2YMUA

Structure of a highly repetitive propeller structure
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
577
structure length
577
Chain Sequence
GSHMGVKERNRLEAHSSSVRGVAFSPDGQTIASASDDKTVKLWNRNGQLLQTLTGHSSSVWGVAFSPDGQTIASASDDKTVKLWNRNGQLLQTLTGHSSSVRGVAFSPDGQTIASASDDKTVKLWNRNGQLLQTLTGHSSSVWGVAFSPDGQTIASASDDKTVKLWNRNGQLLQTLTGHSSSVWGVAFSPDGQTIASASDDKTVKLWNRNGQLLQTLTGHSSSVRGVAFSPDGQTIASASDDKTVKLWNRNGQLLQTLTGHSSSVNGVAFRPDGQTIASASDDKTVKLWNRNGQLLQTLTGHSSSVWGVAFSPDGQTIASASDDKTVKLWNRNGQHLQTLTGHSSSVWGVAFSPDGQTIASASDDKTVKLWNRNGQLLQTLTGHSSSVRGVAFSPDGQTIASASDDKTVKLWNRNGQLLQTLTGHSSSVWGVAFSPDDQTIASASDDKTVKLWNRNGQLLQTLTGHSSSVRGVAFSPDGQTIASASDDKTVKLWNRNGQLLQTLTGHSSSVRGVAFSPDGQTIASASDDKTVKLWNRNGQLLQTLTGHSSSVWGVAFSPDGQTIASASSDKTVKLWN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of a Highly Repetitive Propeller Structure
rcsb
source organism Nostoc punctiforme
molecule tags Unknown function
molecule keywords WD-40 REPEAT PROTEIN
total genus 179
structure length 577
sequence length 577
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2ymuA01
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2ymuA02
2HKMA 4FA5D 4J82A 2IUPA 2P9UC 4A0BA 1NEXB 2CO0A 4FHLA 4GQBB 1JMXB 3SJLD 3EI2B 3SBRA 4KFMB 1PEVA 3I7HA 3DM0A 1NR0A 3RFHA 4FAND 4CI2A 4JD2C 4ZOYA 2IUQA 2H47A 3SXTD 4CY5A 1JMZB 2IAAA 4CI8A 2H9LA 4ERYA 3W15A 3RLMD 3SCYA 1B9YA 5AJAA 2P9LC 2HXCA 2H14A 2Z2PA 3PXSD 4A08B 1Q47A 1XKSA 3C9CA 3EI2A 3OL2A 4GQ1A 4FB1D 4N14A 5C9ZB 2H13A 4A0BB 4A7JA 5EMKB 4ERZA 2H68A 4J8GA 3EI1B 4J78A 2IWKA 3L4OD 4O3UB 4E5ZA 4JT5C 4A0AB 2Q7QA 3EI1A 2HYEA 1ERJA 1FWXA 3EG6A 4JXMA 4Y5RD 5FKTA 2W18A 3DXMC 4A08A 4I79A 3JPXA 3F3PA 3RN0D 2OK6A 4JT6C 2EBSA 2Z2NA 3HFQA 2CN2A 4J87A 2OVPB 3EI4A 4ESGA 2QC5A 4J86A 4Y7RA 3N0DA 1L0QA 5GXIA 2YMUA 3AL9A 3I7LA 5TEEA 4D6VA 3UKRC 4X61B 2MTAH 3OKYA 4ERQA 4AEZA 4AOWA 1PI6A 2H6KA 4E54B 2I0SA 3NVQA 3I7NA 4J0WA 2UZYB 3SFZA 2YNPA 5B4WA 4J0XA 1SQJA 4ZN4A 4MK0B 2XL3A 4XEIC 2P9PC 3BG0A 5EARA 1B9XA 2I3SA 5AMSA 3V7DB 3VGZA 3SHFA 4BH6A 3SLED 2OVRB 3UKUC 