2XL3A

Wdr5 in complex with an rbbp5 peptide and histone h3 peptide
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
303
structure length
303
Chain Sequence
KPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Characterisation of a Novel Wdr5 Binding Site that Recruits Rbbp5 Through a Conserved Motif and Enhances Methylation of H3K4 by Mll1.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
molecule keywords WD REPEAT-CONTAINING PROTEIN 5
total genus 94
structure length 303
sequence length 303
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2xl3A00
2YBAA 5EAMA 2H9MA 3I7PA 5IT9g 2AQ5A 2Q7QA 4OWRA 3MXXA 5EM2A 3IJCA 4A2MA 3DXKC 5HE3B 5EMMB 3F3PA 3RFHA 4A09A 5IGOA 4J81A 4L3HD 3CIKB 3OKYB 3PVUB 4CY2A 4CI8A 4CI2A 2AGYA 4XEIC 3VA6A 4A11B 5GSAA 5FKRA 3JROA 4QRJA 2OVQB 3UVOA 1L0QA 3P4FA 4E54A 4CZYA 3DM0A 3EI3A 4GMBA 4E5ZA 3BG0A 3CFSB 1XKSA 4JT6C 2HJBA 5CXCA 2BCJB 4HDJA 3RMZD 4Z8LA 5C2VB 4D6VA 1XIPA 3I7KA 2HXCA 3RRMC 2G9AA 3SJLD 3OL2B 3JB9L 4Y5RD 4R7AB 5C9ZB 3PSCB 3EI1A 2P9SC 3EI2A 1P22A 3C9CA 5EMLB 5TF2A 1OLZA 3BG1A 4PSXB 2MTAH 1VYHC 4J84A 4PXWA 2I3SA 3B7FA 3PXTD 4UI9R 5FQDA 4CI1A 4FA4D 2H9NA 5EARA 5HYNB 2H3XA 3EI4A 3A0FA 1NEXB 4ESGA 2OJYA 3K27A 2H9LA 5GMKn 3EG6A 4J0WA 3MZKA 4O3TB 2PM7B 4FHLA 4ERYA 4E5ZB 3EU7A 3DWLC 1N6DA 2XL2A 2CE9A 2IURA 4JXMA 3NVQA 4J78A 1JOFA 4A11A 1B9XA 3N0EA 3SMRA 3PE7A 2H9PA 4Y7RA 4A08B 2IUVA 4OZUA 3SBQA 4LGNA 2AGZA 4A09B 1N6FA 3MMYA 4J0XA 2H13A 2H14A 2P9NC 3KRXB 3JRPA 4X3EA 4N14A 4FA9D 5GXIA 3ZWLB 4A0BB 2GC4A 2J55H 4GM9A 3CFVA 2H6NA 5AFU3 5JWZA 1Q47A 3SBPA 2EBSA 3HFQA 4CC9A 5FA5B 2CO0C 3FM0A 5CYKB 5EM2B 4PBZA 2W18A 5SXMA 4CZXA 3ULEC 2AGXA 3ORVD 4E54B 2AH1A 4K3JB 1SQ9A 1GP2B 2BBKH 4GGCA 4QL1A 2YNPA 2P9LC 4A7JA 4FAND 3V5WB 1RI6A 3NVNA 4PSWB 2H6KA 4CY3A 4JSXC 3I89A 3JPXA 3IIWA 2HESX 3PXWD 3EI3B 2B5MA 3AL9A 4JSNC 2PM6B 5I5JA 4O1QD 5EMKB 4FWWA 2H68A 4PC0A 3SLED 4BH6A 4IMMA 4ERQA 1PBYB 3C5MA 2CN2A 1ERJA 3I7NA 4AOWA 3UVMA 4CY5A 2CO0A 4L3GD 3FGBA 3UR4A 3UVKA 3JZHA 4QQEA 5CYKA 5FLXg 4ZOXA 3UKUC 2CE8A 4FB1D 1MG2A 1YFQA 4J87A 3IJ0A 3AFCA 5C2WB 5FKSA 2I3TA 4NSXA 1K32A 2OVPB 4XYIA 2CNXA 4ZOZA 3UVLA 3I7HA 1NR0A 3AL8B 4ZOVA 3SHFA 4ES0A 5EMJB 2I0RA 4PNKB 4BL0A 2PM9A 4QT8A 5HE0B 3C75H 2B4EA 4CZVA 3FRXA 2G99A 2UZXB 4X61B 5H17A 4D0KA 1U4CA 3PVWB 1S4UX 2UZYB 4JSVC 1GOTB 1XHMA 4GM8A 2AGWA 2HYEA 4O45A 1FWXA 3E0CA 3I2NA 2B5LA 5TEFA 4XYHA 2XU7A 3JZNA 4TZ4A 5GXHA 2IWKA 2OIZA 5HE2B 2HJ4A 5H14A 2IUQA 2YB8B 3SWSD 2Z2OA 3EMHA 5FXYA 2O9KA 3ODTA 5CXBB 3L4MD 4H5IA 4A0BA 1TBGA 3PSLA 4G56B 3RN1D 5FKTA 4A0AB 5A2Qg 4JT5C 2I0SA 2TRCB 5TDHB 4AEZA 3U4YA 2OK4A 2CN3A 4JD2C 3IJ1A 5IGQA 3SVWD 3OKWA 3RLMD 4GM3A 4MK0B 5AJAA 1TYQC 5EAPA 1GG2B 3JZGA 4A08A 5IC7A 4A0AA 1SHYB 1JMZB 3L4OD 2XYIA 2AGLA 2HKMA 4O9DA 3V9FA 1PI6A 5H1MA 4EWRA 2IAAA 4O3UB 5THAA 5IJ7E 3F3GA 1SQJA 2J57G 5I5IA 4ZOYA 4J8BA 4FA1D 2I0TA 3OTTA 4LG9A 4J82A 4YVDA 3UVNA 1JMXB 3K26A 2IWFA 5IJ8E 3VH0A 4L1QD 5HE1B 3SFZA 2Z2NA 3I8CA 4U7AA 4K3ID 2HKRA 4GGAA 3SBRA 2AH0A 5CXCB 3EWEA 1B9YA 1U2VC 1MG3A 2P9UC 3GREA 1A0RB 3EI4B 2OVRB 2J56H 3N0DA 4L9OA 1PGUA 4LG8A 3MZLA 2XL3A 5TEEA 3DSMA 4JSPC 5KDOB 3BWSA 4KFMB 2P9PC 3OL2A 2GC7A 3V7DB 3SCYA 1JJUB 3OKYA 5CXBA 4GQBB 2Z2PA 5I5MA 1MDAH 4J86A 5B4WA 3EI2B 4CY1A 3EI1B 4FAVD 3NVXA 5HQGA 3I7LA 3MKSB 2YNNA 3AL8A 2IUPA 2P9KC 3GFCA 2P9IC 5K1CC 4J79A 3PXSD 3I7OA 2H47A 3W15A 3SN6B 3SXTD 3KRWB 4GGDA 4GZ8A 3AH8B 1N6EA 3DXMC 2OK6A 3OW8A 4H5JA 1QNIA 4GQ2P 4I79A 5AMSA 3JAMg 4CI3A 3VGZA 3C99A 3J80g 3RN0D 1R5MA 1PEVA 2PBIB 2YNOA 4FA5D 1K8KC 2QXVA 4ERZA 3RSEC 4U1EI 3MKQA 4ZN4A 2PM9B 4X63B 3IIYA 2YMUA 3OKTA 3UKRC 1OMWB 5EALA 2B5NA 2QC5A 4BUJC 4PBYA 2H6QA 2GNQA 4X60B 3RFGA 5K19A 4A2LA 1GXRA 3F3FA 4IA9A 4J8GA 5FKQA 3I8EA 3J81g 4J77A 4J73A 3IKOA 4GQ1A
