2YMUA

Structure of a highly repetitive propeller structure
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
577
structure length
577
Chain Sequence
GSHMGVKERNRLEAHSSSVRGVAFSPDGQTIASASDDKTVKLWNRNGQLLQTLTGHSSSVWGVAFSPDGQTIASASDDKTVKLWNRNGQLLQTLTGHSSSVRGVAFSPDGQTIASASDDKTVKLWNRNGQLLQTLTGHSSSVWGVAFSPDGQTIASASDDKTVKLWNRNGQLLQTLTGHSSSVWGVAFSPDGQTIASASDDKTVKLWNRNGQLLQTLTGHSSSVRGVAFSPDGQTIASASDDKTVKLWNRNGQLLQTLTGHSSSVNGVAFRPDGQTIASASDDKTVKLWNRNGQLLQTLTGHSSSVWGVAFSPDGQTIASASDDKTVKLWNRNGQHLQTLTGHSSSVWGVAFSPDGQTIASASDDKTVKLWNRNGQLLQTLTGHSSSVRGVAFSPDGQTIASASDDKTVKLWNRNGQLLQTLTGHSSSVWGVAFSPDDQTIASASDDKTVKLWNRNGQLLQTLTGHSSSVRGVAFSPDGQTIASASDDKTVKLWNRNGQLLQTLTGHSSSVRGVAFSPDGQTIASASDDKTVKLWNRNGQLLQTLTGHSSSVWGVAFSPDGQTIASASSDKTVKLWN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Unknown function
molecule keywords WD-40 REPEAT PROTEIN
publication title Structure of a Highly Repetitive Propeller Structure
rcsb
source organism Nostoc punctiforme
total genus 179
structure length 577
sequence length 577
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2ymuA01
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2ymuA02
5HE3B 2CE9A 1XKSA 3UVNA 5AJAA 5H1MA 5C2WB 2YNNA 2OVPB 3CFSB 3SN6B 2B4EA 2IUPA 1XHMA 3IJCA 2XYIA 4TZ4A 2OJYA 3EMHA 3L4MD 3I89A 3V9FA 2AH1A 3B7FA 2XU7A 3RSEC 4N14A 4XYIA 3BG1A 4ZOYA 3EI2B 3PVUB 5K1CC 4J82A 4CZYA 1P22A 4ERYA 2AH0A 4GZ8A 2I3TA 3F3GA 3I8CA 4GM3A 3A0FA 3OW8A 4J73A 3VA6A 4A11B 4CI3A 3I7HA 3V7DB 4A08A 3I7NA 4ESGA 2UZYB 2I0TA 3RN1D 4FHLA 5FKSA 3OKYA 5EM2A 5CYKA 4JSXC 2QC5A 1OLZA 3AL9A 1GG2B 3NVQA 5HE2B 4GGDA 2H47A 2CE8A 1XIPA 2HJBA 2AGZA 2GC4A 2H9NA 3P4FA 3UKRC 4O45A 3EI3A 3MXXA 3JRPA 3C9CA 5TEEA 2P9NC 3RFGA 4E54A 2HJ4A 2I0RA 3JZGA 1FWXA 2GC7A 2HKRA 4JT5C 4PSWB 4A09A 2YB8B 3IJ1A 1NEXB 1Q47A 3VGZA 4FA4D 1TYQC 3C99A 2CO0C 3EI4A 2IURA 3UVMA 3KRWB 3PE7A 3E0CA 4MK0B 1U4CA 4L1QD 2H3XA 3ODTA 3J81g 3W15A 4J79A 3V5WB 4K3JB 4QL1A 4GQBB 2I0SA 2J56H 3SFZA 3UR4A 4OZUA 4X63B 4FAND 3RN0D 4CC9A 5EMLB 4JSNC 4JXMA 4LG8A 5IGOA 4CY1A 3DXKC 3MKQA 3SWSD 1A0RB 5CXBB 1RI6A 5FKRA 4CZXA 3I7KA 5FKQA 2H14A 3NVNA 5IT9g 1ERJA 5JWZA 3OKTA 5FXYA 5H17A 4FAVD 2J57G 3JZNA 3OKYB 5CYKB 3SJLD 3PSCB 4G56B 2HYEA 4A0BB 3FRXA 2OVQB 3N0EA 2XL2A 4XYHA 4O3TB 4L3HD 2I3SA 1PI6A 5EARA 3I2NA 4O9DA 3MZLA 4FA5D 1GOTB 1PEVA 1L0QA 2EBSA 3F3FA 2CN2A 4IMMA 3UVLA 3UVKA 4E54B 3AFCA 5I5JA 5C9ZB 4Z8LA 2YMUA 5FA5B 4FA9D 5HYNB 3K27A 4A09B 4X61B 4L9OA 1JOFA 4ERZA 4QQEA 3K26A 4PBZA 3U4YA 4FWWA 3EI1A 4Y7RA 3SBQA 2AGYA 1OMWB 3OKWA 4LG9A 2XL3A 4ZN4A 4GMBA 5HE0B 2Z2OA 2J55H 3PXWD 2PM7B 3EG6A 4JD2C 3RMZD 5SXMA 5CXCB 1SHYB 3ORVD 3SVWD 5GXHA 5EMKB 2G99A 4I79A 4ZOZA 2P9SC 4JT6C 3I7LA 3OTTA 3MKSB 4PBYA 5FLXg 4QT8A 1U2VC 5EMJB 4J8GA 5TF2A 4CZVA 3IJ0A 5EAPA 3PXSD 2IUQA 1N6FA 1K8KC 4R7AB 4X60B 1B9YA 2BCJB 5GMKn 3DM0A 4BL0A 2CNXA 2AGWA 2Z2PA 4ES0A 5EAMA 4GGCA 2HKMA 2IAAA 3PSLA 3GREA 4ZOVA 1B9XA 3ULEC 4H5IA 2AGXA 3BG0A 4U7AA 5I5IA 4CY3A 4L3GD 4CI1A 1NR0A 2H6KA 4CI8A 2YNOA 2PM9A 5TDHB 2QXVA 2HESX 4CY5A 1K32A 1JMZB 1TBGA 4A0AA 2AGLA 3CIKB 3I7PA 2AQ5A 3RLMD 5HE1B 2OIZA 2YNPA 2PBIB 4GM9A 5HQGA 4NSXA 4FB1D 2IWFA 3KRXB 2TRCB 3JB9L 2G9AA 3C75H 3OL2A 4J77A 1SQJA 3AL8A 4A08B 5IJ7E 2OVRB 1JMXB 2H13A 2OK4A 4E5ZA 4AOWA 2B5NA 5EM2B 5FKTA 5H14A 1QNIA 1GP2B 5B4WA 2YBAA 5A2Qg 4LGNA 3IKOA 4CI2A 3EI3B 4GGAA 4Y5RD 2H9PA 3PVWB 2BBKH 4PXWA 5KDOB 3MZKA 2O9KA 3N0DA 3JZHA 2MTAH 3JROA 4JSVC 3I7OA 5AFU3 4J81A 3UKUC 2P9LC 4CY2A 