3FRXA 3RMZD 3ZWLB 5C2VB 3OL2B 5HQGA 4LGNA 4CZVA 3JB9L 4QL1A 4GMBA 1PBYB 2H6QA 5K19A 5EALA 1VYHC 3OW8A 5FKQA 3UR4A 3IIYA 5CXBA 2PM7B 4L3GD 5FKSA 5GMKn 4FAVD 3CIKB 4A0AA 1TBGA 2AGZA 1MG2A 3P4FA 3JZHA 4E5ZB 2I0TA 3MKQA 4CZXA 2P9KC 3GFCA 3V5WB 4HDJA 3OKTA 2O9KA 3KRWB 3V9FA 1R5MA 2H9MA 5IJ7E 2H9NA 2H9PA 5EAPA 3RRMC 5CXCA 3K26A 3IKOA 3EI3A 2CE8A 2BCJB 4ZOZA 3JROA 2IWFA 5EM2B 4PNKB 3DWLC 2XYIA 2I0RA 1P22A 5IC7A 2AH1A 4A11A 4JSXC 3AL8B 4G56B 5I5IA 4XYHA 5FKRA 4FA1D 4EWRA 3C99A 3MZKA 4FWWA 4X60B 4UI9R 4X63B 1MG3A 3FGBA 5TDHB 3RN1D 3SVWD 3OKWA 1RI6A 4CY1A 3MMYA 3MKSB 4QT8A 1PGUA 3I8EA 5JWZA 3ORVD 4OWRA 4BUJC 3ULEC 4K3ID 5CYKB 2B5MA 2J55H 3PSCB 2YB8B 1JJUB 3I8CA 4U1EI 3A0FA 2HESX 2PBIB 3NVNA 3BG1A 4H5JA 5SXMA 2YBAA 4GM3A 2P9IC 3I89A 4GGCA 3MZLA 5A2Qg 3FM0A 1GG2B 3GREA 4D0KA 1QNIA 1TYQC 2UZXB 3IIWA 4OZUA 2PM9A 5I5MA 3PVUB 2GC7A 3C5MA 4ZOVA 4J79A 2J57G 2TRCB 3PSLA 1GOTB 4L9OA 3SMRA 2YNNA 3SBPA 2OJYA 3JAMg 3UVNA 4QQEA 3EU7A 3OTTA 2B4EA 3RSEC 4ZOXA 5FA5B 3I7OA 3SBQA 1U2VC 1N6EA 3N0EA 3VH0A 2AH0A 4LG8A 2AGLA 3CFSB 3I2NA 2CE9A 3JRPA 4LG9A 5FXYA 5C2WB 3UVKA 3IJCA 4GQ2P 1XIPA 4GZ8A 3EMHA 4J77A 2QXVA 2J56H 3PVWB 4E54A 2H6NA 4PBZA 4JSPC 4PXWA 5IGOA 2H3XA 4L3HD 3UVLA 3IJ1A 3UVMA 4IMMA 5GSAA 4CI3A 2I3TA 4PC0A 4JSNC 2G9AA 4GGDA 3J81g 5EMJB 5HE2B 4CC9A 5TF2A 3PE7A 2B5LA 3AL8A 3NVXA 2PM6B 3EWEA 4R7AB 3BWSA 5TEFA 4PBYA 5THAA 4FA4D 4FA9D 5IT9g 2BBKH 5IGQA 4O1QD 5H14A 2B5NA 2XU7A 3E0CA 1MDAH 3PXTD 2IUVA 5EM2A 4O45A 3MXXA 4U7AA 1U4CA 4XYIA 4BL0A 4CZYA 1YFQA 4J81A 5KDOB 4J73A 4YVDA 4CY2A 4A2LA 2HJBA 1N6FA 2IURA 3DSMA 4GM8A 1GP2B 4L1QD 3UVOA 4ES0A 2OK4A 3C75H 2Z2OA 5AFU3 4J8BA 3L4MD 3B7FA 2XL2A 2HJ4A 1XHMA 1SHYB 4K3JB 5EMLB 3PXWD 3U4YA 5IJ8E 4H5IA 3F3GA 4TZ4A 4A11B 1A0RB 4JSVC 4PSXB 3J80g 3AFCA 4GGAA 2CN3A 2OVQB 5K1CC 2PM9B 5HE1B 4NSXA 5I5JA 3DXKC 3SN6B 3RFGA 3EI3B 5FQDA 2P9NC 4IA9A 3KRXB 2HKRA 5H1MA 2CNXA 4CI1A 5EMMB 3OKYB 3ODTA 2CO0C 2AGWA 4PSWB 1OLZA 4X3EA 2GC4A 2YNOA 4Z8LA 5GXHA 3F3FA 2AGYA 1SQ9A 2OIZA 3VA6A 2P9SC 2G99A 5HYNB 5CXBB 4J84A 3JZGA 3K27A 5HE3B 3AH8B 5CXCB 4QRJA 1OMWB 5H17A 2AGXA 3I7KA 4A09A 1K8KC 1N6DA 3I7PA 1S4UX 5HE0B 2GNQA 3IJ0A 3SWSD 1K32A 4CY3A 4O9DA 4A2MA 5FLXg 1GXRA 1JOFA 3CFVA 2AQ5A 4O3TB 5EAMA 3EI4B 4GM9A 4A09B 3JZNA 5CYKA
