1U4CA

Structure of spindle checkpoint protein bub3
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
340
structure length
322
Chain Sequence
MQIVQIEQAPKDYISDIKIIPSKSLLLITSWDGSLTVYKFDIQAKNVDLLQSLRYKHPLLCCNFIDNTDLQIYVGTVQGEILKVDLIGSPSFQALTNNEANLGICRICKYGDDKLIAASWDGLIEVIDPRNYGDGVIAVKNLNSNNTKVKNKIFTMDTNSSRLIVGMNNSQVQWFRLPLCNGTIEESGLKYQIRDVALLPKEQEGYACSSIDGRVAVEFFDDSSKRFAFRCHRNLAYPVNSIEFSPRHKFLYTAGSDGIISCWNLQTRKKIKNFAKFNEDSVVKIACSDNILCLATSDDTFKTNAATIELNASSIYIIFDYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords Cell cycle arrest protein BUB3
publication title Crystal structure of the spindle assembly checkpoint protein Bub3
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 70
structure length 322
sequence length 340
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 1u4cA00
5C9ZB 5AFU3 3F3FA 2B5NA 3I7KA 4J78A 4E54B 5C2VB 5FKTA 2Q7QA 3HFQA 3C99A 3EI3B 4D6VA 3SBPA 2AGWA 2HKMA 5I5MA 3JPXA 1MG3A 3F3PA 4OZUA 4ESGA 2HJBA 3UKRC 4LG8A 5CXBB 3GFCA 2I3TA 3OL2A 4IMMA 4YVDA 4X3EA 2EBSA 4GQBB 1QNIA 2B5LA 2HJ4A 3CIKB 5EMLB 3PSLA 3IIWA 4Y5RD 2GNQA 2GC4A 3I7HA 3OKYB 3VA6A 2IAAA 1PBYB 2AGYA 3PXWD 2H13A 4CY5A 5HYNB 4O9DA 4E5ZA 3SBQA 3SFZA 1JOFA 3N0DA 4BL0A 4A08B 5H1MA 3SHFA 5IT9g 1SHYB 2CNXA 3SMRA 4ES0A 2CO0A 3AH8B 4CI3A 3ZWLB 2P9LC 5AMSA 4IA9A 5EAMA 5FKRA 3P4FA 3MMYA 3OKWA 3IKOA 2AQ5A 2HKRA 3SXTD 3NVQA 3JB9L 1GG2B 3UVOA 2AGLA 4BH6A 3DXKC 5FA5B 2O9KA 4J79A 4KFMB 5K1CC 5FQDA 1R5MA 2I0RA 2YB8B 1N6EA 3EI4A 3PVWB 2B5MA 2I0SA 4X63B 3EI2A 2XL2A 3NVXA 3UVKA 3JROA 5TEFA 4R7AB 1N6FA 1XKSA 4J0XA 4Z8LA 3RRMC 3SCYA 3BWSA 3PXTD 4GZ8A 4J0WA 3I2NA 1TBGA 4FA5D 4CY1A 5IJ7E 4FWWA 2IUVA 2I3SA 4EWRA 2YNNA 2YMUA 3V7DB 1TYQC 5H14A 5HE1B 4CY3A 4FAVD 2XL3A 2AH0A 4PC0A 3MZKA 2HESX 4ERZA 2PM9A 4L3GD 2BCJB 1OMWB 3C5MA 4GQ1A 1NEXB 3VH0A 3NVNA 2H9PA 2CE8A 5HQGA 2IWKA 2Z2PA 3SN6B 2IURA 4E5ZB 2PM7B 3K26A 5HE3B 3DM0A 4U1EI 4GMBA 2H9LA 1GP2B 4JSVC 3EU7A 3UKUC 4CC9A 2P9UC 4QL1A 3PSCB 4CI2A 2OVPB 3MZLA 2J57G 4CI8A 4A0BB 2G9AA 3I7PA 1VYHC 5FXYA 3DSMA 3DWLC 4A7JA 4O1QD 4J8GA 3N0EA 4ZOVA 3JZGA 2HYEA 5IGQA 2CN3A 3A0FA 4A09A 1K8KC 4GGDA 4A0AA 3U4YA 4PNKB 2H47A 5TF2A 4AOWA 3CFVA 2P9IC 1MDAH 2OVQB 3EI4B 3W15A 3EI2B 5CXCB 2H6KA 4A2LA 2H3XA 4GM9A 3OKTA 1NR0A 2IWFA 5B4WA 3BG0A 1JMXB 2W18A 5TEEA 3UR4A 5GMKn 3I8CA 4G56B 4XEIC 5KDOB 1U4CA 4D0KA 2YNOA 1Q47A 3RFHA 1L0QA 4Y7RA 3AFCA 4X61B 4FA1D 4O45A 2QC5A 3PVUB 3RSEC 5H17A 3SLED 3JZHA 3J80g 1B9YA 3I7OA 5AJAA 4TZ4A 3EI3A 5TDHB 2H6QA 5EM2B 4J8BA 2H14A 1P22A 2IUQA 3RN0D 3E0CA 2H9NA 2OVRB 2P9NC 5GSAA 2OK4A 5A2Qg 1GXRA 4JD2C 4JT6C 1PEVA 2OIZA 5FKQA 3OW8A 4FA9D 2CO0C 3JZNA 1PGUA 3RMZD 4PBZA 2UZXB 3EWEA 1S4UX 1U2VC 1K32A 3OL2B 2OK6A 3OKYA 3EI1A 4CI1A 3MXXA 1XIPA 4ERYA 2AGZA 1SQ9A 1OLZA 2B4EA 3J81g 4A09B 2Z2NA 4UI9R 4GGAA 5I5JA 4NSXA 3SWSD 5GXIA 3UVMA 3JAMg 2J56H 5EAPA 4LGNA 4XYHA 4PXWA 3I7NA 3L4OD 3FM0A 4GM8A 4CZVA 5FKSA 5IJ8E 3I8EA 4A11A 3KRXB 4L1QD 3C9CA 5EALA 3GREA 4PBYA 4J73A 1XHMA 4AEZA 1A0RB 5C2WB 3PE7A 2H9MA 3ORVD 4J77A 5IC7A 3KRWB 2Z2OA 4J81A 3EG6A 2YBAA 4ZOXA 2CN2A 3B7FA 2AH1A 1PI6A 2YNPA 5EMKB 4ZOZA 5EMJB 3BG1A 4JXMA 3UVLA 3AL8A 4ZOYA 5HE0B 4K3JB 4CZXA 3V5WB 4J84A 5EMMB 2UZYB 3DXMC 1YFQA 4ZN4A 2G99A 4GQ2P 3EMHA 5SXMA 3SVWD 5CYKA 3ODTA 4GM3A 2TRCB 4FA4D 3FRXA 3RLMD 5I5IA 3UVNA 2XU7A 3I7LA 3EI1B 5GXHA 1GOTB 4E54A 2AGXA 4H5JA 4I79A 2XYIA 2IUPA 4FAND 2PM9B 3JRPA 4ERQA 4L3HD 5EARA 2MTAH 2PBIB 1JMZB 4L9OA 4FHLA 