2XL3A

Wdr5 in complex with an rbbp5 peptide and histone h3 peptide
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
303
structure length
303
Chain Sequence
KPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD REPEAT-CONTAINING PROTEIN 5
publication title Characterisation of a Novel Wdr5 Binding Site that Recruits Rbbp5 Through a Conserved Motif and Enhances Methylation of H3K4 by Mll1.
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 94
structure length 303
sequence length 303
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-07-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2xl3A00
5K1CC 3SXTD 4GM9A 3I7OA 5GSAA 1QNIA 2YNOA 2H9NA 4A09A 3SMRA 4CZYA 2MTAH 4L3GD 4QL1A 1TYQC 2H13A 4PSXB 2J55H 5CXCB 4A7JA 2IWKA 3EI3A 4QT8A 2BBKH 2TRCB 3C5MA 3HFQA 4J77A 4E54B 1VYHC 4X61B 3RFGA 3AFCA 3EU7A 4GMBA 2OIZA 4FHLA 1N6FA 3B7FA 4FA1D 2P9PC 3E0CA 5EAPA 4CI2A 4GQ1A 1A0RB 4ESGA 3IJ1A 5FXYA 5EAMA 2I3SA 3JAMg 3EI2B 2IWFA 3V9FA 1Q47A 3DXKC 4XYHA 1SQ9A 4HDJA 4CZXA 1K8KC 2CNXA 1N6DA 5EM2B 3PVWB 2CO0A 4CI8A 2AH1A 3MKQA 3I8CA 2CE9A 2XL2A 1NR0A 4PNKB 4A08B 5HE3B 4X60B 3I7LA 4H5IA 4PBYA 1XIPA 3RLMD 3SFZA 4J87A 5TEFA 4BL0A 5AMSA 2XU7A 3V5WB 3J80g 2B5NA 3NVQA 5IGQA 5JWZA 1JMXB 5I5JA 3DXMC 4I79A 2OK4A 4ZOXA 2W18A 1SQJA 4QQEA 3PSLA 5GMKn 3C75H 3W15A 2QC5A 3N0EA 3DM0A 2OJYA 3F3GA 5HYNB 5IJ8E 5FLXg 4A2MA 4D0KA 1B9XA 3VGZA 5HE2B 2H9PA 4E5ZB 4ZOZA 2H6NA 4MK0B 2AGLA 2P9UC 2QXVA 4J0WA 4NSXA 5TEEA 5TF2A 3A0FA 4CY5A 4J78A 3BWSA 4CZVA 2YB8B 3OL2A 4JSPC 3SHFA 2PM9A 2P9NC 4JSNC 4U1EI 5EALA 5CYKB 2HJ4A 3EI4B 3CFSB 3I2NA 5K19A 3U4YA 3SBPA 1GXRA 3OKTA 4JXMA 3UKUC 5EMJB 3OTTA 3RFHA 4JSXC 5SXMA 1YFQA 3EG6A 3MMYA 5H17A 2IUPA 5HE1B 4A11B 3UKRC 4O3TB 5CXBB 3SN6B 4OWRA 3JROA 5CXCA 2G99A 4TZ4A 3EI1A 4GGAA 3JPXA 4GM3A 3IIYA 3I7HA 2Q7QA 1K32A 3PXTD 3F3FA 2HYEA 4GQ2P 4YVDA 5IGOA 4PBZA 2EBSA 3MXXA 5AJAA 4ZN4A 3GFCA 5EMLB 1GP2B 3FGBA 5FKSA 2P9KC 2HESX 1MG2A 2AQ5A 3I7KA 2OK6A 4L1QD 3AL8B 3K26A 2IUVA 2XYIA 3J81g 3CFVA 4GZ8A 3I7NA 5TDHB 3NVXA 2CN3A 2P9LC 5THAA 2YMUA 5EM2A 4CY2A 3UVKA 4JT6C 5HE0B 2J57G 3JRPA 2J56H 3KRWB 4A0BB 1RI6A 4A0AA 1SHYB 1S4UX 4A08A 2H47A 4KFMB 4X3EA 4LG8A 3SCYA 1NEXB 3SVWD 4JSVC 3ULEC 4GGDA 1XKSA 3AL9A 3P4FA 5IT9g 3RN0D 3VH0A 3K27A 2IURA 5H1MA 3SBQA 4U7AA 4CY1A 4D6VA 2H9LA 4GM8A 1GOTB 2HJBA 2HKMA 1PGUA 1R5MA 3BG0A 3OKYA 1B9YA 5FKRA 2Z2NA 4JD2C 4O1QD 3FRXA 3SWSD 3MKSB 4Z8LA 5A2Qg 4ZOVA 1PEVA 2H6KA 2AGZA 4FA9D 2PM6B 4GGCA 5FA5B 5GXHA 4XYIA 2H3XA 4N14A 2YNNA 4O9DA 1N6EA 4J81A 4ERYA 4FAND 3JB9L 2CN2A 4A2LA 3IKOA 1FWXA 5EMKB 2H14A 3EWEA 4Y5RD 1P22A 4J0XA 4FA4D 4K3ID 5I5IA 1U2VC 2Z2OA 4J82A 3SLED 4AEZA 4PSWB 3FM0A 4A11A 4LGNA 4GQBB 3SBRA 3F3PA 3IIWA 3MZKA 4ERQA 3NVNA 3BG1A 4ZOYA 5C2WB 4QRJA 3IJ0A 3I89A 3RRMC 3UVNA 1JOFA 3JZGA 2I0TA 4H5JA 4E54A 2AGWA 2HXCA 1OLZA 4CI3A 5IJ7E 3OW8A 4J79A 3PE7A 3L4MD 2OVQB 2P9IC 4PXWA 1JMZB 2OVPB 3AL8A 3PSCB 1ERJA 3UR4A 4FB1D 4OZUA 4K3JB 3RN1D 1OMWB 4A09B 5IC7A 4X63B 5B4WA 3EI1B 3EI2A 2YBAA 3ORVD 4J8BA 3UVMA 2GC4A 3JZHA 4O3UB 4A0BA 3C99A 1JJUB 1MG3A 3RSEC 3EI3B 2B4EA 2O9KA 4LG9A 2H9MA 3DSMA 1MDAH 2H6QA 3PXWD 4Y7RA 3ODTA 4J86A 3EMHA 5AFU3 5GXIA 1PBYB 1U4CA 1PI6A 2AGYA 1XHMA 4CC9A 2UZXB 1L0QA 3ZWLB 3OKWA 2B5LA 2AGXA 5H14A 4FWWA 2H68A 1GG2B 4CI1A 4A0AB 5FKQA 4FAVD 4L3HD 4FA5D 3KRXB 3SJLD 3JZNA 2I3TA 4E5ZA 4PC0A 2IUQA 4ES0A 5EARA 5I5MA 4CY3A 3PVUB 2CE8A 5HQGA 4BUJC 2I0RA 3UVOA 4G56B 4L9OA 2G9AA 3DWLC 5EMMB 3L4OD 4ERZA 3OKYB 4J73A 5CYKA 3EI4A 3VA6A 2XL3A 2GNQA 5FKTA 2UZYB 5KDOB 4J8GA 3UVLA 3I8EA 1TBGA 2P9SC 4J84A 4AOWA 3AH8B 2I0SA 3CIKB 2OVRB 3I7PA 3PXSD 2PBIB 4IA9A 3V7DB 5CXBA 5FQDA 4BH6A 5C2VB 3IJCA 2Z2PA 4XEIC 4UI9R 4IMMA 4EWRA 2AH0A 3RMZD 2IAAA 2B5MA 2YNPA 3C9CA 2PM7B 4R7AB 2BCJB 2HKRA 3OL2B 2PM9B 3N0DA 2CO0C 5C9ZB 2GC7A 4O45A 3GREA 3MZLA 4JT5C
