVXA 5HDBA 2XL2A 2PM9B 1P22A 3I2NA 2VDQA 1VZ2A 4JSNC 2IWFA 3KCIA 4PSXB 3ZE0A 3CFSB 4O2WA 1UOPA 5C86A 4J77A 5I5JA 2VDMA 4J86A 1GOHA 4JT5C 4E54B 3SWSD 3VGZA 4OZUA 4JHPC 1GP2B 3V4VA 1VE6A 2PM7B 4X60B 3EI4A 4J81A 3F3GA 1I2MB 3C75H 5FKSA 4A08B 3RMZD 3IUQA 2CO0C 2HJBA 2HU7A 3SFZA 4CZYA 5I5MA 2EIEA 3QI0A 1JOFA 2VZ3A 3SXTD 3J80g 1GOTB 3O4HA 1E8MA 3JZGA 3EQ8A 2PM9A 2YBAA 3DWLC 3JPXA 5TEFA 5C2WB 4L1MA 2BKLA 3RRMC 3SBQA 1GXRA 2CNXA 3FCUA 4D6VA 5C2VB 4CY3A 3KRXB 4J79A 4O1QD 5GXHA 1A0RB 4GM8A 4GGDA 3SCYA 1BPOA 4CI2A 4DNVA 3F3FA 3IVMA 3I7PA 5HE3B 3C5MA 4E5ZB 2HXCA 4BCCA 1PBYB 2B4EA 3EI3B 3ZWLB 1H2WA 3DXKC 5IGOA 2IUQA 2JKXA 4G1EA 4A09B 3C9CA 4CY5A 4FA1D 3UVKA 4MMYA 2G99A 5FFGA 4UM9A 1QFSA 1O6FA 2B5LA 3RN1D 2W18A 4UM8A 4ZN4A 3JB9L 1Q47A 4OWRA 4WK4A 4ZOZA 4CY2A 5B4WA 5JWZA 4Z8LA 4GZ8A 2AGZA 4IRZA 4JHNA 4J78A 2OVPB 4X63B 5E6UA 5EAPA 1XKSA 3E0CA 4EWRA 3VH0A 5IJ8E 3RLMD 4AOWA 1JJUB 3SBRA 5FLXg 3IUMA 1B9XA 3UVOA 3ZE1A 5AMSA 4E5ZA 4GQ2P 3UVLA 4G55A 3EI3A 4D9SA 3ZE2A 1H2YA 3W15A 1OMWB 4L3HD 1XHMA 3A0FA 2WQ8A 3OTTA 1A12A 4O02A 4CC9A 2AGLA 1H2ZA 3IJCA 4QT8A 3OL2B 2HKMA 1K3IA 2XYIA 4QRJA 5CXBA 5EMJB 4UI9R 2H47A 2EIBA 2P9IC 2P9SC 4YVDA 4DNUA 1YFQA 4JSPC 2IUVA 2I3SA 3FCSA 4ZOYA 3KRWB 3CFVA 2QXVA 4BP8A 3EQ7A 2H68A 2VDNA 4U7AA 4ERZA 1YR2A 2H13A 2HU5A 3MUOA 5E6SA 3AL8B 2BCJB 2MTAH 3OKWA 1GOFA 2B5MA 4J82A 4K3ID 1O6GA 2OK6A 3AFCA 1ERJA 3IURA 1VE7A 5CYKB 4G56B 1NR0A 5M5SA 3PXWD 4FWWA 5C9ZB 3EI2B 1SQJA 3U4YA 3VA6A 3NVNA 4LG8A 5H17A 1SHYB 3GFCA 3SBPA 5EM2A 4MK0B 4Y5RD 4ERQA 5C92A 1UTCA 3QHYB 4DNWA 3K72A 2UZYB 4BCDA 3SVWD 3SN6B 4A11A 2IAAA 3OL2A 1E5TA 4ES0A 2EBSA 3UR4A 3VI3A 3EI1B 2CN2A 3I8CA 5M5VA 4LG9A 1GG2B 4Z7QA 3MVDK 4Z7NA 4FHLA 3T3PA 3FM0A 4PBZA 4AN0A 1U8CA 5I5IA 2TRCB 3NIGA 2YNOA 5FFOA 3DDUA 1K32A 1QFMA 4PNKB 5SXMA 3SJLD 3SHFA 4X61B 4AN1A 2YMUA 2AQ5A 4K3JB 5HQGA 5EALA 4NBMA 1M1XA 2H9LA 4J87A 4WK0A 5FQDA 5IT9g 1L0QA 3PVUB 3K71A 5FKQA 5CYKA 5K19A 1U4CA 5K1CC 3NVQA 3MZKA 4E54A 1PEVA 3I7NA 4CI8A 3N0DA 3RFHA 3EI2A 2GNQA 1T2XA 3PXSD 4NENA 2O9KA 3B7FA 3ZDXA 4AMYA 4O9DA 4JD2C 4PXWA 2I3TA 3FRXA 4Y7RA 4A08A 3EU7A 5GSAA 4RE6A 5IC7A 4J84A 2VDLA 3UVNA 4GM9A 5FA5B 2G9AA 2GC4A 2VDPA 2VDKA 2CO0A 3K6SA 5M5RA 2YNNA 2VDOA 4JSVC 2PM6B 4AEZA 3MKSB 3EQ9A 3JRPA 2Q7QA 4O3TB 4X3EA 4J0XA 4NC4A 2BBKH 3L4OD 4BL0A 3AL9A 4L1QD 4CI1A 5M5TA
chains in the Genus database with same CATH topology