4JSPC 4A0BA 5JWZA 2P9KC 5CXBA 4H5IA 4N14A 3IJCA 4JSXC 1RI6A 2I0TA 3IJ0A 4A11B 2GC7A 4LG9A 4XYIA 2BBKH 4X60B 4PSXB 3MKQA 2HXCA 4JT5C 3F3GA 5CXCA 5K19A 3C75H 3SJLD 4CZYA 3FGBA 3RN1D 2H6NA 1FWXA 4FB1D 4A0AB 2P9SC 4J87A 4GGCA 1JJUB 4A08A 2J55H 2QXVA 4PSWB 4O3TB 3AL8B 3K27A 4J82A 3AL9A 3PXSD 1ERJA 4QRJA 4O3UB 1B9XA 4CY2A 1N6DA 3I89A 3L4MD 3IJ1A 4QT8A 4OWRA 5IGOA 5FLXg 5HE2B 3MKSB 3IIYA 4MK0B 2PM6B 4A2MA 3OTTA 1SQJA 4JSNC 2CE9A 5THAA 3V9FA 3CFSB 5CYKB 3SBRA 4BUJC 2H68A 2P9PC 4QQEA 2OJYA 4K3ID 5EM2A 3ULEC 4J86A 4HDJA 3RFGA 1MG2A 3VGZA 4U7AA
chains in the Genus database with same CATH superfamily
5C9ZB 5AFU3 3F3FA 2B5NA 3I7KA 4J78A 4WK2A 4E54B 5C2VB 5FKTA 4L1MA 2Q7QA 4Z7OA 3HFQA 4BCCA 4IRZA 3C99A 3EI3B 4D6VA 3SBPA 2VDNA 2AGWA 2HKMA 5I5MA 3JPXA 1MG3A 3F3PA 4OZUA 4ESGA 4BP9A 2HJBA 3UKRC 4LG8A 5CXBB 1U8CA 3GFCA 2I3TA 3OL2A 4IMMA 4MMXA 4YVDA 4X3EA 2EBSA 3O4JA 1QNIA 4GQBB 4O2WA 2B5LA 2HJ4A 3CIKB 4BCBA 4G1EA 5EMLB 3PSLA 3IIWA 1K3IA 4Y5RD 2BKLA 2GNQA 2GC4A 3I7HA 2VZ1A 3OKYB 2VDKA 3VA6A 2IAAA 1PBYB 2AGYA 3PXWD 4JHPC 2H13A 4CY5A 3ZE0A 5HYNB 1UOPA 3IVMA 4O9DA 4E5ZA 1UOQA 3SBQA 3SFZA 1JOFA 3N0DA 4BL0A 4A08B 5H1MA 3SHFA 5IT9g 1SHYB 3VI3A 2CNXA 3SMRA 4ES0A 1YR2A 3IJEA 2CO0A 3AH8B 3K71A 4CI3A 3ZWLB 2P9LC 2VDOA 3T3PA 5AMSA 2XZGA 4IA9A 5EAMA 5FKRA 3P4FA 3MMYA 3NIGA 3OKWA 1QFMA 3KCIA 3IKOA 2AQ5A 2HKRA 3SXTD 3NVQA 1UTCA 3JB9L 1GG2B 3UVOA 2AGLA 4G1MA 5FFOA 4BH6A 3DXKC 5FA5B 4WK4A 2O9KA 3O4GA 3MUNA 4J79A 4KFMB 5K1CC 5FQDA 1R5MA 2I0RA 2YB8B 1N6EA 3EI4A 3GD1I 3PVWB 2B5MA 2I0SA 4Z7QA 3QI0A 4X63B 3EI2A 2XL2A 3NVXA 3UVKA 3T3MA 3JROA 5TEFA 4R7AB 4JHNA 1A12A 1N6FA 1XKSA 4J0XA 4Z8LA 3IURA 3RRMC 3SCYA 3BWSA 3PXTD 4GZ8A 4J0WA 5HDBA 3I2NA 1TBGA 2VDMA 4FA5D 4CY1A 5IJ7E 4FWWA 2IUVA 2I3SA 4EWRA 2YNNA 2YMUA 3V7DB 4AN1A 1TYQC 5H14A 5HE1B 4CY3A 4FAVD 2XL3A 2AH0A 3EQ8A 3ZDYA 4PC0A 3MZKA 2HESX 4UM8A 4ERZA 2PM9A 4L3GD 2BCJB 1OMWB 2VC2A 3C5MA 4GQ1A 1NEXB 3VH0A 4O02A 3NVNA 2H9PA 2CE8A 3NIFA 5HQGA 2IWKA 2Z2PA 4RE5A 3SN6B 2IURA 4E5ZB 2PM7B 2WQ8A 3K26A 3DM0A 5HE3B 4U1EI 4NAAA 4GMBA 2H9LA 1C9IA 1GP2B 4JSVC 3EU7A 3UKUC 4CC9A 2P9UC 4QL1A 3PSCB 4CI2A 3ZE1A 2OVPB 3FCUA 3MZLA 5M5VA 2J57G 4CI8A 4A0BB 2G9AA 3I7PA 1VYHC 5FXYA 3DSMA 3DWLC 1JV2A 4A7JA 3QHYB 4O1QD 4J8GA 3N0EA 4NC4A 4ZOVA 1H2YA 1VE7A 3JZGA 2HYEA 2XE4A 4BCDA 5IGQA 2CN3A 3A0FA 1BPOA 4A09A 1K8KC 4GGDA 4A0AA 3U4YA 2VDLA 4PNKB 2H47A 5TF2A 4AOWA 5C86A 3CFVA 5M5TA 2P9IC 1MDAH 2OVQB 3EI4B 3W15A 3EI2B 5CXCB 2H6KA 3NIDA 4A2LA 2H3XA 4GM9A 3OKTA 1NR0A 2IWFA 5B4WA 3BG0A 1JMXB 2W18A 5TEEA 3UR4A 3V4VA 5GMKn 3EQ9A 3I8CA 4G56B 4XEIC 5KDOB 1U4CA 4D0KA 2YNOA 1Q47A 3RFHA 1L0QA 4Y7RA 3AFCA 4X61B 4FA1D 4O45A 2QC5A 3PVUB 3RSEC 4WK0A 1H2ZA 5H17A 3SLED 3V4PA 1VZ3A 3JZHA 3IUNA 3J80g 1B9YA 3I7OA 5AJAA 4TZ4A 3EI3A 5TDHB 2H6QA 5EM2B 4J8BA 2H14A 1P22A 2IUQA 4RE6A 4DNUA 3RN0D 1H2XA 3K72A 3E0CA 1GOFA 2H9NA 2OVRB 2P9NC 5GSAA 4QAMA 2OK4A 5A2Qg 1GXRA 4JD2C 4JT6C 1PEVA 2EIDA 2OIZA 5FKQA 3OW8A 4FA9D 1GOGA 2CO0C 1PGUA 3JZNA 3RMZD 3EQ7A 4PBZA 2UZXB 2QZPA 3EWEA 1S4UX 1U2VC 1I2MB 1UOOA 5M5UA 1K32A 3ZDZA 3OL2B 2OK6A 3OKYA 3EI1A 2VDPA 4CI1A 4AMYA 3FCSA 3MXXA 1QFSA 1XIPA 4ERYA 2AGZA 1SQ9A 3O4HA 1OLZA 2B4EA 3J81g 4A09B 2Z2NA 4UI9R 4GGAA 5I5JA 4DNVA 4NSXA 3SWSD 5GXIA 3UVMA 1VE6A 3JAMg 2J56H 4AX4A 5EAPA 2QR5A 4LGNA 4XYHA 5FFGA 4PXWA 3I7NA 3IUMA 3L4OD 3FM0A 2VDRA 4GM8A 2HU5A 1TYEA 4CZVA 2VZ3A 5FKSA 3IULA 5M61A 1H2WA 3I8EA 3KRXB 4A11A 4D9SA 5IJ8E 