chains in the Genus database with same CATH superfamily
5K1CC 4WK2A 3SXTD 4GM9A 3I7OA 3EQ8A 4UM9A 5GSAA 1QNIA 2YNOA 2H9NA 3MVDK 4A09A 3SMRA 4CZYA 2VDNA 2MTAH 4L3GD 4QL1A 1TYQC 2H13A 4PSXB 1UOOA 2J55H 5CXCB 4A7JA 1C9IA 2IWKA 3EI3A 3ZDXA 3IURA 4QT8A 2BBKH 2TRCB 3C5MA 3HFQA 4J77A 4E54B 1VYHC 4X61B 3RFGA 3AFCA 3EU7A 4GMBA 2OIZA 4FHLA 1N6FA 3ZDZA 3B7FA 4FA1D 2P9PC 3E0CA 5EAPA 2VDKA 1UOPA 5FFOA 4CI2A 4GQ1A 1A0RB 3NIDA 1H2XA 5FFGA 3ZDYA 4ESGA 3IJ1A 1TYEA 5FXYA 5EAMA 2I3SA 1K3IA 3JAMg 4AN0A 3EI2B 4BCBA 3O4GA 2IWFA 3V9FA 1Q47A 3DXKC 4Z7QA 4XYHA 1SQ9A 4HDJA 3QI0A 4CZXA 1K8KC 2CNXA 1N6DA 5EM2B 3PVWB 2CO0A 4CI8A 2AH1A 3QHYB 3MKQA 3I8CA 2CE9A 2XL2A 1NR0A 4PNKB 2XE4A 5HE3B 4A08B 4X60B 3I7LA 4H5IA 4PBYA 1XIPA 3NIFA 3RLMD 4J87A 5TEFA 3SFZA 4BL0A 5AMSA 2XU7A 3V5WB 3DDUA 3J80g 2B5NA 3NVQA 5IGQA 5JWZA 1JMXB 5I5JA 3DXMC 4I79A 4IRZA 2OK4A 2VDRA 4ZOXA 2W18A 1E8MA 1SQJA 4G1MA 2QR5A 4QQEA 3PSLA 5GMKn 3C75H 3W15A 4RE6A 2QC5A 3N0EA 4MMZA 2EICA 3DM0A 2OJYA 3F3GA 5HYNB 5IJ8E 5FLXg 4A2MA 4D0KA 1B9XA 3VGZA 5HE2B 2H9PA 2VZ1A 4E5ZB 4ZOZA 2H6NA 4MK0B 2AGLA 2P9UC 4WJKA 3K6SA 2QXVA 4J0WA 4NSXA 5TEEA 5TF2A 1A12A 3A0FA 2JKXA 4CY5A 3ZE1A 4J78A 2VZ3A 3BWSA 4CZVA 2YB8B 3OL2A 4JSPC 3SHFA 2PM9A 2P9NC 4AMZA 4JSNC 4U1EI 4Z7NA 3GD1I 5EALA 5CYKB 2HJ4A 3EI4B 3CFSB 3I2NA 5K19A 3U4YA 3SBPA 1GXRA 3OKTA 4JXMA 3UKUC 5EMJB 3OTTA 3RFHA 3IUMA 4JSXC 5SXMA 1YFQA 3EG6A 3MMYA 5H17A 2IUPA 5HE1B 4A11B 1O6FA 4MMXA 3UKRC 4O3TB 5CXBB 3SN6B 4OWRA 4NAAA 3JROA 3GC3B 5CXCA 2G99A 4TZ4A 3EI1A 4GGAA 4JHNA 3JPXA 4GM3A 3IIYA 3I7HA 4AMYA 2Q7QA 1K32A 4AX4A 5E6SA 3PXTD 3F3FA 2HYEA 4GQ2P 4YVDA 5IGOA 4PBZA 3IUQA 4QAMA 2EBSA 3MXXA 5AJAA 3FCUA 4ZN4A 3GFCA 2EIDA 5EMLB 1GP2B 3FGBA 5FKSA 2P9KC 2HESX 1MG2A 2AQ5A 5E6RA 3I7KA 2QZPA 2OK6A 4L1QD 3K71A 3AL8B 3VI4A 3K26A 2VC2A 4NBMA 2WQ8A 2IUVA 2XYIA 3J81g 1YR2A 3CFVA 3MUOA 4O02A 3V4PA 4GZ8A 5M5VA 3I7NA 5TDHB 1VZ3A 3NVXA 2CN3A 2P9LC 5THAA 2YMUA 5EM2A 4CY2A 3UVKA 4JT6C 5HE0B 3JRPA 2J57G 2J56H 3KRWB 4A0BB 1RI6A 4A0AA 2HU8A 1SHYB 1S4UX 4A08A 2H47A 4KFMB 4X3EA 4LG8A 3V4VA 3SCYA 1NEXB 3SVWD 1GOGA 4JSVC 3ULEC 1E5TA 4GGDA 1XKSA 3AL9A 1H2YA 3P4FA 4RE5A 5IT9g 2EIEA 4G55A 3RN0D 3VH0A 3K27A 3IJEA 2XZGA 5M5TA 2IURA 5H1MA 3SBQA 4U7AA 1QFSA 4CY1A 4D6VA 2H9LA 4GM8A 5M5SA 4DNWA 5M5RA 1VE7A 1GOTB 2HJBA 3KCIA 2HKMA 1PGUA 1R5MA 3BG0A 3OKYA 1B9YA 5FKRA 2Z2NA 4JD2C 4O1QD 3FRXA 1E8NA 3SWSD 3MKSB 4Z8LA 5A2Qg 4ZOVA 1PEVA 2H6KA 2AGZA 4FA9D 2PM6B 4GGCA 5FA5B 5GXHA 5HDBA 4XYIA 2H3XA 4N14A 2YNNA 4O9DA 1UTCA 1N6EA 4J81A 4ERYA 1T2XA 5E6UA 4FAND 5C92A 3JB9L 3O4JA 2CN2A 4NENA 4A2LA 4G1EA 3IKOA 1FWXA 5EMKB 1VE6A 1JTDB 3EQ9A 2H14A 3EQ7A 3EWEA 1M1XA 4Y5RD 1P22A 4J0XA 4FA4D 4K3ID 4WK0A 5I5IA 1U2VC 2Z2OA 4J82A 3SLED 4AEZA 4PSWB 3FM0A 4A11A 4LGNA 4BCDA 4GQBB 3SBRA 3F3PA 3OF7A 4NC4A 3IIWA 3MZKA 4ERQA 3ZE0A 3NVNA 3BG1A 4ZOYA 5C2WB 4Z7OA 1I2MB 2VDOA 4QRJA 2EIBA 3IJ0A 3I89A 3RRMC 3UVNA 1JOFA 3JZGA 2I0TA 2HU5A 3IULA 4H5JA 4E54A 2AGWA 2HXCA 1OLZA 4CI3A 5IJ7E 1JV2A 3OW8A 4J79A 3PE7A 3L4MD 