chains in the Genus database with same CATH superfamily
2YBAA 5EAMA 3IURA 1T2XA 2H9MA 3I7PA 1JTDB 5IT9g 2AQ5A 2Q7QA 1UOOA 3FCUA 4OWRA 3MXXA 5EM2A 1UOPA 3IJCA 4A2MA 3DXKC 5HE3B 5EMMB 3F3PA 3RFHA 4A09A 5IGOA 4J81A 4L3HD 2XE4A 3CIKB 3NIFA 3OKYB 3PVUB 4CY2A 4CI8A 4CI2A 2AGYA 4XEIC 3VA6A 4A11B 5GSAA 5FKRA 1GOGA 2QZPA 1U8CA 4NBMA 4G1EA 3JROA 4QRJA 2OVQB 3UVOA 1L0QA 3P4FA 1C9LA 5M5RA 4E54A 4WK0A 4CZYA 3DM0A 3EI3A 4GMBA 4E5ZA 3BG0A 3CFSB 1XKSA 4JT6C 1UOQA 2HJBA 5CXCA 2BCJB 4Z7OA 4HDJA 3O4GA 2XDWA 3RMZD 4G55A 4Z8LA 4MMZA 5C2VB 4D6VA 3QI0A 1XIPA 3I7KA 2HXCA 3RRMC 4IRZA 2G9AA 3SJLD 3OF7A 3OL2B 3JB9L 1O6GA 4Y5RD 4R7AB 3K72A 5C9ZB 3PSCB 3EI1A 2P9SC 3EI2A 1P22A 3EQ9A 2BKLA 2VDNA 3C9CA 5EMLB 5TF2A 1OLZA 1YR2A 3BG1A 4PSXB 3IUMA 2MTAH 4Z7NA 2XZGA 3ZDZA 1VYHC 4J84A 4PXWA 2I3SA 3B7FA 3GD1I 3PXTD 4UI9R 5FQDA 4CI1A 1A12A 4FA4D 2H9NA 5EARA 5HYNB 2H3XA 3EI4A 3A0FA 4DNUA 1NEXB 4ESGA 2OJYA 3K6SA 3K27A 3QHYB 1I2MB 4L1MA 1H2WA 4AN0A 2H9LA 5C86A 5GMKn 3EG6A 4J0WA 3MZKA 4O3TB 3IUQA 2PM7B 4UM8A 4FHLA 4ERYA 4E5ZB 2VC2A 2HU7A 3EU7A 3DWLC 1N6DA 2XL2A 2CE9A 2IURA 4RE5A 2VDPA 4JXMA 3O4IA 3NVQA 4J78A 1JOFA 2VDMA 4A11A 1B9XA 3N0EA 3SMRA 3PE7A 2H9PA 4Y7RA 4A08B 2IUVA 3NIGA 4AMYA 4OZUA 2VDLA 3SBQA 4LGNA 2AGZA 4NC4A 3V4PA 4O02A 5M5SA 4A09B 1N6FA 3MMYA 4J0XA 2H13A 2H14A 1GOHA 2P9NC 3KRXB 3JRPA 4X3EA 4N14A 4FA9D 4O2WA 5GXIA 4BCBA 3ZWLB 4A0BB 2GC4A 2J55H 4GM9A 3CFVA 2H6NA 3DDUA 4WK4A 5FFOA 5AFU3 2VZ1A 5JWZA 4AN1A 1Q47A 3SBPA 2EBSA 3HFQA 4CC9A 2VDRA 2JKXA 5FA5B 2CO0C 3FM0A 3IULA 5CYKB 4BP9A 5EM2B 4PBZA 4BCCA 2W18A 5SXMA 4CZXA 1K3IA 3ULEC 2AGXA 3ZE2A 3ORVD 4E54B 2AH1A 3K71A 4K3JB 1SQ9A 1GP2B 2BBKH 4GGCA 4QL1A 2YNPA 2P9LC 4A7JA 4FAND 3V5WB 1RI6A 2EICA 3NVNA 4PSWB 2H6KA 4CY3A 4JSXC 3I89A 3JPXA 3IIWA 2HESX 3PXWD 1L5GA 3EI3B 2B5MA 3AL9A 4JSNC 2PM6B 1E5TA 5I5JA 4O1QD 5EMKB 1QFMA 1H2ZA 4FWWA 2H68A 4PC0A 3SLED 3T3MA 4BH6A 4IMMA 4ERQA 1PBYB 3C5MA 5HDBA 2CN2A 1ERJA 3I7NA 4AOWA 3UVMA 4CY5A 2CO0A 4L3GD 3FGBA 3UR4A 3UVKA 3JZHA 4QQEA 5CYKA 3V4VA 5FLXg 1BPOA 4ZOXA 3UKUC 2CE8A 4FB1D 4NAAA 1MG2A 1YFQA 4DNVA 4J87A 3IJ0A 3AFCA 5C2WB 5FKSA 2I3TA 4NSXA 1K32A 2OVPB 4XYIA 2CNXA 4MMXA 3VI4A 4ZOZA 3UVLA 1QFSA 3I7HA 1NR0A 1VE6A 3AL8B 4ZOVA 3SHFA 4ES0A 5EMJB 2I0RA 4PNKB 2EIEA 4BL0A 2PM9A 4QT8A 5HE0B 3C75H 2B4EA 2HU8A 4CZVA 3FRXA 2G99A 2UZXB 4X61B 5H17A 4BP8A 4D0KA 1TYEA 1VZ3A 1U4CA 3PVWB 1S4UX 1VZ2A 2UZYB 4JSVC 1GOTB 3ZDXA 1XHMA 4GM8A 3EQ8A 2AGWA 2HYEA 4O45A 1FWXA 3E0CA 3I2NA 2B5LA 3O4JA 5TEFA 4XYHA 2XU7A 3JZNA 4TZ4A 3VI3A 5GXHA 2IWKA 2OIZA 5HE2B 5E6UA 1M1XA 2HJ4A 5H14A 2IUQA 2YB8B 3SWSD 2Z2OA 3EMHA 5FXYA 2O9KA 4G1MA 3ODTA 3O4HA 3MUNA 1O6FA 5CXBB 3L4MD 4H5IA 4A0BA 4JHPC 4UM9A 1TBGA 3PSLA 4G56B 4NENA 3RN1D 1GOFA 5FKTA 4A0AB 3KCIA 5C92A 4JT5C 5A2Qg 2I0SA 2TRCB 5TDHB 4AEZA 3U4YA 2OK4A 2CN3A 4JD2C 3IJ1A 5IGQA 1H2XA 3SVWD 3OKWA 3RLMD 4GM3A 4MK0B 5AJAA 4AX4A 1TYQC 5EAPA 1GG2B 3JZGA 4QAMA 4A08A 5IC7A 1VE7A 4A0AA 1SHYB 1JMZB 3L4OD 2XYIA 2AGLA 2HKMA 4O9DA 3V9FA 1PI6A 5H1MA 4D9SA 2IAAA 4EWRA 4O3UB 5THAA 5IJ7E 3F3GA 1SQJA 