chains in the Genus database with same CATH superfamily
2HKMA 4FA5D 4J82A 2IUPA 5M5VA 2P9UC 4QAMA 4A0BA 1NEXB 2CO0A 4FHLA 4GQBB 1JMXB 3ZE2A 1UOQA 3SJLD 3EI2B 3SBRA 4KFMB 1UOOA 1M1XA 1PEVA 3I7HA 5C86A 3DM0A 5E6SA 1NR0A 3RFHA 4FAND 4CI2A 4JD2C 4ZOYA 2IUQA 5M5RA 2H47A 3SXTD 4CY5A 4DNVA 3MVDK 3EQ8A 1JMZB 2IAAA 4CI8A 2H9LA 4ERYA 3W15A 3RLMD 2VDLA 4AMZA 3SCYA 1B9YA 5AJAA 2P9LC 4O2WA 2HXCA 3NIDA 2H14A 2Z2PA 3PXSD 4A08B 1Q47A 1XKSA 3ZDZA 2HU7A 3C9CA 3EI2A 3OL2A 4GQ1A 4G1MA 2EIBA 4FB1D 1T2XA 4N14A 5C9ZB 2H13A 4A0BB 4A7JA 4D9SA 3MUOA 1A12A 5EMKB 3O4IA 4WK4A 4AN0A 3ZE1A 4ERZA 2H68A 4J8GA 3EI1B 3NIGA 1E8MA 4J78A 2IWKA 3L4OD 4O3UB 4E5ZA 4JT5C 5E6RA 4A0AB 2Q7QA 3O4JA 5E6UA 3EI1A 2HYEA 1ERJA 1FWXA 3EG6A 4JXMA 4Y5RD 5FKTA 2W18A 3DDUA 3DXMC 4A08A 4I79A 3JPXA 3F3PA 3RN0D 2OK6A 4JT6C 2EBSA 2Z2NA 3HFQA 2CN2A 4NENA 4J87A 2OVPB 4RE5A 3EI4A 2XE4A 4ESGA 2QC5A 4JHPC 4J86A 4Y7RA 3ZDYA 3IURA 3N0DA 1QFMA 4AN1A 4JHNA 2QZPA 1L0QA 5GXIA 3IJEA 2YMUA 3AL9A 3I7LA 4AMYA 5TEEA 4D6VA 5M5UA 3UKRC 4X61B 2EIEA 4MMXA 2MTAH 3OKYA 4ERQA 4AEZA 4AOWA 3FCSA 2XZGA 1PI6A 2H6KA 3QHYB 4E54B 3T3MA 1GOGA 2I0SA 3I7NA 3NVQA 4J0WA 2UZYB 3IUQA 3SFZA 2YNPA 5B4WA 4J0XA 5FFOA 1SQJA 4ZN4A 4MK0B 4RE6A 2XL3A 3ZE0A 4XEIC 3NIFA 2P9PC 3BG0A 5EARA 1B9XA 4G1EA 2I3SA 5AMSA 3V7DB 1L5GA 3VGZA 3SHFA 2WQ8A 4BH6A 3SLED 2OVRB 2HU5A 1H2YA 3UKUC 3FRXA 3RMZD 3ZWLB 3VI3A 5C2VB 1VE6A 4BP9A 3OF7A 3OL2B 4LGNA 5HQGA 4CZVA 4QL1A 3QI0A 1PBYB 2H6QA 4GMBA 5K19A 2VC2A 5EALA 1VYHC 3OW8A 5FKQA 3UR4A 3IIYA 2JKXA 1JV2A 5CXBA 2PM7B 4L3GD 5FKSA 2VDMA 3IUNA 4BCBA 4FAVD 5GMKn 5HDBA 3CIKB 4Z7NA 4A0AA 1TBGA 2AGZA 1MG2A 3P4FA 3JZHA 4E5ZB 2I0TA 3MKQA 4CZXA 2P9KC 3GFCA 3V5WB 4HDJA 2VDOA 3OKTA 2O9KA 1O6GA 3KRWB 3V9FA 1R5MA 2H9MA 1TYEA 5IJ7E 2H9NA 2H9PA 5EAPA 3RRMC 5CXCA 3K26A 2VDPA 2VZ1A 3IKOA 2VDRA 3EI3A 2CE8A 2BCJB 4ZOZA 3JROA 2IWFA 5EM2B 4PNKB 3DWLC 