2OVQB 2P9IC 1VZ2A 4PXWA 4WK4A 1JMZB 2OVPB 2BKLA 3AL8A 3PSCB 1ERJA 3UR4A 4FB1D 4OZUA 4K3JB 3RN1D 5C86A 1QFMA 1OMWB 4A09B 4BCCA 5IC7A 4X63B 5B4WA 3EI1B 3EI2A 2YBAA 4JHPC 1GOFA 3ORVD 2XDWA 1O6GA 4J8BA 3UVMA 2GC4A 3JZHA 4O3UB 4A0BA 3C99A 1JJUB 1MG3A 3RSEC 3EI3B 2B4EA 2O9KA 5M61A 3O4HA 4LG9A 1C9LA 1H2ZA 4DNVA 2H9MA 3DSMA 1MDAH 2H6QA 3PXWD 4Y7RA 3ODTA 4J86A 3EMHA 2VDLA 5AFU3 5GXIA 1PBYB 1U4CA 1PI6A 2AGYA 4UM8A 1XHMA 4CC9A 1BPOA 3T3MA 2UZXB 1L0QA 4L1MA 3ZWLB 3OKWA 2B5LA 2AGXA 5H14A 4FWWA 2H68A 1GG2B 3K72A 4CI1A 2VDQA 1H2WA 4A0AB 3IVMA 1U8CA 2VDPA 5FKQA 4FAVD 3FCSA 4L3HD 4FA5D 3KRXB 3SJLD 3JZNA 2I3TA 4MMYA 4E5ZA 4PC0A 4D9SA 2IUQA 3T3PA 4ES0A 5EARA 5I5MA 3MUNA 4CY3A 3PVUB 2CE8A 5HQGA 4BUJC 2I0RA 4BP9A 3UVOA 3ZE2A 4G56B 4L9OA 2G9AA 3DWLC 5EMMB 3L4OD 4ERZA 3OKYB 4J73A 4DNUA 5CYKA 3EI4A 3VA6A 5M5UA 2XL3A 2GNQA 5FKTA 2UZYB 1UOQA 5KDOB 4J8GA 2VDMA 3UVLA 3I8EA 1TBGA 2P9SC 1L5GA 4J84A 4AOWA 3AH8B 2I0SA 3CIKB 2OVRB 3I7PA 3VI3A 3PXSD 2PBIB 3IUNA 4IA9A 3V7DB 5CXBA 4BP8A 5FQDA 4BH6A 5C2VB 3IJCA 2Z2PA 4XEIC 4UI9R 4IMMA 4EWRA 4O2WA 2AH0A 3NIGA 3RMZD 2IAAA 2B5MA 2YNPA 4AN1A 2HU7A 3C9CA 2PM7B 4R7AB 2BCJB 2HKRA 3OL2B 2PM9B 1GOHA 3N0DA 2CO0C 5C9ZB 2GC7A 4O45A 3O4IA 3GREA 3MZLA 3IUJA 4JT5C
chains in the Genus database with same CATH topology
5K1CC 3SXTD 4GM9A 3I7OA 5GSAA 1QNIA 2YNOA 2H9NA 4A09A 3SMRA 4CZYA 2MTAH 4L3GD 4QL1A 1TYQC 2H13A 4PSXB 2J55H 5CXCB 4A7JA 2IWKA 3EI3A 4QT8A 2BBKH 2TRCB 3C5MA 3HFQA 4J77A 4E54B 1VYHC 4X61B 3RFGA 3AFCA 3EU7A 4GMBA 2OIZA 4FHLA 1N6FA 3B7FA 4FA1D 2P9PC 3E0CA 5EAPA 4CI2A 4GQ1A 1A0RB 4ESGA 3IJ1A 5FXYA 5EAMA 2I3SA 3JAMg 3EI2B 2IWFA 3V9FA 1Q47A 3DXKC 4XYHA 1SQ9A 4HDJA 4CZXA 1K8KC 2CNXA 1N6DA 5EM2B 3PVWB 2CO0A 4CI8A 2AH1A 3MKQA 3I8CA 2CE9A 2XL2A 1NR0A 4PNKB 4A08B 5HE3B 4X60B 3I7LA 4H5IA 4PBYA 1XIPA 3RLMD 3SFZA 4J87A 5TEFA 4BL0A 5AMSA 2XU7A 3V5WB 3J80g 2B5NA 3NVQA 5IGQA 5JWZA 1JMXB 5I5JA 3DXMC 4I79A 2OK4A 4ZOXA 2W18A 1SQJA 4QQEA 3PSLA 5GMKn 3C75H 3W15A 2QC5A 3N0EA 3DM0A 2OJYA 3F3GA 5HYNB 5IJ8E 5FLXg 4A2MA 4D0KA 1B9XA 3VGZA 5HE2B 2H9PA 4E5ZB 4ZOZA 2H6NA 4MK0B 2AGLA 2P9UC 2QXVA 4J0WA 4NSXA 5TEEA 5TF2A 3A0FA 4CY5A 4J78A 3BWSA 4CZVA 2YB8B 3OL2A 4JSPC 3SHFA 2PM9A 2P9NC 4JSNC 4U1EI 5EALA 5CYKB 2HJ4A 3EI4B 3CFSB 3I2NA 5K19A 3U4YA 3SBPA 1GXRA 3OKTA 4JXMA 3UKUC 5EMJB 3OTTA 3RFHA 4JSXC 5SXMA 1YFQA 3EG6A 3MMYA 5H17A 2IUPA 5HE1B 4A11B 3UKRC 4O3TB 5CXBB 3SN6B 4OWRA 3JROA 5CXCA 2G99A 4TZ4A 3EI1A 4GGAA 3JPXA 4GM3A 3IIYA 3I7HA 2Q7QA 1K32A 3PXTD 3F3FA 2HYEA 4GQ2P 4YVDA 5IGOA 4PBZA 2EBSA 3MXXA 5AJAA 4ZN4A 3GFCA 5EMLB 1GP2B 3FGBA 5FKSA 2P9KC 2HESX 1MG2A 2AQ5A 3I7KA 2OK6A 4L1QD 3AL8B 3K26A 2IUVA 2XYIA 3J81g 3CFVA 4GZ8A 3I7NA 5TDHB 3NVXA 2CN3A 2P9LC 5THAA 2YMUA 5EM2A 4CY2A 3UVKA 4JT6C 5HE0B 2J57G 3JRPA 2J56H 3KRWB 4A0BB 1RI6A 4A0AA 1SHYB 1S4UX 4A08A 2H47A 4KFMB 4X3EA 4LG8A 3SCYA 1NEXB 3SVWD 4JSVC 3ULEC 4GGDA 1XKSA 3AL9A 3P4FA 5IT9g 3RN0D 3VH0A 3K27A 2IURA 5H1MA 3SBQA 4U7AA 4CY1A 4D6VA 2H9LA 4GM8A 1GOTB 2HJBA 2HKMA 1PGUA 1R5MA 3BG0A 3OKYA 1B9YA 5FKRA 2Z2NA 4JD2C 4O1QD 3FRXA 3SWSD 3MKSB 4Z8LA 5A2Qg 4ZOVA 1PEVA 2H6KA 2AGZA 4FA9D 2PM6B 4GGCA 5FA5B 5GXHA 4XYIA 2H3XA 4N14A 2YNNA 4O9DA 1N6EA 4J81A 4ERYA 4FAND 3JB9L 2CN2A 4A2LA 3IKOA 1FWXA 5EMKB 2H14A 3EWEA 4Y5RD 1P22A 4J0XA 4FA4D 4K3ID 5I5IA 1U2VC 2Z2OA 4J82A 3SLED 4AEZA 4PSWB 3FM0A 4A11A 4LGNA 4GQBB 3SBRA 3F3PA 3IIWA 3MZKA 4ERQA 3NVNA 3BG1A 4ZOYA 5C2WB 4QRJA 3IJ0A 