2YMUA

Structure of a highly repetitive propeller structure
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
577
structure length
577
Chain Sequence
GSHMGVKERNRLEAHSSSVRGVAFSPDGQTIASASDDKTVKLWNRNGQLLQTLTGHSSSVWGVAFSPDGQTIASASDDKTVKLWNRNGQLLQTLTGHSSSVRGVAFSPDGQTIASASDDKTVKLWNRNGQLLQTLTGHSSSVWGVAFSPDGQTIASASDDKTVKLWNRNGQLLQTLTGHSSSVWGVAFSPDGQTIASASDDKTVKLWNRNGQLLQTLTGHSSSVRGVAFSPDGQTIASASDDKTVKLWNRNGQLLQTLTGHSSSVNGVAFRPDGQTIASASDDKTVKLWNRNGQLLQTLTGHSSSVWGVAFSPDGQTIASASDDKTVKLWNRNGQHLQTLTGHSSSVWGVAFSPDGQTIASASDDKTVKLWNRNGQLLQTLTGHSSSVRGVAFSPDGQTIASASDDKTVKLWNRNGQLLQTLTGHSSSVWGVAFSPDDQTIASASDDKTVKLWNRNGQLLQTLTGHSSSVRGVAFSPDGQTIASASDDKTVKLWNRNGQLLQTLTGHSSSVRGVAFSPDGQTIASASDDKTVKLWNRNGQLLQTLTGHSSSVWGVAFSPDGQTIASASSDKTVKLWN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords WD-40 REPEAT PROTEIN
publication title Structure of a Highly Repetitive Propeller Structure
rcsb
source organism Nostoc punctiforme
molecule tags Unknown function
total genus 179
structure length 577
sequence length 577
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2ymuA01
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2ymuA02
3CFVA 3I8CA 4A2LA 3SMRA 3RLMD 4Y5RD 5I5MA 3L4MD 3RMZD 2B4EA 4PBYA 2J55H 2BBKH 4BL0A 4J84A 4GQ1A 3RSEC 4XYIA 4H5JA 4YVDA 3SHFA 4LG9A 2I3SA 2HJBA 3SFZA 1MG2A 4K3JB 3ULEC 5IGQA 3RFHA 2IUQA 3F3FA 4QT8A 2AH1A 4GGCA 4QL1A 3SJLD 3CIKB 3N0EA 5IGOA 4A08A 4JD2C 5CXBB 2BCJB 2CE9A 2AH0A 2H9MA 5EALA 5SXMA 4E54A 2PM6B 3JPXA 4X3EA 3BG1A 5CXCB 4O1QD 4A0AA 4NSXA 4K3ID 5CYKB 2HESX 3PE7A 1SQ9A 4L9OA 4PSXB 2PBIB 1GXRA 2H6QA 3EI4B 2IWFA 1FWXA 1RI6A 5HE2B 2Z2PA 1SQJA 2P9LC 4CC9A 2P9IC 1Q47A 3EI1B 4GGDA 2G9AA 2HXCA 2OVPB 1JMXB 4CY1A 4D0KA 3SBQA 2QXVA 5AFU3 2GC7A 3BG0A 2OJYA 4O45A 4AOWA 4J87A 2P9UC 3PXTD 3K27A 3BWSA 3ORVD 5FKRA 4JT6C 4J0XA 4A11A 3SLED 3DXMC 5B4WA 3GREA 4CY2A 2I3TA 3EWEA 1L0QA 3UVOA 2HYEA 4OWRA 2H14A 3AL8A 4GM8A 3C9CA 4PSWB 3KRWB 1XIPA 3DSMA 1A0RB 4JT5C 4XYHA 5FKQA 5IJ8E 2HKMA 1JJUB 3PVWB 1K8KC 3JZGA 2P9KC 4CY5A 2B5LA 4GQ2P 4X63B 1MG3A 3OKYB 3A0FA 5H17A 2YNOA 2H9LA 2GC4A 3EI3B 3JZNA 3IJ1A 1N6EA 1GOTB 5I5IA 2CE8A 4OZUA 4D6VA 3EMHA 4CZYA 4FAVD 4R7AB 3I8EA 3SBPA 5FKSA 1K32A 3OL2B 4J82A 5FKTA 2XYIA 2MTAH 2G99A 4O9DA 3NVXA 4ES0A 5FXYA 2YMUA 4L3HD 4MK0B 1YFQA 5GMKn 3HFQA 2CO0C 5EMKB 3IJCA 2IAAA 2GNQA 4EWRA 4CI1A 4E5ZA 5AJAA 4FA9D 4GMBA 1PGUA 4J78A 4CY3A 3F3PA 1P22A 2IUPA 2TRCB 3RFGA 3AH8B 3ZWLB 5GXIA 2OK4A 1NEXB 3SVWD 3FGBA 3NVNA 2IURA 3C99A 3FRXA 4A0BB 2AQ5A 4AEZA 3OKWA 2QC5A 3IIWA 4A09B 3PSCB 3JB9L 5AMSA 4JSPC 4BH6A 3PXWD 4O3UB 3RRMC 3PSLA 3I7HA 5H14A 3GFCA 2Q7QA 1JMZB 5TDHB 3JROA 4H5IA 4FB1D 5IT9g 2Z2NA 5JWZA 2UZXB 4JSNC 4U1EI 5GSAA 2XL2A 5TEFA 4FHLA 5HE1B 3I89A 5FA5B 3EI2A 2PM9A 3SN6B 1R5MA 5EM2A 4X61B 4A08B 2J56H 4L3GD 3JAMg 2P9NC 3JZHA 3MXXA 4E54B 5EMJB 2H68A 4U7AA 4A0AB 4ERYA 3VGZA 3IJ0A 4CZVA 2Z2OA 2OK6A 4ERZA 3B7FA 4QQEA 3MZLA 5EMLB 4A2MA 1TBGA 2I0TA 5H1MA 1TYQC 1OMWB 1S4UX 3SBRA 3C75H 3UKUC 5HE3B 5C9ZB 4A7JA 2AGYA 3K26A 3UVLA 4FA1D 2W18A 3SCYA 2HKRA 2I0SA 4ZOXA 4JSVC 3DWLC 1OLZA 4N14A 4UI9R 4PC0A 4ZOVA 5A2Qg 4ZN4A 4O3TB 3OTTA 4GZ8A 3AFCA 4ZOYA 1B9YA 2EBSA 5CXBA 1N6FA 1MDAH 2O9KA 4BUJC 4J86A 4A11B 3I7OA 5THAA 4GM3A 2CN3A 1NR0A 2HJ4A 5I5JA 1U4CA 4TZ4A 5CXCA 3IIYA 2CO0A 4CI3A 3AL8B 3OKTA 5EAPA 3UVNA 4Y7RA 3I7KA 3P4FA 4LGNA 5HQGA 5CYKA 4KFMB 3V5WB 4J79A 4IMMA 1SHYB 2B5MA 3OW8A 2J57G 3EI4A 4FAND 5TEEA 4FA5D 2AGWA 5TF2A 3L4OD 2IWKA 2I0RA 2AGXA 