2XYIA 2I0RA 4MMZA 1C9LA 1P22A 4BP8A 5IC7A 2AH1A 4A11A 4JSXC 3AL8B 4G56B 5I5IA 1H2ZA 3O4HA 4XYHA 5FKRA 4FA1D 4EWRA 3C99A 3MZKA 4FWWA 4X60B 4UI9R 4X63B 1MG3A 3FGBA 1GOHA 5TDHB 3RN1D 3SVWD 3OKWA 4MMYA 3IVMA 1RI6A 4CY1A 3MMYA 3MKSB 4QT8A 1PGUA 3I8EA 5JWZA 5M61A 3KCIA 3GC3B 3ORVD 4OWRA 4BUJC 3ULEC 4K3ID 5CYKB 2B5MA 2J55H 3PSCB 2YB8B 1JJUB 3I8CA 4U1EI 3A0FA 5M5SA 2HESX 3ZDXA 2PBIB 3NVNA 3BG1A 4H5JA 5SXMA 2YBAA 1U8CA 4GM3A 3K71A 2P9IC 3I89A 4GGCA 4DNWA 3MZLA 4BCDA 5A2Qg 3FM0A 1GG2B 3VI4A 3GREA 4D0KA 1QNIA 1TYQC 2UZXB 3IIWA 4OZUA 2PM9A 5I5MA 3PVUB 4BCCA 2GC7A 3C5MA 1VZ2A 4ZOVA 4J79A 1H2WA 2J57G 2TRCB 3PSLA 1GOTB 4L9OA 3SMRA 2YNNA 3SBPA 2OJYA 3V4VA 3K6SA 3JAMg 4G55A 4AX4A 3UVNA 4QQEA 3EU7A 3OTTA 2B4EA 3RSEC 4ZOXA 1H2XA 5FA5B 3I7OA 3V4PA 3SBQA 1U2VC 1N6EA 3N0EA 3VH0A 2AH0A 1UTCA 2XDWA 2AGLA 3CFSB 3I2NA 3JRPA 2CE9A 4LG8A 4LG9A 5FXYA 1YR2A 5C2WB 3UVKA 3IJCA 4GQ2P 1XIPA 4Z7OA 4GZ8A 3EMHA 4J77A 2QXVA 2J56H 3PVWB 1VE7A 3EQ9A 4E54A 1C9IA 2H6NA 4PBZA 4JSPC 4PXWA 5IGOA 2H3XA 3IUMA 4L3HD 3UVLA 3IJ1A 1JTDB 3UVMA 4IMMA 5GSAA 4CI3A 2I3TA 4NAAA 4PC0A 4JSNC 3IULA 2G9AA 4GGDA 4DNUA 3J81g 5EMJB 5HE2B 4CC9A 5TF2A 3PE7A 4Z7QA 2B5LA 3AL8A 3NVXA 2PM6B 3EWEA 4R7AB 3BWSA 5TEFA 1I2MB 4PBYA 5THAA 4FA4D 4FA9D 2BBKH 5IT9g 2VDKA 5IGQA 3IUJA 3MUNA 4O1QD 5H14A 2HU8A 2B5NA 2XU7A 3E0CA 4WK2A 1MDAH 3PXTD 2IUVA 5EM2A 4IRZA 4O45A 5C92A 3MXXA 4U7AA 1U4CA 4XYIA 4BL0A 3K72A 1E5TA 4CZYA 1GOFA 1YFQA 4J81A 3T3PA 5KDOB 4J73A 4YVDA 4CY2A 2VZ3A 4A2LA 2HJBA 4NBMA 1N6FA 2IURA 3DSMA 4GM8A 1GP2B 4L1QD 3UVOA 4ES0A 2OK4A 3C75H 2Z2OA 1E8NA 3O4GA 3EQ7A 5AFU3 2EIDA 4J8BA 3L4MD 3B7FA 2XL2A 2HJ4A 1XHMA 1SHYB 4K3JB 5EMLB 2QR5A 3PXWD 3U4YA 5IJ8E 4H5IA 3F3GA 4TZ4A 4A11B 1A0RB 4JSVC 1BPOA 4O02A 4PSXB 1O6FA 3J80g 3AFCA 4GGAA 3GD1I 2CN3A 4L1MA 2OVQB 5K1CC 1VZ3A 2PM9B 5HE1B 4NSXA 5I5JA 5M5TA 3DXKC 3SN6B 3RFGA 3EI3B 5FQDA 2P9NC 4IA9A 1QFSA 3KRXB 2HKRA 5H1MA 2CNXA 4CI1A 5EMMB 3OKYB 3ODTA 2CO0C 2AGWA 4PSWB 1OLZA 3FCUA 4X3EA 2BKLA 2GC4A 2YNOA 4Z8LA 5GXHA 4NC4A 3F3FA 2AGYA 1SQ9A 2OIZA 4WK0A 3VA6A 2P9SC 2G99A 5HYNB 5CXBB 4J84A 3JZGA 1UOPA 3K27A 5HE3B 3AH8B 5CXCB 1K3IA 4QRJA 1OMWB 2VDNA 4WJKA 2AGXA 5H17A 3I7KA 4A09A 1K8KC 4UM9A 2VDQA 1N6DA 3I7PA 1S4UX 5HE0B 2GNQA 3IJ0A 3SWSD 1K32A 4CY3A 4O9DA 4A2MA 5FLXg 2EICA 1GXRA 1JOFA 3CFVA 2AQ5A 4O3TB 5EAMA 3EI4B 5FFGA 4GM9A 4A09B 3JZNA 5CYKA 4UM8A 3JB9L