4L1QD 2EIEA 3C9CA 5EALA 3GREA 4PBYA 4J73A 1XHMA 4AEZA 1A0RB 5C2WB 3PE7A 2H9MA 3ORVD 4J77A 5IC7A 3KRWB 2Z2OA 4J81A 3EG6A 2YBAA 4ZOXA 4UM9A 2CN2A 3B7FA 2AH1A 1PI6A 2YNPA 5EMKB 3O4IA 4ZOZA 5EMJB 3BG1A 3MUOA 4JXMA 3UVLA 3AL8A 4ZOYA 5HE0B 4G55A 5E6SA 3GC3B 2HU7A 4K3JB 3OF7A 4CZXA 3V5WB 4J84A 1GOHA 5EMMB 3IUQA 1T2XA 2UZYB 3DDUA 3DXMC 1YFQA 4ZN4A 2G99A 4GQ2P 3EMHA 2VDQA 5SXMA 3SVWD 5CYKA 3ODTA 4GM3A 2TRCB 4FA4D 2EICA 4MMYA 2EIBA 3FRXA 3RLMD 1VZ2A 5I5IA 3UVNA 2XU7A 5E6UA 3I7LA 3EI1B 5GXHA 1JTDB 4MMZA 1GOTB 3VI4A 4DNWA 4E54A 2AGXA 4H5JA 4I79A 1M1XA 2XYIA 2IUPA 4FAND 2PM9B 4NENA 3JRPA 4ERQA 4L3HD 5EARA 2MTAH 2PBIB 1JMZB 2HU8A 4WJKA 4L9OA 1O6GA 4FHLA 1E8MA 4AN0A 4JSPC 4A0BA 5JWZA 2P9KC 5CXBA 4H5IA 4N14A 3IJCA 4JSXC 1RI6A 3MVDK 1C9LA 2I0TA 3IJ0A 4A11B 4Z7NA 2GC7A 4LG9A 4XYIA 2BBKH 5E6RA 3K6SA 3ZDXA 1O6FA 3IUJA 4X60B 1L5GA 4PSXB 3MKQA 2HXCA 4JT5C 3F3GA 5CXCA 5K19A 3C75H 5M5SA 3SJLD 4NBMA 4CZYA 3FGBA 3RN1D 2H6NA 1FWXA 4FB1D 5M5RA 4A0AB 4BP8A 2P9SC 4J87A 4GGCA 1JJUB 4A08A 2J55H 2QXVA 3ZE2A 4PSWB 4O3TB 3AL8B 3K27A 4J82A 3AL9A 3PXSD 1ERJA 4QRJA 4O3UB 1B9XA 4CY2A 1N6DA 3I89A 3L4MD 3IJ1A 4QT8A 2JKXA 4OWRA 5IGOA 5FLXg 5HE2B 3MKSB 3IIYA 4MK0B 2PM6B 4A2MA 3OTTA 1SQJA 4JSNC 2CE9A 5THAA 3V9FA 3CFSB 5CYKB 4AMZA 5C92A 3SBRA 4BUJC 2H68A 2P9PC 2XDWA 2OJYA 4QQEA 4K3ID 5EM2A 3ULEC 4J86A 4HDJA 3RFGA 1E5TA 1MG2A 3VGZA 4U7AA 1E8NA
chains in the Genus database with same CATH topology
5C9ZB 5AFU3 3F3FA 2B5NA 3I7KA 4J78A 4E54B 5C2VB 5FKTA 2Q7QA 3HFQA 3C99A 3EI3B 4D6VA 3SBPA 2AGWA 2HKMA 5I5MA 3JPXA 1MG3A 3F3PA 4OZUA 4ESGA 2HJBA 3UKRC 4LG8A 5CXBB 3GFCA 2I3TA 3OL2A 4IMMA 4YVDA 4X3EA 2EBSA 4GQBB 1QNIA 2B5LA 2HJ4A 3CIKB 5EMLB 3PSLA 3IIWA 4Y5RD 2GNQA 2GC4A 3I7HA 3OKYB 3VA6A 2IAAA 1PBYB 2AGYA 3PXWD 2H13A 4CY5A 5HYNB 4O9DA 4E5ZA 3SBQA 3SFZA 1JOFA 3N0DA 4BL0A 4A08B 5H1MA 3SHFA 5IT9g 1SHYB 2CNXA 3SMRA 4ES0A 2CO0A 3AH8B 4CI3A 3ZWLB 2P9LC 5AMSA 4IA9A 5EAMA 5FKRA 3P4FA 3MMYA 3OKWA 3IKOA 2AQ5A 2HKRA 3SXTD 3NVQA 3JB9L 1GG2B 3UVOA 2AGLA 4BH6A 3DXKC 5FA5B 2O9KA 4J79A 4KFMB 5K1CC 5FQDA 1R5MA 2I0RA 2YB8B 1N6EA 3EI4A 3PVWB 2B5MA 2I0SA 4X63B 3EI2A 2XL2A 3NVXA 3UVKA 3JROA 5TEFA 4R7AB 1N6FA 1XKSA 4J0XA 4Z8LA 3RRMC 3SCYA 3BWSA 3PXTD 4GZ8A 4J0WA 3I2NA 1TBGA 4FA5D 4CY1A 5IJ7E 4FWWA 2IUVA 2I3SA 4EWRA 2YNNA 2YMUA 3V7DB 1TYQC 5H14A 5HE1B 4CY3A 4FAVD 2XL3A 2AH0A 4PC0A 3MZKA 2HESX 4ERZA 2PM9A 4L3GD 2BCJB 1OMWB 3C5MA 4GQ1A 1NEXB 3VH0A 3NVNA 2H9PA 2CE8A 5HQGA 2IWKA 2Z2PA 3SN6B 2IURA 4E5ZB 2PM7B 3K26A 5HE3B 3DM0A 4U1EI 4GMBA 2H9LA 1GP2B 4JSVC 3EU7A 3UKUC 4CC9A 2P9UC 4QL1A 3PSCB 4CI2A 2OVPB 3MZLA 2J57G 4CI8A 4A0BB 2G9AA 3I7PA 1VYHC 5FXYA 3DSMA 3DWLC 4A7JA 4O1QD 4J8GA 3N0EA 4ZOVA 3JZGA 2HYEA 5IGQA 2CN3A 3A0FA 4A09A 1K8KC 4GGDA 4A0AA 3U4YA 4PNKB 2H47A 5TF2A 4AOWA 3CFVA 2P9IC 1MDAH 2OVQB 3EI4B 3W15A 3EI2B 5CXCB 2H6KA 4A2LA 2H3XA 4GM9A 3OKTA 1NR0A 2IWFA 5B4WA 3BG0A 1JMXB 2W18A 5TEEA 3UR4A 5GMKn 3I8CA 4G56B 4XEIC 5KDOB 1U4CA 4D0KA 2YNOA 1Q47A 3RFHA 1L0QA 4Y7RA 3AFCA 4X61B 4FA1D 4O45A 2QC5A 3PVUB 3RSEC 5H17A 3SLED 3JZHA 3J80g 1B9YA 3I7OA 5AJAA 4TZ4A 3EI3A 5TDHB 2H6QA 5EM2B 4J8BA 2H14A 1P22A 2IUQA 3RN0D 3E0CA 2H9NA 2OVRB 2P9NC 5GSAA 2OK4A 5A2Qg 1GXRA 4JD2C 4JT6C 1PEVA 2OIZA 5FKQA 3OW8A 4FA9D 2CO0C 3JZNA 1PGUA 3RMZD 4PBZA 2UZXB 3EWEA 1S4UX 1U2VC 1K32A 3OL2B 2OK6A 3OKYA 3EI1A 4CI1A 3MXXA 1XIPA 4ERYA 2AGZA 1SQ9A 1OLZA 2B4EA 3J81g 4A09B 2Z2NA 4UI9R 4GGAA 5I5JA 4NSXA 3SWSD 5GXIA 3UVMA 