3EI1A 3I7LA 4ESGA 4I79A 2H9PA 4Z8LA 4G56B 4L1QD 4JSXC 3UVKA 2B5NA 4J73A 2UZYB 5EARA 3C5MA 5FLXg 4GGAA 3EU7A 3ODTA 2PM7B 4JXMA 5C2VB 2H6NA 2AGLA 3MKSB 5HE0B 3V7DB 4CI2A 3MMYA 4X60B 5GXHA 3CFSB 2YNNA 4HDJA 3J80g 2CN2A 3UKRC 2AGZA 5IC7A 3EG6A 2IUVA 3N0DA 2OIZA 3IKOA 4IA9A 3F3GA 4E5ZB 1PI6A 4PNKB 3UVMA 3MZKA 4FWWA 2YBAA 1JOFA 4ZOZA 4CI8A 1ERJA 3J81g 2H47A 1U2VC 3V9FA 2P9PC 1XKSA 3PVUB 2P9SC 1VYHC 5FQDA 1GP2B 1N6DA 5EAMA 3U4YA 3OKYA 4FA4D 2XU7A 5K1CC 3EI3A 4ERQA 1QNIA 4J0WA 3UR4A 3AL9A 2H6KA 3SXTD 2H9NA 3VA6A 4QRJA 5KDOB 3NVQA 2H13A 5HYNB 2XL3A 3OL2A 2YB8B 1GG2B 3I7NA 3E0CA 3DM0A 1PEVA 4LG8A 4J81A 2YNPA 3MKQA 3I2NA 3W15A 3SWSD 1B9XA 4CZXA 3DXKC 4J8GA 4GQBB 2CNXA 4XEIC 4PXWA 3KRXB 5C2WB 3VH0A 3EI2B 2PM9B 1PBYB 4GM9A 4J77A 3RN1D 5IJ7E 5EM2B 2H3XA 3PXSD 3FM0A 4A0BA 5EMMB 3I7PA 1XHMA 3RN0D 5K19A 4A09A 2OVQB 3JRPA 4J8BA 4PBZA 2OVRB
chains in the Genus database with same CATH superfamily
1O6FA 1E8NA 3CFVA 3I8CA 3QHYB 4A2LA 3SMRA 3RLMD 4Y5RD 5I5MA 3L4MD 3RMZD 2B4EA 1M1XA 4PBYA 2J55H 2BBKH 4BL0A 2JKXA 2VDOA 4J84A 4GQ1A 3RSEC 1E5TA 4XYIA 4H5JA 4YVDA 3SHFA 4LG9A 3QI0A 2I3SA 2HJBA 3SFZA 1VZ2A 1MG2A 2HU7A 4K3JB 3ULEC 5IGQA 1H2YA 3RFHA 4NAAA 1A12A 2IUQA 3F3FA 4QT8A 2AH1A 4GGCA 4QL1A 3NIGA 3SJLD 3CIKB 3N0EA 5IGOA 4A08A 4JD2C 5CXBB 2BCJB 2CE9A 1VZ3A 2AH0A 2H9MA 4L1MA 5EALA 5SXMA 2PM6B 4E54A 3JPXA 4X3EA 3BG1A 5CXCB 4O1QD 4A0AA 3FCUA 4NSXA 4DNUA 4K3ID 5CYKB 2HESX 3PE7A 1SQ9A 4L9OA 4PSXB 2PBIB 2VDKA 4AN0A 1GXRA 2H6QA 3VI4A 5E6UA 3EI4B 3EQ8A 2IWFA 1FWXA 1RI6A 1UTCA 5HE2B 2Z2PA 1SQJA 2VDMA 2P9LC 4CC9A 2P9IC 1Q47A 3EI1B 1GOFA 4GGDA 4NC4A 2G9AA 2HXCA 2OVPB 1JMXB 4CY1A 4D0KA 3SBQA 2QXVA 5AFU3 2GC7A 3BG0A 1JV2A 2XDWA 4G1MA 4AN1A 4DNWA 4BCBA 2OJYA 4O45A 4AOWA 4J87A 2P9UC 3MUNA 1TYEA 3PXTD 3K27A 1C9IA 3BWSA 1O6GA 3ORVD 5FKRA 4JT6C 4J0XA 4A11A 3SLED 3DXMC 5B4WA 4RE5A 3GREA 4CY2A 2I3TA 3EWEA 1L0QA 3UVOA 2HYEA 4OWRA 2H14A 3AL8A 3DDUA 4GM8A 1UOQA 3C9CA 4PSWB 3KRWB 4WJKA 1XIPA 3DSMA 1A0RB 4JT5C 4XYHA 5FKQA 5IJ8E 3GD1I 4D9SA 2HKMA 4BP8A 3KCIA 1JJUB 3PVWB 1K8KC 3JZGA 2P9KC 4CY5A 2B5LA 4GQ2P 4X63B 4JHNA 1MG3A 4MMXA 3OKYB 3A0FA 5H17A 5M5TA 2YNOA 2H9LA 2GC4A 3EI3B 4NENA 3JZNA 3IJ1A 1N6EA 1GOTB 5I5IA 2CE8A 4OZUA 4D6VA 3EMHA 4Z7OA 4BCCA 4CZYA 4FAVD 4R7AB 3I8EA 3SBPA 5FKSA 4Z7QA 1K32A 3GC3B 3OL2B 4J82A 5FKTA 2XYIA 2MTAH 2G99A 3EQ7A 4O9DA 3NVXA 4ES0A 5FXYA 2YMUA 3ZE2A 4L3HD 4MK0B 1YFQA 5GMKn 3HFQA 2CO0C 5M5VA 5EMKB 3IJCA 4G55A 4O02A 5M5RA 2IAAA 2GNQA 4EWRA 4CI1A 1C9LA 5HDBA 4E5ZA 5AJAA 4FA9D 4GMBA 1PGUA 3T3MA 4J78A 4CY3A 3F3PA 1P22A 2IUPA 2TRCB 3RFGA 3AH8B 3ZWLB 5GXIA 2EIDA 2OK4A 1NEXB 3SVWD 3FGBA 3NVNA 5M61A 3IUMA 4UM9A 2IURA 3C99A 1GOHA 3FRXA 4A0BB 2AQ5A 1I2MB 4AEZA 4G1EA 3OKWA 2QC5A 2VZ3A 3IIWA 4A09B 3PSCB 2VDLA 3JB9L 5AMSA 4JSPC 4BH6A 3PXWD 4O3UB 2VC2A 3RRMC 3PSLA 2HU5A 3I7HA 5H14A 3GFCA 2Q7QA 1JMZB 5TDHB 3VI3A 3ZDZA 3JROA 4JHPC 4H5IA 4FB1D 3IURA 5IT9g 2Z2NA 3V4PA 5JWZA 3NIDA 2UZXB 4JSNC 1JTDB 4U1EI 5GSAA 2XL2A 5TEFA 2EIBA 1L5GA 4FHLA 5HE1B 3I89A 3ZE0A 3K6SA 3O4IA 5FA5B 1T2XA 3EI2A 2PM9A 2EICA 4Z7NA 2BKLA 3SN6B 1R5MA 3K71A 5EM2A 4X61B 4A08B 3IULA 2J56H 4L3GD 3JAMg 2P9NC 3JZHA 3MXXA 4E54B 5EMJB 2H68A 4U7AA 4A0AB 4ERYA 3VGZA 3O4JA 2QZPA 3IJ0A 4CZVA 2Z2OA 2OK6A 4ERZA 3B7FA 4QQEA 3MZLA 5EMLB 3K72A 1K3IA 4WK0A 4A2MA 1TBGA 2I0TA 5H1MA 1GOGA 1TYQC 3O4GA 1OMWB 1S4UX 4MMZA 3SBRA 3C75H 4AMYA 3UKUC 5HE3B 5C9ZB 4A7JA 4IRZA 2AGYA 3K26A 3UVLA 4FA1D 2W18A 3SCYA 2HKRA 2I0SA 4ZOXA 4JSVC 3DWLC 1OLZA 3MUOA 