4JSXC 2AH0A 2HJ4A 4A2LA 4FAVD 3I7KA 2Z2OA 5EMMB 5EMKB 3SMRA 4O45A 4A09A 2J57G 3IKOA 3UKRC 3SLED 1FWXA 1K8KC 5H14A 2H14A 1PI6A 3CIKB 4GQBB 4IA9A 3PSLA 3BG0A 2GC7A 3ULEC 1MDAH 4XYIA 4PSWB 4GM3A 3V7DB 5TDHB 4QQEA 1JMZB 2Z2NA 2I0RA 5GXIA 4QL1A 3EI4B 4XEIC 4FAND 3PE7A 3N0EA 4GGAA 3K27A 1N6FA 2PBIB 2OIZA 2H6NA 4PBYA 4FA9D 2P9PC 5AJAA 4BH6A 3I7OA 2AH1A 1MG2A 2H6KA 2QC5A 4GGCA 2P9UC 2J56H 3V5WB 3V9FA 3UKUC 3DM0A 3ORVD 2P9LC 2AGWA 4FB1D 2OVRB 3MZLA 3BG1A 3MKQA 2HESX 5CXCB 2IUPA 4A7JA 4A2MA 3OW8A 4JXMA 5KDOB 3IIYA 4NSXA 3AL8A 1N6DA 1TYQC 2XU7A 1QNIA 1VYHC 2P9KC 4ZOVA 3OKTA 4J8GA 2B5NA 3F3PA 4A0AB 3P4FA 3K26A 4N14A 3PXTD 3PSCB 3HFQA 3I7HA 3RN0D 5HE2B 4BUJC 3JROA 4A0BB 5H1MA 4CI3A 3RSEC 1MG3A 5HE1B 1R5MA 4L9OA 1JMXB 3L4MD 2CE9A 4FA5D 5IGQA 1B9YA 3EI1A 3EWEA 3DXMC 2IURA 2H3XA 2UZXB 2YNPA 3DSMA 4D0KA 5TEEA 5CXCA 3IJ1A 3OKYB 4H5IA 4J0WA 2H9NA 3MMYA 4ERYA 4R7AB 3IIWA 3I7LA 5HYNB 1NEXB 1RI6A 3I8EA 5TF2A 4GMBA 4A0AA 3FGBA 4I79A 4H5JA 5AFU3 1TBGA 2AGYA 4JT6C 4TZ4A 5CXBB 4U1EI 1XIPA 2OK4A 3AH8B 3ODTA 4J8BA 5EMLB 2OJYA 3RFGA 4PC0A 2I0SA 4A0BA 3UVMA 2H9PA 2IWKA 4CY1A 5A2Qg 4FA4D 2H6QA 5EARA 2Z2PA 2YB8B 4LGNA 4ESGA 1PGUA 4ZOXA 3GREA 4KFMB 2P9NC 4XYHA 4CZXA 5FXYA 4IMMA 2AGXA 1N6EA 2HKRA 5HE0B 5THAA 3EG6A 4GQ1A 3EMHA 3OKYA 1OLZA 4CZVA 3IJ0A 4L3GD 3PVWB 3C99A 5FKTA 3MXXA 1S4UX 1SQ9A 5EM2B 1U2VC 3JZHA 2OVQB 5IJ7E 2CN3A 4A11B 2H9MA 4O3UB 2HYEA 3I89A 2CE8A 3JZNA 4J73A 5GMKn 3JAMg 2XL3A 3BWSA 5EAMA 3J81g 5FKRA 2I0TA 2J55H 4HDJA 3NVXA 2XL2A 2PM9B 1P22A 3I2NA 4JSNC 2IWFA 4PSXB 3CFSB 4J77A 5I5JA 4J86A 4JT5C 4E54B 3SWSD 3VGZA 4OZUA 1GP2B 2PM7B 4X60B 3EI4A 4J81A 3F3GA 3C75H 5FKSA 4A08B 3RMZD 2CO0C 2HJBA 3SFZA 4CZYA 5I5MA 1JOFA 3SXTD 3J80g 1GOTB 3JZGA 2PM9A 2YBAA 3DWLC 3JPXA 5TEFA 5C2WB 3RRMC 3SBQA 1GXRA 2CNXA 4D6VA 5C2VB 4CY3A 3KRXB 4J79A 4O1QD 5GXHA 1A0RB 4GM8A 4GGDA 3SCYA 4CI2A 3F3FA 3I7PA 5HE3B 3C5MA 4E5ZB 2HXCA 1PBYB 2B4EA 3EI3B 3ZWLB 5IGOA 3DXKC 2IUQA 4A09B 3C9CA 4CY5A 4FA1D 3UVKA 2G99A 2B5LA 3RN1D 2W18A 4ZN4A 3JB9L 1Q47A 4OWRA 4ZOZA 4CY2A 5B4WA 5JWZA 4Z8LA 4GZ8A 2AGZA 4J78A 2OVPB 4X63B 5EAPA 1XKSA 3E0CA 4EWRA 3VH0A 5IJ8E 3RLMD 4AOWA 1JJUB 3SBRA 5FLXg 1B9XA 3UVOA 4E5ZA 5AMSA 4GQ2P 3UVLA 3EI3A 3W15A 1OMWB 4L3HD 1XHMA 3A0FA 3OTTA 4CC9A 2AGLA 3IJCA 4QT8A 3OL2B 2HKMA 2XYIA 4QRJA 5CXBA 5EMJB 4UI9R 2H47A 2P9IC 2P9SC 4YVDA 1YFQA 4JSPC 2IUVA 2I3SA 4ZOYA 3KRWB 3CFVA 2QXVA 2H68A 4ERZA 4U7AA 2H13A 3AL8B 2BCJB 2MTAH 3OKWA 2B5MA 4J82A 4K3ID 2OK6A 3AFCA 1ERJA 5CYKB 4G56B 1NR0A 3PXWD 4FWWA 5C9ZB 3EI2B 1SQJA 3U4YA 3VA6A 3NVNA 4LG8A 5H17A 1SHYB 3GFCA 3SBPA 5EM2A 4MK0B 4Y5RD 4ERQA 2UZYB 3SVWD 3SN6B 4A11A 2IAAA 3OL2A 4ES0A 2EBSA 3UR4A 3EI1B 2CN2A 3I8CA 4LG9A 1GG2B 4FHLA 3FM0A 4PBZA 5I5IA 2TRCB 2YNOA 1K32A 4PNKB 5SXMA 3SJLD 3SHFA 4X61B 2YMUA 2AQ5A 4K3JB 5HQGA 5EALA 2H9LA 4J87A 5FQDA 5IT9g 1L0QA 3PVUB 5FKQA 5CYKA 5K19A 1U4CA 5K1CC 3NVQA 3MZKA 4E54A 1PEVA 3I7NA 4CI8A 3N0DA 3RFHA 3EI2A 2GNQA 3PXSD 2O9KA 3B7FA 4O9DA 4JD2C 4PXWA 2I3TA 3FRXA 4Y7RA 4A08A 