3I89A 3RRMC 3UVNA 1JOFA 3JZGA 2I0TA 4H5JA 4E54A 2AGWA 2HXCA 1OLZA 4CI3A 5IJ7E 3OW8A 4J79A 3PE7A 3L4MD 2OVQB 2P9IC 4PXWA 1JMZB 2OVPB 3AL8A 3PSCB 1ERJA 3UR4A 4FB1D 4OZUA 4K3JB 3RN1D 1OMWB 4A09B 5IC7A 4X63B 5B4WA 3EI1B 3EI2A 2YBAA 3ORVD 4J8BA 3UVMA 2GC4A 3JZHA 4O3UB 4A0BA 3C99A 1JJUB 1MG3A 3RSEC 3EI3B 2B4EA 2O9KA 4LG9A 2H9MA 3DSMA 1MDAH 2H6QA 3PXWD 4Y7RA 3ODTA 4J86A 3EMHA 5AFU3 5GXIA 1PBYB 1U4CA 1PI6A 2AGYA 1XHMA 4CC9A 2UZXB 1L0QA 3ZWLB 3OKWA 2B5LA 2AGXA 5H14A 4FWWA 2H68A 1GG2B 4CI1A 4A0AB 5FKQA 4FAVD 4L3HD 4FA5D 3KRXB 3SJLD 3JZNA 2I3TA 4E5ZA 4PC0A 2IUQA 4ES0A 5EARA 5I5MA 4CY3A 3PVUB 2CE8A 5HQGA 4BUJC 2I0RA 3UVOA 4G56B 4L9OA 2G9AA 3DWLC 5EMMB 3L4OD 4ERZA 3OKYB 4J73A 5CYKA 3EI4A 3VA6A 2XL3A 2GNQA 5FKTA 2UZYB 5KDOB 4J8GA 3UVLA 3I8EA 1TBGA 2P9SC 4J84A 4AOWA 3AH8B 2I0SA 3CIKB 2OVRB 3I7PA 3PXSD 2PBIB 4IA9A 3V7DB 5CXBA 5FQDA 4BH6A 5C2VB 3IJCA 2Z2PA 4XEIC 4UI9R 4IMMA 4EWRA 2AH0A 3RMZD 2IAAA 2B5MA 2YNPA 3C9CA 2PM7B 4R7AB 2BCJB 2HKRA 3OL2B 2PM9B 3N0DA 2CO0C 5C9ZB 2GC7A 4O45A 3GREA 3MZLA 4JT5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5K1C C;  3SXT D;  4GM9 A;  3I7O A;  5GSA A;  1QNI A;  2YNO A;  2H9N A;  4A09 A;  3SMR A;  4CZY A;  2MTA H;  4L3G D;  4QL1 A;  1TYQ C;  2H13 A;  4PSX B;  2J55 H;  5CXC B;  4A7J A;  2IWK A;  3EI3 A;  4QT8 A;  2BBK H;  2TRC B;  3C5M A;  3HFQ A;  4J77 A;  4E54 B;  1VYH C;  4X61 B;  3RFG A;  3AFC A;  3EU7 A;  4GMB A;  2OIZ A;  4FHL A;  1N6F A;  3B7F A;  4FA1 D;  2P9P C;  3E0C A;  5EAP A;  4CI2 A;  4GQ1 A;  1A0R B;  4ESG A;  3IJ1 A;  5FXY A;  5EAM A;  2I3S A;  3JAM g;  3EI2 B;  2IWF A;  3V9F A;  1Q47 A;  3DXK C;  4XYH A;  1SQ9 A;  4HDJ A;  4CZX A;  1K8K C;  2CNX A;  1N6D A;  5EM2 B;  3PVW B;  2CO0 A;  4CI8 A;  2AH1 A;  3MKQ A;  3I8C A;  2CE9 A;  2XL2 A;  1NR0 A;  4PNK B;  4A08 B;  5HE3 B;  4X60 B;  3I7L A;  4H5I A;  4PBY A;  1XIP A;  3RLM D;  3SFZ A;  4J87 A;  5TEF A;  4BL0 A;  5AMS A;  2XU7 A;  3V5W B;  3J80 g;  2B5N A;  3NVQ A;  5IGQ A;  5JWZ A;  1JMX B;  5I5J A;  3DXM C;  4I79 A;  2OK4 A;  4ZOX A;  2W18 A;  1SQJ A;  4QQE A;  3PSL A;  5GMK n;  3C75 H;  3W15 A;  2QC5 A;  3N0E A;  3DM0 A;  2OJY A;  3F3G A;  5HYN B;  5IJ8 E;  5FLX g;  4A2M A;  4D0K A;  1B9X A;  3VGZ A;  5HE2 B;  2H9P A;  4E5Z B;  4ZOZ A;  2H6N A;  4MK0 B;  2AGL A;  2P9U C;  2QXV A;  4J0W A;  4NSX A;  5TEE A;  5TF2 A;  3A0F A;  4CY5 A;  4J78 A;  3BWS A;  4CZV A;  2YB8 B;  3OL2 A;  4JSP C;  3SHF A;  2PM9 A;  2P9N C;  4JSN C;  4U1E I;  5EAL A;  5CYK B;  2HJ4 A;  3EI4 B;  3CFS B;  3I2N A;  5K19 A;  3U4Y A;  3SBP A;  1GXR A;  3OKT A;  4JXM A;  3UKU C;  5EMJ B;  3OTT A;  3RFH A;  4JSX C;  5SXM A;  1YFQ A;  3EG6 A;  3MMY A;  5H17 A;  2IUP A;  5HE1 B;  4A11 B;  3UKR C;  4O3T B;  5CXB B;  3SN6 B;  4OWR A;  3JRO A;  5CXC A;  2G99 A;  4TZ4 A;  3EI1 A;  4GGA A;  3JPX A;  4GM3 A;  3IIY A;  3I7H A;  2Q7Q A;  1K32 A;  3PXT D;  3F3F A;  2HYE A;  4GQ2 P;  4YVD A;  5IGO A;  4PBZ A;  2EBS A;  3MXX A;  5AJA A;  4ZN4 A;  3GFC A;  5EML B;  1GP2 B;  3FGB A;  5FKS A;  2P9K C;  2HES X;  1MG2 A;  2AQ5 A;  3I7K A;  2OK6 A;  4L1Q D;  3AL8 B;  3K26 A;  2IUV A;  2XYI A;  3J81 g;  3CFV A;  4GZ8 A;  3I7N A;  5TDH B;  3NVX A;  2CN3 A;  2P9L C;  5THA A;  2YMU A;  5EM2 A;  4CY2 A;  3UVK A;  4JT6 C;  5HE0 B;  2J57 G;  3JRP A;  2J56 H;  3KRW B;  4A0B B;  1RI6 A;  4A0A A;  1SHY B;  1S4U X;  4A08 A;  2H47 A;  4KFM B;  4X3E A;  4LG8 