3JAMg 2J56H 5EAPA 4LGNA 4XYHA 4PXWA 3I7NA 3L4OD 3FM0A 4GM8A 4CZVA 5FKSA 5IJ8E 3I8EA 4A11A 3KRXB 4L1QD 3C9CA 5EALA 3GREA 4PBYA 4J73A 1XHMA 4AEZA 1A0RB 5C2WB 3PE7A 2H9MA 3ORVD 4J77A 5IC7A 3KRWB 2Z2OA 4J81A 3EG6A 2YBAA 4ZOXA 2CN2A 3B7FA 2AH1A 1PI6A 2YNPA 5EMKB 4ZOZA 5EMJB 3BG1A 4JXMA 3UVLA 3AL8A 4ZOYA 5HE0B 4K3JB 4CZXA 3V5WB 4J84A 5EMMB 2UZYB 3DXMC 1YFQA 4ZN4A 2G99A 4GQ2P 3EMHA 5SXMA 3SVWD 5CYKA 3ODTA 4GM3A 2TRCB 4FA4D 3FRXA 3RLMD 5I5IA 3UVNA 2XU7A 3I7LA 3EI1B 5GXHA 1GOTB 4E54A 2AGXA 4H5JA 4I79A 2XYIA 2IUPA 4FAND 2PM9B 3JRPA 4ERQA 4L3HD 5EARA 2MTAH 2PBIB 1JMZB 4L9OA 4FHLA 4JSPC 4A0BA 5JWZA 2P9KC 5CXBA 4H5IA 4N14A 3IJCA 4JSXC 1RI6A 2I0TA 3IJ0A 4A11B 2GC7A 4LG9A 4XYIA 2BBKH 4X60B 4PSXB 3MKQA 2HXCA 4JT5C 3F3GA 5CXCA 5K19A 3C75H 3SJLD 4CZYA 3FGBA 3RN1D 2H6NA 1FWXA 4FB1D 4A0AB 2P9SC 4J87A 4GGCA 1JJUB 4A08A 2J55H 2QXVA 4PSWB 4O3TB 3AL8B 3K27A 4J82A 3AL9A 3PXSD 1ERJA 4QRJA 4O3UB 1B9XA 4CY2A 1N6DA 3I89A 3L4MD 3IJ1A 4QT8A 4OWRA 5IGOA 5FLXg 5HE2B 3MKSB 3IIYA 4MK0B 2PM6B 4A2MA 3OTTA 1SQJA 4JSNC 2CE9A 5THAA 3V9FA 3CFSB 5CYKB 3SBRA 4BUJC 2H68A 2P9PC 4QQEA 2OJYA 4K3ID 5EM2A 3ULEC 4J86A 4HDJA 3RFGA 1MG2A 3VGZA 4U7AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C9Z B;  5AFU 3;  3F3F A;  2B5N A;  3I7K A;  4J78 A;  4E54 B;  5C2V B;  5FKT A;  2Q7Q A;  3HFQ A;  3C99 A;  3EI3 B;  4D6V A;  3SBP A;  2AGW A;  2HKM A;  5I5M A;  3JPX A;  1MG3 A;  3F3P A;  4OZU A;  4ESG A;  2HJB A;  3UKR C;  4LG8 A;  5CXB B;  3GFC A;  2I3T A;  3OL2 A;  4IMM A;  4YVD A;  4X3E A;  2EBS A;  4GQB B;  1QNI A;  2B5L A;  2HJ4 A;  3CIK B;  5EML B;  3PSL A;  3IIW A;  4Y5R D;  2GNQ A;  2GC4 A;  3I7H A;  3OKY B;  3VA6 A;  2IAA A;  1PBY B;  2AGY A;  3PXW D;  2H13 A;  4CY5 A;  5HYN B;  4O9D A;  4E5Z A;  3SBQ A;  3SFZ A;  1JOF A;  3N0D A;  4BL0 A;  4A08 B;  5H1M A;  3SHF A;  5IT9 g;  1SHY B;  2CNX A;  3SMR A;  4ES0 A;  2CO0 A;  3AH8 B;  4CI3 A;  3ZWL B;  2P9L C;  5AMS A;  4IA9 A;  5EAM A;  5FKR A;  3P4F A;  3MMY A;  3OKW A;  3IKO A;  2AQ5 A;  2HKR A;  3SXT D;  3NVQ A;  3JB9 L;  1GG2 B;  3UVO A;  2AGL A;  4BH6 A;  3DXK C;  5FA5 B;  2O9K A;  4J79 A;  4KFM B;  5K1C C;  5FQD A;  1R5M A;  2I0R A;  2YB8 B;  1N6E A;  3EI4 A;  3PVW B;  2B5M A;  2I0S A;  4X63 B;  3EI2 A;  2XL2 A;  3NVX A;  3UVK A;  3JRO A;  5TEF A;  4R7A B;  1N6F A;  1XKS A;  4J0X A;  4Z8L A;  3RRM C;  3SCY A;  3BWS A;  3PXT D;  4GZ8 A;  4J0W A;  3I2N A;  1TBG A;  4FA5 D;  4CY1 A;  5IJ7 E;  4FWW A;  2IUV A;  2I3S A;  4EWR A;  2YNN A;  2YMU A;  3V7D B;  1TYQ C;  5H14 A;  5HE1 B;  4CY3 A;  4FAV D;  2XL3 A;  2AH0 A;  4PC0 A;  3MZK A;  2HES X;  4ERZ A;  2PM9 A;  4L3G D;  2BCJ B;  1OMW B;  3C5M A;  4GQ1 A;  1NEX B;  3VH0 A;  3NVN A;  2H9P A;  2CE8 A;  5HQG A;  2IWK A;  2Z2P A;  3SN6 B;  2IUR A;  4E5Z B;  2PM7 B;  3K26 A;  5HE3 B;  3DM0 A;  4U1E I;  4GMB A;  2H9L A;  1GP2 B;  4JSV C;  3EU7 A;  3UKU C;  4CC9 A;  2P9U C;  4QL1 A;  3PSC B;  4CI2 A;  2OVP B;  3MZL A;  2J57 G;  4CI8 A;  4A0B B;  2G9A A;  3I7P A;  1VYH C;  5FXY A;  3DSM A;  3DWL C;  4A7J A;  4O1Q D;  4J8G A;  3N0E A;  4ZOV A;  3JZG A;  2HYE A;  5IGQ A;  2CN3 A;  3A0F A;  4A09 A;  1K8K C;  4GGD A;  4A0A A;  3U4Y A;  4PNK B;  2H47 A;  5TF2 A;  4AOW A;  3CFV A;  2P9I C;  1MDA H;  2OVQ B;  3EI4 B;  3W15 A;  3EI2 B;  5CXC B;  2H6K A;  4A2L A;  2H3X A;  4GM9 A;  3OKT A;  1NR0 A;  2IWF A;  5B4W A;  3BG0 A;  1JMX B;  2W18 A;  5TEE A;  3UR4 A;  5GMK n;  3I8C