2J57G 5I5IA 4ZOYA 4J8BA 4FA1D 2I0TA 3OTTA 4LG9A 3NIDA 4J82A 4YVDA 5FFGA 3UVNA 1JMXB 3K26A 2IWFA 5IJ8E 2VDKA 3VH0A 4L1QD 3MVDK 3ZE0A 5HE1B 3SFZA 2Z2NA 3I8CA 4U7AA 4K3ID 2HKRA 4GGAA 3SBRA 2AH0A 5CXCB 3EWEA 1B9YA 1JV2A 1U2VC 3IJEA 1MG3A 2P9UC 3GREA 1A0RB 3EI4B 2OVRB 2J56H 3N0DA 4L9OA 1PGUA 2VDQA 4LG8A 5E6RA 3MZLA 2XL3A 5TEEA 3DSMA 3ZDYA 5E6SA 4JSPC 5KDOB 3ZE1A 3BWSA 2WQ8A 4KFMB 2P9PC 3OL2A 3IUNA 2GC7A 3V7DB 3SCYA 1JJUB 2QR5A 3OKYA 5CXBA 3T3PA 4GQBB 2Z2PA 5I5MA 1MDAH 4J86A 5B4WA 3EI2B 4CY1A 3EI1B 4BCDA 4FAVD 3NVXA 5M5TA 5HQGA 3GC3B 3I7LA 3MKSB 2VZ3A 2YNNA 3AL8A 2IUPA 2P9KC 3GFCA 2P9IC 5K1CC 4WK2A 5M61A 4J79A 3PXSD 3IVMA 3I7OA 2H47A 3W15A 3SN6B 3SXTD 3KRWB 4GGDA 4GZ8A 1H2YA 4Z7QA 3AH8B 1N6EA 3DXMC 2OK6A 3OW8A 4H5JA 1QNIA 4GQ2P 4I79A 5AMSA 3JAMg 4CI3A 3VGZA 3C99A 3J80g 3RN0D 1R5MA 1PEVA 2PBIB 2VDOA 3FCSA 2YNOA 4FA5D 1K8KC 2QXVA 4ERZA 3RSEC 4U1EI 3MKQA 4ZN4A 2PM9B 4X63B 5M5VA 3IIYA 2YMUA 3OKTA 4DNWA 3UKRC 1OMWB 5EALA 4AMZA 2EIDA 4RE6A 5M5UA 2B5NA 1UTCA 2QC5A 1E8NA 3MUOA 4BUJC 4PBYA 2H6QA 2GNQA 4X60B 3RFGA 1E8MA 5K19A 4WJKA 4A2LA 1GXRA 3F3FA 4IA9A 3IUJA 4J8GA 4MMYA 1C9IA 2HU5A 3I8EA 5FKQA 3J81g 4J77A 3EQ7A 4JHNA 4J73A 2EIBA 3IKOA 4GQ1A
chains in the Genus database with same CATH topology
2YBAA 5EAMA 2H9MA 3I7PA 5IT9g 2AQ5A 2Q7QA 4OWRA 3MXXA 5EM2A 3IJCA 4A2MA 3DXKC 5HE3B 5EMMB 3F3PA 3RFHA 4A09A 5IGOA 4J81A 4L3HD 3CIKB 3OKYB 3PVUB 4CY2A 4CI8A 4CI2A 2AGYA 4XEIC 3VA6A 4A11B 5GSAA 5FKRA 3JROA 4QRJA 2OVQB 3UVOA 1L0QA 3P4FA 4E54A 4CZYA 3DM0A 3EI3A 4GMBA 4E5ZA 3BG0A 3CFSB 1XKSA 4JT6C 2HJBA 5CXCA 2BCJB 4HDJA 3RMZD 4Z8LA 5C2VB 4D6VA 1XIPA 3I7KA 2HXCA 3RRMC 2G9AA 3SJLD 3OL2B 3JB9L 4Y5RD 4R7AB 5C9ZB 3PSCB 3EI1A 2P9SC 3EI2A 1P22A 3C9CA 5EMLB 5TF2A 1OLZA 3BG1A 4PSXB 2MTAH 1VYHC 4J84A 4PXWA 2I3SA 3B7FA 3PXTD 4UI9R 5FQDA 4CI1A 4FA4D 2H9NA 5EARA 5HYNB 2H3XA 3EI4A 3A0FA 1NEXB 4ESGA 2OJYA 3K27A 2H9LA 5GMKn 3EG6A 4J0WA 3MZKA 4O3TB 2PM7B 4FHLA 4ERYA 4E5ZB 3EU7A 3DWLC 1N6DA 2XL2A 2CE9A 2IURA 4JXMA 3NVQA 4J78A 1JOFA 4A11A 1B9XA 3N0EA 3SMRA 3PE7A 2H9PA 4Y7RA 4A08B 2IUVA 4OZUA 3SBQA 4LGNA 2AGZA 4A09B 1N6FA 3MMYA 4J0XA 2H13A 2H14A 2P9NC 3KRXB 3JRPA 4X3EA 4N14A 4FA9D 5GXIA 3ZWLB 4A0BB 2GC4A 2J55H 4GM9A 3CFVA 2H6NA 5AFU3 5JWZA 1Q47A 3SBPA 2EBSA 3HFQA 4CC9A 5FA5B 2CO0C 3FM0A 5CYKB 5EM2B 4PBZA 2W18A 5SXMA 4CZXA 3ULEC 2AGXA 3ORVD 4E54B 2AH1A 4K3JB 1SQ9A 1GP2B 2BBKH 4GGCA 4QL1A 2YNPA 2P9LC 4A7JA 4FAND 3V5WB 1RI6A 3NVNA 4PSWB 2H6KA 4CY3A 4JSXC 3I89A 3JPXA 3IIWA 2HESX 3PXWD 3EI3B 2B5MA 3AL9A 4JSNC 2PM6B 5I5JA 4O1QD 5EMKB 4FWWA 2H68A 4PC0A 3SLED 4BH6A 4IMMA 4ERQA 1PBYB 3C5MA 2CN2A 1ERJA 3I7NA 4AOWA 3UVMA 4CY5A 2CO0A 4L3GD 3FGBA 3UR4A 3UVKA 3JZHA 4QQEA 5CYKA 5FLXg 4ZOXA 3UKUC 2CE8A 4FB1D 1MG2A 1YFQA 4J87A 3IJ0A 3AFCA 5C2WB 5FKSA 2I3TA 4NSXA 1K32A 2OVPB 4XYIA 2CNXA 4ZOZA 3UVLA 3I7HA 1NR0A 3AL8B 4ZOVA 3SHFA 4ES0A 5EMJB 2I0RA 4PNKB 4BL0A 2PM9A 4QT8A 5HE0B 3C75H 2B4EA 4CZVA 3FRXA 2G99A 2UZXB 4X61B 5H17A 4D0KA 1U4CA 3PVWB 1S4UX 2UZYB 4JSVC 1GOTB 1XHMA 4GM8A 2AGWA 2HYEA 4O45A 1FWXA 3E0CA 3I2NA 2B5LA 5TEFA 4XYHA 2XU7A 3JZNA 4TZ4A 5GXHA 2IWKA 2OIZA 5HE2B 2HJ4A 5H14A 2IUQA 2YB8B 3SWSD 2Z2OA 3EMHA 5FXYA 2O9KA 3ODTA 5CXBB 3L4MD 4H5IA 4A0BA 1TBGA 3PSLA 4G56B 3RN1D 5FKTA 4A0AB 5A2Qg 4JT5C 2I0SA 2TRCB 5TDHB 4AEZA 3U4YA 2OK4A 2CN3A 4JD2C 3IJ1A 5IGQA 3SVWD 3OKWA 3RLMD 4GM3A 4MK0B 5AJAA 1TYQC 5EAPA 1GG2B 3JZGA 4A08A 5IC7A 4A0AA 1SHYB 