3EU7A 5GSAA 5IC7A 4J84A 3UVNA 4GM9A 5FA5B 2G9AA 2GC4A 2CO0A 2YNNA 4JSVC 2PM6B 4AEZA 3MKSB 3JRPA 2Q7QA 4O3TB 4X3EA 4J0XA 2BBKH 3L4OD 4BL0A 3AL9A 4L1QD 4CI1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JSX C;  2AH0 A;  2HJ4 A;  4A2L A;  4FAV D;  3I7K A;  2Z2O A;  5EMM B;  5EMK B;  3SMR A;  4O45 A;  4A09 A;  2J57 G;  3IKO A;  3UKR C;  3SLE D;  1FWX A;  1K8K C;  5H14 A;  2H14 A;  1PI6 A;  3CIK B;  4GQB B;  4IA9 A;  3PSL A;  3BG0 A;  2GC7 A;  3ULE C;  1MDA H;  4XYI A;  4PSW B;  4GM3 A;  3V7D B;  5TDH B;  4QQE A;  1JMZ B;  2Z2N A;  2I0R A;  5GXI A;  4QL1 A;  3EI4 B;  4XEI C;  4FAN D;  3PE7 A;  3N0E A;  4GGA A;  3K27 A;  1N6F A;  2PBI B;  2OIZ A;  2H6N A;  4PBY A;  4FA9 D;  2P9P C;  5AJA A;  4BH6 A;  3I7O A;  2AH1 A;  1MG2 A;  2H6K A;  2QC5 A;  4GGC A;  2P9U C;  2J56 H;  3V5W B;  3V9F A;  3UKU C;  3DM0 A;  3ORV D;  2P9L C;  2AGW A;  4FB1 D;  2OVR B;  3MZL A;  3BG1 A;  3MKQ A;  2HES X;  5CXC B;  2IUP A;  4A7J A;  4A2M A;  3OW8 A;  4JXM A;  5KDO B;  3IIY A;  4NSX A;  3AL8 A;  1N6D A;  1TYQ C;  2XU7 A;  1QNI A;  1VYH C;  2P9K C;  4ZOV A;  3OKT A;  4J8G A;  2B5N A;  3F3P A;  4A0A B;  3P4F A;  3K26 A;  4N14 A;  3PXT D;  3PSC B;  3HFQ A;  3I7H A;  3RN0 D;  5HE2 B;  4BUJ C;  3JRO A;  4A0B B;  5H1M A;  4CI3 A;  3RSE C;  1MG3 A;  5HE1 B;  1R5M A;  4L9O A;  1JMX B;  3L4M D;  2CE9 A;  4FA5 D;  5IGQ A;  1B9Y A;  3EI1 A;  3EWE A;  3DXM C;  2IUR A;  2H3X A;  2UZX B;  2YNP A;  3DSM A;  4D0K A;  5TEE A;  5CXC A;  3IJ1 A;  3OKY B;  4H5I A;  4J0W A;  2H9N A;  3MMY A;  4ERY A;  4R7A B;  3IIW A;  3I7L A;  5HYN B;  1NEX B;  1RI6 A;  3I8E A;  5TF2 A;  4GMB A;  4A0A A;  3FGB A;  4I79 A;  4H5J A;  5AFU 3;  1TBG A;  2AGY A;  4JT6 C;  4TZ4 A;  5CXB B;  4U1E I;  1XIP A;  2OK4 A;  3AH8 B;  3ODT A;  4J8B A;  5EML B;  2OJY A;  3RFG A;  4PC0 A;  2I0S A;  4A0B A;  3UVM A;  2H9P A;  2IWK A;  4CY1 A;  5A2Q g;  4FA4 D;  2H6Q A;  5EAR A;  2Z2P A;  2YB8 B;  4LGN A;  4ESG A;  1PGU A;  4ZOX A;  3GRE A;  4KFM B;  2P9N C;  4XYH A;  4CZX A;  5FXY A;  4IMM A;  2AGX A;  1N6E A;  2HKR A;  5HE0 B;  5THA A;  3EG6 A;  4GQ1 A;  3EMH A;  3OKY A;  1OLZ A;  4CZV A;  3IJ0 A;  4L3G D;  3PVW B;  3C99 A;  5FKT A;  3MXX A;  1S4U X;  1SQ9 A;  5EM2 B;  1U2V C;  3JZH A;  2OVQ B;  5IJ7 E;  2CN3 A;  4A11 B;  2H9M A;  4O3U B;  2HYE A;  3I89 A;  2CE8 A;  3JZN A;  4J73 A;  5GMK n;  3JAM g;  2XL3 A;  3BWS A;  5EAM A;  3J81 g;  5FKR A;  2I0T A;  2J55 H;  4HDJ A;  3NVX A;  2XL2 A;  2PM9 B;  1P22 A;  3I2N A;  4JSN C;  2IWF A;  4PSX B;  3CFS B;  4J77 A;  5I5J A;  4J86 A;  4JT5 C;  4E54 B;  3SWS D;  3VGZ A;  4OZU A;  1GP2 B;  2PM7 B;  4X60 B;  3EI4 A;  4J81 A;  3F3G A;  3C75 H;  5FKS