2P9PC 5FQDA 3AH8B 3EWEA 3EI4B 4JSPC 3SBPA 1N6DA 2H6QA 3UVOA 2PM9B 4H5JA 3SMRA 1VYHC 4IA9A 1SQ9A 2IWKA 4QRJA 4J0XA 4A0AB 5CXBA 4BUJC 2IUVA 2P9IC 3SLED 3PXTD 5EALA 4O3UB 3JPXA 4UI9R 2H68A 4J86A 3CFVA 4EWRA 3J80g 5IC7A 4OWRA 3HFQA 3C5MA 4XEIC 4GQ2P 4AEZA 3OL2B 4A0BA 3L4OD 4O1QD 3I8EA 5THAA 1JJUB 5TEFA 3AL8B 2B5MA 4KFMB 3RRMC 2P9UC 1MG2A 4GQ1A 4J8BA 4E5ZB 4HDJA 2GNQA 4X3EA 2UZXB 1MDAH 4K3ID 1S4UX 5C2VB 3RFHA 2Z2NA 3EI2A 4PC0A 3EU7A 3GFCA 3ZWLB 3DWLC 3SHFA 4BH6A 2OK6A 5AMSA 5EMMB 4GM8A 4A11A 2B5LA 1GXRA 3VH0A 2PM6B 3DSMA 3SCYA 3SBRA 4D6VA 1YFQA 5GXIA 2HXCA 4ERQA 5CXCA 4FA1D 4YVDA 1PBYB 3EI1B 3F3PA 4J78A 3SXTD 2H6NA 2Q7QA 4J87A 4PSXB 3NVXA 4U1EI 5IJ8E 2CN3A 3MMYA 2H9MA 2H9LA 4J0WA 1MG3A 5GSAA 2P9KC 4A2LA 4A7JA 3FM0A 2W18A 1PGUA 1R5MA 4J84A 2CO0A 3FGBA 4D0KA 3JAMg 3BWSA 4ZOXA 4A2MA 1N6EA 5K19A 5IGQA 4PNKB 3IIYA 3DXMC 5I5MA 3IIWA
chains in the Genus database with same CATH superfamily
4QAMA 5HE3B 2CE9A 1XKSA 3UVNA 5AJAA 5H1MA 5C2WB 2YNNA 2OVPB 4JHPC 3CFSB 3SN6B 4MMYA 2B4EA 2IUPA 4WK0A 1XHMA 3IJCA 2XYIA 4TZ4A 2OJYA 3EMHA 3L4MD 5FFOA 3I89A 3V9FA 2AH1A 4RE5A 3B7FA 2XU7A 4UM9A 3RSEC 4N14A 4XYIA 3BG1A 4ZOYA 3EI2B 3PVUB 3KCIA 5K1CC 4J82A 4CZYA 1BPOA 1P22A 4ERYA 2AH0A 4GZ8A 2I3TA 2QR5A 3F3GA 3I8CA 3MUNA 1C9IA 4GM3A 2VZ1A 3A0FA 3OW8A 4J73A 3VA6A 4A11B 4CI3A 1M1XA 3I7HA 3V7DB 4A08A 3I7NA 1A12A 4ESGA 2UZYB 2I0TA 3RN1D 4FHLA 5FKSA 1K3IA 3OKYA 5EM2A 5CYKA 4JSXC 2QC5A 1OLZA 3AL9A 1GG2B 1T2XA 3NVQA 4NAAA 3EQ9A 5HE2B 4GGDA 2H47A 2CE8A 1XIPA 2HJBA 2AGZA 2GC4A 2H9NA 3P4FA 3UKRC 4O45A 3EI3A 3MXXA 1I2MB 3NIGA 3GC3B 3JRPA 3C9CA 5TEEA 2P9NC 3RFGA 4E54A 2HJ4A 2I0RA 3JZGA 2EICA 3IULA 3T3MA 1FWXA 2GC7A 2HKRA 1H2XA 4JT5C 4PSWB 4A09A 2YB8B 3IJ1A 1NEXB 4G1EA 1Q47A 3NIFA 3VGZA 4FA4D 1TYQC 4NC4A 5M61A 3C99A 2CO0C 1QFSA 3IJEA 2VDMA 3EI4A 2IURA 3UVMA 3KRWB 3PE7A 4DNWA 3E0CA 4MK0B 1U4CA 4L1QD 3ZDXA 4WK4A 2H3XA 3DDUA 3IURA 3ODTA 4Z7QA 4BCDA 3J81g 3W15A 4J79A 3ZE1A 4AN0A 3V5WB 3FCUA 4K3JB 4QL1A 4GQBB 2I0SA 4DNUA 2J56H 3SFZA 3UR4A 2VDLA 4OZUA 4X63B 4FAND 3RN0D 4CC9A 4BP8A 3K72A 5EMLB 4JSNC 4JXMA 4LG8A 5IGOA 4L1MA 4CY1A 3DXKC 3MKQA 3SWSD 3EQ8A 1A0RB 3ZDYA 5CXBB 1RI6A 4JHNA 5FKRA 3I7KA 4CZXA 5FKQA 2H14A 3IUMA 2XE4A 3NVNA 5IT9g 1ERJA 5JWZA 3OKTA 5FXYA 4G1MA 5H17A 4FAVD 2J57G 3JZNA 3OKYB 5CYKB 3SJLD 1O6FA 4D9SA 2VZ3A 3OF7A 3PSCB 4G56B 2HYEA 4A0BB 3FRXA 2OVQB 3N0EA 2XL2A 4XYHA 4O3TB 4L3HD 2I3SA 1PI6A 5EARA 2WQ8A 3I2NA 4O9DA 3MZLA 4FA5D 1GOTB 5C86A 1PEVA 1L0QA 2EBSA 3F3FA 2CN2A 3V4VA 4IMMA 3UVLA 3UVKA 4E54B 3AFCA 1QFMA 5I5JA 5C9ZB 4Z8LA 2HU5A 2YMUA 5FA5B 4BCBA 4FA9D 5HYNB 3K27A 4A09B 5HDBA 4X61B 4L9OA 2HU8A 1JOFA 4ERZA 4QQEA 3K26A 4PBZA 3U4YA 4FWWA 3EI1A 4Y7RA 3SBQA 2AGYA 5M5UA 1OMWB 3OKWA 4LG9A 2XL3A 4ZN4A 5E6RA 1GOGA 4GMBA 5HE0B 2Z2OA 2J55H 3PXWD 2PM7B 3EG6A 4JD2C 3RMZD 5SXMA 5CXCB 1SHYB 2VDKA 3ORVD 3EQ7A 3SVWD 4WJKA 3O4HA 5EMKB 5GXHA 4BP9A 2G99A 4I79A 2VDNA 1TYEA 4ZOZA 2P9SC 4JT6C 3I7LA 4AMYA 3OTTA 3MKSB 4PBYA 5FLXg 4Z7OA 4QT8A 1U2VC 5EMJB 4J8GA 5TF2A 4CZVA 3IJ0A 5EAPA 1GOHA 3PXSD 2IUQA 1N6FA 1K8KC 4R7AB 4X60B 1B9YA 2BCJB 5GMKn 3DM0A 4BL0A 2CNXA 2VDQA 2AGWA 2VC2A 2Z2PA 4ES0A 5EAMA 3K71A 4GGCA 2HKMA 2IAAA 3PSLA 2QZPA 1E8NA 3GREA 5M5TA 2HU7A 2EIBA 1B9XA 4ZOVA 3ULEC 4H5IA 2AGXA 3BG0A 4U7AA 1JV2A 5I5IA 4CY3A 3IVMA 4L3GD 4CI1A 1NR0A 2H6KA 4CI8A 2YNOA 2PM9A 5TDHB 3NIDA 2QXVA 1UOQA 2HESX 3GD1I 4CY5A 1K32A 2VDPA 1JMZB 1TBGA 4A0AA 2AGLA 2EIEA 3CIKB 3I7PA 2AQ5A 3RLMD 4AN1A 5HE1B 3O4GA 2OIZA 2YNPA 2PBIB 