chains in the Genus database with same CATH topology
2HKMA 4FA5D 4J82A 2IUPA 2P9UC 4A0BA 1NEXB 2CO0A 4FHLA 4GQBB 1JMXB 3SJLD 3EI2B 3SBRA 4KFMB 1PEVA 3I7HA 3DM0A 1NR0A 3RFHA 4FAND 4CI2A 4JD2C 4ZOYA 2IUQA 2H47A 3SXTD 4CY5A 1JMZB 2IAAA 4CI8A 2H9LA 4ERYA 3W15A 3RLMD 3SCYA 1B9YA 5AJAA 2P9LC 2HXCA 2H14A 2Z2PA 3PXSD 4A08B 1Q47A 1XKSA 3C9CA 3EI2A 3OL2A 4GQ1A 4FB1D 4N14A 5C9ZB 2H13A 4A0BB 4A7JA 5EMKB 4ERZA 2H68A 4J8GA 3EI1B 4J78A 2IWKA 3L4OD 4O3UB 4E5ZA 4JT5C 4A0AB 2Q7QA 3EI1A 2HYEA 1ERJA 1FWXA 3EG6A 4JXMA 4Y5RD 5FKTA 2W18A 3DXMC 4A08A 4I79A 3JPXA 3F3PA 3RN0D 2OK6A 4JT6C 2EBSA 2Z2NA 3HFQA 2CN2A 4J87A 2OVPB 3EI4A 4ESGA 2QC5A 4J86A 4Y7RA 3N0DA 1L0QA 5GXIA 2YMUA 3AL9A 3I7LA 5TEEA 4D6VA 3UKRC 4X61B 2MTAH 3OKYA 4ERQA 4AEZA 4AOWA 1PI6A 2H6KA 4E54B 2I0SA 3NVQA 3I7NA 4J0WA 2UZYB 3SFZA 2YNPA 5B4WA 4J0XA 1SQJA 4ZN4A 4MK0B 2XL3A 4XEIC 2P9PC 3BG0A 5EARA 1B9XA 2I3SA 5AMSA 3V7DB 3VGZA 3SHFA 4BH6A 3SLED 2OVRB 3UKUC 3FRXA 3RMZD 3ZWLB 5C2VB 3OL2B 5HQGA 4LGNA 4CZVA 3JB9L 4QL1A 4GMBA 1PBYB 2H6QA 5K19A 5EALA 1VYHC 3OW8A 5FKQA 3UR4A 3IIYA 5CXBA 2PM7B 4L3GD 5FKSA 5GMKn 4FAVD 3CIKB 4A0AA 1TBGA 2AGZA 1MG2A 3P4FA 3JZHA 4E5ZB 2I0TA 3MKQA 4CZXA 2P9KC 3GFCA 3V5WB 4HDJA 3OKTA 2O9KA 3KRWB 3V9FA 1R5MA 2H9MA 5IJ7E 2H9NA 2H9PA 5EAPA 3RRMC 5CXCA 3K26A 3IKOA 3EI3A 2CE8A 2BCJB 4ZOZA 3JROA 2IWFA 5EM2B 4PNKB 3DWLC 2XYIA 2I0RA 1P22A 5IC7A 2AH1A 4A11A 4JSXC 3AL8B 4G56B 5I5IA 4XYHA 5FKRA 4FA1D 4EWRA 3C99A 3MZKA 4FWWA 4X60B 4UI9R 4X63B 1MG3A 3FGBA 5TDHB 3RN1D 3SVWD 3OKWA 1RI6A 4CY1A 3MMYA 3MKSB 4QT8A 1PGUA 3I8EA 5JWZA 3ORVD 4OWRA 4BUJC 3ULEC 4K3ID 5CYKB 2B5MA 2J55H 3PSCB 2YB8B 1JJUB 3I8CA 4U1EI 3A0FA 2HESX 2PBIB 3NVNA 3BG1A 4H5JA 5SXMA 2YBAA 4GM3A 2P9IC 3I89A 4GGCA 3MZLA 5A2Qg 3FM0A 1GG2B 3GREA 4D0KA 