A;  4A08 B;  3RMZ D;  2CO0 C;  2HJB A;  3SFZ A;  4CZY A;  5I5M A;  1JOF A;  3SXT D;  3J80 g;  1GOT B;  3JZG A;  2PM9 A;  2YBA A;  3DWL C;  3JPX A;  5TEF A;  5C2W B;  3RRM C;  3SBQ A;  1GXR A;  2CNX A;  4D6V A;  5C2V B;  4CY3 A;  3KRX B;  4J79 A;  4O1Q D;  5GXH A;  1A0R B;  4GM8 A;  4GGD A;  3SCY A;  4CI2 A;  3F3F A;  3I7P A;  5HE3 B;  3C5M A;  4E5Z B;  2HXC A;  1PBY B;  2B4E A;  3EI3 B;  3ZWL B;  5IGO A;  3DXK C;  2IUQ A;  4A09 B;  3C9C A;  4CY5 A;  4FA1 D;  3UVK A;  2G99 A;  2B5L A;  3RN1 D;  2W18 A;  4ZN4 A;  3JB9 L;  1Q47 A;  4OWR A;  4ZOZ A;  4CY2 A;  5B4W A;  5JWZ A;  4Z8L A;  4GZ8 A;  2AGZ A;  4J78 A;  2OVP B;  4X63 B;  5EAP A;  1XKS A;  3E0C A;  4EWR A;  3VH0 A;  5IJ8 E;  3RLM D;  4AOW A;  1JJU B;  3SBR A;  5FLX g;  1B9X A;  3UVO A;  4E5Z A;  5AMS A;  4GQ2 P;  3UVL A;  3EI3 A;  3W15 A;  1OMW B;  4L3H D;  1XHM A;  3A0F A;  3OTT A;  4CC9 A;  2AGL A;  3IJC A;  4QT8 A;  3OL2 B;  2HKM A;  2XYI A;  4QRJ A;  5CXB A;  5EMJ B;  4UI9 R;  2H47 A;  2P9I C;  2P9S C;  4YVD A;  1YFQ A;  4JSP C;  2IUV A;  2I3S A;  4ZOY A;  3KRW B;  3CFV A;  2QXV A;  2H68 A;  4ERZ A;  4U7A A;  2H13 A;  3AL8 B;  2BCJ B;  2MTA H;  3OKW A;  2B5M A;  4J82 A;  4K3I D;  2OK6 A;  3AFC A;  1ERJ A;  5CYK B;  4G56 B;  1NR0 A;  3PXW D;  4FWW A;  5C9Z B;  3EI2 B;  1SQJ A;  3U4Y A;  3VA6 A;  3NVN A;  4LG8 A;  5H17 A;  1SHY B;  3GFC A;  3SBP A;  5EM2 A;  4MK0 B;  4Y5R D;  4ERQ A;  2UZY B;  3SVW D;  3SN6 B;  4A11 A;  2IAA A;  3OL2 A;  4ES0 A;  2EBS A;  3UR4 A;  3EI1 B;  2CN2 A;  3I8C A;  4LG9 A;  1GG2 B;  4FHL A;  3FM0 A;  4PBZ A;  5I5I A;  2TRC B;  2YNO A;  1K32 A;  4PNK B;  5SXM A;  3SJL D;  3SHF A;  4X61 B;  2YMU A;  2AQ5 A;  4K3J B;  5HQG A;  5EAL A;  2H9L A;  4J87 A;  5FQD A;  5IT9 g;  1L0Q A;  3PVU B;  5FKQ A;  5CYK A;  5K19 A;  1U4C A;  5K1C C;  3NVQ A;  3MZK A;  4E54 A;  1PEV A;  3I7N A;  4CI8 A;  3N0D A;  3RFH A;  3EI2 A;  2GNQ A;  3PXS D;  2O9K A;  3B7F A;  4O9D A;  4JD2 C;  4PXW A;  2I3T A;  3FRX A;  4Y7R A;  4A08 A;  3EU7 A;  5GSA A;  5IC7 A;  4J84 A;  3UVN A;  4GM9 A;  5FA5 B;  2G9A A;  2GC4 A;  2CO0 A;  2YNN A;  4JSV C;  2PM6 B;  4AEZ A;  3MKS B;  3JRP A;  2Q7Q A;  4O3T B;  4X3E A;  4J0X A;  2BBK H;  3L4O D;  4BL0 A;  3AL9 A;  4L1Q D;  4CI1 A; 
#chains in the Genus database with same CATH topology