4N14A 4UI9R 4MMYA 2HU8A 4PC0A 4ZOVA 5A2Qg 4ZN4A 4WK4A 4O3TB 1U8CA 3OTTA 4GZ8A 3AFCA 4ZOYA 1E8MA 1B9YA 2EBSA 5C92A 4AX4A 5CXBA 1N6FA 1MDAH 2O9KA 5FFOA 4BUJC 4J86A 5FFGA 4A11B 3I7OA 5THAA 4GM3A 2CN3A 1NR0A 2HJ4A 4AMZA 5I5JA 1U4CA 4TZ4A 5CXCA 3IIYA 2CO0A 4CI3A 3AL8B 3OKTA 5EAPA 3UVNA 4Y7RA 3I7KA 3P4FA 4LGNA 5HQGA 5CYKA 4KFMB 3V5WB 4J79A 4IMMA 1SHYB 2B5MA 3OW8A 2J57G 3OF7A 2VDNA 2VZ1A 3EI4A 4FAND 5TEEA 4BCDA 4FA5D 2AGWA 3IVMA 5TF2A 3L4OD 2IWKA 2I0RA 2AGXA 4BP9A 3EI1A 3I7LA 1VE7A 4ESGA 4I79A 2H9PA 4Z8LA 4G56B 4L1QD 4JSXC 3UVKA 2B5NA 2WQ8A 2UZYB 4J73A 4WK2A 5EARA 3C5MA 4UM8A 5FLXg 1UOOA 3EU7A 4GGAA 3ODTA 2PM7B 4JXMA 5C2VB 2H6NA 3O4HA 2AGLA 3MKSB 3ZE1A 5HE0B 2QR5A 1VE6A 3V7DB 3IUQA 2VDRA 4CI2A 3MMYA 4X60B 2XE4A 5GXHA 1QFSA 3CFSB 2YNNA 4HDJA 3J80g 4QAMA 1YR2A 2CN2A 3UKRC 2AGZA 5IC7A 3EG6A 2IUVA 3N0DA 2OIZA 3IKOA 4IA9A 3F3GA 4E5ZB 1PI6A 4PNKB 3UVMA 1H2XA 3MZKA 4FWWA 5E6SA 3T3PA 2YBAA 1QFMA 1JOFA 4ZOZA 1BPOA 1H2WA 4CI8A 1ERJA 1H2ZA 3J81g 2H47A 1U2VC 3V9FA 5M5SA 2P9PC 1XKSA 3PVUB 2P9SC 1VYHC 5FQDA 1GP2B 1N6DA 5EAMA 3U4YA 3OKYA 4FA4D 4DNVA 2XU7A 5K1CC 3EI3A 4ERQA 1QNIA 4J0WA 3UR4A 3AL9A 2H6KA 3SXTD 2H9NA 3VA6A 3IUNA 4O2WA 4QRJA 3MVDK 2XZGA 5KDOB 5E6RA 3NVQA 2H13A 5HYNB 2XL3A 3OL2A 2YB8B 1GG2B 3FCSA 5C86A 3I7NA 3E0CA 3DM0A 1PEVA 4LG8A 4J81A 1UOPA 2YNPA 3MKQA 3I2NA 3W15A 3SWSD 1B9XA 4CZXA 3DXKC 4J8GA 4GQBB 2CNXA 4XEIC 4PXWA 3KRXB 5C2WB 3NIFA 3VH0A 3EI2B 2PM9B 1PBYB 4GM9A 4J77A 2EIEA 3RN1D 3IJEA 4NBMA 2VDPA 5IJ7E 5EM2B 5M5UA 2H3XA 3PXSD 3FM0A 3V4VA 4RE6A 3ZDYA 4A0BA 5EMMB 3I7PA 2VDQA 1XHMA 3EQ9A 3RN0D 5K19A 4A09A 3ZDXA 2OVQB 3JRPA 4J8BA 4PBZA 3IUJA 2OVRB
chains in the Genus database with same CATH topology
3CFVA 3I8CA 4A2LA 3SMRA 3RLMD 4Y5RD 5I5MA 3L4MD 3RMZD 2B4EA 4PBYA 2J55H 2BBKH 4BL0A 4J84A 4GQ1A 3RSEC 4XYIA 4H5JA 4YVDA 3SHFA 4LG9A 2I3SA 2HJBA 3SFZA 1MG2A 4K3JB 3ULEC 5IGQA 3RFHA 2IUQA 3F3FA 4QT8A 2AH1A 4GGCA 4QL1A 3SJLD 3CIKB 3N0EA 5IGOA 4A08A 4JD2C 5CXBB 2BCJB 2CE9A 2AH0A 2H9MA 5EALA 5SXMA 4E54A 2PM6B 3JPXA 4X3EA 3BG1A 5CXCB 4O1QD 4A0AA 4NSXA 4K3ID 5CYKB 2HESX 3PE7A 1SQ9A 4L9OA 4PSXB 2PBIB 1GXRA 2H6QA 3EI4B 2IWFA 1FWXA 1RI6A 5HE2B 2Z2PA 1SQJA 2P9LC 4CC9A 2P9IC 1Q47A 3EI1B 4GGDA 2G9AA 2HXCA 2OVPB 1JMXB 4CY1A 4D0KA 3SBQA 2QXVA 5AFU3 2GC7A 3BG0A 2OJYA 4O45A 4AOWA 4J87A 2P9UC 3PXTD 3K27A 3BWSA 3ORVD 5FKRA 4JT6C 4J0XA 4A11A 3SLED 3DXMC 5B4WA 3GREA 4CY2A 2I3TA 3EWEA 1L0QA 3UVOA 2HYEA 4OWRA 2H14A 3AL8A 4GM8A 3C9CA 4PSWB 3KRWB 1XIPA 3DSMA 1A0RB 4JT5C 4XYHA 5FKQA 5IJ8E 2HKMA 1JJUB 3PVWB 1K8KC 3JZGA 2P9KC 4CY5A 2B5LA 4GQ2P 4X63B 1MG3A 3OKYB 3A0FA 5H17A 2YNOA 2H9LA 2GC4A 3EI3B 3JZNA 3IJ1A 1N6EA 1GOTB 5I5IA 2CE8A 4OZUA 4D6VA 3EMHA 4CZYA 4FAVD 4R7AB 3I8EA 3SBPA 5FKSA 1K32A 3OL2B 4J82A 5FKTA 2XYIA 2MTAH 2G99A 4O9DA 3NVXA 4ES0A 5FXYA 2YMUA 4L3HD 4MK0B 1YFQA 5GMKn 3HFQA 2CO0C 5EMKB 3IJCA 2IAAA 2GNQA 4EWRA 4CI1A 4E5ZA 5AJAA 4FA9D 4GMBA 1PGUA 4J78A 4CY3A 3F3PA 1P22A 2IUPA 2TRCB 3RFGA 3AH8B 3ZWLB 5GXIA 2OK4A 1NEXB 3SVWD 3FGBA 3NVNA 2IURA 3C99A 3FRXA 4A0BB 2AQ5A 4AEZA 3OKWA 2QC5A 3IIWA 4A09B 3PSCB 3JB9L 5AMSA 4JSPC 4BH6A 3PXWD 4O3UB 3RRMC 3PSLA 3I7HA 5H14A 3GFCA 2Q7QA 1JMZB 5TDHB 3JROA 4H5IA 4FB1D 5IT9g 2Z2NA 5JWZA 2UZXB 4JSNC 4U1EI 5GSAA 2XL2A 5TEFA 4FHLA 5HE1B 3I89A 5FA5B 3EI2A 2PM9A 3SN6B 1R5MA 5EM2A 4X61B 4A08B 2J56H 4L3GD 3JAMg 2P9NC 3JZHA 3MXXA 4E54B 5EMJB 2H68A 4U7AA 4A0AB 4ERYA 3VGZA 3IJ0A 4CZVA 2Z2OA 2OK6A 4ERZA 3B7FA 4QQEA 3MZLA 5EMLB 4A2MA 1TBGA 2I0TA 5H1MA 1TYQC 