1JMZB 3L4OD 2XYIA 2AGLA 2HKMA 4O9DA 3V9FA 1PI6A 5H1MA 4EWRA 2IAAA 4O3UB 5THAA 5IJ7E 3F3GA 1SQJA 2J57G 5I5IA 4ZOYA 4J8BA 4FA1D 2I0TA 3OTTA 4LG9A 4J82A 4YVDA 3UVNA 1JMXB 3K26A 2IWFA 5IJ8E 3VH0A 4L1QD 5HE1B 3SFZA 2Z2NA 3I8CA 4U7AA 4K3ID 2HKRA 4GGAA 3SBRA 2AH0A 5CXCB 3EWEA 1B9YA 1U2VC 1MG3A 2P9UC 3GREA 1A0RB 3EI4B 2OVRB 2J56H 3N0DA 4L9OA 1PGUA 4LG8A 3MZLA 2XL3A 5TEEA 3DSMA 4JSPC 5KDOB 3BWSA 4KFMB 2P9PC 3OL2A 2GC7A 3V7DB 3SCYA 1JJUB 3OKYA 5CXBA 4GQBB 2Z2PA 5I5MA 1MDAH 4J86A 5B4WA 3EI2B 4CY1A 3EI1B 4FAVD 3NVXA 5HQGA 3I7LA 3MKSB 2YNNA 3AL8A 2IUPA 2P9KC 3GFCA 2P9IC 5K1CC 4J79A 3PXSD 3I7OA 2H47A 3W15A 3SN6B 3SXTD 3KRWB 4GGDA 4GZ8A 3AH8B 1N6EA 3DXMC 2OK6A 3OW8A 4H5JA 1QNIA 4GQ2P 4I79A 5AMSA 3JAMg 4CI3A 3VGZA 3C99A 3J80g 3RN0D 1R5MA 1PEVA 2PBIB 2YNOA 4FA5D 1K8KC 2QXVA 4ERZA 3RSEC 4U1EI 3MKQA 4ZN4A 2PM9B 4X63B 3IIYA 2YMUA 3OKTA 3UKRC 1OMWB 5EALA 2B5NA 2QC5A 4BUJC 4PBYA 2H6QA 2GNQA 4X60B 3RFGA 5K19A 4A2LA 1GXRA 3F3FA 4IA9A 4J8GA 5FKQA 3I8EA 3J81g 4J77A 4J73A 3IKOA 4GQ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YBA A;  5EAM A;  2H9M A;  3I7P A;  5IT9 g;  2AQ5 A;  2Q7Q A;  4OWR A;  3MXX A;  5EM2 A;  3IJC A;  4A2M A;  3DXK C;  5HE3 B;  5EMM B;  3F3P A;  3RFH A;  4A09 A;  5IGO A;  4J81 A;  4L3H D;  3CIK B;  3OKY B;  3PVU B;  4CY2 A;  4CI8 A;  4CI2 A;  2AGY A;  4XEI C;  3VA6 A;  4A11 B;  5GSA A;  5FKR A;  3JRO A;  4QRJ A;  2OVQ B;  3UVO A;  1L0Q A;  3P4F A;  4E54 A;  4CZY A;  3DM0 A;  3EI3 A;  4GMB A;  4E5Z A;  3BG0 A;  3CFS B;  1XKS A;  4JT6 C;  2HJB A;  5CXC A;  2BCJ B;  4HDJ A;  3RMZ D;  4Z8L A;  5C2V B;  4D6V A;  1XIP A;  3I7K A;  2HXC A;  3RRM C;  2G9A A;  3SJL D;  3OL2 B;  3JB9 L;  4Y5R D;  4R7A B;  5C9Z B;  3PSC B;  3EI1 A;  2P9S C;  3EI2 A;  1P22 A;  3C9C A;  5EML B;  5TF2 A;  1OLZ A;  3BG1 A;  4PSX B;  2MTA H;  1VYH C;  4J84 A;  4PXW A;  2I3S A;  3B7F A;  3PXT D;  4UI9 R;  5FQD A;  4CI1 A;  4FA4 D;  2H9N A;  5EAR A;  5HYN B;  2H3X A;  3EI4 A;  3A0F A;  1NEX B;  4ESG A;  2OJY A;  3K27 A;  2H9L A;  5GMK n;  3EG6 A;  4J0W A;  3MZK A;  4O3T B;  2PM7 B;  4FHL A;  4ERY A;  4E5Z B;  3EU7 A;  3DWL C;  1N6D A;  2XL2 A;  2CE9 A;  2IUR A;  4JXM A;  3NVQ A;  4J78 A;  1JOF A;  4A11 A;  1B9X A;  3N0E A;  3SMR A;  3PE7 A;  2H9P A;  4Y7R A;  4A08 B;  2IUV A;  4OZU A;  3SBQ A;  4LGN A;  2AGZ A;  4A09 B;  1N6F A;  3MMY A;  4J0X A;  2H13 A;  2H14 A;  2P9N C;  3KRX B;  3JRP A;  4X3E A;  4N14 A;  4FA9 D;  5GXI A;  3ZWL B;  4A0B B;  2GC4 A;  2J55 H;  4GM9 A;  3CFV A;  2H6N A;  5AFU 3;  5JWZ A;  1Q47 A;  3SBP A;  2EBS A;  3HFQ A;  4CC9 A;  5FA5 B;  2CO0 C;  3FM0 A;  5CYK B;  5EM2 B;  4PBZ A;  2W18 A;  5SXM A;  4CZX A;  3ULE C;  2AGX A;  3ORV D;  4E54 B;  2AH1 A;  4K3J B;  1SQ9 A;  1GP2 B;  2BBK H;  4GGC A;  4QL1 A;  2YNP A;  2P9L C;  4A7J A;  4FAN D;  3V5W B;  1RI6 A;  3NVN A;  4PSW B;  2H6K A;  4CY3 A;  4JSX C;  3I89 A;  3JPX A;  3IIW A;  2HES X;  3PXW D;  3EI3 B;  2B5M A;  3AL9 A;  4JSN C;  2PM6 B;  5I5J A;  4O1Q D;  5EMK B;  4FWW A;  2H68 A;  4PC0 A;  3SLE D;  4BH6 A;  4IMM A;  4ERQ A;  1PBY B;  3C5M A;  2CN2 A;  1ERJ A;  3I7N A;  4AOW A;  3UVM A;  4CY5 A;  2CO0 A;  4L3G D;  3FGB A;  3UR4 A;  3UVK A;  3JZH A;  4QQE A;  5CYK A;  5FLX g;  4ZOX A;  3UKU C;  2CE8 A;  4FB1 D;  1MG2 A;  1YFQ A;  4J87 A;  3IJ0 A;  3AFC A;  5C2W B;  5FKS A;  2I3T A;  4NSX A;  1K32 A;  2OVP B;  4XYI A;  2CNX A;  4ZOZ A;  