A;  4G56 B;  4XEI C;  5KDO B;  1U4C A;  4D0K A;  2YNO A;  1Q47 A;  3RFH A;  1L0Q A;  4Y7R A;  3AFC A;  4X61 B;  4FA1 D;  4O45 A;  2QC5 A;  3PVU B;  3RSE C;  5H17 A;  3SLE D;  3JZH A;  3J80 g;  1B9Y A;  3I7O A;  5AJA A;  4TZ4 A;  3EI3 A;  5TDH B;  2H6Q A;  5EM2 B;  4J8B A;  2H14 A;  1P22 A;  2IUQ A;  3RN0 D;  3E0C A;  2H9N A;  2OVR B;  2P9N C;  5GSA A;  2OK4 A;  5A2Q g;  1GXR A;  4JD2 C;  4JT6 C;  1PEV A;  2OIZ A;  5FKQ A;  3OW8 A;  4FA9 D;  2CO0 C;  3JZN A;  1PGU A;  3RMZ D;  4PBZ A;  2UZX B;  3EWE A;  1S4U X;  1U2V C;  1K32 A;  3OL2 B;  2OK6 A;  3OKY A;  3EI1 A;  4CI1 A;  3MXX A;  1XIP A;  4ERY A;  2AGZ A;  1SQ9 A;  1OLZ A;  2B4E A;  3J81 g;  4A09 B;  2Z2N A;  4UI9 R;  4GGA A;  5I5J A;  4NSX A;  3SWS D;  5GXI A;  3UVM A;  3JAM g;  2J56 H;  5EAP A;  4LGN A;  4XYH A;  4PXW A;  3I7N A;  3L4O D;  3FM0 A;  4GM8 A;  4CZV A;  5FKS A;  5IJ8 E;  3I8E A;  4A11 A;  3KRX B;  4L1Q D;  3C9C A;  5EAL A;  3GRE A;  4PBY A;  4J73 A;  1XHM A;  4AEZ A;  1A0R B;  5C2W B;  3PE7 A;  2H9M A;  3ORV D;  4J77 A;  5IC7 A;  3KRW B;  2Z2O A;  4J81 A;  3EG6 A;  2YBA A;  4ZOX A;  2CN2 A;  3B7F A;  2AH1 A;  1PI6 A;  2YNP A;  5EMK B;  4ZOZ A;  5EMJ B;  3BG1 A;  4JXM A;  3UVL A;  3AL8 A;  4ZOY A;  5HE0 B;  4K3J B;  4CZX A;  3V5W B;  4J84 A;  5EMM B;  2UZY B;  3DXM C;  1YFQ A;  4ZN4 A;  2G99 A;  4GQ2 P;  3EMH A;  5SXM A;  3SVW D;  5CYK A;  3ODT A;  4GM3 A;  2TRC B;  4FA4 D;  3FRX A;  3RLM D;  5I5I A;  3UVN A;  2XU7 A;  3I7L A;  3EI1 B;  5GXH A;  1GOT B;  4E54 A;  2AGX A;  4H5J A;  4I79 A;  2XYI A;  2IUP A;  4FAN D;  2PM9 B;  3JRP A;  4ERQ A;  4L3H D;  5EAR A;  2MTA H;  2PBI B;  1JMZ B;  4L9O A;  4FHL A;  4JSP C;  4A0B A;  5JWZ A;  2P9K C;  5CXB A;  4H5I A;  4N14 A;  3IJC A;  4JSX C;  1RI6 A;  2I0T A;  3IJ0 A;  4A11 B;  2GC7 A;  4LG9 A;  4XYI A;  2BBK H;  4X60 B;  4PSX B;  3MKQ A;  2HXC A;  4JT5 C;  3F3G A;  5CXC A;  5K19 A;  3C75 H;  3SJL D;  4CZY A;  3FGB A;  3RN1 D;  2H6N A;  1FWX A;  4FB1 D;  4A0A B;  2P9S C;  4J87 A;  4GGC A;  1JJU B;  4A08 A;  2J55 H;  2QXV A;  4PSW B;  4O3T B;  3AL8 B;  3K27 A;  4J82 A;  3AL9 A;  3PXS D;  1ERJ A;  4QRJ A;  4O3U B;  1B9X A;  4CY2 A;  1N6D A;  3I89 A;  3L4M D;  3IJ1 A;  4QT8 A;  4OWR A;  5IGO A;  5FLX g;  5HE2 B;  3MKS B;  3IIY A;  4MK0 B;  2PM6 B;  4A2M A;  3OTT A;  1SQJ A;  4JSN C;  2CE9 A;  5THA A;  3V9F A;  3CFS B;  5CYK B;  3SBR A;  4BUJ C;  2H68 A;  2P9P C;  4QQE A;  2OJY A;  4K3I D;  5EM2 A;  3ULE C;  4J86 A;  4HDJ A;  3RFG A;  1MG2 A;  3VGZ A;  4U7A A; 
#chains in the Genus database with same CATH topology
 5C9Z B;  5AFU 3;  3F3F A;  2B5N A;  3I7K A;  4J78 A;  4WK2 A;  4E54 B;  5C2V B;  5FKT A;  4L1M A;  2Q7Q A;  4Z7O A;  3HFQ A;  4BCC A;  4IRZ A;  3C99 A;  3EI3 B;  4D6V A;  3SBP A;  2VDN A;  2AGW A;  2HKM A;  5I5M A;  3JPX A;  1MG3 A;  3F3P A;  4OZU A;  4ESG A;  4BP9 A;  2HJB A;  3UKR C;  4LG8 A;  5CXB B;  1U8C A;  3GFC A;  2I3T A;  3OL2 A;  4IMM A;  4MMX A;  4YVD A;  4X3E A;  2EBS A;  3O4J A;  1QNI A;  4GQB B;  4O2W A;  2B5L A;  2HJ4 A;  3CIK B;  4BCB A;  4G1E A;  5EML B;  3PSL A;  3IIW A;  1K3I A;  4Y5R D;  2BKL A;  2GNQ A;  2GC4 A;  3I7H A;  2VZ1 A;  3OKY B;  2VDK A;  3VA6 A;  2IAA A;  1PBY B;  2AGY A;  3PXW D;  4JHP C;  2H13 A;  4CY5 A;  3ZE0 A;  5HYN B;  1UOP A;  3IVM A;  4O9D A;  4E5Z A;  1UOQ A;  3SBQ A;  3SFZ A;  1JOF A;  3N0D A;  4BL0 A;  4A08 B;  5H1M A;  3SHF A;  5IT9 g;  1SHY B;  