1OMWB 1S4UX 3SBRA 3C75H 3UKUC 5HE3B 5C9ZB 4A7JA 2AGYA 3K26A 3UVLA 4FA1D 2W18A 3SCYA 2HKRA 2I0SA 4ZOXA 4JSVC 3DWLC 1OLZA 4N14A 4UI9R 4PC0A 4ZOVA 5A2Qg 4ZN4A 4O3TB 3OTTA 4GZ8A 3AFCA 4ZOYA 1B9YA 2EBSA 5CXBA 1N6FA 1MDAH 2O9KA 4BUJC 4J86A 4A11B 3I7OA 5THAA 4GM3A 2CN3A 1NR0A 2HJ4A 5I5JA 1U4CA 4TZ4A 5CXCA 3IIYA 2CO0A 4CI3A 3AL8B 3OKTA 5EAPA 3UVNA 4Y7RA 3I7KA 3P4FA 4LGNA 5HQGA 5CYKA 4KFMB 3V5WB 4J79A 4IMMA 1SHYB 2B5MA 3OW8A 2J57G 3EI4A 4FAND 5TEEA 4FA5D 2AGWA 5TF2A 3L4OD 2IWKA 2I0RA 2AGXA 3EI1A 3I7LA 4ESGA 4I79A 2H9PA 4Z8LA 4G56B 4L1QD 4JSXC 3UVKA 2B5NA 4J73A 2UZYB 5EARA 3C5MA 5FLXg 4GGAA 3EU7A 3ODTA 2PM7B 4JXMA 5C2VB 2H6NA 2AGLA 3MKSB 5HE0B 3V7DB 4CI2A 3MMYA 4X60B 5GXHA 3CFSB 2YNNA 4HDJA 3J80g 2CN2A 3UKRC 2AGZA 5IC7A 3EG6A 2IUVA 3N0DA 2OIZA 3IKOA 4IA9A 3F3GA 4E5ZB 1PI6A 4PNKB 3UVMA 3MZKA 4FWWA 2YBAA 1JOFA 4ZOZA 4CI8A 1ERJA 3J81g 2H47A 1U2VC 3V9FA 2P9PC 1XKSA 3PVUB 2P9SC 1VYHC 5FQDA 1GP2B 1N6DA 5EAMA 3U4YA 3OKYA 4FA4D 2XU7A 5K1CC 3EI3A 4ERQA 1QNIA 4J0WA 3UR4A 3AL9A 2H6KA 3SXTD 2H9NA 3VA6A 4QRJA 5KDOB 3NVQA 2H13A 5HYNB 2XL3A 3OL2A 2YB8B 1GG2B 3I7NA 3E0CA 3DM0A 1PEVA 4LG8A 4J81A 2YNPA 3MKQA 3I2NA 3W15A 3SWSD 1B9XA 4CZXA 3DXKC 4J8GA 4GQBB 2CNXA 4XEIC 4PXWA 3KRXB 5C2WB 3VH0A 3EI2B 2PM9B 1PBYB 4GM9A 4J77A 3RN1D 5IJ7E 5EM2B 2H3XA 3PXSD 3FM0A 4A0BA 5EMMB 3I7PA 1XHMA 3RN0D 5K19A 4A09A 2OVQB 3JRPA 4J8BA 4PBZA 2OVRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CFV A;  3I8C A;  4A2L A;  3SMR A;  3RLM D;  4Y5R D;  5I5M A;  3L4M D;  3RMZ D;  2B4E A;  4PBY A;  2J55 H;  2BBK H;  4BL0 A;  4J84 A;  4GQ1 A;  3RSE C;  4XYI A;  4H5J A;  4YVD A;  3SHF A;  4LG9 A;  2I3S A;  2HJB A;  3SFZ A;  1MG2 A;  4K3J B;  3ULE C;  5IGQ A;  3RFH A;  2IUQ A;  3F3F A;  4QT8 A;  2AH1 A;  4GGC A;  4QL1 A;  3SJL D;  3CIK B;  3N0E A;  5IGO A;  4A08 A;  4JD2 C;  5CXB B;  2BCJ B;  2CE9 A;  2AH0 A;  2H9M A;  5EAL A;  5SXM A;  4E54 A;  2PM6 B;  3JPX A;  4X3E A;  3BG1 A;  5CXC B;  4O1Q D;  4A0A A;  4NSX A;  4K3I D;  5CYK B;  2HES X;  3PE7 A;  1SQ9 A;  4L9O A;  4PSX B;  2PBI B;  1GXR A;  2H6Q A;  3EI4 B;  2IWF A;  1FWX A;  1RI6 A;  5HE2 B;  2Z2P A;  1SQJ A;  2P9L C;  4CC9 A;  2P9I C;  1Q47 A;  3EI1 B;  4GGD A;  2G9A A;  2HXC A;  2OVP B;  1JMX B;  4CY1 A;  4D0K A;  3SBQ A;  2QXV A;  5AFU 3;  2GC7 A;  3BG0 A;  2OJY A;  4O45 A;  4AOW A;  4J87 A;  2P9U C;  3PXT D;  3K27 A;  3BWS A;  3ORV D;  5FKR A;  4JT6 C;  4J0X A;  4A11 A;  3SLE D;  3DXM C;  5B4W A;  3GRE A;  4CY2 A;  2I3T A;  3EWE A;  1L0Q A;  3UVO A;  2HYE A;  4OWR A;  2H14 A;  3AL8 A;  4GM8 A;  3C9C A;  4PSW B;  3KRW B;  1XIP A;  3DSM A;  1A0R B;  4JT5 C;  4XYH A;  5FKQ A;  5IJ8 E;  2HKM A;  1JJU B;  3PVW B;  1K8K C;  3JZG A;  2P9K C;  4CY5 A;  2B5L A;  4GQ2 P;  4X63 B;  1MG3 A;  3OKY B;  3A0F A;  5H17 A;  2YNO A;  2H9L A;  2GC4 A;  3EI3 B;  3JZN A;  3IJ1 A;  1N6E A;  1GOT B;  5I5I A;  2CE8 A;  4OZU A;  4D6V A;  3EMH A;  4CZY A;  4FAV D;  4R7A B;  3I8E A;  3SBP A;  5FKS A;  1K32 A;  3OL2 B;  4J82 A;  5FKT A;  2XYI A;  2MTA H;  2G99 A;  4O9D A;  3NVX A;  4ES0 A;  5FXY A;  2YMU A;  4L3H D;  4MK0 B;  1YFQ A;  5GMK n;  3HFQ A;  2CO0 C;  5EMK B;  3IJC A;  2IAA A;  2GNQ A;  4EWR A;  4CI1 A;  4E5Z A;  5AJA A;  4FA9 D;  4GMB A;  1PGU A;  4J78 A;  4CY3 A;  3F3P A;  1P22 A;  2IUP A;  2TRC B;  3RFG A;  3AH8 B;  3ZWL B;  5GXI A;  2OK4 A;  1NEX B;  3SVW D;  3FGB A;  3NVN A;  2IUR A;  3C99 A;  3FRX A;  4A0B B;  2AQ5 A;  4AEZ A;  3OKW A;  2QC5 A;  3IIW A;  