3UVL A;  3I7H A;  1NR0 A;  3AL8 B;  4ZOV A;  3SHF A;  4ES0 A;  5EMJ B;  2I0R A;  4PNK B;  4BL0 A;  2PM9 A;  4QT8 A;  5HE0 B;  3C75 H;  2B4E A;  4CZV A;  3FRX A;  2G99 A;  2UZX B;  4X61 B;  5H17 A;  4D0K A;  1U4C A;  3PVW B;  1S4U X;  2UZY B;  4JSV C;  1GOT B;  1XHM A;  4GM8 A;  2AGW A;  2HYE A;  4O45 A;  1FWX A;  3E0C A;  3I2N A;  2B5L A;  5TEF A;  4XYH A;  2XU7 A;  3JZN A;  4TZ4 A;  5GXH A;  2IWK A;  2OIZ A;  5HE2 B;  2HJ4 A;  5H14 A;  2IUQ A;  2YB8 B;  3SWS D;  2Z2O A;  3EMH A;  5FXY A;  2O9K A;  3ODT A;  5CXB B;  3L4M D;  4H5I A;  4A0B A;  1TBG A;  3PSL A;  4G56 B;  3RN1 D;  5FKT A;  4A0A B;  5A2Q g;  4JT5 C;  2I0S A;  2TRC B;  5TDH B;  4AEZ A;  3U4Y A;  2OK4 A;  2CN3 A;  4JD2 C;  3IJ1 A;  5IGQ A;  3SVW D;  3OKW A;  3RLM D;  4GM3 A;  4MK0 B;  5AJA A;  1TYQ C;  5EAP A;  1GG2 B;  3JZG A;  4A08 A;  5IC7 A;  4A0A A;  1SHY B;  1JMZ B;  3L4O D;  2XYI A;  2AGL A;  2HKM A;  4O9D A;  3V9F A;  1PI6 A;  5H1M A;  4EWR A;  2IAA A;  4O3U B;  5THA A;  5IJ7 E;  3F3G A;  1SQJ A;  2J57 G;  5I5I A;  4ZOY A;  4J8B A;  4FA1 D;  2I0T A;  3OTT A;  4LG9 A;  4J82 A;  4YVD A;  3UVN A;  1JMX B;  3K26 A;  2IWF A;  5IJ8 E;  3VH0 A;  4L1Q D;  5HE1 B;  3SFZ A;  2Z2N A;  3I8C A;  4U7A A;  4K3I D;  2HKR A;  4GGA A;  3SBR A;  2AH0 A;  5CXC B;  3EWE A;  1B9Y A;  1U2V C;  1MG3 A;  2P9U C;  3GRE A;  1A0R B;  3EI4 B;  2OVR B;  2J56 H;  3N0D A;  4L9O A;  1PGU A;  4LG8 A;  3MZL A;  2XL3 A;  5TEE A;  3DSM A;  4JSP C;  5KDO B;  3BWS A;  4KFM B;  2P9P C;  3OL2 A;  2GC7 A;  3V7D B;  3SCY A;  1JJU B;  3OKY A;  5CXB A;  4GQB B;  2Z2P A;  5I5M A;  1MDA H;  4J86 A;  5B4W A;  3EI2 B;  4CY1 A;  3EI1 B;  4FAV D;  3NVX A;  5HQG A;  3I7L A;  3MKS B;  2YNN A;  3AL8 A;  2IUP A;  2P9K C;  3GFC A;  2P9I C;  5K1C C;  4J79 A;  3PXS D;  3I7O A;  2H47 A;  3W15 A;  3SN6 B;  3SXT D;  3KRW B;  4GGD A;  4GZ8 A;  3AH8 B;  1N6E A;  3DXM C;  2OK6 A;  3OW8 A;  4H5J A;  1QNI A;  4GQ2 P;  4I79 A;  5AMS A;  3JAM g;  4CI3 A;  3VGZ A;  3C99 A;  3J80 g;  3RN0 D;  1R5M A;  1PEV A;  2PBI B;  2YNO A;  4FA5 D;  1K8K C;  2QXV A;  4ERZ A;  3RSE C;  4U1E I;  3MKQ A;  4ZN4 A;  2PM9 B;  4X63 B;  3IIY A;  2YMU A;  3OKT A;  3UKR C;  1OMW B;  5EAL A;  2B5N A;  2QC5 A;  4BUJ C;  4PBY A;  2H6Q A;  2GNQ A;  4X60 B;  3RFG A;  5K19 A;  4A2L A;  1GXR A;  3F3F A;  4IA9 A;  4J8G A;  5FKQ A;  3I8E A;  3J81 g;  4J77 A;  4J73 A;  3IKO A;  4GQ1 A; 
#chains in the Genus database with same CATH topology
 2YBA A;  5EAM A;  3IUR A;  1T2X A;  2H9M A;  3I7P A;  1JTD B;  5IT9 g;  2AQ5 A;  2Q7Q A;  1UOO A;  3FCU A;  4OWR A;  3MXX A;  5EM2 A;  1UOP A;  3IJC A;  4A2M A;  3DXK C;  5HE3 B;  5EMM B;  3F3P A;  3RFH A;  4A09 A;  5IGO A;  4J81 A;  4L3H D;  2XE4 A;  3CIK B;  3NIF A;  3OKY B;  3PVU B;  4CY2 A;  4CI8 A;  4CI2 A;  2AGY A;  4XEI C;  3VA6 A;  4A11 B;  5GSA A;  5FKR A;  1GOG A;  2QZP A;  1U8C A;  4NBM A;  4G1E A;  3JRO A;  4QRJ A;  2OVQ B;  3UVO A;  1L0Q A;  3P4F A;  1C9L A;  5M5R A;  4E54 A;  4WK0 A;  4CZY A;  3DM0 A;  3EI3 A;  4GMB A;  4E5Z A;  3BG0 A;  3CFS B;  1XKS A;  4JT6 C;  1UOQ A;  2HJB A;  5CXC A;  2BCJ B;  4Z7O A;  4HDJ A;  3O4G A;  2XDW A;  3RMZ D;  4G55 A;  4Z8L A;  4MMZ A;  5C2V B;  4D6V A;  3QI0 A;  1XIP A;  3I7K A;  2HXC A;  3RRM C;  4IRZ A;  2G9A A;  3SJL D;  3OF7 A;  3OL2 B;  3JB9 L;  1O6G A;  4Y5R D;  4R7A B;  3K72 A;  5C9Z B;  3PSC B;  3EI1 A;  2P9S C;  3EI2 