4GM9A 5HQGA 3K6SA 4NSXA 5M5VA 4FB1D 2IWFA 5E6SA 3KRXB 2TRCB 3JB9L 2G9AA 5C92A 3C75H 3OL2A 1UOOA 4J77A 1SQJA 1VE6A 3AL8A 1C9LA 4A08B 5IJ7E 2OVRB 1JMXB 1GOFA 2H13A 2OK4A 4E5ZA 4AOWA 2B5NA 5EM2B 5FKTA 3MUOA 5H14A 3IUNA 1QNIA 1GP2B 5B4WA 2YBAA 5A2Qg 4NENA 4LGNA 3IKOA 4UM8A 4CI2A 4MMZA 3EI3B 4GGAA 4AX4A 4Y5RD 4O2WA 2H9PA 3PVWB 2BBKH 4PXWA 5KDOB 3MZKA 2O9KA 3N0DA 3V4PA 3JZHA 2MTAH 3JROA 3ZDZA 4JSVC 3I7OA 5AFU3 3O4IA 4J81A 2P9LC 3UKUC 1H2WA 4CY2A 2P9PC 5FQDA 3AH8B 1E5TA 2XZGA 3EWEA 3EI4B 4NBMA 4JSPC 3SBPA 1N6DA 2H6QA 3UVOA 2PM9B 4H5JA 5M5SA 3SMRA 1VYHC 4IA9A 1SQ9A 2IWKA 4QRJA 4J0XA 4A0AB 5CXBA 1L5GA 4BUJC 2IUVA 2P9IC 3FCSA 3SLED 3PXTD 5EALA 1H2YA 4O3UB 4G55A 3VI3A 3JPXA 2JKXA 4UI9R 2H68A 4J86A 1VE7A 1O6GA 3CFVA 4EWRA 3J80g 5IC7A 4OWRA 3HFQA 3C5MA 5FFGA 4XEIC 3QI0A 4GQ2P 4AEZA 3OL2B 4A0BA 3L4OD 4O1QD 3I8EA 5THAA 1JJUB 5TEFA 1YR2A 3AL8B 3MVDK 2B5MA 4KFMB 3RRMC 1UOPA 2P9UC 4RE6A 1MG2A 4GQ1A 4J8BA 4E5ZB 4HDJA 2GNQA 2BKLA 4X3EA 2UZXB 1MDAH 4K3ID 1UTCA 1S4UX 3T3PA 3IUQA 5C2VB 3RFHA 2Z2NA 3EI2A 3ZE0A 4PC0A 3EU7A 3VI4A 1U8CA 3GFCA 3ZWLB 3DWLC 4WK2A 3SHFA 4BH6A 5E6UA 4BCCA 2OK6A 5AMSA 5EMMB 4GM8A 4A11A 2B5LA 1GXRA 2VDRA 3VH0A 2PM6B 3DSMA 1VZ2A 3ZE2A 3SCYA 3SBRA 4D6VA 4O02A 1YFQA 5GXIA 2HXCA 2VDOA 4ERQA 5CXCA 4FA1D 4MMXA 1VZ3A 1H2ZA 4YVDA 1PBYB 3EI1B 3F3PA 4J78A 3SXTD 2H6NA 3O4JA 2Q7QA 4J87A 4PSXB 4IRZA 3NVXA 4U1EI 5IJ8E 2CN3A 4Z7NA 1JTDB 2H9MA 3MMYA 5M5RA 2H9LA 4J0WA 1MG3A 3QHYB 2P9KC 4A2LA 5GSAA 4A7JA 4AMZA 3FM0A 2W18A 1PGUA 4DNVA 1R5MA 2EIDA 4J84A 2CO0A 3FGBA 4D0KA 3JAMg 3BWSA 4ZOXA 2XDWA 4A2MA 1N6EA 5K19A 5IGQA 3IUJA 4PNKB 3IIYA 3DXMC 5I5MA 1E8MA 3IIWA
chains in the Genus database with same CATH topology
5HE3B 2CE9A 1XKSA 3UVNA 5AJAA 5H1MA 5C2WB 2YNNA 2OVPB 3CFSB 3SN6B 2B4EA 2IUPA 1XHMA 3IJCA 2XYIA 4TZ4A 2OJYA 3EMHA 3L4MD 3I89A 3V9FA 2AH1A 3B7FA 2XU7A 3RSEC 4N14A 4XYIA 3BG1A 4ZOYA 3EI2B 3PVUB 5K1CC 4J82A 4CZYA 1P22A 4ERYA 2AH0A 4GZ8A 2I3TA 3F3GA 3I8CA 4GM3A 3A0FA 3OW8A 4J73A 3VA6A 4A11B 4CI3A 3I7HA 3V7DB 4A08A 3I7NA 4ESGA 2UZYB 2I0TA 3RN1D 4FHLA 5FKSA 3OKYA 5EM2A 5CYKA 4JSXC 2QC5A 1OLZA 3AL9A 1GG2B 3NVQA 5HE2B 4GGDA 2H47A 2CE8A 1XIPA 2HJBA 2AGZA 2GC4A 2H9NA 3P4FA 3UKRC 4O45A 3EI3A 3MXXA 3JRPA 3C9CA 5TEEA 2P9NC 3RFGA 4E54A 2HJ4A 2I0RA 3JZGA 1FWXA 2GC7A 2HKRA 4JT5C 4PSWB 4A09A 2YB8B 3IJ1A 1NEXB 1Q47A 3VGZA 4FA4D 1TYQC 3C99A 2CO0C 3EI4A 2IURA 3UVMA 3KRWB 3PE7A 3E0CA 4MK0B 1U4CA 4L1QD 2H3XA 3ODTA 3J81g 3W15A 4J79A 3V5WB 4K3JB 4QL1A 4GQBB 2I0SA 2J56H 3SFZA 3UR4A 4OZUA 4X63B 4FAND 3RN0D 4CC9A 5EMLB 4JSNC 4JXMA 4LG8A 5IGOA 4CY1A 3DXKC 3MKQA 3SWSD 1A0RB 5CXBB 1RI6A 5FKRA 4CZXA 3I7KA 5FKQA 2H14A 3NVNA 5IT9g 1ERJA 5JWZA 3OKTA 5FXYA 5H17A 4FAVD 2J57G 3JZNA 3OKYB 5CYKB 3SJLD 3PSCB 4G56B 2HYEA 4A0BB 3FRXA 2OVQB 3N0EA 2XL2A 4XYHA 4O3TB 4L3HD 2I3SA 1PI6A 5EARA 3I2NA 4O9DA 3MZLA 4FA5D 1GOTB 1PEVA 1L0QA 2EBSA 3F3FA 2CN2A 4IMMA 3UVLA 3UVKA 4E54B 3AFCA 5I5JA 5C9ZB 4Z8LA 2YMUA 5FA5B 4FA9D 5HYNB 3K27A 4A09B 4X61B 4L9OA 1JOFA 4ERZA 4QQEA 3K26A 4PBZA 3U4YA 4FWWA 3EI1A 4Y7RA 3SBQA 2AGYA 1OMWB 3OKWA 4LG9A 2XL3A 4ZN4A 4GMBA 5HE0B 2Z2OA 2J55H 3PXWD 2PM7B 3EG6A 4JD2C 3RMZD 5SXMA 5CXCB 1SHYB 3ORVD 3SVWD 5GXHA 5EMKB 2G99A 4I79A 4ZOZA 2P9SC 4JT6C 3I7LA 3OTTA 3MKSB 4PBYA 5FLXg 4QT8A 1U2VC 5EMJB 4J8GA 5TF2A 4CZVA 3IJ0A 5EAPA 3PXSD 2IUQA 1N6FA 1K8KC 4R7AB 4X60B 1B9YA 2BCJB 5GMKn 3DM0A 4BL0A 2CNXA 2AGWA 2Z2PA 4ES0A 5EAMA 4GGCA 2HKMA 2IAAA 3PSLA 3GREA 4ZOVA 1B9XA 3ULEC 4H5IA 2AGXA 3BG0A 4U7AA 