3VI3 A;  2CNX A;  3SMR A;  4ES0 A;  1YR2 A;  3IJE A;  2CO0 A;  3AH8 B;  3K71 A;  4CI3 A;  3ZWL B;  2P9L C;  2VDO A;  3T3P A;  5AMS A;  2XZG A;  4IA9 A;  5EAM A;  5FKR A;  3P4F A;  3MMY A;  3NIG A;  3OKW A;  1QFM A;  3KCI A;  3IKO A;  2AQ5 A;  2HKR A;  3SXT D;  3NVQ A;  1UTC A;  3JB9 L;  1GG2 B;  3UVO A;  2AGL A;  4G1M A;  5FFO A;  4BH6 A;  3DXK C;  5FA5 B;  4WK4 A;  2O9K A;  3O4G A;  3MUN A;  4J79 A;  4KFM B;  5K1C C;  5FQD A;  1R5M A;  2I0R A;  2YB8 B;  1N6E A;  3EI4 A;  3GD1 I;  3PVW B;  2B5M A;  2I0S A;  4Z7Q A;  3QI0 A;  4X63 B;  3EI2 A;  2XL2 A;  3NVX A;  3UVK A;  3T3M A;  3JRO A;  5TEF A;  4R7A B;  4JHN A;  1A12 A;  1N6F A;  1XKS A;  4J0X A;  4Z8L A;  3IUR A;  3RRM C;  3SCY A;  3BWS A;  3PXT D;  4GZ8 A;  4J0W A;  5HDB A;  3I2N A;  1TBG A;  2VDM A;  4FA5 D;  4CY1 A;  5IJ7 E;  4FWW A;  2IUV A;  2I3S A;  4EWR A;  2YNN A;  2YMU A;  3V7D B;  4AN1 A;  1TYQ C;  5H14 A;  5HE1 B;  4CY3 A;  4FAV D;  2XL3 A;  2AH0 A;  3EQ8 A;  3ZDY A;  4PC0 A;  3MZK A;  2HES X;  4UM8 A;  4ERZ A;  2PM9 A;  4L3G D;  2BCJ B;  1OMW B;  2VC2 A;  3C5M A;  4GQ1 A;  1NEX B;  3VH0 A;  4O02 A;  3NVN A;  2H9P A;  2CE8 A;  3NIF A;  5HQG A;  2IWK A;  2Z2P A;  4RE5 A;  3SN6 B;  2IUR A;  4E5Z B;  2PM7 B;  2WQ8 A;  3K26 A;  3DM0 A;  5HE3 B;  4U1E I;  4NAA A;  4GMB A;  2H9L A;  1C9I A;  1GP2 B;  4JSV C;  3EU7 A;  3UKU C;  4CC9 A;  2P9U C;  4QL1 A;  3PSC B;  4CI2 A;  3ZE1 A;  2OVP B;  3FCU A;  3MZL A;  5M5V A;  2J57 G;  4CI8 A;  4A0B B;  2G9A A;  3I7P A;  1VYH C;  5FXY A;  3DSM A;  3DWL C;  1JV2 A;  4A7J A;  3QHY B;  4O1Q D;  4J8G A;  3N0E A;  4NC4 A;  4ZOV A;  1H2Y A;  1VE7 A;  3JZG A;  2HYE A;  2XE4 A;  4BCD A;  5IGQ A;  2CN3 A;  3A0F A;  1BPO A;  4A09 A;  1K8K C;  4GGD A;  4A0A A;  3U4Y A;  2VDL A;  4PNK B;  2H47 A;  5TF2 A;  4AOW A;  5C86 A;  3CFV A;  5M5T A;  2P9I C;  1MDA H;  2OVQ B;  3EI4 B;  3W15 A;  3EI2 B;  5CXC B;  2H6K A;  3NID A;  4A2L A;  2H3X A;  4GM9 A;  3OKT A;  1NR0 A;  2IWF A;  5B4W A;  3BG0 A;  1JMX B;  2W18 A;  5TEE A;  3UR4 A;  3V4V A;  5GMK n;  3EQ9 A;  3I8C A;  4G56 B;  4XEI C;  5KDO B;  1U4C A;  4D0K A;  2YNO A;  1Q47 A;  3RFH A;  1L0Q A;  4Y7R A;  3AFC A;  4X61 B;  4FA1 D;  4O45 A;  2QC5 A;  3PVU B;  3RSE C;  4WK0 A;  1H2Z A;  5H17 A;  3SLE D;  3V4P A;  1VZ3 A;  3JZH A;  3IUN A;  3J80 g;  1B9Y A;  3I7O A;  5AJA A;  4TZ4 A;  3EI3 A;  5TDH B;  2H6Q A;  5EM2 B;  4J8B A;  2H14 A;  1P22 A;  2IUQ A;  4RE6 A;  4DNU A;  3RN0 D;  1H2X A;  3K72 A;  3E0C A;  1GOF A;  2H9N A;  2OVR B;  2P9N C;  5GSA A;  4QAM A;  2OK4 A;  5A2Q g;  1GXR A;  4JD2 C;  4JT6 C;  1PEV A;  2EID A;  2OIZ A;  5FKQ A;  3OW8 A;  4FA9 D;  1GOG A;  2CO0 C;  1PGU A;  3JZN A;  3RMZ D;  3EQ7 A;  4PBZ A;  2UZX B;  2QZP A;  3EWE A;  1S4U X;  1U2V C;  1I2M B;  1UOO A;  5M5U A;  1K32 A;  3ZDZ A;  3OL2 B;  2OK6 A;  3OKY A;  3EI1 A;  2VDP A;  4CI1 A;  4AMY A;  3FCS A;  3MXX A;  1QFS A;  1XIP A;  4ERY A;  2AGZ A;  1SQ9 A;  3O4H A;  1OLZ A;  2B4E A;  3J81 g;  4A09 B;  2Z2N A;  4UI9 R;  4GGA A;  5I5J A;  4DNV A;  4NSX A;  3SWS D;  5GXI A;  3UVM A;  1VE6 A;  3JAM g;  2J56 H;  4AX4 A;  5EAP A;  2QR5 A;  4LGN A;  4XYH A;  5FFG A;  4PXW A;  3I7N A;  3IUM A;  3L4O D;  3FM0 A;  2VDR A;  4GM8 A;  2HU5 A;  1TYE A;  4CZV A;  2VZ3 A;  5FKS A;  3IUL A;  5M61 A;  1H2W A;  3I8E A;  3KRX B;  4A11 A;  4D9S A;  5IJ8 E;  4L1Q D;  2EIE A;  3C9C A;  5EAL A;  3GRE A;  4PBY A;  4J73 A;  1XHM