 4JSX C;  2AH0 A;  2HJ4 A;  2EID A;  1UOQ A;  4BP9 A;  4A2L A;  4FAV D;  3I7K A;  2Z2O A;  5EMM B;  5EMK B;  3SMR A;  4O45 A;  4A09 A;  2J57 G;  3IKO A;  3UKR C;  3SLE D;  1FWX A;  2XE4 A;  1K8K C;  4MMX A;  5H14 A;  2H14 A;  4Z7O A;  1PI6 A;  3CIK B;  3IUN A;  4GQB B;  1TYE A;  4IA9 A;  3PSL A;  3BG0 A;  2GC7 A;  3O4J A;  3ULE C;  1MDA H;  4XYI A;  4PSW B;  4GM3 A;  3V7D B;  4WJK A;  5TDH B;  4QQE A;  4NAA A;  1JMZ B;  2Z2N A;  2I0R A;  5GXI A;  4QL1 A;  3EI4 B;  3NIF A;  4XEI C;  4FAN D;  2VDR A;  3PE7 A;  3N0E A;  1VZ3 A;  4GGA A;  3K27 A;  1N6F A;  1JV2 A;  2PBI B;  2OIZ A;  2H6N A;  4PBY A;  1E8N A;  4FA9 D;  2QR5 A;  2P9P C;  5AJA A;  3IUL A;  4BH6 A;  2XZG A;  3I7O A;  2AH1 A;  1MG2 A;  2H6K A;  2QC5 A;  4GGC A;  2P9U C;  4WK2 A;  2J56 H;  3V5W B;  3V9F A;  3UKU C;  3DM0 A;  3MUN A;  3ORV D;  2P9L C;  2AGW A;  4FB1 D;  2OVR B;  3MZL A;  1L5G A;  3GC3 B;  4G1M A;  3BG1 A;  3MKQ A;  2HES X;  5CXC B;  2IUP A;  4A7J A;  4A2M A;  3OW8 A;  4JXM A;  5KDO B;  3IIY A;  2HU8 A;  4NSX A;  3AL8 A;  1N6D A;  1C9I A;  1TYQ C;  2XU7 A;  1QNI A;  1VYH C;  2P9K C;  4ZOV A;  3OKT A;  4J8G A;  2B5N A;  3F3P A;  4A0A B;  3P4F A;  3K26 A;  4QAM A;  4N14 A;  3PXT D;  3PSC B;  3HFQ A;  3I7H A;  3RN0 D;  5HE2 B;  4BUJ C;  3JRO A;  4A0B B;  5H1M A;  4CI3 A;  2VZ1 A;  3RSE C;  1MG3 A;  5HE1 B;  1R5M A;  1JMX B;  4L9O A;  3L4M D;  2CE9 A;  3O4G A;  4FA5 D;  3IUJ A;  5IGQ A;  1GOG A;  1B9Y A;  3VI4 A;  3EI1 A;  3EWE A;  3DXM C;  2IUR A;  2H3X A;  2UZX B;  2YNP A;  3DSM A;  4D0K A;  5M61 A;  5TEE A;  1C9L A;  3O4I A;  5CXC A;  4AMZ A;  3IJ1 A;  3OKY B;  4H5I A;  4J0W A;  2H9N A;  3MMY A;  4ERY A;  1UOO A;  4R7A B;  3IIW A;  3I7L A;  4RE5 A;  5HYN B;  4MMZ A;  1NEX B;  1RI6 A;  3I8E A;  5TF2 A;  4GMB A;  4A0A A;  3FGB A;  3NID A;  4I79 A;  4H5J A;  2VC2 A;  5AFU 3;  1TBG A;  2AGY A;  2XDW A;  4JT6 C;  4TZ4 A;  5CXB B;  3GD1 I;  1XIP A;  2OK4 A;  3AH8 B;  3ODT A;  4U1E I;  4J8B A;  5EML B;  2OJY A;  3RFG A;  4PC0 A;  2I0S A;  4A0B A;  3UVM A;  2H9P A;  2IWK A;  3T3M A;  4CY1 A;  5A2Q g;  3IJE A;  4FA4 D;  2H6Q A;  5EAR A;  2Z2P A;  2YB8 B;  4LGN A;  4ESG A;  1PGU A;  4ZOX A;  4AX4 A;  3ZDY A;  3GRE A;  4KFM B;  2P9N C;  4XYH A;  4CZX A;  5FXY A;  4IMM A;  2AGX A;  1N6E A;  2HKR A;  5HE0 B;  5THA A;  3EG6 A;  4GQ1 A;  3EMH A;  3OKY A;  1H2X A;  1OLZ A;  4CZV A;  3IJ0 A;  4L3G D;  3PVW B;  3V4P A;  5E6R A;  3C99 A;  5FKT A;  3MXX A;  1S4U X;  1SQ9 A;  2QZP A;  5EM2 B;  1U2V C;  3JZH A;  3ZDZ A;  3OF7 A;  2OVQ B;  1JTD B;  2EIC A;  5IJ7 E;  2CN3 A;  4A11 B;  2H9M A;  4O3U B;  2HYE A;  5M5U A;  3I89 A;  2CE8 A;  3JZN A;  4J73 A;  5GMK n;  3JAM g;  2XL3 A;  3BWS A;  5EAM A;  4BCB A;  3J81 g;  5FKR A;  2I0T A;  2J55 H;  4HDJ A;  3NVX A;  5HDB A;  2XL2 A;  2PM9 B;  1P22 A;  3I2N A;  2VDQ A;  1VZ2 A;  4JSN C;  2IWF A;  3KCI A;  4PSX B;  3ZE0 A;  3CFS B;  4O2W A;  1UOP A;  5C86 A;  4J77 A;  5I5J A;  2VDM A;  4J86 A;  1GOH A;  4JT5 C;  4E54 B;  3SWS D;  3VGZ A;  4OZU A;  4JHP C;  1GP2 B;  3V4V