A;  3SCY A;  1NEX B;  3SVW D;  4JSV C;  3ULE C;  4GGD A;  1XKS A;  3AL9 A;  3P4F A;  5IT9 g;  3RN0 D;  3VH0 A;  3K27 A;  2IUR A;  5H1M A;  3SBQ A;  4U7A A;  4CY1 A;  4D6V A;  2H9L A;  4GM8 A;  1GOT B;  2HJB A;  2HKM A;  1PGU A;  1R5M A;  3BG0 A;  3OKY A;  1B9Y A;  5FKR A;  2Z2N A;  4JD2 C;  4O1Q D;  3FRX A;  3SWS D;  3MKS B;  4Z8L A;  5A2Q g;  4ZOV A;  1PEV A;  2H6K A;  2AGZ A;  4FA9 D;  2PM6 B;  4GGC A;  5FA5 B;  5GXH A;  4XYI A;  2H3X A;  4N14 A;  2YNN A;  4O9D A;  1N6E A;  4J81 A;  4ERY A;  4FAN D;  3JB9 L;  2CN2 A;  4A2L A;  3IKO A;  1FWX A;  5EMK B;  2H14 A;  3EWE A;  4Y5R D;  1P22 A;  4J0X A;  4FA4 D;  4K3I D;  5I5I A;  1U2V C;  2Z2O A;  4J82 A;  3SLE D;  4AEZ A;  4PSW B;  3FM0 A;  4A11 A;  4LGN A;  4GQB B;  3SBR A;  3F3P A;  3IIW A;  3MZK A;  4ERQ A;  3NVN A;  3BG1 A;  4ZOY A;  5C2W B;  4QRJ A;  3IJ0 A;  3I89 A;  3RRM C;  3UVN A;  1JOF A;  3JZG A;  2I0T A;  4H5J A;  4E54 A;  2AGW A;  2HXC A;  1OLZ A;  4CI3 A;  5IJ7 E;  3OW8 A;  4J79 A;  3PE7 A;  3L4M D;  2OVQ B;  2P9I C;  4PXW A;  1JMZ B;  2OVP B;  3AL8 A;  3PSC B;  1ERJ A;  3UR4 A;  4FB1 D;  4OZU A;  4K3J B;  3RN1 D;  1OMW B;  4A09 B;  5IC7 A;  4X63 B;  5B4W A;  3EI1 B;  3EI2 A;  2YBA A;  3ORV D;  4J8B A;  3UVM A;  2GC4 A;  3JZH A;  4O3U B;  4A0B A;  3C99 A;  1JJU B;  1MG3 A;  3RSE C;  3EI3 B;  2B4E A;  2O9K A;  4LG9 A;  2H9M A;  3DSM A;  1MDA H;  2H6Q A;  3PXW D;  4Y7R A;  3ODT A;  4J86 A;  3EMH A;  5AFU 3;  5GXI A;  1PBY B;  1U4C A;  1PI6 A;  2AGY A;  1XHM A;  4CC9 A;  2UZX B;  1L0Q A;  3ZWL B;  3OKW A;  2B5L A;  2AGX A;  5H14 A;  4FWW A;  2H68 A;  1GG2 B;  4CI1 A;  4A0A B;  5FKQ A;  4FAV D;  4L3H D;  4FA5 D;  3KRX B;  3SJL D;  3JZN A;  2I3T A;  4E5Z A;  4PC0 A;  2IUQ A;  4ES0 A;  5EAR A;  5I5M A;  4CY3 A;  3PVU B;  2CE8 A;  5HQG A;  4BUJ C;  2I0R A;  3UVO A;  4G56 B;  4L9O A;  2G9A A;  3DWL C;  5EMM B;  3L4O D;  4ERZ A;  3OKY B;  4J73 A;  5CYK A;  3EI4 A;  3VA6 A;  2XL3 A;  2GNQ A;  5FKT A;  2UZY B;  5KDO B;  4J8G A;  3UVL A;  3I8E A;  1TBG A;  2P9S C;  4J84 A;  4AOW A;  3AH8 B;  2I0S A;  3CIK B;  2OVR B;  3I7P A;  3PXS D;  2PBI B;  4IA9 A;  3V7D B;  5CXB A;  5FQD A;  4BH6 A;  5C2V B;  3IJC A;  2Z2P A;  4XEI C;  4UI9 R;  4IMM A;  4EWR A;  2AH0 A;  3RMZ D;  2IAA A;  2B5M A;  2YNP A;  3C9C A;  2PM7 B;  4R7A B;  2BCJ B;  2HKR A;  3OL2 B;  2PM9 B;  3N0D A;  2CO0 C;  5C9Z B;  2GC7 A;  4O45 A;  3GRE A;  3MZL A;  4JT5 C; 
#chains in the Genus database with same CATH topology
 5K1C C;  4WK2 A;  3SXT D;  4GM9 A;  3I7O A;  3EQ8 A;  4UM9 A;  5GSA A;  1QNI A;  2YNO A;  2H9N A;  3MVD K;  4A09 A;  3SMR A;  4CZY A;  2VDN A;  2MTA H;  4L3G D;  4QL1 A;  1TYQ C;  2H13 A;  4PSX B;  1UOO A;  2J55 H;  5CXC B;  4A7J A;  1C9I A;  2IWK A;  3EI3 A;  3ZDX A;  3IUR A;  4QT8 A;  2BBK H;  2TRC B;  3C5M A;  3HFQ A;  4J77 A;  4E54 B;  1VYH C;  4X61 B;  3RFG A;  3AFC A;  3EU7 A;  4GMB A;  2OIZ A;  4FHL A;  1N6F A;  3ZDZ A;  3B7F A;  4FA1 D;  2P9P C;  3E0C A;  5EAP A;  2VDK A;  1UOP A;  5FFO A;  4CI2 A;  4GQ1 A;  1A0R B;  3NID A;  1H2X A;  5FFG A;  3ZDY A;  4ESG A;  3IJ1 A;  1TYE A;  5FXY A;  5EAM A;  2I3S A;  1K3I A;  3JAM g;  4AN0 A;  3EI2 B;  4BCB A;  3O4G A;  2IWF A;  3V9F A;  1Q47 A;  3DXK C;  4Z7Q A;  4XYH A;  1SQ9 A;  4HDJ A;  3QI0 A;  4CZX A;  1K8K C;  2CNX A;  1N6D A;  5EM2 B;  3PVW B;  2CO0 A;  4CI8 A;  2AH1 A;  3QHY B;  3MKQ A;  3I8C A;  2CE9 