1QNIA 1TYQC 2UZXB 3IIWA 4OZUA 2PM9A 5I5MA 3PVUB 2GC7A 3C5MA 4ZOVA 4J79A 2J57G 2TRCB 3PSLA 1GOTB 4L9OA 3SMRA 2YNNA 3SBPA 2OJYA 3JAMg 3UVNA 4QQEA 3EU7A 3OTTA 2B4EA 3RSEC 4ZOXA 5FA5B 3I7OA 3SBQA 1U2VC 1N6EA 3N0EA 3VH0A 2AH0A 4LG8A 2AGLA 3CFSB 3I2NA 2CE9A 3JRPA 4LG9A 5FXYA 5C2WB 3UVKA 3IJCA 4GQ2P 1XIPA 4GZ8A 3EMHA 4J77A 2QXVA 2J56H 3PVWB 4E54A 2H6NA 4PBZA 4JSPC 4PXWA 5IGOA 2H3XA 4L3HD 3UVLA 3IJ1A 3UVMA 4IMMA 5GSAA 4CI3A 2I3TA 4PC0A 4JSNC 2G9AA 4GGDA 3J81g 5EMJB 5HE2B 4CC9A 5TF2A 3PE7A 2B5LA 3AL8A 3NVXA 2PM6B 3EWEA 4R7AB 3BWSA 5TEFA 4PBYA 5THAA 4FA4D 4FA9D 5IT9g 2BBKH 5IGQA 4O1QD 5H14A 2B5NA 2XU7A 3E0CA 1MDAH 3PXTD 2IUVA 5EM2A 4O45A 3MXXA 4U7AA 1U4CA 4XYIA 4BL0A 4CZYA 1YFQA 4J81A 5KDOB 4J73A 4YVDA 4CY2A 4A2LA 2HJBA 1N6FA 2IURA 3DSMA 4GM8A 1GP2B 4L1QD 3UVOA 4ES0A 2OK4A 3C75H 2Z2OA 5AFU3 4J8BA 3L4MD 3B7FA 2XL2A 2HJ4A 1XHMA 1SHYB 4K3JB 5EMLB 3PXWD 3U4YA 5IJ8E 4H5IA 3F3GA 4TZ4A 4A11B 1A0RB 4JSVC 4PSXB 3J80g 3AFCA 4GGAA 2CN3A 2OVQB 5K1CC 2PM9B 5HE1B 4NSXA 5I5JA 3DXKC 3SN6B 3RFGA 3EI3B 5FQDA 2P9NC 4IA9A 3KRXB 2HKRA 5H1MA 2CNXA 4CI1A 5EMMB 3OKYB 3ODTA 2CO0C 2AGWA 4PSWB 1OLZA 4X3EA 2GC4A 2YNOA 4Z8LA 5GXHA 3F3FA 2AGYA 1SQ9A 2OIZA 3VA6A 2P9SC 2G99A 5HYNB 5CXBB 4J84A 3JZGA 3K27A 5HE3B 3AH8B 5CXCB 4QRJA 1OMWB 5H17A 2AGXA 3I7KA 4A09A 1K8KC 1N6DA 3I7PA 1S4UX 5HE0B 2GNQA 3IJ0A 3SWSD 1K32A 4CY3A 4O9DA 4A2MA 5FLXg 1GXRA 1JOFA 3CFVA 2AQ5A 4O3TB 5EAMA 3EI4B 4GM9A 4A09B 3JZNA 5CYKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HKM A;  4FA5 D;  4J82 A;  2IUP A;  2P9U C;  4A0B A;  1NEX B;  2CO0 A;  4FHL A;  4GQB B;  1JMX B;  3SJL D;  3EI2 B;  3SBR A;  4KFM B;  1PEV A;  3I7H A;  3DM0 A;  1NR0 A;  3RFH A;  4FAN D;  4CI2 A;  4JD2 C;  4ZOY A;  2IUQ A;  2H47 A;  3SXT D;  4CY5 A;  1JMZ B;  2IAA A;  4CI8 A;  2H9L A;  4ERY A;  3W15 A;  3RLM D;  3SCY A;  1B9Y A;  5AJA A;  2P9L C;  2HXC A;  2H14 A;  2Z2P A;  3PXS D;  4A08 B;  1Q47 A;  1XKS A;  3C9C A;  3EI2 A;  3OL2 A;  4GQ1 A;  4FB1 D;  4N14 A;  5C9Z B;  2H13 A;  4A0B B;  4A7J A;  5EMK B;  4ERZ A;  2H68 A;  4J8G