4A09 B;  3PSC B;  3JB9 L;  5AMS A;  4JSP C;  4BH6 A;  3PXW D;  4O3U B;  3RRM C;  3PSL A;  3I7H A;  5H14 A;  3GFC A;  2Q7Q A;  1JMZ B;  5TDH B;  3JRO A;  4H5I A;  4FB1 D;  5IT9 g;  2Z2N A;  5JWZ A;  2UZX B;  4JSN C;  4U1E I;  5GSA A;  2XL2 A;  5TEF A;  4FHL A;  5HE1 B;  3I89 A;  5FA5 B;  3EI2 A;  2PM9 A;  3SN6 B;  1R5M A;  5EM2 A;  4X61 B;  4A08 B;  2J56 H;  4L3G D;  3JAM g;  2P9N C;  3JZH A;  3MXX A;  4E54 B;  5EMJ B;  2H68 A;  4U7A A;  4A0A B;  4ERY A;  3VGZ A;  3IJ0 A;  4CZV A;  2Z2O A;  2OK6 A;  4ERZ A;  3B7F A;  4QQE A;  3MZL A;  5EML B;  4A2M A;  1TBG A;  2I0T A;  5H1M A;  1TYQ C;  1OMW B;  1S4U X;  3SBR A;  3C75 H;  3UKU C;  5HE3 B;  5C9Z B;  4A7J A;  2AGY A;  3K26 A;  3UVL A;  4FA1 D;  2W18 A;  3SCY A;  2HKR A;  2I0S A;  4ZOX A;  4JSV C;  3DWL C;  1OLZ A;  4N14 A;  4UI9 R;  4PC0 A;  4ZOV A;  5A2Q g;  4ZN4 A;  4O3T B;  3OTT A;  4GZ8 A;  3AFC A;  4ZOY A;  1B9Y A;  2EBS A;  5CXB A;  1N6F A;  1MDA H;  2O9K A;  4BUJ C;  4J86 A;  4A11 B;  3I7O A;  5THA A;  4GM3 A;  2CN3 A;  1NR0 A;  2HJ4 A;  5I5J A;  1U4C A;  4TZ4 A;  5CXC A;  3IIY A;  2CO0 A;  4CI3 A;  3AL8 B;  3OKT A;  5EAP A;  3UVN A;  4Y7R A;  3I7K A;  3P4F A;  4LGN A;  5HQG A;  5CYK A;  4KFM B;  3V5W B;  4J79 A;  4IMM A;  1SHY B;  2B5M A;  3OW8 A;  2J57 G;  3EI4 A;  4FAN D;  5TEE A;  4FA5 D;  2AGW A;  5TF2 A;  3L4O D;  2IWK A;  2I0R A;  2AGX A;  3EI1 A;  3I7L A;  4ESG A;  4I79 A;  2H9P A;  4Z8L A;  4G56 B;  4L1Q D;  4JSX C;  3UVK A;  2B5N A;  4J73 A;  2UZY B;  5EAR A;  3C5M A;  5FLX g;  4GGA A;  3EU7 A;  3ODT A;  2PM7 B;  4JXM A;  5C2V B;  2H6N A;  2AGL A;  3MKS B;  5HE0 B;  3V7D B;  4CI2 A;  3MMY A;  4X60 B;  5GXH A;  3CFS B;  2YNN A;  4HDJ A;  3J80 g;  2CN2 A;  3UKR C;  2AGZ A;  5IC7 A;  3EG6 A;  2IUV A;  3N0D A;  2OIZ A;  3IKO A;  4IA9 A;  3F3G A;  4E5Z B;  1PI6 A;  4PNK B;  3UVM A;  3MZK A;  4FWW A;  2YBA A;  1JOF A;  4ZOZ A;  4CI8 A;  1ERJ A;  3J81 g;  2H47 A;  1U2V C;  3V9F A;  2P9P C;  1XKS A;  3PVU B;  2P9S C;  1VYH C;  5FQD A;  1GP2 B;  1N6D A;  5EAM A;  3U4Y A;  3OKY A;  4FA4 D;  2XU7 A;  5K1C C;  3EI3 A;  4ERQ A;  1QNI A;  4J0W A;  3UR4 A;  3AL9 A;  2H6K A;  3SXT D;  2H9N A;  3VA6 A;  4QRJ A;  5KDO B;  3NVQ A;  2H13 A;  5HYN B;  2XL3 A;  3OL2 A;  2YB8 B;  1GG2 B;  3I7N A;  3E0C A;  3DM0 A;  1PEV A;  4LG8 A;  4J81 A;  2YNP A;  3MKQ A;  3I2N A;  3W15 A;  3SWS D;  1B9X A;  4CZX A;  3DXK C;  4J8G A;  4GQB B;  2CNX A;  4XEI C;  4PXW A;  3KRX B;  5C2W B;  3VH0 A;  3EI2 B;  2PM9 B;  1PBY B;  4GM9 A;  4J77 A;  3RN1 D;  5IJ7 E;  5EM2 B;  2H3X A;  3PXS D;  3FM0 A;  4A0B A;  5EMM B;  3I7P A;  1XHM A;  3RN0 D;  5K19 A;  4A09 A;  2OVQ B;  3JRP A;  4J8B A;  4PBZ A;  2OVR B; 
#chains in the Genus database with same CATH topology
 1O6F A;  1E8N A;  3CFV A;  3I8C A;  3QHY B;  4A2L A;  3SMR A;  3RLM D;  4Y5R D;  5I5M A;  3L4M D;  3RMZ D;  2B4E A;  1M1X A;  4PBY A;  2J55 H;  2BBK H;  4BL0 A;  2JKX A;  2VDO A;  4J84 A;  4GQ1 A;  3RSE C;  1E5T A;  4XYI A;  4H5J A;  4YVD A;  3SHF A;  4LG9 A;  3QI0 A;  2I3S A;  2HJB A;  3SFZ A;  1VZ2 A;  1MG2 A;  2HU7 A;  4K3J B;  3ULE C;  5IGQ A;  1H2Y A;  3RFH A;  4NAA A;  1A12 A;  2IUQ A;  3F3F A;  4QT8 A;  2AH1 A;  4GGC A;  4QL1 A;  3NIG A;  3SJL D;  3CIK B;  3N0E A;  5IGO A;  4A08 A;  4JD2 C;  5CXB B;  2BCJ B;  2CE9 A;  1VZ3 A;  2AH0 A;  2H9M A;  4L1M A;  5EAL A;  5SXM A;  2PM6 B;  4E54 A;  3JPX A;  4X3E A;  3BG1 A;  5CXC B;  4O1Q D;  4A0A A;  3FCU A;  4NSX A;  