5I5IA 4CY3A 4L3GD 4CI1A 1NR0A 2H6KA 4CI8A 2YNOA 2PM9A 5TDHB 2QXVA 2HESX 4CY5A 1K32A 1JMZB 1TBGA 4A0AA 2AGLA 3CIKB 3I7PA 2AQ5A 3RLMD 5HE1B 2OIZA 2YNPA 2PBIB 4GM9A 5HQGA 4NSXA 4FB1D 2IWFA 3KRXB 2TRCB 3JB9L 2G9AA 3C75H 3OL2A 4J77A 1SQJA 3AL8A 4A08B 5IJ7E 2OVRB 1JMXB 2H13A 2OK4A 4E5ZA 4AOWA 2B5NA 5EM2B 5FKTA 5H14A 1QNIA 1GP2B 5B4WA 2YBAA 5A2Qg 4LGNA 3IKOA 4CI2A 3EI3B 4GGAA 4Y5RD 2H9PA 3PVWB 2BBKH 4PXWA 5KDOB 3MZKA 2O9KA 3N0DA 3JZHA 2MTAH 3JROA 4JSVC 3I7OA 5AFU3 4J81A 3UKUC 2P9LC 4CY2A 2P9PC 5FQDA 3AH8B 3EWEA 3EI4B 4JSPC 3SBPA 1N6DA 2H6QA 3UVOA 2PM9B 4H5JA 3SMRA 1VYHC 4IA9A 1SQ9A 2IWKA 4QRJA 4J0XA 4A0AB 5CXBA 4BUJC 2IUVA 2P9IC 3SLED 3PXTD 5EALA 4O3UB 3JPXA 4UI9R 2H68A 4J86A 3CFVA 4EWRA 3J80g 5IC7A 4OWRA 3HFQA 3C5MA 4XEIC 4GQ2P 4AEZA 3OL2B 4A0BA 3L4OD 4O1QD 3I8EA 5THAA 1JJUB 5TEFA 3AL8B 2B5MA 4KFMB 3RRMC 2P9UC 1MG2A 4GQ1A 4J8BA 4E5ZB 4HDJA 2GNQA 4X3EA 2UZXB 1MDAH 4K3ID 1S4UX 5C2VB 3RFHA 2Z2NA 3EI2A 4PC0A 3EU7A 3GFCA 3ZWLB 3DWLC 3SHFA 4BH6A 2OK6A 5AMSA 5EMMB 4GM8A 4A11A 2B5LA 1GXRA 3VH0A 2PM6B 3DSMA 3SCYA 3SBRA 4D6VA 1YFQA 5GXIA 2HXCA 4ERQA 5CXCA 4FA1D 4YVDA 1PBYB 3EI1B 3F3PA 4J78A 3SXTD 2H6NA 2Q7QA 4J87A 4PSXB 3NVXA 4U1EI 5IJ8E 2CN3A 3MMYA 2H9MA 2H9LA 4J0WA 1MG3A 5GSAA 2P9KC 4A2LA 4A7JA 3FM0A 2W18A 1PGUA 1R5MA 4J84A 2CO0A 3FGBA 4D0KA 3JAMg 3BWSA 4ZOXA 4A2MA 1N6EA 5K19A 5IGQA 4PNKB 3IIYA 3DXMC 5I5MA 3IIWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HE3 B;  2CE9 A;  1XKS A;  3UVN A;  5AJA A;  5H1M A;  5C2W B;  2YNN A;  2OVP B;  3CFS B;  3SN6 B;  2B4E A;  2IUP A;  1XHM A;  3IJC A;  2XYI A;  4TZ4 A;  2OJY A;  3EMH A;  3L4M D;  3I89 A;  3V9F A;  2AH1 A;  3B7F A;  2XU7 A;  3RSE C;  4N14 A;  4XYI A;  3BG1 A;  4ZOY A;  3EI2 B;  3PVU B;  5K1C C;  4J82 A;  4CZY A;  1P22 A;  4ERY A;  2AH0 A;  4GZ8 A;  2I3T A;  3F3G A;  3I8C A;  4GM3 A;  3A0F A;  3OW8 A;  4J73 A;  3VA6 A;  4A11 B;  4CI3 A;  3I7H A;  3V7D B;  4A08 A;  3I7N A;  4ESG A;  2UZY B;  2I0T A;  3RN1 D;  4FHL A;  5FKS A;  3OKY A;  5EM2 A;  5CYK A;  4JSX C;  2QC5 A;  1OLZ A;  3AL9 A;  1GG2 B;  3NVQ A;  5HE2 B;  4GGD A;  2H47 A;  2CE8 A;  1XIP A;  2HJB A;  2AGZ A;  2GC4 A;  2H9N A;  3P4F A;  3UKR C;  4O45 A;  3EI3 A;  3MXX A;  3JRP A;  3C9C A;  5TEE A;  2P9N C;  3RFG A;  4E54 A;  2HJ4 A;  2I0R A;  3JZG A;  1FWX A;  2GC7 A;  2HKR A;  4JT5 C;  4PSW B;  4A09 A;  2YB8 B;  3IJ1 A;  1NEX B;  1Q47 A;  3VGZ A;  4FA4 D;  1TYQ C;  3C99 A;  2CO0 C;  3EI4 A;  2IUR A;  3UVM A;  3KRW B;  3PE7 A;  3E0C A;  4MK0 B;  1U4C A;  4L1Q D;  2H3X A;  3ODT A;  3J81 g;  3W15 A;  4J79 A;  3V5W B;  4K3J B;  4QL1 A;  4GQB B;  2I0S A;  2J56 H;  3SFZ A;  3UR4 A;  4OZU A;  4X63 B;  4FAN D;  3RN0 D;  4CC9 A;  5EML B;  4JSN C;  4JXM A;  4LG8 A;  5IGO A;  4CY1 A;  3DXK C;  3MKQ A;  3SWS D;  1A0R B;  5CXB B;  1RI6 A;  5FKR A;  4CZX A;  3I7K A;  5FKQ A;  2H14 A;  3NVN A;  5IT9 g;  1ERJ A;  5JWZ A;  3OKT A;  5FXY A;  5H17 A;  4FAV D;  2J57 G;  3JZN A;  3OKY B;  5CYK B;  3SJL D;  3PSC B;  4G56 B;  2HYE A;  4A0B B;  3FRX A;  2OVQ B;  3N0E A;  2XL2 A;  4XYH A;  4O3T B;  4L3H D;  2I3S A;  1PI6 A;  5EAR A;  3I2N A;  4O9D A;  3MZL A;  4FA5 D;  1GOT B;  1PEV A;  1L0Q A;  2EBS A;  3F3F A;  2CN2 A;  4IMM A;  3UVL A;  3UVK A;  4E54 B;  3AFC A;  5I5J A;  5C9Z B;  4Z8L A;  2YMU A;  5FA5 B;  4FA9 D;  5HYN B;  3K27 A;  4A09 B;  4X61 B;  4L9O A;  1JOF A;  4ERZ A;  4QQE A;  3K26 A;  4PBZ A;  3U4Y A;  4FWW A;  3EI1 A;  4Y7R A;  3SBQ A;  2AGY A;  1OMW B;  