A;  1P22 A;  3EQ9 A;  2BKL A;  2VDN A;  3C9C A;  5EML B;  5TF2 A;  1OLZ A;  1YR2 A;  3BG1 A;  4PSX B;  3IUM A;  2MTA H;  4Z7N A;  2XZG A;  3ZDZ A;  1VYH C;  4J84 A;  4PXW A;  2I3S A;  3B7F A;  3GD1 I;  3PXT D;  4UI9 R;  5FQD A;  4CI1 A;  1A12 A;  4FA4 D;  2H9N A;  5EAR A;  5HYN B;  2H3X A;  3EI4 A;  3A0F A;  4DNU A;  1NEX B;  4ESG A;  2OJY A;  3K6S A;  3K27 A;  3QHY B;  1I2M B;  4L1M A;  1H2W A;  4AN0 A;  2H9L A;  5C86 A;  5GMK n;  3EG6 A;  4J0W A;  3MZK A;  4O3T B;  3IUQ A;  2PM7 B;  4UM8 A;  4FHL A;  4ERY A;  4E5Z B;  2VC2 A;  2HU7 A;  3EU7 A;  3DWL C;  1N6D A;  2XL2 A;  2CE9 A;  2IUR A;  4RE5 A;  2VDP A;  4JXM A;  3O4I A;  3NVQ A;  4J78 A;  1JOF A;  2VDM A;  4A11 A;  1B9X A;  3N0E A;  3SMR A;  3PE7 A;  2H9P A;  4Y7R A;  4A08 B;  2IUV A;  3NIG A;  4AMY A;  4OZU A;  2VDL A;  3SBQ A;  4LGN A;  2AGZ A;  4NC4 A;  3V4P A;  4O02 A;  5M5S A;  4A09 B;  1N6F A;  3MMY A;  4J0X A;  2H13 A;  2H14 A;  1GOH A;  2P9N C;  3KRX B;  3JRP A;  4X3E A;  4N14 A;  4FA9 D;  4O2W A;  5GXI A;  4BCB A;  3ZWL B;  4A0B B;  2GC4 A;  2J55 H;  4GM9 A;  3CFV A;  2H6N A;  3DDU A;  4WK4 A;  5FFO A;  5AFU 3;  2VZ1 A;  5JWZ A;  4AN1 A;  1Q47 A;  3SBP A;  2EBS A;  3HFQ A;  4CC9 A;  2VDR A;  2JKX A;  5FA5 B;  2CO0 C;  3FM0 A;  3IUL A;  5CYK B;  4BP9 A;  5EM2 B;  4PBZ A;  4BCC A;  2W18 A;  5SXM A;  4CZX A;  1K3I A;  3ULE C;  2AGX A;  3ZE2 A;  3ORV D;  4E54 B;  2AH1 A;  3K71 A;  4K3J B;  1SQ9 A;  1GP2 B;  2BBK H;  4GGC A;  4QL1 A;  2YNP A;  2P9L C;  4A7J A;  4FAN D;  3V5W B;  1RI6 A;  2EIC A;  3NVN A;  4PSW B;  2H6K A;  4CY3 A;  4JSX C;  3I89 A;  3JPX A;  3IIW A;  2HES X;  3PXW D;  1L5G A;  3EI3 B;  2B5M A;  3AL9 A;  4JSN C;  2PM6 B;  1E5T A;  5I5J A;  4O1Q D;  5EMK B;  1QFM A;  1H2Z A;  4FWW A;  2H68 A;  4PC0 A;  3SLE D;  3T3M A;  4BH6 A;  4IMM A;  4ERQ A;  1PBY B;  3C5M A;  5HDB A;  2CN2 A;  1ERJ A;  3I7N A;  4AOW A;  3UVM A;  4CY5 A;  2CO0 A;  4L3G D;  3FGB A;  3UR4 A;  3UVK A;  3JZH A;  4QQE A;  5CYK A;  3V4V A;  5FLX g;  1BPO A;  4ZOX A;  3UKU C;  2CE8 A;  4FB1 D;  4NAA A;  1MG2 A;  1YFQ A;  4DNV A;  4J87 A;  3IJ0 A;  3AFC A;  5C2W B;  5FKS A;  2I3T A;  4NSX A;  1K32 A;  2OVP B;  4XYI A;  2CNX A;  4MMX A;  3VI4 A;  4ZOZ A;  3UVL A;  1QFS A;  3I7H A;  1NR0 A;  1VE6 A;  3AL8 B;  4ZOV A;  3SHF A;  4ES0 A;  5EMJ B;  2I0R A;  4PNK B;  2EIE A;  4BL0 A;  2PM9 A;  4QT8 A;  5HE0 B;  3C75 H;  2B4E A;  2HU8 A;  4CZV A;  3FRX A;  2G99 A;  2UZX B;  4X61 B;  5H17 A;  4BP8 A;  4D0K A;  1TYE A;  1VZ3 A;  1U4C A;  3PVW B;  1S4U X;  1VZ2 A;  2UZY B;  4JSV C;  1GOT B;  3ZDX A;  1XHM A;  4GM8 A;  3EQ8 A;  2AGW A;  2HYE A;  4O45 A;  1FWX A;  3E0C A;  3I2N A;  2B5L A;  3O4J A;  5TEF A;  4XYH A;  2XU7 A;  3JZN A;  4TZ4 A;  3VI3 A;  5GXH A;  2IWK A;  2OIZ A;  5HE2 B;  5E6U A;  1M1X A;  2HJ4 A;  5H14 A;  2IUQ A;  2YB8 B;  3SWS D;  2Z2O A;  3EMH A;  5FXY A;  2O9K A;  4G1M A;  3ODT A;  3O4H A;  3MUN A;  1O6F A;  5CXB B;  3L4M D;  4H5I A;  4A0B A;  4JHP C;  4UM9 A;  1TBG A;  3PSL A;  4G56 B;  4NEN A;  3RN1 D;  1GOF A;  5FKT A;  4A0A B;  3KCI A;  5C92 A;  4JT5 C;  5A2Q g;  2I0S A;  2TRC B;  5TDH B;  4AEZ A;  3U4Y A;  2OK4 A;  2CN3 A;  4JD2 C;  3IJ1 A;  5IGQ A;  1H2X A;  3SVW D;  3OKW A;  3RLM D;  4GM3 A;  4MK0 B;  5AJA A;  4AX4 A;  1TYQ C;  5EAP A;  1GG2 B;  3JZG A;  4QAM A;  4A08 A;  5IC7 A;  1VE7 A;  4A0A A;  1SHY B;  1JMZ B;  3L4O D;  