4DNU A;  4K3I D;  5CYK B;  2HES X;  3PE7 A;  1SQ9 A;  4L9O A;  4PSX B;  2PBI B;  2VDK A;  4AN0 A;  1GXR A;  2H6Q A;  3VI4 A;  5E6U A;  3EI4 B;  3EQ8 A;  2IWF A;  1FWX A;  1RI6 A;  1UTC A;  5HE2 B;  2Z2P A;  1SQJ A;  2VDM A;  2P9L C;  4CC9 A;  2P9I C;  1Q47 A;  3EI1 B;  1GOF A;  4GGD A;  4NC4 A;  2G9A A;  2HXC A;  2OVP B;  1JMX B;  4CY1 A;  4D0K A;  3SBQ A;  2QXV A;  5AFU 3;  2GC7 A;  3BG0 A;  1JV2 A;  2XDW A;  4G1M A;  4AN1 A;  4DNW A;  4BCB A;  2OJY A;  4O45 A;  4AOW A;  4J87 A;  2P9U C;  3MUN A;  1TYE A;  3PXT D;  3K27 A;  1C9I A;  3BWS A;  1O6G A;  3ORV D;  5FKR A;  4JT6 C;  4J0X A;  4A11 A;  3SLE D;  3DXM C;  5B4W A;  4RE5 A;  3GRE A;  4CY2 A;  2I3T A;  3EWE A;  1L0Q A;  3UVO A;  2HYE A;  4OWR A;  2H14 A;  3AL8 A;  3DDU A;  4GM8 A;  1UOQ A;  3C9C A;  4PSW B;  3KRW B;  4WJK A;  1XIP A;  3DSM A;  1A0R B;  4JT5 C;  4XYH A;  5FKQ A;  5IJ8 E;  3GD1 I;  4D9S A;  2HKM A;  4BP8 A;  3KCI A;  1JJU B;  3PVW B;  1K8K C;  3JZG A;  2P9K C;  4CY5 A;  2B5L A;  4GQ2 P;  4X63 B;  4JHN A;  1MG3 A;  4MMX A;  3OKY B;  3A0F A;  5H17 A;  5M5T A;  2YNO A;  2H9L A;  2GC4 A;  3EI3 B;  4NEN A;  3JZN A;  3IJ1 A;  1N6E A;  1GOT B;  5I5I A;  2CE8 A;  4OZU A;  4D6V A;  3EMH A;  4Z7O A;  4BCC A;  4CZY A;  4FAV D;  4R7A B;  3I8E A;  3SBP A;  5FKS A;  4Z7Q A;  1K32 A;  3GC3 B;  3OL2 B;  4J82 A;  5FKT A;  2XYI A;  2MTA H;  2G99 A;  3EQ7 A;  4O9D A;  3NVX A;  4ES0 A;  5FXY A;  2YMU A;  3ZE2 A;  4L3H D;  4MK0 B;  1YFQ A;  5GMK n;  3HFQ A;  2CO0 C;  5M5V A;  5EMK B;  3IJC A;  4G55 A;  4O02 A;  5M5R A;  2IAA A;  2GNQ A;  4EWR A;  4CI1 A;  1C9L A;  5HDB A;  4E5Z A;  5AJA A;  4FA9 D;  4GMB A;  1PGU A;  3T3M A;  4J78 A;  4CY3 A;  3F3P A;  1P22 A;  2IUP A;  2TRC B;  3RFG A;  3AH8 B;  3ZWL B;  5GXI A;  2EID A;  2OK4 A;  1NEX B;  3SVW D;  3FGB A;  3NVN A;  5M61 A;  3IUM A;  4UM9 A;  2IUR A;  3C99 A;  1GOH A;  3FRX A;  4A0B B;  2AQ5 A;  1I2M B;  4AEZ A;  4G1E A;  3OKW A;  2QC5 A;  2VZ3 A;  3IIW A;  4A09 B;  3PSC B;  2VDL A;  3JB9 L;  5AMS A;  4JSP C;  4BH6 A;  3PXW D;  4O3U B;  2VC2 A;  3RRM C;  3PSL A;  2HU5 A;  3I7H A;  5H14 A;  3GFC A;  2Q7Q A;  1JMZ B;  5TDH B;  3VI3 A;  3ZDZ A;  3JRO A;  4JHP C;  4H5I A;  4FB1 D;  3IUR A;  5IT9 g;  2Z2N A;  3V4P A;  5JWZ A;  3NID A;  2UZX B;  4JSN C;  1JTD B;  4U1E I;  5GSA A;  2XL2 A;  5TEF A;  2EIB A;  1L5G A;  4FHL A;  5HE1 B;  3I89 A;  3ZE0 A;  3K6S A;  3O4I A;  5FA5 B;  1T2X A;  3EI2 A;  2PM9 A;  2EIC A;  4Z7N A;  2BKL A;  3SN6 B;  1R5M A;  3K71 A;  5EM2 A;  4X61 B;  4A08 B;  3IUL A;  2J56 H;  4L3G D;  3JAM g;  2P9N C;  3JZH A;  3MXX A;  4E54 B;  5EMJ B;  2H68 A;  4U7A A;  4A0A B;  4ERY A;  3VGZ A;  3O4J A;  2QZP A;  3IJ0 A;  4CZV A;  2Z2O A;  2OK6 A;  4ERZ A;  3B7F A;  4QQE A;  3MZL A;  5EML B;  3K72 A;  1K3I A;  4WK0 A;  4A2M A;  1TBG A;  2I0T A;  5H1M A;  1GOG A;  1TYQ C;  3O4G A;  1OMW B;  1S4U X;  4MMZ A;  3SBR A;  3C75 H;  4AMY A;  3UKU C;  5HE3 B;  5C9Z B;  4A7J A;  4IRZ A;  2AGY A;  3K26 A;  3UVL A;  4FA1 D;  2W18 A;  3SCY A;  2HKR A;  2I0S A;  4ZOX A;  4JSV C;  3DWL C;  1OLZ A;  3MUO A;  4N14 A;  4UI9 R;  4MMY A;  2HU8 A;  4PC0 A;  4ZOV A;  5A2Q g;  4ZN4 A;  4WK4 A;  4O3T B;  1U8C A;  3OTT A;  4GZ8 A;  3AFC A;  4ZOY A;  1E8M A;  1B9Y A;  2EBS A;  5C92 A;  4AX4 A;  5CXB A;  1N6F A;  1MDA H;  2O9K A;  5FFO A;  4BUJ C;  4J86 A;  5FFG A;  4A11 B;  3I7O A;  5THA A;  4GM3 A;  2CN3 A;  1NR0 A;  2HJ4 A;  4AMZ A;  5I5J A;  1U4C A;  4TZ4 A;  5CXC