3OKW A;  4LG9 A;  2XL3 A;  4ZN4 A;  4GMB A;  5HE0 B;  2Z2O A;  2J55 H;  3PXW D;  2PM7 B;  3EG6 A;  4JD2 C;  3RMZ D;  5SXM A;  5CXC B;  1SHY B;  3ORV D;  3SVW D;  5GXH A;  5EMK B;  2G99 A;  4I79 A;  4ZOZ A;  2P9S C;  4JT6 C;  3I7L A;  3OTT A;  3MKS B;  4PBY A;  5FLX g;  4QT8 A;  1U2V C;  5EMJ B;  4J8G A;  5TF2 A;  4CZV A;  3IJ0 A;  5EAP A;  3PXS D;  2IUQ A;  1N6F A;  1K8K C;  4R7A B;  4X60 B;  1B9Y A;  2BCJ B;  5GMK n;  3DM0 A;  4BL0 A;  2CNX A;  2AGW A;  2Z2P A;  4ES0 A;  5EAM A;  4GGC A;  2HKM A;  2IAA A;  3PSL A;  3GRE A;  4ZOV A;  1B9X A;  3ULE C;  4H5I A;  2AGX A;  3BG0 A;  4U7A A;  5I5I A;  4CY3 A;  4L3G D;  4CI1 A;  1NR0 A;  2H6K A;  4CI8 A;  2YNO A;  2PM9 A;  5TDH B;  2QXV A;  2HES X;  4CY5 A;  1K32 A;  1JMZ B;  1TBG A;  4A0A A;  2AGL A;  3CIK B;  3I7P A;  2AQ5 A;  3RLM D;  5HE1 B;  2OIZ A;  2YNP A;  2PBI B;  4GM9 A;  5HQG A;  4NSX A;  4FB1 D;  2IWF A;  3KRX B;  2TRC B;  3JB9 L;  2G9A A;  3C75 H;  3OL2 A;  4J77 A;  1SQJ A;  3AL8 A;  4A08 B;  5IJ7 E;  2OVR B;  1JMX B;  2H13 A;  2OK4 A;  4E5Z A;  4AOW A;  2B5N A;  5EM2 B;  5FKT A;  5H14 A;  1QNI A;  1GP2 B;  5B4W A;  2YBA A;  5A2Q g;  4LGN A;  3IKO A;  4CI2 A;  3EI3 B;  4GGA A;  4Y5R D;  2H9P A;  3PVW B;  2BBK H;  4PXW A;  5KDO B;  3MZK A;  2O9K A;  3N0D A;  3JZH A;  2MTA H;  3JRO A;  4JSV C;  3I7O A;  5AFU 3;  4J81 A;  3UKU C;  2P9L C;  4CY2 A;  2P9P C;  5FQD A;  3AH8 B;  3EWE A;  3EI4 B;  4JSP C;  3SBP A;  1N6D A;  2H6Q A;  3UVO A;  2PM9 B;  4H5J A;  3SMR A;  1VYH C;  4IA9 A;  1SQ9 A;  2IWK A;  4QRJ A;  4J0X A;  4A0A B;  5CXB A;  4BUJ C;  2IUV A;  2P9I C;  3SLE D;  3PXT D;  5EAL A;  4O3U B;  3JPX A;  4UI9 R;  2H68 A;  4J86 A;  3CFV A;  4EWR A;  3J80 g;  5IC7 A;  4OWR A;  3HFQ A;  3C5M A;  4XEI C;  4GQ2 P;  4AEZ A;  3OL2 B;  4A0B A;  3L4O D;  4O1Q D;  3I8E A;  5THA A;  1JJU B;  5TEF A;  3AL8 B;  2B5M A;  4KFM B;  3RRM C;  2P9U C;  1MG2 A;  4GQ1 A;  4J8B A;  4E5Z B;  4HDJ A;  2GNQ A;  4X3E A;  2UZX B;  1MDA H;  4K3I D;  1S4U X;  5C2V B;  3RFH A;  2Z2N A;  3EI2 A;  4PC0 A;  3EU7 A;  3GFC A;  3ZWL B;  3DWL C;  3SHF A;  4BH6 A;  2OK6 A;  5AMS A;  5EMM B;  4GM8 A;  4A11 A;  2B5L A;  1GXR A;  3VH0 A;  2PM6 B;  3DSM A;  3SCY A;  3SBR A;  4D6V A;  1YFQ A;  5GXI A;  2HXC A;  4ERQ A;  5CXC A;  4FA1 D;  4YVD A;  1PBY B;  3EI1 B;  3F3P A;  4J78 A;  3SXT D;  2H6N A;  2Q7Q A;  4J87 A;  4PSX B;  3NVX A;  4U1E I;  5IJ8 E;  2CN3 A;  3MMY A;  2H9M A;  2H9L A;  4J0W A;  1MG3 A;  5GSA A;  2P9K C;  4A2L A;  4A7J A;  3FM0 A;  2W18 A;  1PGU A;  1R5M A;  4J84 A;  2CO0 A;  3FGB A;  4D0K A;  3JAM g;  3BWS A;  4ZOX A;  4A2M A;  1N6E A;  5K19 A;  5IGQ A;  4PNK B;  3IIY A;  3DXM C;  5I5M A;  3IIW A; 
#chains in the Genus database with same CATH topology
 4QAM A;  5HE3 B;  2CE9 A;  1XKS A;  3UVN A;  5AJA A;  5H1M A;  5C2W B;  2YNN A;  2OVP B;  4JHP C;  3CFS B;  3SN6 B;  4MMY A;  2B4E A;  2IUP A;  4WK0 A;  1XHM A;  3IJC A;  2XYI A;  4TZ4 A;  2OJY A;  3EMH A;  3L4M D;  5FFO A;  3I89 A;  3V9F A;  2AH1 A;  4RE5 A;  3B7F A;  2XU7 A;  4UM9 A;  3RSE C;  4N14 A;  4XYI A;  3BG1 A;  4ZOY A;  3EI2 B;  3PVU B;  3KCI A;  5K1C C;  4J82 A;  4CZY A;  1BPO A;  1P22 A;  4ERY A;  2AH0 A;  4GZ8 A;  2I3T A;  2QR5 A;  3F3G A;  3I8C A;  3MUN A;  1C9I A;  4GM3 A;  2VZ1 A;  3A0F A;  3OW8 A;  4J73 A;  3VA6 A;  4A11 B;  4CI3 A;  1M1X A;  3I7H A;  3V7D B;  4A08 A;  3I7N A;  1A12 A;  4ESG A;  2UZY B;  2I0T A;  3RN1 D;  4FHL A;  5FKS A;  1K3I A;  