2XYI A;  2AGL A;  2HKM A;  4O9D A;  3V9F A;  1PI6 A;  5H1M A;  4D9S A;  2IAA A;  4EWR A;  4O3U B;  5THA A;  5IJ7 E;  3F3G A;  1SQJ A;  2J57 G;  5I5I A;  4ZOY A;  4J8B A;  4FA1 D;  2I0T A;  3OTT A;  4LG9 A;  3NID A;  4J82 A;  4YVD A;  5FFG A;  3UVN A;  1JMX B;  3K26 A;  2IWF A;  5IJ8 E;  2VDK A;  3VH0 A;  4L1Q D;  3MVD K;  3ZE0 A;  5HE1 B;  3SFZ A;  2Z2N A;  3I8C A;  4U7A A;  4K3I D;  2HKR A;  4GGA A;  3SBR A;  2AH0 A;  5CXC B;  3EWE A;  1B9Y A;  1JV2 A;  1U2V C;  3IJE A;  1MG3 A;  2P9U C;  3GRE A;  1A0R B;  3EI4 B;  2OVR B;  2J56 H;  3N0D A;  4L9O A;  1PGU A;  2VDQ A;  4LG8 A;  5E6R A;  3MZL A;  2XL3 A;  5TEE A;  3DSM A;  3ZDY A;  5E6S A;  4JSP C;  5KDO B;  3ZE1 A;  3BWS A;  2WQ8 A;  4KFM B;  2P9P C;  3OL2 A;  3IUN A;  2GC7 A;  3V7D B;  3SCY A;  1JJU B;  2QR5 A;  3OKY A;  5CXB A;  3T3P A;  4GQB B;  2Z2P A;  5I5M A;  1MDA H;  4J86 A;  5B4W A;  3EI2 B;  4CY1 A;  3EI1 B;  4BCD A;  4FAV D;  3NVX A;  5M5T A;  5HQG A;  3GC3 B;  3I7L A;  3MKS B;  2VZ3 A;  2YNN A;  3AL8 A;  2IUP A;  2P9K C;  3GFC A;  2P9I C;  5K1C C;  4WK2 A;  5M61 A;  4J79 A;  3PXS D;  3IVM A;  3I7O A;  2H47 A;  3W15 A;  3SN6 B;  3SXT D;  3KRW B;  4GGD A;  4GZ8 A;  1H2Y A;  4Z7Q A;  3AH8 B;  1N6E A;  3DXM C;  2OK6 A;  3OW8 A;  4H5J A;  1QNI A;  4GQ2 P;  4I79 A;  5AMS A;  3JAM g;  4CI3 A;  3VGZ A;  3C99 A;  3J80 g;  3RN0 D;  1R5M A;  1PEV A;  2PBI B;  2VDO A;  3FCS A;  2YNO A;  4FA5 D;  1K8K C;  2QXV A;  4ERZ A;  3RSE C;  4U1E I;  3MKQ A;  4ZN4 A;  2PM9 B;  4X63 B;  5M5V A;  3IIY A;  2YMU A;  3OKT A;  4DNW A;  3UKR C;  1OMW B;  5EAL A;  4AMZ A;  2EID A;  4RE6 A;  5M5U A;  2B5N A;  1UTC A;  2QC5 A;  1E8N A;  3MUO A;  4BUJ C;  4PBY A;  2H6Q A;  2GNQ A;  4X60 B;  3RFG A;  1E8M A;  5K19 A;  4WJK A;  4A2L A;  1GXR A;  3F3F A;  4IA9 A;  3IUJ A;  4J8G A;  4MMY A;  1C9I A;  2HU5 A;  3I8E A;  5FKQ A;  3J81 g;  4J77 A;  3EQ7 A;  4JHN A;  4J73 A;  2EIB A;  3IKO A;  4GQ1 A; 
#chains in the Genus database with same CATH homology
 2YBA A;  5EAM A;  2H9M A;  3I7P A;  5IT9 g;  2AQ5 A;  2Q7Q A;  4OWR A;  3MXX A;  5EM2 A;  3IJC A;  4A2M A;  3DXK C;  5HE3 B;  5EMM B;  3F3P A;  3RFH A;  4A09 A;  5IGO A;  4J81 A;  4L3H D;  3CIK B;  3OKY B;  3PVU B;  4CY2 A;  4CI8 A;  4CI2 A;  2AGY A;  4XEI C;  3VA6 A;  4A11 B;  5GSA A;  5FKR A;  3JRO A;  4QRJ A;  2OVQ B;  3UVO A;  1L0Q A;  3P4F A;  4E54 A;  4CZY A;  3DM0 A;  3EI3 A;  4GMB A;  4E5Z A;  3BG0 A;  3CFS B;  1XKS A;  4JT6 C;  2HJB A;  5CXC A;  2BCJ B;  4HDJ A;  3RMZ D;  4Z8L A;  5C2V B;  4D6V A;  1XIP A;  3I7K A;  2HXC A;  3RRM C;  2G9A A;  3SJL D;  3OL2 B;  3JB9 L;  4Y5R D;  4R7A B;  5C9Z B;  3PSC B;  3EI1 A;  2P9S C;  3EI2 A;  1P22 A;  3C9C A;  5EML B;  5TF2 A;  1OLZ A;  3BG1 A;  4PSX B;  2MTA H;  1VYH C;  4J84 A;  4PXW A;  2I3S A;  3B7F A;  3PXT D;  4UI9 R;  5FQD A;  4CI1 A;  4FA4 D;  2H9N A;  5EAR A;  5HYN B;  2H3X A;  3EI4 A;  3A0F A;  1NEX B;  4ESG A;  2OJY A;  3K27 A;  2H9L A;  5GMK n;  3EG6 A;  4J0W A;  3MZK A;  4O3T B;  2PM7 B;  4FHL A;  4ERY A;  4E5Z B;  3EU7 A;  3DWL C;  1N6D A;  2XL2 A;  2CE9 A;  2IUR A;  4JXM A;  3NVQ A;  4J78 A;  1JOF A;  4A11 A;  1B9X A;  3N0E A;  3SMR A;  3PE7 A;  2H9P A;  4Y7R A;  4A08 B;  2IUV A;  4OZU A;  3SBQ A;  4LGN A;  2AGZ A;  4A09 B;  1N6F A;  3MMY A;  4J0X A;  2H13 A;  2H14 A;  2P9N C;  3KRX B;  3JRP A;  4X3E A;  4N14 A;  4FA9 D;  5GXI A;  3ZWL B;  