A;  3IIY A;  2CO0 A;  4CI3 A;  3AL8 B;  3OKT A;  5EAP A;  3UVN A;  4Y7R A;  3I7K A;  3P4F A;  4LGN A;  5HQG A;  5CYK A;  4KFM B;  3V5W B;  4J79 A;  4IMM A;  1SHY B;  2B5M A;  3OW8 A;  2J57 G;  3OF7 A;  2VDN A;  2VZ1 A;  3EI4 A;  4FAN D;  5TEE A;  4BCD A;  4FA5 D;  2AGW A;  3IVM A;  5TF2 A;  3L4O D;  2IWK A;  2I0R A;  2AGX A;  4BP9 A;  3EI1 A;  3I7L A;  1VE7 A;  4ESG A;  4I79 A;  2H9P A;  4Z8L A;  4G56 B;  4L1Q D;  4JSX C;  3UVK A;  2B5N A;  2WQ8 A;  2UZY B;  4J73 A;  4WK2 A;  5EAR A;  3C5M A;  4UM8 A;  5FLX g;  1UOO A;  3EU7 A;  4GGA A;  3ODT A;  2PM7 B;  4JXM A;  5C2V B;  2H6N A;  3O4H A;  2AGL A;  3MKS B;  3ZE1 A;  5HE0 B;  2QR5 A;  1VE6 A;  3V7D B;  3IUQ A;  2VDR A;  4CI2 A;  3MMY A;  4X60 B;  2XE4 A;  5GXH A;  1QFS A;  3CFS B;  2YNN A;  4HDJ A;  3J80 g;  4QAM A;  1YR2 A;  2CN2 A;  3UKR C;  2AGZ A;  5IC7 A;  3EG6 A;  2IUV A;  3N0D A;  2OIZ A;  3IKO A;  4IA9 A;  3F3G A;  4E5Z B;  1PI6 A;  4PNK B;  3UVM A;  1H2X A;  3MZK A;  4FWW A;  5E6S A;  3T3P A;  2YBA A;  1QFM A;  1JOF A;  4ZOZ A;  1BPO A;  1H2W A;  4CI8 A;  1ERJ A;  1H2Z A;  3J81 g;  2H47 A;  1U2V C;  3V9F A;  5M5S A;  2P9P C;  1XKS A;  3PVU B;  2P9S C;  1VYH C;  5FQD A;  1GP2 B;  1N6D A;  5EAM A;  3U4Y A;  3OKY A;  4FA4 D;  4DNV A;  2XU7 A;  5K1C C;  3EI3 A;  4ERQ A;  1QNI A;  4J0W A;  3UR4 A;  3AL9 A;  2H6K A;  3SXT D;  2H9N A;  3VA6 A;  3IUN A;  4O2W A;  4QRJ A;  3MVD K;  2XZG A;  5KDO B;  5E6R A;  3NVQ A;  2H13 A;  5HYN B;  2XL3 A;  3OL2 A;  2YB8 B;  1GG2 B;  3FCS A;  5C86 A;  3I7N A;  3E0C A;  3DM0 A;  1PEV A;  4LG8 A;  4J81 A;  1UOP A;  2YNP A;  3MKQ A;  3I2N A;  3W15 A;  3SWS D;  1B9X A;  4CZX A;  3DXK C;  4J8G A;  4GQB B;  2CNX A;  4XEI C;  4PXW A;  3KRX B;  5C2W B;  3NIF A;  3VH0 A;  3EI2 B;  2PM9 B;  1PBY B;  4GM9 A;  4J77 A;  2EIE A;  3RN1 D;  3IJE A;  4NBM A;  2VDP A;  5IJ7 E;  5EM2 B;  5M5U A;  2H3X A;  3PXS D;  3FM0 A;  3V4V A;  4RE6 A;  3ZDY A;  4A0B A;  5EMM B;  3I7P A;  2VDQ A;  1XHM A;  3EQ9 A;  3RN0 D;  5K19 A;  4A09 A;  3ZDX A;  2OVQ B;  3JRP A;  4J8B A;  4PBZ A;  3IUJ A;  2OVR B; 
#chains in the Genus database with same CATH homology
 3CFV A;  3I8C A;  4A2L A;  3SMR A;  3RLM D;  4Y5R D;  5I5M A;  3L4M D;  3RMZ D;  2B4E A;  4PBY A;  2J55 H;  2BBK H;  4BL0 A;  4J84 A;  4GQ1 A;  3RSE C;  4XYI A;  4H5J A;  4YVD A;  3SHF A;  4LG9 A;  2I3S A;  2HJB A;  3SFZ A;  1MG2 A;  4K3J B;  3ULE C;  5IGQ A;  3RFH A;  2IUQ A;  3F3F A;  4QT8 A;  2AH1 A;  4GGC A;  4QL1 A;  3SJL D;  3CIK B;  3N0E A;  5IGO A;  4A08 A;  4JD2 C;  5CXB B;  2BCJ B;  2CE9 A;  2AH0 A;  2H9M A;  5EAL A;  5SXM A;  4E54 A;  2PM6 B;  3JPX A;  4X3E A;  3BG1 A;  5CXC B;  4O1Q D;  4A0A A;  4NSX A;  4K3I D;  5CYK B;  2HES X;  3PE7 A;  1SQ9 A;  4L9O A;  4PSX B;  2PBI B;  1GXR A;  2H6Q A;  3EI4 B;  2IWF A;  1FWX A;  1RI6 A;  5HE2 B;  2Z2P A;  1SQJ A;  2P9L C;  4CC9 A;  2P9I C;  1Q47 A;  3EI1 B;  4GGD A;  2G9A A;  2HXC A;  2OVP B;  1JMX B;  4CY1 A;  4D0K A;  3SBQ A;  2QXV A;  5AFU 3;  2GC7 A;  3BG0 A;  2OJY A;  4O45 A;  4AOW A;  4J87 A;  2P9U C;  3PXT D;  3K27 A;  3BWS A;  3ORV D;  5FKR A;  4JT6 C;  4J0X A;  4A11 A;  3SLE D;  3DXM C;  5B4W A;  3GRE A;  4CY2 A;  2I3T A;  3EWE A;  1L0Q A;  3UVO A;  2HYE A;  4OWR A;  2H14 A;  3AL8 A;  4GM8 A;  3C9C A;  4PSW B;  3KRW B;  1XIP A;  3DSM A;  1A0R B;  4JT5 C;  4XYH A;  5FKQ A;  5IJ8 E;  2HKM A;  1JJU B;  3PVW B;  1K8K C;  3JZG A;  2P9K C;  4CY5 A;  2B5L A;  4GQ2 P;  4X63 B;  1MG3 