3OKY A;  5EM2 A;  5CYK A;  4JSX C;  2QC5 A;  1OLZ A;  3AL9 A;  1GG2 B;  1T2X A;  3NVQ A;  4NAA A;  3EQ9 A;  5HE2 B;  4GGD A;  2H47 A;  2CE8 A;  1XIP A;  2HJB A;  2AGZ A;  2GC4 A;  2H9N A;  3P4F A;  3UKR C;  4O45 A;  3EI3 A;  3MXX A;  1I2M B;  3NIG A;  3GC3 B;  3JRP A;  3C9C A;  5TEE A;  2P9N C;  3RFG A;  4E54 A;  2HJ4 A;  2I0R A;  3JZG A;  2EIC A;  3IUL A;  3T3M A;  1FWX A;  2GC7 A;  2HKR A;  1H2X A;  4JT5 C;  4PSW B;  4A09 A;  2YB8 B;  3IJ1 A;  1NEX B;  4G1E A;  1Q47 A;  3NIF A;  3VGZ A;  4FA4 D;  1TYQ C;  4NC4 A;  5M61 A;  3C99 A;  2CO0 C;  1QFS A;  3IJE A;  2VDM A;  3EI4 A;  2IUR A;  3UVM A;  3KRW B;  3PE7 A;  4DNW A;  3E0C A;  4MK0 B;  1U4C A;  4L1Q D;  3ZDX A;  4WK4 A;  2H3X A;  3DDU A;  3IUR A;  3ODT A;  4Z7Q A;  4BCD A;  3J81 g;  3W15 A;  4J79 A;  3ZE1 A;  4AN0 A;  3V5W B;  3FCU A;  4K3J B;  4QL1 A;  4GQB B;  2I0S A;  4DNU A;  2J56 H;  3SFZ A;  3UR4 A;  2VDL A;  4OZU A;  4X63 B;  4FAN D;  3RN0 D;  4CC9 A;  4BP8 A;  3K72 A;  5EML B;  4JSN C;  4JXM A;  4LG8 A;  5IGO A;  4L1M A;  4CY1 A;  3DXK C;  3MKQ A;  3SWS D;  3EQ8 A;  1A0R B;  3ZDY A;  5CXB B;  1RI6 A;  4JHN A;  5FKR A;  3I7K A;  4CZX A;  5FKQ A;  2H14 A;  3IUM A;  2XE4 A;  3NVN A;  5IT9 g;  1ERJ A;  5JWZ A;  3OKT A;  5FXY A;  4G1M A;  5H17 A;  4FAV D;  2J57 G;  3JZN A;  3OKY B;  5CYK B;  3SJL D;  1O6F A;  4D9S A;  2VZ3 A;  3OF7 A;  3PSC B;  4G56 B;  2HYE A;  4A0B B;  3FRX A;  2OVQ B;  3N0E A;  2XL2 A;  4XYH A;  4O3T B;  4L3H D;  2I3S A;  1PI6 A;  5EAR A;  2WQ8 A;  3I2N A;  4O9D A;  3MZL A;  4FA5 D;  1GOT B;  5C86 A;  1PEV A;  1L0Q A;  2EBS A;  3F3F A;  2CN2 A;  3V4V A;  4IMM A;  3UVL A;  3UVK A;  4E54 B;  3AFC A;  1QFM A;  5I5J A;  5C9Z B;  4Z8L A;  2HU5 A;  2YMU A;  5FA5 B;  4BCB A;  4FA9 D;  5HYN B;  3K27 A;  4A09 B;  5HDB A;  4X61 B;  4L9O A;  2HU8 A;  1JOF A;  4ERZ A;  4QQE A;  3K26 A;  4PBZ A;  3U4Y A;  4FWW A;  3EI1 A;  4Y7R A;  3SBQ A;  2AGY A;  5M5U A;  1OMW B;  3OKW A;  4LG9 A;  2XL3 A;  4ZN4 A;  5E6R A;  1GOG A;  4GMB A;  5HE0 B;  2Z2O A;  2J55 H;  3PXW D;  2PM7 B;  3EG6 A;  4JD2 C;  3RMZ D;  5SXM A;  5CXC B;  1SHY B;  2VDK A;  3ORV D;  3EQ7 A;  3SVW D;  4WJK A;  3O4H A;  5EMK B;  5GXH A;  4BP9 A;  2G99 A;  4I79 A;  2VDN A;  1TYE A;  4ZOZ A;  2P9S C;  4JT6 C;  3I7L A;  4AMY A;  3OTT A;  3MKS B;  4PBY A;  5FLX g;  4Z7O A;  4QT8 A;  1U2V C;  5EMJ B;  4J8G A;  5TF2 A;  4CZV A;  3IJ0 A;  5EAP A;  1GOH A;  3PXS D;  2IUQ A;  1N6F A;  1K8K C;  4R7A B;  4X60 B;  1B9Y A;  2BCJ B;  5GMK n;  3DM0 A;  4BL0 A;  2CNX A;  2VDQ A;  2AGW A;  2VC2 A;  2Z2P A;  4ES0 A;  5EAM A;  3K71 A;  4GGC A;  2HKM A;  2IAA A;  3PSL A;  2QZP A;  1E8N A;  3GRE A;  5M5T A;  2HU7 A;  2EIB A;  1B9X A;  4ZOV A;  3ULE C;  4H5I A;  2AGX A;  3BG0 A;  4U7A A;  1JV2 A;  5I5I A;  4CY3 A;  3IVM A;  4L3G D;  4CI1 A;  1NR0 A;  2H6K A;  4CI8 A;  2YNO A;  2PM9 A;  5TDH B;  3NID A;  2QXV A;  1UOQ A;  2HES X;  3GD1 I;  4CY5 A;  1K32 A;  2VDP A;  1JMZ B;  1TBG A;  4A0A A;  2AGL A;  2EIE A;  3CIK B;  3I7P A;  2AQ5 A;  3RLM D;  4AN1 A;  5HE1 B;  3O4G A;  2OIZ A;  2YNP A;  2PBI B;  4GM9 A;  5HQG A;  3K6S A;  4NSX A;  5M5V A;  4FB1 D;  2IWF A;  5E6S A;  3KRX B;  2TRC B;  3JB9 L;  2G9A A;  5C92 A;  3C75 H;  3OL2 A;  1UOO A;  4J77 A;  1SQJ A;  1VE6 A;  3AL8 A;  1C9L A;  4A08 B;  5IJ7 E;  2OVR B;  1JMX B;  1GOF A;  2H13 A;  2OK4 A;  4E5Z A;  4AOW A;  2B5N A;  5EM2 B;  5FKT A;  3MUO A;  5H14 A;  3IUN A;  1QNI A;  1GP2 B;  5B4W A;  2YBA