A;  3EI1 B;  4J78 A;  2IWK A;  3L4O D;  4O3U B;  4E5Z A;  4JT5 C;  4A0A B;  2Q7Q A;  3EI1 A;  2HYE A;  1ERJ A;  1FWX A;  3EG6 A;  4JXM A;  4Y5R D;  5FKT A;  2W18 A;  3DXM C;  4A08 A;  4I79 A;  3JPX A;  3F3P A;  3RN0 D;  2OK6 A;  4JT6 C;  2EBS A;  2Z2N A;  3HFQ A;  2CN2 A;  4J87 A;  2OVP B;  3EI4 A;  4ESG A;  2QC5 A;  4J86 A;  4Y7R A;  3N0D A;  1L0Q A;  5GXI A;  2YMU A;  3AL9 A;  3I7L A;  5TEE A;  4D6V A;  3UKR C;  4X61 B;  2MTA H;  3OKY A;  4ERQ A;  4AEZ A;  4AOW A;  1PI6 A;  2H6K A;  4E54 B;  2I0S A;  3NVQ A;  3I7N A;  4J0W A;  2UZY B;  3SFZ A;  2YNP A;  5B4W A;  4J0X A;  1SQJ A;  4ZN4 A;  4MK0 B;  2XL3 A;  4XEI C;  2P9P C;  3BG0 A;  5EAR A;  1B9X A;  2I3S A;  5AMS A;  3V7D B;  3VGZ A;  3SHF A;  4BH6 A;  3SLE D;  2OVR B;  3UKU C;  3FRX A;  3RMZ D;  3ZWL B;  5C2V B;  3OL2 B;  5HQG A;  4LGN A;  4CZV A;  3JB9 L;  4QL1 A;  4GMB A;  1PBY B;  2H6Q A;  5K19 A;  5EAL A;  1VYH C;  3OW8 A;  5FKQ A;  3UR4 A;  3IIY A;  5CXB A;  2PM7 B;  4L3G D;  5FKS A;  5GMK n;  4FAV D;  3CIK B;  4A0A A;  1TBG A;  2AGZ A;  1MG2 A;  3P4F A;  3JZH A;  4E5Z B;  2I0T A;  3MKQ A;  4CZX A;  2P9K C;  3GFC A;  3V5W B;  4HDJ A;  3OKT A;  2O9K A;  3KRW B;  3V9F A;  1R5M A;  2H9M A;  5IJ7 E;  2H9N A;  2H9P A;  5EAP A;  3RRM C;  5CXC A;  3K26 A;  3IKO A;  3EI3 A;  2CE8 A;  2BCJ B;  4ZOZ A;  3JRO A;  2IWF A;  5EM2 B;  4PNK B;  3DWL C;  2XYI A;  2I0R A;  1P22 A;  5IC7 A;  2AH1 A;  4A11 A;  4JSX C;  3AL8 B;  4G56 B;  5I5I A;  4XYH A;  5FKR A;  4FA1 D;  4EWR A;  3C99 A;  3MZK A;  4FWW A;  4X60 B;  4UI9 R;  4X63 B;  1MG3 A;  3FGB A;  5TDH B;  3RN1 D;  3SVW D;  3OKW A;  1RI6 A;  4CY1 A;  3MMY A;  3MKS B;  4QT8 A;  1PGU A;  3I8E A;  5JWZ A;  3ORV D;  4OWR A;  4BUJ C;  3ULE C;  4K3I D;  5CYK B;  2B5M A;  2J55 H;  3PSC B;  2YB8 B;  1JJU B;  3I8C A;  4U1E I;  3A0F A;  2HES X;  2PBI B;  3NVN A;  3BG1 A;  4H5J A;  5SXM A;  2YBA A;  4GM3 A;  2P9I C;  3I89 A;  4GGC A;  3MZL A;  5A2Q g;  3FM0 A;  1GG2 B;  3GRE A;  4D0K A;  1QNI A;  1TYQ C;  2UZX B;  3IIW A;  4OZU A;  2PM9 A;  5I5M A;  