4A0B B;  2GC4 A;  2J55 H;  4GM9 A;  3CFV A;  2H6N A;  5AFU 3;  5JWZ A;  1Q47 A;  3SBP A;  2EBS A;  3HFQ A;  4CC9 A;  5FA5 B;  2CO0 C;  3FM0 A;  5CYK B;  5EM2 B;  4PBZ A;  2W18 A;  5SXM A;  4CZX A;  3ULE C;  2AGX A;  3ORV D;  4E54 B;  2AH1 A;  4K3J B;  1SQ9 A;  1GP2 B;  2BBK H;  4GGC A;  4QL1 A;  2YNP A;  2P9L C;  4A7J A;  4FAN D;  3V5W B;  1RI6 A;  3NVN A;  4PSW B;  2H6K A;  4CY3 A;  4JSX C;  3I89 A;  3JPX A;  3IIW A;  2HES X;  3PXW D;  3EI3 B;  2B5M A;  3AL9 A;  4JSN C;  2PM6 B;  5I5J A;  4O1Q D;  5EMK B;  4FWW A;  2H68 A;  4PC0 A;  3SLE D;  4BH6 A;  4IMM A;  4ERQ A;  1PBY B;  3C5M A;  2CN2 A;  1ERJ A;  3I7N A;  4AOW A;  3UVM A;  4CY5 A;  2CO0 A;  4L3G D;  3FGB A;  3UR4 A;  3UVK A;  3JZH A;  4QQE A;  5CYK A;  5FLX g;  4ZOX A;  3UKU C;  2CE8 A;  4FB1 D;  1MG2 A;  1YFQ A;  4J87 A;  3IJ0 A;  3AFC A;  5C2W B;  5FKS A;  2I3T A;  4NSX A;  1K32 A;  2OVP B;  4XYI A;  2CNX A;  4ZOZ A;  3UVL A;  3I7H A;  1NR0 A;  3AL8 B;  4ZOV A;  3SHF A;  4ES0 A;  5EMJ B;  2I0R A;  4PNK B;  4BL0 A;  2PM9 A;  4QT8 A;  5HE0 B;  3C75 H;  2B4E A;  4CZV A;  3FRX A;  2G99 A;  2UZX B;  4X61 B;  5H17 A;  4D0K A;  1U4C A;  3PVW B;  1S4U X;  2UZY B;  4JSV C;  1GOT B;  1XHM A;  4GM8 A;  2AGW A;  2HYE A;  4O45 A;  1FWX A;  3E0C A;  3I2N A;  2B5L A;  5TEF A;  4XYH A;  2XU7 A;  3JZN A;  4TZ4 A;  5GXH A;  2IWK A;  2OIZ A;  5HE2 B;  2HJ4 A;  5H14 A;  2IUQ A;  2YB8 B;  3SWS D;  2Z2O A;  3EMH A;  5FXY A;  2O9K A;  3ODT A;  5CXB B;  3L4M D;  4H5I A;  4A0B A;  1TBG A;  3PSL A;  4G56 B;  3RN1 D;  5FKT A;  4A0A B;  5A2Q g;  4JT5 C;  2I0S A;  2TRC B;  5TDH B;  4AEZ A;  3U4Y A;  2OK4 A;  2CN3 A;  4JD2 C;  3IJ1 A;  5IGQ A;  3SVW D;  3OKW A;  3RLM D;  4GM3 A;  4MK0 B;  5AJA A;  1TYQ C;  5EAP A;  1GG2 B;  3JZG A;  4A08 A;  5IC7 A;  4A0A A;  1SHY B;  1JMZ B;  3L4O D;  2XYI A;  2AGL A;  2HKM A;  4O9D A;  3V9F A;  1PI6 A;  5H1M A;  4EWR A;  2IAA A;  4O3U B;  5THA A;  5IJ7 E;  3F3G A;  1SQJ A;  2J57 G;  5I5I A;  4ZOY A;  4J8B A;  4FA1 D;  2I0T A;  3OTT A;  4LG9 A;  4J82 A;  4YVD A;  3UVN A;  1JMX B;  3K26 A;  2IWF A;  5IJ8 E;  3VH0 A;  4L1Q D;  5HE1 B;  3SFZ A;  2Z2N A;  3I8C A;  4U7A A;  4K3I D;  2HKR A;  4GGA A;  3SBR A;  2AH0 A;  5CXC B;  3EWE A;  1B9Y A;  1U2V C;  1MG3 A;  2P9U C;  3GRE A;  1A0R B;  3EI4 B;  2OVR B;  2J56 H;  3N0D A;  4L9O A;  1PGU A;  4LG8 A;  3MZL A;  2XL3 A;  5TEE A;  3DSM A;  4JSP C;  5KDO B;  3BWS A;  4KFM B;  2P9P C;  3OL2 A;  2GC7 A;  3V7D B;  3SCY A;  1JJU B;  3OKY A;  5CXB A;  4GQB B;  2Z2P A;  5I5M A;  1MDA H;  4J86 A;  5B4W A;  3EI2 B;  4CY1 A;  3EI1 B;  4FAV D;  3NVX A;  5HQG A;  3I7L A;  3MKS B;  2YNN A;  3AL8 A;  2IUP A;  2P9K C;  3GFC A;  2P9I C;  5K1C C;  4J79 A;  3PXS D;  3I7O A;  2H47 A;  3W15 A;  3SN6 B;  3SXT D;  3KRW B;  4GGD A;  4GZ8 A;  3AH8 B;  1N6E A;  3DXM C;  2OK6 A;  3OW8 A;  4H5J A;  1QNI A;  4GQ2 P;  4I79 A;  5AMS A;  3JAM g;  4CI3 A;  3VGZ A;  3C99 A;  3J80 g;  3RN0 D;  1R5M A;  1PEV A;  2PBI B;  2YNO A;  4FA5 D;  1K8K C;  2QXV A;  4ERZ A;  3RSE C;  4U1E I;  3MKQ A;  4ZN4 A;  2PM9 B;  4X63 B;  3IIY A;  2YMU A;  3OKT A;  3UKR C;  1OMW B;  5EAL A;  2B5N A;  2QC5 A;  4BUJ C;  4PBY A;  2H6Q A;  2GNQ A;  4X60 B;  3RFG A;  5K19 A;  4A2L A;  1GXR A;  3F3F A;  4IA9 A;  4J8G A;  5FKQ A;  3I8E A;  3J81 g;  4J77 A;  4J73 A;  3IKO A;  4GQ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...