A;  5A2Q g;  4NEN A;  4LGN A;  3IKO A;  4UM8 A;  4CI2 A;  4MMZ A;  3EI3 B;  4GGA A;  4AX4 A;  4Y5R D;  4O2W A;  2H9P A;  3PVW B;  2BBK H;  4PXW A;  5KDO B;  3MZK A;  2O9K A;  3N0D A;  3V4P A;  3JZH A;  2MTA H;  3JRO A;  3ZDZ A;  4JSV C;  3I7O A;  5AFU 3;  3O4I A;  4J81 A;  2P9L C;  3UKU C;  1H2W A;  4CY2 A;  2P9P C;  5FQD A;  3AH8 B;  1E5T A;  2XZG A;  3EWE A;  3EI4 B;  4NBM A;  4JSP C;  3SBP A;  1N6D A;  2H6Q A;  3UVO A;  2PM9 B;  4H5J A;  5M5S A;  3SMR A;  1VYH C;  4IA9 A;  1SQ9 A;  2IWK A;  4QRJ A;  4J0X A;  4A0A B;  5CXB A;  1L5G A;  4BUJ C;  2IUV A;  2P9I C;  3FCS A;  3SLE D;  3PXT D;  5EAL A;  1H2Y A;  4O3U B;  4G55 A;  3VI3 A;  3JPX A;  2JKX A;  4UI9 R;  2H68 A;  4J86 A;  1VE7 A;  1O6G A;  3CFV A;  4EWR A;  3J80 g;  5IC7 A;  4OWR A;  3HFQ A;  3C5M A;  5FFG A;  4XEI C;  3QI0 A;  4GQ2 P;  4AEZ A;  3OL2 B;  4A0B A;  3L4O D;  4O1Q D;  3I8E A;  5THA A;  1JJU B;  5TEF A;  1YR2 A;  3AL8 B;  3MVD K;  2B5M A;  4KFM B;  3RRM C;  1UOP A;  2P9U C;  4RE6 A;  1MG2 A;  4GQ1 A;  4J8B A;  4E5Z B;  4HDJ A;  2GNQ A;  2BKL A;  4X3E A;  2UZX B;  1MDA H;  4K3I D;  1UTC A;  1S4U X;  3T3P A;  3IUQ A;  5C2V B;  3RFH A;  2Z2N A;  3EI2 A;  3ZE0 A;  4PC0 A;  3EU7 A;  3VI4 A;  1U8C A;  3GFC A;  3ZWL B;  3DWL C;  4WK2 A;  3SHF A;  4BH6 A;  5E6U A;  4BCC A;  2OK6 A;  5AMS A;  5EMM B;  4GM8 A;  4A11 A;  2B5L A;  1GXR A;  2VDR A;  3VH0 A;  2PM6 B;  3DSM A;  1VZ2 A;  3ZE2 A;  3SCY A;  3SBR A;  4D6V A;  4O02 A;  1YFQ A;  5GXI A;  2HXC A;  2VDO A;  4ERQ A;  5CXC A;  4FA1 D;  4MMX A;  1VZ3 A;  1H2Z A;  4YVD A;  1PBY B;  3EI1 B;  3F3P A;  4J78 A;  3SXT D;  2H6N A;  3O4J A;  2Q7Q A;  4J87 A;  4PSX B;  4IRZ A;  3NVX A;  4U1E I;  5IJ8 E;  2CN3 A;  4Z7N A;  1JTD B;  2H9M A;  3MMY A;  5M5R A;  2H9L A;  4J0W A;  1MG3 A;  3QHY B;  2P9K C;  4A2L A;  5GSA A;  4A7J A;  4AMZ A;  3FM0 A;  2W18 A;  1PGU A;  4DNV A;  1R5M A;  2EID A;  4J84 A;  2CO0 A;  3FGB A;  4D0K A;  3JAM g;  3BWS A;  4ZOX A;  2XDW A;  4A2M A;  1N6E A;  5K19 A;  5IGQ A;  3IUJ A;  4PNK B;  3IIY A;  3DXM C;  5I5M A;  1E8M A;  3IIW A; 
#chains in the Genus database with same CATH homology
 5HE3 B;  2CE9 A;  1XKS A;  3UVN A;  5AJA A;  5H1M A;  5C2W B;  2YNN A;  2OVP B;  3CFS B;  3SN6 B;  2B4E A;  2IUP A;  1XHM A;  3IJC A;  2XYI A;  4TZ4 A;  2OJY A;  3EMH A;  3L4M D;  3I89 A;  3V9F A;  2AH1 A;  3B7F A;  2XU7 A;  3RSE C;  4N14 A;  4XYI A;  3BG1 A;  4ZOY A;  3EI2 B;  3PVU B;  5K1C C;  4J82 A;  4CZY A;  1P22 A;  4ERY A;  2AH0 A;  4GZ8 A;  2I3T A;  3F3G A;  3I8C A;  4GM3 A;  3A0F A;  3OW8 A;  4J73 A;  3VA6 A;  4A11 B;  4CI3 A;  3I7H A;  3V7D B;  4A08 A;  3I7N A;  4ESG A;  2UZY B;  2I0T A;  3RN1 D;  4FHL A;  5FKS A;  3OKY A;  5EM2 A;  5CYK A;  4JSX C;  2QC5 A;  1OLZ A;  3AL9 A;  1GG2 B;  3NVQ A;  5HE2 B;  4GGD A;  2H47 A;  2CE8 A;  1XIP A;  2HJB A;  2AGZ A;  2GC4 A;  2H9N A;  3P4F A;  3UKR C;  4O45 A;  3EI3 A;  3MXX A;  3JRP A;  3C9C A;  5TEE A;  2P9N C;  3RFG A;  4E54 A;  2HJ4 A;  2I0R A;  3JZG A;  1FWX A;  2GC7 A;  2HKR A;  4JT5 C;  4PSW B;  4A09 A;  2YB8 B;  3IJ1 A;  1NEX B;  1Q47 A;  3VGZ A;  4FA4 D;  1TYQ C;  3C99 A;  2CO0 C;  3EI4 A;  2IUR A;  3UVM A;  3KRW B;  3PE7 A;  3E0C A;  4MK0 B;  1U4C A;  4L1Q D;  2H3X A;  3ODT A;  3J81 g;  3W15 A;  4J79 A;  3V5W B;  4K3J B;  4QL1 A;  4GQB B;  2I0S A;  2J56 H;  3SFZ A;  3UR4 A;  4OZU A;  4X63 B;  4FAN D;  3RN0 D;  4CC9 A;  5EML B;  4JSN C;  4JXM A;  4LG8 A;  5IGO A;  4CY1 A;  3DXK