A;  4AEZ A;  1A0R B;  5C2W B;  3PE7 A;  2H9M A;  3ORV D;  4J77 A;  5IC7 A;  3KRW B;  2Z2O A;  4J81 A;  3EG6 A;  2YBA A;  4ZOX A;  4UM9 A;  2CN2 A;  3B7F A;  2AH1 A;  1PI6 A;  2YNP A;  5EMK B;  3O4I A;  4ZOZ A;  5EMJ B;  3BG1 A;  3MUO A;  4JXM A;  3UVL A;  3AL8 A;  4ZOY A;  5HE0 B;  4G55 A;  5E6S A;  3GC3 B;  2HU7 A;  4K3J B;  3OF7 A;  4CZX A;  3V5W B;  4J84 A;  1GOH A;  5EMM B;  3IUQ A;  1T2X A;  2UZY B;  3DDU A;  3DXM C;  1YFQ A;  4ZN4 A;  2G99 A;  4GQ2 P;  3EMH A;  2VDQ A;  5SXM A;  3SVW D;  5CYK A;  3ODT A;  4GM3 A;  2TRC B;  4FA4 D;  2EIC A;  4MMY A;  2EIB A;  3FRX A;  3RLM D;  1VZ2 A;  5I5I A;  3UVN A;  2XU7 A;  5E6U A;  3I7L A;  3EI1 B;  5GXH A;  1JTD B;  4MMZ A;  1GOT B;  3VI4 A;  4DNW A;  4E54 A;  2AGX A;  4H5J A;  4I79 A;  1M1X A;  2XYI A;  2IUP A;  4FAN D;  2PM9 B;  4NEN A;  3JRP A;  4ERQ A;  4L3H D;  5EAR A;  2MTA H;  2PBI B;  1JMZ B;  2HU8 A;  4WJK A;  4L9O A;  1O6G A;  4FHL A;  1E8M A;  4AN0 A;  4JSP C;  4A0B A;  5JWZ A;  2P9K C;  5CXB A;  4H5I A;  4N14 A;  3IJC A;  4JSX C;  1RI6 A;  3MVD K;  1C9L A;  2I0T A;  3IJ0 A;  4A11 B;  4Z7N A;  2GC7 A;  4LG9 A;  4XYI A;  2BBK H;  5E6R A;  3K6S A;  3ZDX A;  1O6F A;  3IUJ A;  4X60 B;  1L5G A;  4PSX B;  3MKQ A;  2HXC A;  4JT5 C;  3F3G A;  5CXC A;  5K19 A;  3C75 H;  5M5S A;  3SJL D;  4NBM A;  4CZY A;  3FGB A;  3RN1 D;  2H6N A;  1FWX A;  4FB1 D;  5M5R A;  4A0A B;  4BP8 A;  2P9S C;  4J87 A;  4GGC A;  1JJU B;  4A08 A;  2J55 H;  2QXV A;  3ZE2 A;  4PSW B;  4O3T B;  3AL8 B;  3K27 A;  4J82 A;  3AL9 A;  3PXS D;  1ERJ A;  4QRJ A;  4O3U B;  1B9X A;  4CY2 A;  1N6D A;  3I89 A;  3L4M D;  3IJ1 A;  4QT8 A;  2JKX A;  4OWR A;  5IGO A;  5FLX g;  5HE2 B;  3MKS B;  3IIY A;  4MK0 B;  2PM6 B;  4A2M A;  3OTT A;  1SQJ A;  4JSN C;  2CE9 A;  5THA A;  3V9F A;  3CFS B;  5CYK B;  4AMZ A;  5C92 A;  3SBR A;  4BUJ C;  2H68 A;  2P9P C;  2XDW A;  2OJY A;  4QQE A;  4K3I D;  5EM2 A;  3ULE C;  4J86 A;  4HDJ A;  3RFG A;  1E5T A;  1MG2 A;  3VGZ A;  4U7A A;  1E8N A; 
#chains in the Genus database with same CATH homology
 5C9Z B;  5AFU 3;  3F3F A;  2B5N A;  3I7K A;  4J78 A;  4E54 B;  5C2V B;  5FKT A;  2Q7Q A;  3HFQ A;  3C99 A;  3EI3 B;  4D6V A;  3SBP A;  2AGW A;  2HKM A;  5I5M A;  3JPX A;  1MG3 A;  3F3P A;  4OZU A;  4ESG A;  2HJB A;  3UKR C;  4LG8 A;  5CXB B;  3GFC A;  2I3T A;  3OL2 A;  4IMM A;  4YVD A;  4X3E A;  2EBS A;  4GQB B;  1QNI A;  2B5L A;  2HJ4 A;  3CIK B;  5EML B;  3PSL A;  3IIW A;  4Y5R D;  2GNQ A;  2GC4 A;  3I7H A;  3OKY B;  3VA6 A;  2IAA A;  1PBY B;  2AGY A;  3PXW D;  2H13 A;  4CY5 A;  5HYN B;  4O9D A;  4E5Z A;  3SBQ A;  3SFZ A;  1JOF A;  3N0D A;  4BL0 A;  4A08 B;  5H1M A;  3SHF A;  5IT9 g;  1SHY B;  2CNX A;  3SMR A;  4ES0 A;  2CO0 A;  3AH8 B;  4CI3 A;  3ZWL B;  2P9L C;  5AMS A;  4IA9 A;  5EAM A;  5FKR A;  3P4F A;  3MMY A;  3OKW A;  3IKO A;  2AQ5 A;  2HKR A;  3SXT D;  3NVQ A;  3JB9 L;  1GG2 B;  3UVO A;  2AGL A;  4BH6 A;  3DXK C;  5FA5 B;  2O9K A;  4J79 A;  4KFM B;  5K1C C;  5FQD A;  1R5M A;  2I0R A;  2YB8 B;  1N6E A;  3EI4 A;  3PVW B;  2B5M A;  2I0S A;  4X63 B;  3EI2 A;  2XL2 A;  3NVX A;  3UVK A;  3JRO A;  5TEF A;  4R7A B;  1N6F A;  1XKS A;  4J0X A;  4Z8L A;  3RRM C;  3SCY A;  3BWS A;  3PXT D;  4GZ8 A;  4J0W A;  3I2N A;  1TBG A;  4FA5 D;  4CY1 A;  5IJ7 E;  4FWW A;  2IUV A;  2I3S A;  4EWR A;  2YNN A;  2YMU A;  3V7D B;  1TYQ C;  5H14 A;  5HE1 B;  4CY3 A;  4FAV D;  2XL3 A;  2AH0 A;  