A;  3OKY B;  3A0F A;  5H17 A;  2YNO A;  2H9L A;  2GC4 A;  3EI3 B;  3JZN A;  3IJ1 A;  1N6E A;  1GOT B;  5I5I A;  2CE8 A;  4OZU A;  4D6V A;  3EMH A;  4CZY A;  4FAV D;  4R7A B;  3I8E A;  3SBP A;  5FKS A;  1K32 A;  3OL2 B;  4J82 A;  5FKT A;  2XYI A;  2MTA H;  2G99 A;  4O9D A;  3NVX A;  4ES0 A;  5FXY A;  2YMU A;  4L3H D;  4MK0 B;  1YFQ A;  5GMK n;  3HFQ A;  2CO0 C;  5EMK B;  3IJC A;  2IAA A;  2GNQ A;  4EWR A;  4CI1 A;  4E5Z A;  5AJA A;  4FA9 D;  4GMB A;  1PGU A;  4J78 A;  4CY3 A;  3F3P A;  1P22 A;  2IUP A;  2TRC B;  3RFG A;  3AH8 B;  3ZWL B;  5GXI A;  2OK4 A;  1NEX B;  3SVW D;  3FGB A;  3NVN A;  2IUR A;  3C99 A;  3FRX A;  4A0B B;  2AQ5 A;  4AEZ A;  3OKW A;  2QC5 A;  3IIW A;  4A09 B;  3PSC B;  3JB9 L;  5AMS A;  4JSP C;  4BH6 A;  3PXW D;  4O3U B;  3RRM C;  3PSL A;  3I7H A;  5H14 A;  3GFC A;  2Q7Q A;  1JMZ B;  5TDH B;  3JRO A;  4H5I A;  4FB1 D;  5IT9 g;  2Z2N A;  5JWZ A;  2UZX B;  4JSN C;  4U1E I;  5GSA A;  2XL2 A;  5TEF A;  4FHL A;  5HE1 B;  3I89 A;  5FA5 B;  3EI2 A;  2PM9 A;  3SN6 B;  1R5M A;  5EM2 A;  4X61 B;  4A08 B;  2J56 H;  4L3G D;  3JAM g;  2P9N C;  3JZH A;  3MXX A;  4E54 B;  5EMJ B;  2H68 A;  4U7A A;  4A0A B;  4ERY A;  3VGZ A;  3IJ0 A;  4CZV A;  2Z2O A;  2OK6 A;  4ERZ A;  3B7F A;  4QQE A;  3MZL A;  5EML B;  4A2M A;  1TBG A;  2I0T A;  5H1M A;  1TYQ C;  1OMW B;  1S4U X;  3SBR A;  3C75 H;  3UKU C;  5HE3 B;  5C9Z B;  4A7J A;  2AGY A;  3K26 A;  3UVL A;  4FA1 D;  2W18 A;  3SCY A;  2HKR A;  2I0S A;  4ZOX A;  4JSV C;  3DWL C;  1OLZ A;  4N14 A;  4UI9 R;  4PC0 A;  4ZOV A;  5A2Q g;  4ZN4 A;  4O3T B;  3OTT A;  4GZ8 A;  3AFC A;  4ZOY A;  1B9Y A;  2EBS A;  5CXB A;  1N6F A;  1MDA H;  2O9K A;  4BUJ C;  4J86 A;  4A11 B;  3I7O A;  5THA A;  4GM3 A;  2CN3 A;  1NR0 A;  2HJ4 A;  5I5J A;  1U4C A;  4TZ4 A;  5CXC A;  3IIY A;  2CO0 A;  4CI3 A;  3AL8 B;  3OKT A;  5EAP A;  3UVN A;  4Y7R A;  3I7K A;  3P4F A;  4LGN A;  5HQG A;  5CYK A;  4KFM B;  3V5W B;  4J79 A;  4IMM A;  1SHY B;  2B5M A;  3OW8 A;  2J57 G;  3EI4 A;  4FAN D;  5TEE A;  4FA5 D;  2AGW A;  5TF2 A;  3L4O D;  2IWK A;  2I0R A;  2AGX A;  3EI1 A;  3I7L A;  4ESG A;  4I79 A;  2H9P A;  4Z8L A;  4G56 B;  4L1Q D;  4JSX C;  3UVK A;  2B5N A;  4J73 A;  2UZY B;  5EAR A;  3C5M A;  5FLX g;  4GGA A;  3EU7 A;  3ODT A;  2PM7 B;  4JXM A;  5C2V B;  2H6N A;  2AGL A;  3MKS B;  5HE0 B;  3V7D B;  4CI2 A;  3MMY A;  4X60 B;  5GXH A;  3CFS B;  2YNN A;  4HDJ A;  3J80 g;  2CN2 A;  3UKR C;  2AGZ A;  5IC7 A;  3EG6 A;  2IUV A;  3N0D A;  2OIZ A;  3IKO A;  4IA9 A;  3F3G A;  4E5Z B;  1PI6 A;  4PNK B;  3UVM A;  3MZK A;  4FWW A;  2YBA A;  1JOF A;  4ZOZ A;  4CI8 A;  1ERJ A;  3J81 g;  2H47 A;  1U2V C;  3V9F A;  2P9P C;  1XKS A;  3PVU B;  2P9S C;  1VYH C;  5FQD A;  1GP2 B;  1N6D A;  5EAM A;  3U4Y A;  3OKY A;  4FA4 D;  2XU7 A;  5K1C C;  3EI3 A;  4ERQ A;  1QNI A;  4J0W A;  3UR4 A;  3AL9 A;  2H6K A;  3SXT D;  2H9N A;  3VA6 A;  4QRJ A;  5KDO B;  3NVQ A;  2H13 A;  5HYN B;  2XL3 A;  3OL2 A;  2YB8 B;  1GG2 B;  3I7N A;  3E0C A;  3DM0 A;  1PEV A;  4LG8 A;  4J81 A;  2YNP A;  3MKQ A;  3I2N A;  3W15 A;  3SWS D;  1B9X A;  4CZX A;  3DXK C;  4J8G A;  4GQB B;  2CNX A;  4XEI C;  4PXW A;  3KRX B;  5C2W B;  3VH0 A;  3EI2 B;  2PM9 B;  1PBY B;  4GM9 A;  4J77 A;  3RN1 D;  5IJ7 E;  5EM2 B;  2H3X A;  3PXS D;  3FM0 A;  4A0B A;  5EMM B;  3I7P A;  1XHM A;  3RN0 D;  5K19 A;  4A09 A;  2OVQ B;  3JRP A;  4J8B A;  4PBZ A;  2OVR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...