C;  3MKQ A;  3SWS D;  1A0R B;  5CXB B;  1RI6 A;  5FKR A;  4CZX A;  3I7K A;  5FKQ A;  2H14 A;  3NVN A;  5IT9 g;  1ERJ A;  5JWZ A;  3OKT A;  5FXY A;  5H17 A;  4FAV D;  2J57 G;  3JZN A;  3OKY B;  5CYK B;  3SJL D;  3PSC B;  4G56 B;  2HYE A;  4A0B B;  3FRX A;  2OVQ B;  3N0E A;  2XL2 A;  4XYH A;  4O3T B;  4L3H D;  2I3S A;  1PI6 A;  5EAR A;  3I2N A;  4O9D A;  3MZL A;  4FA5 D;  1GOT B;  1PEV A;  1L0Q A;  2EBS A;  3F3F A;  2CN2 A;  4IMM A;  3UVL A;  3UVK A;  4E54 B;  3AFC A;  5I5J A;  5C9Z B;  4Z8L A;  2YMU A;  5FA5 B;  4FA9 D;  5HYN B;  3K27 A;  4A09 B;  4X61 B;  4L9O A;  1JOF A;  4ERZ A;  4QQE A;  3K26 A;  4PBZ A;  3U4Y A;  4FWW A;  3EI1 A;  4Y7R A;  3SBQ A;  2AGY A;  1OMW B;  3OKW A;  4LG9 A;  2XL3 A;  4ZN4 A;  4GMB A;  5HE0 B;  2Z2O A;  2J55 H;  3PXW D;  2PM7 B;  3EG6 A;  4JD2 C;  3RMZ D;  5SXM A;  5CXC B;  1SHY B;  3ORV D;  3SVW D;  5GXH A;  5EMK B;  2G99 A;  4I79 A;  4ZOZ A;  2P9S C;  4JT6 C;  3I7L A;  3OTT A;  3MKS B;  4PBY A;  5FLX g;  4QT8 A;  1U2V C;  5EMJ B;  4J8G A;  5TF2 A;  4CZV A;  3IJ0 A;  5EAP A;  3PXS D;  2IUQ A;  1N6F A;  1K8K C;  4R7A B;  4X60 B;  1B9Y A;  2BCJ B;  5GMK n;  3DM0 A;  4BL0 A;  2CNX A;  2AGW A;  2Z2P A;  4ES0 A;  5EAM A;  4GGC A;  2HKM A;  2IAA A;  3PSL A;  3GRE A;  4ZOV A;  1B9X A;  3ULE C;  4H5I A;  2AGX A;  3BG0 A;  4U7A A;  5I5I A;  4CY3 A;  4L3G D;  4CI1 A;  1NR0 A;  2H6K A;  4CI8 A;  2YNO A;  2PM9 A;  5TDH B;  2QXV A;  2HES X;  4CY5 A;  1K32 A;  1JMZ B;  1TBG A;  4A0A A;  2AGL A;  3CIK B;  3I7P A;  2AQ5 A;  3RLM D;  5HE1 B;  2OIZ A;  2YNP A;  2PBI B;  4GM9 A;  5HQG A;  4NSX A;  4FB1 D;  2IWF A;  3KRX B;  2TRC B;  3JB9 L;  2G9A A;  3C75 H;  3OL2 A;  4J77 A;  1SQJ A;  3AL8 A;  4A08 B;  5IJ7 E;  2OVR B;  1JMX B;  2H13 A;  2OK4 A;  4E5Z A;  4AOW A;  2B5N A;  5EM2 B;  5FKT A;  5H14 A;  1QNI A;  1GP2 B;  5B4W A;  2YBA A;  5A2Q g;  4LGN A;  3IKO A;  4CI2 A;  3EI3 B;  4GGA A;  4Y5R D;  2H9P A;  3PVW B;  2BBK H;  4PXW A;  5KDO B;  3MZK A;  2O9K A;  3N0D A;  3JZH A;  2MTA H;  3JRO A;  4JSV C;  3I7O A;  5AFU 3;  4J81 A;  3UKU C;  2P9L C;  4CY2 A;  2P9P C;  5FQD A;  3AH8 B;  3EWE A;  3EI4 B;  4JSP C;  3SBP A;  1N6D A;  2H6Q A;  3UVO A;  2PM9 B;  4H5J A;  3SMR A;  1VYH C;  4IA9 A;  1SQ9 A;  2IWK A;  4QRJ A;  4J0X A;  4A0A B;  5CXB A;  4BUJ C;  2IUV A;  2P9I C;  3SLE D;  3PXT D;  5EAL A;  4O3U B;  3JPX A;  4UI9 R;  2H68 A;  4J86 A;  3CFV A;  4EWR A;  3J80 g;  5IC7 A;  4OWR A;  3HFQ A;  3C5M A;  4XEI C;  4GQ2 P;  4AEZ A;  3OL2 B;  4A0B A;  3L4O D;  4O1Q D;  3I8E A;  5THA A;  1JJU B;  5TEF A;  3AL8 B;  2B5M A;  4KFM B;  3RRM C;  2P9U C;  1MG2 A;  4GQ1 A;  4J8B A;  4E5Z B;  4HDJ A;  2GNQ A;  4X3E A;  2UZX B;  1MDA H;  4K3I D;  1S4U X;  5C2V B;  3RFH A;  2Z2N A;  3EI2 A;  4PC0 A;  3EU7 A;  3GFC A;  3ZWL B;  3DWL C;  3SHF A;  4BH6 A;  2OK6 A;  5AMS A;  5EMM B;  4GM8 A;  4A11 A;  2B5L A;  1GXR A;  3VH0 A;  2PM6 B;  3DSM A;  3SCY A;  3SBR A;  4D6V A;  1YFQ A;  5GXI A;  2HXC A;  4ERQ A;  5CXC A;  4FA1 D;  4YVD A;  1PBY B;  3EI1 B;  3F3P A;  4J78 A;  3SXT D;  2H6N A;  2Q7Q A;  4J87 A;  4PSX B;  3NVX A;  4U1E I;  5IJ8 E;  2CN3 A;  3MMY A;  2H9M A;  2H9L A;  4J0W A;  1MG3 A;  5GSA A;  2P9K C;  4A2L A;  4A7J A;  3FM0 A;  2W18 A;  1PGU A;  1R5M A;  4J84 A;  2CO0 A;  3FGB A;  4D0K A;  3JAM g;  3BWS A;  4ZOX A;  4A2M A;  1N6E A;  5K19 A;  5IGQ A;  4PNK B;  3IIY A;  3DXM C;  5I5M A;  3IIW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...