A;  2XL2 A;  1NR0 A;  4PNK B;  2XE4 A;  5HE3 B;  4A08 B;  4X60 B;  3I7L A;  4H5I A;  4PBY A;  1XIP A;  3NIF A;  3RLM D;  4J87 A;  5TEF A;  3SFZ A;  4BL0 A;  5AMS A;  2XU7 A;  3V5W B;  3DDU A;  3J80 g;  2B5N A;  3NVQ A;  5IGQ A;  5JWZ A;  1JMX B;  5I5J A;  3DXM C;  4I79 A;  4IRZ A;  2OK4 A;  2VDR A;  4ZOX A;  2W18 A;  1E8M A;  1SQJ A;  4G1M A;  2QR5 A;  4QQE A;  3PSL A;  5GMK n;  3C75 H;  3W15 A;  4RE6 A;  2QC5 A;  3N0E A;  4MMZ A;  2EIC A;  3DM0 A;  2OJY A;  3F3G A;  5HYN B;  5IJ8 E;  5FLX g;  4A2M A;  4D0K A;  1B9X A;  3VGZ A;  5HE2 B;  2H9P A;  2VZ1 A;  4E5Z B;  4ZOZ A;  2H6N A;  4MK0 B;  2AGL A;  2P9U C;  4WJK A;  3K6S A;  2QXV A;  4J0W A;  4NSX A;  5TEE A;  5TF2 A;  1A12 A;  3A0F A;  2JKX A;  4CY5 A;  3ZE1 A;  4J78 A;  2VZ3 A;  3BWS A;  4CZV A;  2YB8 B;  3OL2 A;  4JSP C;  3SHF A;  2PM9 A;  2P9N C;  4AMZ A;  4JSN C;  4U1E I;  4Z7N A;  3GD1 I;  5EAL A;  5CYK B;  2HJ4 A;  3EI4 B;  3CFS B;  3I2N A;  5K19 A;  3U4Y A;  3SBP A;  1GXR A;  3OKT A;  4JXM A;  3UKU C;  5EMJ B;  3OTT A;  3RFH A;  3IUM A;  4JSX C;  5SXM A;  1YFQ A;  3EG6 A;  3MMY A;  5H17 A;  2IUP A;  5HE1 B;  4A11 B;  1O6F A;  4MMX A;  3UKR C;  4O3T B;  5CXB B;  3SN6 B;  4OWR A;  4NAA A;  3JRO A;  3GC3 B;  5CXC A;  2G99 A;  4TZ4 A;  3EI1 A;  4GGA A;  4JHN A;  3JPX A;  4GM3 A;  3IIY A;  3I7H A;  4AMY A;  2Q7Q A;  1K32 A;  4AX4 A;  5E6S A;  3PXT D;  3F3F A;  2HYE A;  4GQ2 P;  4YVD A;  5IGO A;  4PBZ A;  3IUQ A;  4QAM A;  2EBS A;  3MXX A;  5AJA A;  3FCU A;  4ZN4 A;  3GFC A;  2EID A;  5EML B;  1GP2 B;  3FGB A;  5FKS A;  2P9K C;  2HES X;  1MG2 A;  2AQ5 A;  5E6R A;  3I7K A;  2QZP A;  2OK6 A;  4L1Q D;  3K71 A;  3AL8 B;  3VI4 A;  3K26 A;  2VC2 A;  4NBM A;  2WQ8 A;  2IUV A;  2XYI A;  3J81 g;  1YR2 A;  3CFV A;  3MUO A;  4O02 A;  3V4P A;  4GZ8 A;  5M5V A;  3I7N A;  5TDH B;  1VZ3 A;  3NVX A;  2CN3 A;  2P9L C;  5THA A;  2YMU A;  5EM2 A;  4CY2 A;  3UVK A;  4JT6 C;  5HE0 B;  3JRP A;  2J57 G;  2J56 H;  3KRW B;  4A0B B;  1RI6 A;  4A0A A;  2HU8 A;  1SHY B;  1S4U X;  4A08 A;  2H47 A;  4KFM B;  4X3E A;  4LG8 A;  3V4V A;  3SCY A;  1NEX B;  3SVW D;  1GOG A;  4JSV C;  3ULE C;  1E5T A;  4GGD A;  1XKS A;  3AL9 A;  1H2Y A;  3P4F A;  4RE5 A;  5IT9 g;  2EIE A;  4G55 A;  3RN0 D;  3VH0 A;  3K27 A;  3IJE A;  2XZG A;  5M5T A;  2IUR A;  5H1M A;  3SBQ A;  4U7A A;  1QFS A;  4CY1 A;  4D6V A;  2H9L A;  4GM8 A;  5M5S A;  4DNW A;  5M5R A;  1VE7 A;  1GOT B;  2HJB A;  3KCI A;  2HKM A;  1PGU A;  1R5M A;  3BG0 A;  3OKY A;  1B9Y A;  5FKR A;  2Z2N A;  4JD2 C;  4O1Q D;  3FRX A;  1E8N A;  3SWS D;  3MKS B;  4Z8L A;  5A2Q g;  4ZOV A;  1PEV A;  2H6K A;  2AGZ A;  4FA9 D;  2PM6 B;  4GGC A;  5FA5 B;  5GXH A;  5HDB A;  4XYI A;  2H3X A;  4N14 A;  2YNN A;  4O9D A;  1UTC A;  1N6E A;  4J81 A;  4ERY A;  1T2X A;  5E6U A;  4FAN D;  5C92 A;  3JB9 L;  3O4J A;  2CN2 A;  4NEN A;  4A2L A;  4G1E A;  3IKO A;  1FWX A;  5EMK B;  1VE6 A;  1JTD B;  3EQ9 A;  2H14 A;  3EQ7 A;  3EWE A;  1M1X A;  4Y5R D;  1P22 A;  4J0X A;  4FA4 D;  4K3I D;  4WK0 A;  5I5I A;  1U2V C;  2Z2O A;  4J82 A;  3SLE D;  4AEZ A;  4PSW B;  3FM0 A;  4A11 A;  4LGN A;  4BCD A;  4GQB B;  3SBR A;  3F3P A;  3OF7 A;  4NC4 A;  3IIW A;  3MZK A;  4ERQ A;  3ZE0 A;  3NVN A;  3BG1 A;  4ZOY A;  5C2W B;  4Z7O A;  1I2M B;  2VDO A;  4QRJ A;  2EIB A;  3IJ0 A;  3I89 A;  3RRM C;  3UVN A;  1JOF A;  3JZG A;  2I0T A;  2HU5 A;  3IUL A;  4H5J A;  4E54 