A;  1VE6 A;  2PM7 B;  4X60 B;  3EI4 A;  4J81 A;  3F3G A;  1I2M B;  3C75 H;  5FKS A;  4A08 B;  3RMZ D;  3IUQ A;  2CO0 C;  2HJB A;  2HU7 A;  3SFZ A;  4CZY A;  5I5M A;  2EIE A;  3QI0 A;  1JOF A;  2VZ3 A;  3SXT D;  3J80 g;  1GOT B;  3O4H A;  1E8M A;  3JZG A;  3EQ8 A;  2PM9 A;  2YBA A;  3DWL C;  3JPX A;  5TEF A;  5C2W B;  4L1M A;  2BKL A;  3RRM C;  3SBQ A;  1GXR A;  2CNX A;  3FCU A;  4D6V A;  5C2V B;  4CY3 A;  3KRX B;  4J79 A;  4O1Q D;  5GXH A;  1A0R B;  4GM8 A;  4GGD A;  3SCY A;  1BPO A;  4CI2 A;  4DNV A;  3F3F A;  3IVM A;  3I7P A;  5HE3 B;  3C5M A;  4E5Z B;  2HXC A;  4BCC A;  1PBY B;  2B4E A;  3EI3 B;  3ZWL B;  1H2W A;  3DXK C;  5IGO A;  2IUQ A;  2JKX A;  4G1E A;  4A09 B;  3C9C A;  4CY5 A;  4FA1 D;  3UVK A;  4MMY A;  2G99 A;  5FFG A;  4UM9 A;  1QFS A;  1O6F A;  2B5L A;  3RN1 D;  2W18 A;  4UM8 A;  4ZN4 A;  3JB9 L;  1Q47 A;  4OWR A;  4WK4 A;  4ZOZ A;  4CY2 A;  5B4W A;  5JWZ A;  4Z8L A;  4GZ8 A;  2AGZ A;  4IRZ A;  4JHN A;  4J78 A;  2OVP B;  4X63 B;  5E6U A;  5EAP A;  1XKS A;  3E0C A;  4EWR A;  3VH0 A;  5IJ8 E;  3RLM D;  4AOW A;  1JJU B;  3SBR A;  5FLX g;  3IUM A;  1B9X A;  3UVO A;  3ZE1 A;  5AMS A;  4E5Z A;  4GQ2 P;  3UVL A;  4G55 A;  3EI3 A;  4D9S A;  3ZE2 A;  1H2Y A;  3W15 A;  1OMW B;  4L3H D;  1XHM A;  3A0F A;  2WQ8 A;  3OTT A;  1A12 A;  4O02 A;  4CC9 A;  2AGL A;  1H2Z A;  3IJC A;  4QT8 A;  3OL2 B;  2HKM A;  1K3I A;  2XYI A;  4QRJ A;  5CXB A;  5EMJ B;  4UI9 R;  2H47 A;  2EIB A;  2P9I C;  2P9S C;  4YVD A;  4DNU A;  1YFQ A;  4JSP C;  2IUV A;  2I3S A;  3FCS A;  4ZOY A;  3KRW B;  3CFV A;  2QXV A;  4BP8 A;  3EQ7 A;  2H68 A;  2VDN A;  4U7A A;  4ERZ A;  1YR2 A;  2H13 A;  2HU5 A;  3MUO A;  5E6S A;  3AL8 B;  2BCJ B;  2MTA H;  3OKW A;  1GOF A;  2B5M A;  4J82 A;  4K3I D;  1O6G A;  2OK6 A;  3AFC A;  1ERJ A;  3IUR A;  1VE7 A;  5CYK B;  4G56 B;  1NR0 A;  5M5S A;  3PXW D;  4FWW A;  5C9Z B;  3EI2 B;  1SQJ A;  3U4Y A;  3VA6 A;  3NVN A;  4LG8 A;  5H17 A;  1SHY B;  3GFC A;  3SBP A;  5EM2 A;  4MK0 B;  4Y5R D;  4ERQ A;  5C92 A;  1UTC A;  3QHY B;  4DNW A;  3K72 A;  2UZY B;  4BCD A;  3SVW D;  3SN6 B;  4A11 A;  2IAA A;  3OL2 A;  1E5T A;  4ES0 A;  2EBS A;  3UR4 A;  3VI3 A;  3EI1 B;  2CN2 A;  3I8C A;  5M5V A;  4LG9 A;  1GG2 B;  4Z7Q A;  3MVD K;  4Z7N A;  4FHL A;  3T3P A;  3FM0 A;  4PBZ A;  4AN0 A;  1U8C A;  5I5I A;  2TRC B;  3NIG A;  2YNO A;  5FFO A;  3DDU A;  1K32 A;  1QFM A;  4PNK B;  5SXM A;  3SJL D;  3SHF A;  4X61 B;  4AN1 A;  2YMU A;  2AQ5 A;  4K3J B;  5HQG A;  5EAL A;  4NBM A;  1M1X A;  2H9L A;  4J87 A;  4WK0 A;  5FQD A;  5IT9 g;  1L0Q A;  3PVU B;  3K71 A;  5FKQ A;  5CYK A;  5K19 A;  1U4C A;  5K1C C;  3NVQ A;  3MZK A;  4E54 A;  1PEV A;  