4PC0 A;  3MZK A;  2HES X;  4ERZ A;  2PM9 A;  4L3G D;  2BCJ B;  1OMW B;  3C5M A;  4GQ1 A;  1NEX B;  3VH0 A;  3NVN A;  2H9P A;  2CE8 A;  5HQG A;  2IWK A;  2Z2P A;  3SN6 B;  2IUR A;  4E5Z B;  2PM7 B;  3K26 A;  5HE3 B;  3DM0 A;  4U1E I;  4GMB A;  2H9L A;  1GP2 B;  4JSV C;  3EU7 A;  3UKU C;  4CC9 A;  2P9U C;  4QL1 A;  3PSC B;  4CI2 A;  2OVP B;  3MZL A;  2J57 G;  4CI8 A;  4A0B B;  2G9A A;  3I7P A;  1VYH C;  5FXY A;  3DSM A;  3DWL C;  4A7J A;  4O1Q D;  4J8G A;  3N0E A;  4ZOV A;  3JZG A;  2HYE A;  5IGQ A;  2CN3 A;  3A0F A;  4A09 A;  1K8K C;  4GGD A;  4A0A A;  3U4Y A;  4PNK B;  2H47 A;  5TF2 A;  4AOW A;  3CFV A;  2P9I C;  1MDA H;  2OVQ B;  3EI4 B;  3W15 A;  3EI2 B;  5CXC B;  2H6K A;  4A2L A;  2H3X A;  4GM9 A;  3OKT A;  1NR0 A;  2IWF A;  5B4W A;  3BG0 A;  1JMX B;  2W18 A;  5TEE A;  3UR4 A;  5GMK n;  3I8C A;  4G56 B;  4XEI C;  5KDO B;  1U4C A;  4D0K A;  2YNO A;  1Q47 A;  3RFH A;  1L0Q A;  4Y7R A;  3AFC A;  4X61 B;  4FA1 D;  4O45 A;  2QC5 A;  3PVU B;  3RSE C;  5H17 A;  3SLE D;  3JZH A;  3J80 g;  1B9Y A;  3I7O A;  5AJA A;  4TZ4 A;  3EI3 A;  5TDH B;  2H6Q A;  5EM2 B;  4J8B A;  2H14 A;  1P22 A;  2IUQ A;  3RN0 D;  3E0C A;  2H9N A;  2OVR B;  2P9N C;  5GSA A;  2OK4 A;  5A2Q g;  1GXR A;  4JD2 C;  4JT6 C;  1PEV A;  2OIZ A;  5FKQ A;  3OW8 A;  4FA9 D;  2CO0 C;  3JZN A;  1PGU A;  3RMZ D;  4PBZ A;  2UZX B;  3EWE A;  1S4U X;  1U2V C;  1K32 A;  3OL2 B;  2OK6 A;  3OKY A;  3EI1 A;  4CI1 A;  3MXX A;  1XIP A;  4ERY A;  2AGZ A;  1SQ9 A;  1OLZ A;  2B4E A;  3J81 g;  4A09 B;  2Z2N A;  4UI9 R;  4GGA A;  5I5J A;  4NSX A;  3SWS D;  5GXI A;  3UVM A;  3JAM g;  2J56 H;  5EAP A;  4LGN A;  4XYH A;  4PXW A;  3I7N A;  3L4O D;  3FM0 A;  4GM8 A;  4CZV A;  5FKS A;  5IJ8 E;  3I8E A;  4A11 A;  3KRX B;  4L1Q D;  3C9C A;  5EAL A;  3GRE A;  4PBY A;  4J73 A;  1XHM A;  4AEZ A;  1A0R B;  5C2W B;  3PE7 A;  2H9M A;  3ORV D;  4J77 A;  5IC7 A;  3KRW B;  2Z2O A;  4J81 A;  3EG6 A;  2YBA A;  4ZOX A;  2CN2 A;  3B7F A;  2AH1 A;  1PI6 A;  2YNP A;  5EMK B;  4ZOZ A;  5EMJ B;  3BG1 A;  4JXM A;  3UVL A;  3AL8 A;  4ZOY A;  5HE0 B;  4K3J B;  4CZX A;  3V5W B;  4J84 A;  5EMM B;  2UZY B;  3DXM C;  1YFQ A;  4ZN4 A;  2G99 A;  4GQ2 P;  3EMH A;  5SXM A;  3SVW D;  5CYK A;  3ODT A;  4GM3 A;  2TRC B;  4FA4 D;  3FRX A;  3RLM D;  5I5I A;  3UVN A;  2XU7 A;  3I7L A;  3EI1 B;  5GXH A;  1GOT B;  4E54 A;  2AGX A;  4H5J A;  4I79 A;  2XYI A;  2IUP A;  4FAN D;  2PM9 B;  3JRP A;  4ERQ A;  4L3H D;  5EAR A;  2MTA H;  2PBI B;  1JMZ B;  4L9O A;  4FHL A;  4JSP C;  4A0B A;  5JWZ A;  2P9K C;  5CXB A;  4H5I A;  4N14 A;  3IJC A;  4JSX C;  1RI6 A;  2I0T A;  3IJ0 A;  4A11 B;  2GC7 A;  4LG9 A;  4XYI A;  2BBK H;  4X60 B;  4PSX B;  3MKQ A;  2HXC A;  4JT5 C;  3F3G A;  5CXC A;  5K19 A;  3C75 H;  3SJL D;  4CZY A;  3FGB A;  3RN1 D;  2H6N A;  1FWX A;  4FB1 D;  4A0A B;  2P9S C;  4J87 A;  4GGC A;  1JJU B;  4A08 A;  2J55 H;  2QXV A;  4PSW B;  4O3T B;  3AL8 B;  3K27 A;  4J82 A;  3AL9 A;  3PXS D;  1ERJ A;  4QRJ A;  4O3U B;  1B9X A;  4CY2 A;  1N6D A;  3I89 A;  3L4M D;  3IJ1 A;  4QT8 A;  4OWR A;  5IGO A;  5FLX g;  5HE2 B;  3MKS B;  3IIY A;  4MK0 B;  2PM6 B;  4A2M A;  3OTT A;  1SQJ A;  4JSN C;  2CE9 A;  5THA A;  3V9F A;  3CFS B;  5CYK B;  3SBR A;  4BUJ C;  2H68 A;  2P9P C;  4QQE A;  2OJY A;  4K3I D;  5EM2 A;  3ULE C;  4J86 A;  4HDJ A;  3RFG A;  1MG2 A;  3VGZ A;  4U7A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...