A;  2AGW A;  2HXC A;  1OLZ A;  4CI3 A;  5IJ7 E;  1JV2 A;  3OW8 A;  4J79 A;  3PE7 A;  3L4M D;  2OVQ B;  2P9I C;  1VZ2 A;  4PXW A;  4WK4 A;  1JMZ B;  2OVP B;  2BKL A;  3AL8 A;  3PSC B;  1ERJ A;  3UR4 A;  4FB1 D;  4OZU A;  4K3J B;  3RN1 D;  5C86 A;  1QFM A;  1OMW B;  4A09 B;  4BCC A;  5IC7 A;  4X63 B;  5B4W A;  3EI1 B;  3EI2 A;  2YBA A;  4JHP C;  1GOF A;  3ORV D;  2XDW A;  1O6G A;  4J8B A;  3UVM A;  2GC4 A;  3JZH A;  4O3U B;  4A0B A;  3C99 A;  1JJU B;  1MG3 A;  3RSE C;  3EI3 B;  2B4E A;  2O9K A;  5M61 A;  3O4H A;  4LG9 A;  1C9L A;  1H2Z A;  4DNV A;  2H9M A;  3DSM A;  1MDA H;  2H6Q A;  3PXW D;  4Y7R A;  3ODT A;  4J86 A;  3EMH A;  2VDL A;  5AFU 3;  5GXI A;  1PBY B;  1U4C A;  1PI6 A;  2AGY A;  4UM8 A;  1XHM A;  4CC9 A;  1BPO A;  3T3M A;  2UZX B;  1L0Q A;  4L1M A;  3ZWL B;  3OKW A;  2B5L A;  2AGX A;  5H14 A;  4FWW A;  2H68 A;  1GG2 B;  3K72 A;  4CI1 A;  2VDQ A;  1H2W A;  4A0A B;  3IVM A;  1U8C A;  2VDP A;  5FKQ A;  4FAV D;  3FCS A;  4L3H D;  4FA5 D;  3KRX B;  3SJL D;  3JZN A;  2I3T A;  4MMY A;  4E5Z A;  4PC0 A;  4D9S A;  2IUQ A;  3T3P A;  4ES0 A;  5EAR A;  5I5M A;  3MUN A;  4CY3 A;  3PVU B;  2CE8 A;  5HQG A;  4BUJ C;  2I0R A;  4BP9 A;  3UVO A;  3ZE2 A;  4G56 B;  4L9O A;  2G9A A;  3DWL C;  5EMM B;  3L4O D;  4ERZ A;  3OKY B;  4J73 A;  4DNU A;  5CYK A;  3EI4 A;  3VA6 A;  5M5U A;  2XL3 A;  2GNQ A;  5FKT A;  2UZY B;  1UOQ A;  5KDO B;  4J8G A;  2VDM A;  3UVL A;  3I8E A;  1TBG A;  2P9S C;  1L5G A;  4J84 A;  4AOW A;  3AH8 B;  2I0S A;  3CIK B;  2OVR B;  3I7P A;  3VI3 A;  3PXS D;  2PBI B;  3IUN A;  4IA9 A;  3V7D B;  5CXB A;  4BP8 A;  5FQD A;  4BH6 A;  5C2V B;  3IJC A;  2Z2P A;  4XEI C;  4UI9 R;  4IMM A;  4EWR A;  4O2W A;  2AH0 A;  3NIG A;  3RMZ D;  2IAA A;  2B5M A;  2YNP A;  4AN1 A;  2HU7 A;  3C9C A;  2PM7 B;  4R7A B;  2BCJ B;  2HKR A;  3OL2 B;  2PM9 B;  1GOH A;  3N0D A;  2CO0 C;  5C9Z B;  2GC7 A;  4O45 A;  3O4I A;  3GRE A;  3MZL A;  3IUJ A;  4JT5 C; 
#chains in the Genus database with same CATH homology
 5K1C C;  3SXT D;  4GM9 A;  3I7O A;  5GSA A;  1QNI A;  2YNO A;  2H9N A;  4A09 A;  3SMR A;  4CZY A;  2MTA H;  4L3G D;  4QL1 A;  1TYQ C;  2H13 A;  4PSX B;  2J55 H;  5CXC B;  4A7J A;  2IWK A;  3EI3 A;  4QT8 A;  2BBK H;  2TRC B;  3C5M A;  3HFQ A;  4J77 A;  4E54 B;  1VYH C;  4X61 B;  3RFG A;  3AFC A;  3EU7 A;  4GMB A;  2OIZ A;  4FHL A;  1N6F A;  3B7F A;  4FA1 D;  2P9P C;  3E0C A;  5EAP A;  4CI2 A;  4GQ1 A;  1A0R B;  4ESG A;  3IJ1 A;  5FXY A;  5EAM A;  2I3S A;  3JAM g;  3EI2 B;  2IWF A;  3V9F A;  1Q47 A;  3DXK C;  4XYH A;  1SQ9 A;  4HDJ A;  4CZX A;  1K8K C;  2CNX A;  1N6D A;  5EM2 B;  3PVW B;  2CO0 A;  4CI8 A;  2AH1 A;  3MKQ A;  3I8C A;  2CE9 A;  2XL2 A;  1NR0 A;  4PNK B;  4A08 B;  5HE3 B;  4X60 B;  3I7L A;  4H5I A;  4PBY A;  1XIP A;  3RLM D;  3SFZ A;  4J87 A;  5TEF A;  4BL0 A;  5AMS A;  2XU7 A;  3V5W B;  3J80 g;  2B5N A;  3NVQ A;  5IGQ A;  5JWZ A;  1JMX B;  5I5J A;  3DXM C;  4I79 A;  2OK4 A;  4ZOX A;  2W18 A;  1SQJ A;  4QQE A;  3PSL A;  5GMK n;  3C75 H;  3W15 A;  2QC5 A;  3N0E A;  3DM0 A;  2OJY A;  3F3G A;  5HYN B;  5IJ8 E;  5FLX g;  4A2M A;  4D0K A;  1B9X A;  3VGZ A;  5HE2 B;  2H9P A;  4E5Z B;  4ZOZ A;  2H6N A;  4MK0 B;  2AGL A;  2P9U C;  2QXV A;  4J0W A;  4NSX A;  5TEE A;  5TF2 A;  3A0F A;  4CY5 A;  4J78 A;  3BWS A;  4CZV A;  2YB8 B;  3OL2 A;  4JSP C;  3SHF A;  2PM9 A;  2P9N C;  4JSN C;  4U1E I;  5EAL