3I7N A;  4CI8 A;  3N0D A;  3RFH A;  3EI2 A;  2GNQ A;  1T2X A;  3PXS D;  4NEN A;  2O9K A;  3B7F A;  3ZDX A;  4AMY A;  4O9D A;  4JD2 C;  4PXW A;  2I3T A;  3FRX A;  4Y7R A;  4A08 A;  3EU7 A;  5GSA A;  4RE6 A;  5IC7 A;  4J84 A;  2VDL A;  3UVN A;  4GM9 A;  5FA5 B;  2G9A A;  2GC4 A;  2VDP A;  2VDK A;  2CO0 A;  3K6S A;  5M5R A;  2YNN A;  2VDO A;  4JSV C;  2PM6 B;  4AEZ A;  3MKS B;  3EQ9 A;  3JRP A;  2Q7Q A;  4O3T B;  4X3E A;  4J0X A;  4NC4 A;  2BBK H;  3L4O D;  4BL0 A;  3AL9 A;  4L1Q D;  4CI1 A;  5M5T A; 
#chains in the Genus database with same CATH homology
 4JSX C;  2AH0 A;  2HJ4 A;  4A2L A;  4FAV D;  3I7K A;  2Z2O A;  5EMM B;  5EMK B;  3SMR A;  4O45 A;  4A09 A;  2J57 G;  3IKO A;  3UKR C;  3SLE D;  1FWX A;  1K8K C;  5H14 A;  2H14 A;  1PI6 A;  3CIK B;  4GQB B;  4IA9 A;  3PSL A;  3BG0 A;  2GC7 A;  3ULE C;  1MDA H;  4XYI A;  4PSW B;  4GM3 A;  3V7D B;  5TDH B;  4QQE A;  1JMZ B;  2Z2N A;  2I0R A;  5GXI A;  4QL1 A;  3EI4 B;  4XEI C;  4FAN D;  3PE7 A;  3N0E A;  4GGA A;  3K27 A;  1N6F A;  2PBI B;  2OIZ A;  2H6N A;  4PBY A;  4FA9 D;  2P9P C;  5AJA A;  4BH6 A;  3I7O A;  2AH1 A;  1MG2 A;  2H6K A;  2QC5 A;  4GGC A;  2P9U C;  2J56 H;  3V5W B;  3V9F A;  3UKU C;  3DM0 A;  3ORV D;  2P9L C;  2AGW A;  4FB1 D;  2OVR B;  3MZL A;  3BG1 A;  3MKQ A;  2HES X;  5CXC B;  2IUP A;  4A7J A;  4A2M A;  3OW8 A;  4JXM A;  5KDO B;  3IIY A;  4NSX A;  3AL8 A;  1N6D A;  1TYQ C;  2XU7 A;  1QNI A;  1VYH C;  2P9K C;  4ZOV A;  3OKT A;  4J8G A;  2B5N A;  3F3P A;  4A0A B;  3P4F A;  3K26 A;  4N14 A;  3PXT D;  3PSC B;  3HFQ A;  3I7H A;  3RN0 D;  5HE2 B;  4BUJ C;  3JRO A;  4A0B B;  5H1M A;  4CI3 A;  3RSE C;  1MG3 A;  5HE1 B;  1R5M A;  4L9O A;  1JMX B;  3L4M D;  2CE9 A;  4FA5 D;  5IGQ A;  1B9Y A;  3EI1 A;  3EWE A;  3DXM C;  2IUR A;  2H3X A;  2UZX B;  2YNP A;  3DSM A;  4D0K A;  5TEE A;  5CXC A;  3IJ1 A;  3OKY B;  4H5I A;  4J0W A;  2H9N A;  3MMY A;  4ERY A;  4R7A B;  3IIW A;  3I7L A;  5HYN B;  1NEX B;  1RI6 A;  3I8E A;  5TF2 A;  4GMB A;  4A0A A;  3FGB A;  4I79 A;  4H5J A;  5AFU 3;  1TBG A;  2AGY A;  4JT6 C;  4TZ4 A;  5CXB B;  4U1E I;  1XIP A;  2OK4 A;  3AH8 B;  3ODT A;  4J8B A;  5EML B;  2OJY A;  3RFG A;  4PC0 A;  2I0S A;  4A0B A;  3UVM A;  2H9P A;  2IWK A;  4CY1 A;  5A2Q g;  4FA4 D;  2H6Q A;  5EAR A;  2Z2P A;  2YB8 B;  4LGN A;  4ESG A;  1PGU A;  4ZOX A;  3GRE A;  4KFM B;  2P9N C;  4XYH A;  4CZX A;  5FXY A;  4IMM A;  2AGX A;  1N6E A;  2HKR A;  5HE0 B;  5THA A;  3EG6 A;  4GQ1 A;  3EMH A;  3OKY A;  1OLZ A;  4CZV A;  3IJ0 A;  4L3G D;  3PVW B;  3C99 A;  5FKT A;  3MXX A;  1S4U X;  1SQ9 A;  5EM2 B;  1U2V C;  3JZH A;  2OVQ B;  5IJ7 E;  2CN3 A;  4A11 B;  2H9M A;  4O3U B;  