A;  5CYK B;  2HJ4 A;  3EI4 B;  3CFS B;  3I2N A;  5K19 A;  3U4Y A;  3SBP A;  1GXR A;  3OKT A;  4JXM A;  3UKU C;  5EMJ B;  3OTT A;  3RFH A;  4JSX C;  5SXM A;  1YFQ A;  3EG6 A;  3MMY A;  5H17 A;  2IUP A;  5HE1 B;  4A11 B;  3UKR C;  4O3T B;  5CXB B;  3SN6 B;  4OWR A;  3JRO A;  5CXC A;  2G99 A;  4TZ4 A;  3EI1 A;  4GGA A;  3JPX A;  4GM3 A;  3IIY A;  3I7H A;  2Q7Q A;  1K32 A;  3PXT D;  3F3F A;  2HYE A;  4GQ2 P;  4YVD A;  5IGO A;  4PBZ A;  2EBS A;  3MXX A;  5AJA A;  4ZN4 A;  3GFC A;  5EML B;  1GP2 B;  3FGB A;  5FKS A;  2P9K C;  2HES X;  1MG2 A;  2AQ5 A;  3I7K A;  2OK6 A;  4L1Q D;  3AL8 B;  3K26 A;  2IUV A;  2XYI A;  3J81 g;  3CFV A;  4GZ8 A;  3I7N A;  5TDH B;  3NVX A;  2CN3 A;  2P9L C;  5THA A;  2YMU A;  5EM2 A;  4CY2 A;  3UVK A;  4JT6 C;  5HE0 B;  2J57 G;  3JRP A;  2J56 H;  3KRW B;  4A0B B;  1RI6 A;  4A0A A;  1SHY B;  1S4U X;  4A08 A;  2H47 A;  4KFM B;  4X3E A;  4LG8 A;  3SCY A;  1NEX B;  3SVW D;  4JSV C;  3ULE C;  4GGD A;  1XKS A;  3AL9 A;  3P4F A;  5IT9 g;  3RN0 D;  3VH0 A;  3K27 A;  2IUR A;  5H1M A;  3SBQ A;  4U7A A;  4CY1 A;  4D6V A;  2H9L A;  4GM8 A;  1GOT B;  2HJB A;  2HKM A;  1PGU A;  1R5M A;  3BG0 A;  3OKY A;  1B9Y A;  5FKR A;  2Z2N A;  4JD2 C;  4O1Q D;  3FRX A;  3SWS D;  3MKS B;  4Z8L A;  5A2Q g;  4ZOV A;  1PEV A;  2H6K A;  2AGZ A;  4FA9 D;  2PM6 B;  4GGC A;  5FA5 B;  5GXH A;  4XYI A;  2H3X A;  4N14 A;  2YNN A;  4O9D A;  1N6E A;  4J81 A;  4ERY A;  4FAN D;  3JB9 L;  2CN2 A;  4A2L A;  3IKO A;  1FWX A;  5EMK B;  2H14 A;  3EWE A;  4Y5R D;  1P22 A;  4J0X A;  4FA4 D;  4K3I D;  5I5I A;  1U2V C;  2Z2O A;  4J82 A;  3SLE D;  4AEZ A;  4PSW B;  3FM0 A;  4A11 A;  4LGN A;  4GQB B;  3SBR A;  3F3P A;  3IIW A;  3MZK A;  4ERQ A;  3NVN A;  3BG1 A;  4ZOY A;  5C2W B;  4QRJ A;  3IJ0 A;  3I89 A;  3RRM C;  3UVN A;  1JOF A;  3JZG A;  2I0T A;  4H5J A;  4E54 A;  2AGW A;  2HXC A;  1OLZ A;  4CI3 A;  5IJ7 E;  3OW8 A;  4J79 A;  3PE7 A;  3L4M D;  2OVQ B;  2P9I C;  4PXW A;  1JMZ B;  2OVP B;  3AL8 A;  3PSC B;  1ERJ A;  3UR4 A;  4FB1 D;  4OZU A;  4K3J B;  3RN1 D;  1OMW B;  4A09 B;  5IC7 A;  4X63 B;  5B4W A;  3EI1 B;  3EI2 A;  2YBA A;  3ORV D;  4J8B A;  3UVM A;  2GC4 A;  3JZH A;  4O3U B;  4A0B A;  3C99 A;  1JJU B;  1MG3 A;  3RSE C;  3EI3 B;  2B4E A;  2O9K A;  4LG9 A;  2H9M A;  3DSM A;  1MDA H;  2H6Q A;  3PXW D;  4Y7R A;  3ODT A;  4J86 A;  3EMH A;  5AFU 3;  5GXI A;  1PBY B;  1U4C A;  1PI6 A;  2AGY A;  1XHM A;  4CC9 A;  2UZX B;  1L0Q A;  3ZWL B;  3OKW A;  2B5L A;  2AGX A;  5H14 A;  4FWW A;  2H68 A;  1GG2 B;  4CI1 A;  4A0A B;  5FKQ A;  4FAV D;  4L3H D;  4FA5 D;  3KRX B;  3SJL D;  3JZN A;  2I3T A;  4E5Z A;  4PC0 A;  2IUQ A;  4ES0 A;  5EAR A;  5I5M A;  4CY3 A;  3PVU B;  2CE8 A;  5HQG A;  4BUJ C;  2I0R A;  3UVO A;  4G56 B;  4L9O A;  2G9A A;  3DWL C;  5EMM B;  3L4O D;  4ERZ A;  3OKY B;  4J73 A;  5CYK A;  3EI4 A;  3VA6 A;  2XL3 A;  2GNQ A;  5FKT A;  2UZY B;  5KDO B;  4J8G A;  3UVL A;  3I8E A;  1TBG A;  2P9S C;  4J84 A;  4AOW A;  3AH8 B;  2I0S A;  3CIK B;  2OVR B;  3I7P A;  3PXS D;  2PBI B;  4IA9 A;  3V7D B;  5CXB A;  5FQD A;  4BH6 A;  5C2V B;  3IJC A;  2Z2P A;  4XEI C;  4UI9 R;  4IMM A;  4EWR A;  2AH0 A;  3RMZ D;  2IAA A;  2B5M A;  2YNP A;  3C9C A;  2PM7 B;  4R7A B;  2BCJ B;  2HKR A;  3OL2 B;  2PM9 B;  3N0D A;  2CO0 C;  5C9Z B;  2GC7 A;  4O45 A;  3GRE A;  3MZL A;  4JT5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...