2HYE A;  3I89 A;  2CE8 A;  3JZN A;  4J73 A;  5GMK n;  3JAM g;  2XL3 A;  3BWS A;  5EAM A;  3J81 g;  5FKR A;  2I0T A;  2J55 H;  4HDJ A;  3NVX A;  2XL2 A;  2PM9 B;  1P22 A;  3I2N A;  4JSN C;  2IWF A;  4PSX B;  3CFS B;  4J77 A;  5I5J A;  4J86 A;  4JT5 C;  4E54 B;  3SWS D;  3VGZ A;  4OZU A;  1GP2 B;  2PM7 B;  4X60 B;  3EI4 A;  4J81 A;  3F3G A;  3C75 H;  5FKS A;  4A08 B;  3RMZ D;  2CO0 C;  2HJB A;  3SFZ A;  4CZY A;  5I5M A;  1JOF A;  3SXT D;  3J80 g;  1GOT B;  3JZG A;  2PM9 A;  2YBA A;  3DWL C;  3JPX A;  5TEF A;  5C2W B;  3RRM C;  3SBQ A;  1GXR A;  2CNX A;  4D6V A;  5C2V B;  4CY3 A;  3KRX B;  4J79 A;  4O1Q D;  5GXH A;  1A0R B;  4GM8 A;  4GGD A;  3SCY A;  4CI2 A;  3F3F A;  3I7P A;  5HE3 B;  3C5M A;  4E5Z B;  2HXC A;  1PBY B;  2B4E A;  3EI3 B;  3ZWL B;  5IGO A;  3DXK C;  2IUQ A;  4A09 B;  3C9C A;  4CY5 A;  4FA1 D;  3UVK A;  2G99 A;  2B5L A;  3RN1 D;  2W18 A;  4ZN4 A;  3JB9 L;  1Q47 A;  4OWR A;  4ZOZ A;  4CY2 A;  5B4W A;  5JWZ A;  4Z8L A;  4GZ8 A;  2AGZ A;  4J78 A;  2OVP B;  4X63 B;  5EAP A;  1XKS A;  3E0C A;  4EWR A;  3VH0 A;  5IJ8 E;  3RLM D;  4AOW A;  1JJU B;  3SBR A;  5FLX g;  1B9X A;  3UVO A;  4E5Z A;  5AMS A;  4GQ2 P;  3UVL A;  3EI3 A;  3W15 A;  1OMW B;  4L3H D;  1XHM A;  3A0F A;  3OTT A;  4CC9 A;  2AGL A;  3IJC A;  4QT8 A;  3OL2 B;  2HKM A;  2XYI A;  4QRJ A;  5CXB A;  5EMJ B;  4UI9 R;  2H47 A;  2P9I C;  2P9S C;  4YVD A;  1YFQ A;  4JSP C;  2IUV A;  2I3S A;  4ZOY A;  3KRW B;  3CFV A;  2QXV A;  2H68 A;  4ERZ A;  4U7A A;  2H13 A;  3AL8 B;  2BCJ B;  2MTA H;  3OKW A;  2B5M A;  4J82 A;  4K3I D;  2OK6 A;  3AFC A;  1ERJ A;  5CYK B;  4G56 B;  1NR0 A;  3PXW D;  4FWW A;  5C9Z B;  3EI2 B;  1SQJ A;  3U4Y A;  3VA6 A;  3NVN A;  4LG8 A;  5H17 A;  1SHY B;  3GFC A;  3SBP A;  5EM2 A;  4MK0 B;  4Y5R D;  4ERQ A;  2UZY B;  3SVW D;  3SN6 B;  4A11 A;  2IAA A;  3OL2 A;  4ES0 A;  2EBS A;  3UR4 A;  3EI1 B;  2CN2 A;  3I8C A;  4LG9 A;  1GG2 B;  4FHL A;  3FM0 A;  4PBZ A;  5I5I A;  2TRC B;  2YNO A;  1K32 A;  4PNK B;  5SXM A;  3SJL D;  3SHF A;  4X61 B;  2YMU A;  2AQ5 A;  4K3J B;  5HQG A;  5EAL A;  2H9L A;  4J87 A;  5FQD A;  5IT9 g;  1L0Q A;  3PVU B;  5FKQ A;  5CYK A;  5K19 A;  1U4C A;  5K1C C;  3NVQ A;  3MZK A;  4E54 A;  1PEV A;  3I7N A;  4CI8 A;  3N0D A;  3RFH A;  3EI2 A;  2GNQ A;  3PXS D;  2O9K A;  3B7F A;  4O9D A;  4JD2 C;  4PXW A;  2I3T A;  3FRX A;  4Y7R A;  4A08 A;  3EU7 A;  5GSA A;  5IC7 A;  4J84 A;  3UVN A;  4GM9 A;  5FA5 B;  2G9A A;  2GC4 A;  2CO0 A;  2YNN A;  4JSV C;  2PM6 B;  4AEZ A;  3MKS B;  3JRP A;  2Q7Q A;  4O3T B;  4X3E A;  4J0X A;  2BBK H;  3L4O D;  4BL0 A;  3AL9 A;  4L1Q D;  4CI1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...