3PVU B;  2GC7 A;  3C5M A;  4ZOV A;  4J79 A;  2J57 G;  2TRC B;  3PSL A;  1GOT B;  4L9O A;  3SMR A;  2YNN A;  3SBP A;  2OJY A;  3JAM g;  3UVN A;  4QQE A;  3EU7 A;  3OTT A;  2B4E A;  3RSE C;  4ZOX A;  5FA5 B;  3I7O A;  3SBQ A;  1U2V C;  1N6E A;  3N0E A;  3VH0 A;  2AH0 A;  4LG8 A;  2AGL A;  3CFS B;  3I2N A;  2CE9 A;  3JRP A;  4LG9 A;  5FXY A;  5C2W B;  3UVK A;  3IJC A;  4GQ2 P;  1XIP A;  4GZ8 A;  3EMH A;  4J77 A;  2QXV A;  2J56 H;  3PVW B;  4E54 A;  2H6N A;  4PBZ A;  4JSP C;  4PXW A;  5IGO A;  2H3X A;  4L3H D;  3UVL A;  3IJ1 A;  3UVM A;  4IMM A;  5GSA A;  4CI3 A;  2I3T A;  4PC0 A;  4JSN C;  2G9A A;  4GGD A;  3J81 g;  5EMJ B;  5HE2 B;  4CC9 A;  5TF2 A;  3PE7 A;  2B5L A;  3AL8 A;  3NVX A;  2PM6 B;  3EWE A;  4R7A B;  3BWS A;  5TEF A;  4PBY A;  5THA A;  4FA4 D;  4FA9 D;  5IT9 g;  2BBK H;  5IGQ A;  4O1Q D;  5H14 A;  2B5N A;  2XU7 A;  3E0C A;  1MDA H;  3PXT D;  2IUV A;  5EM2 A;  4O45 A;  3MXX A;  4U7A A;  1U4C A;  4XYI A;  4BL0 A;  4CZY A;  1YFQ A;  4J81 A;  5KDO B;  4J73 A;  4YVD A;  4CY2 A;  4A2L A;  2HJB A;  1N6F A;  2IUR A;  3DSM A;  4GM8 A;  1GP2 B;  4L1Q D;  3UVO A;  4ES0 A;  2OK4 A;  3C75 H;  2Z2O A;  5AFU 3;  4J8B A;  3L4M D;  3B7F A;  2XL2 A;  2HJ4 A;  1XHM A;  1SHY B;  4K3J B;  5EML B;  3PXW D;  3U4Y A;  5IJ8 E;  4H5I A;  3F3G A;  4TZ4 A;  4A11 B;  1A0R B;  4JSV C;  4PSX B;  3J80 g;  3AFC A;  4GGA A;  2CN3 A;  2OVQ B;  5K1C C;  2PM9 B;  5HE1 B;  4NSX A;  5I5J A;  3DXK C;  3SN6 B;  3RFG A;  3EI3 B;  5FQD A;  2P9N C;  4IA9 A;  3KRX B;  2HKR A;  5H1M A;  2CNX A;  4CI1 A;  5EMM B;  3OKY B;  3ODT A;  2CO0 C;  2AGW A;  4PSW B;  1OLZ A;  4X3E A;  2GC4 A;  2YNO A;  4Z8L A;  5GXH A;  3F3F A;  2AGY A;  1SQ9 A;  2OIZ A;  3VA6 A;  2P9S C;  2G99 A;  5HYN B;  5CXB B;  4J84 A;  3JZG A;  3K27 A;  5HE3 B;  3AH8 B;  5CXC B;  4QRJ A;  1OMW B;  5H17 A;  2AGX A;  3I7K A;  4A09 A;  1K8K C;  1N6D A;  3I7P A;  1S4U X;  5HE0 B;  2GNQ A;  3IJ0 A;  3SWS D;  1K32 A;  4CY3 A;  4O9D A;  4A2M A;  5FLX g;  1GXR A;  1JOF A;  3CFV A;  2AQ5 A;  4O3T B;  5EAM A;  3EI4 B;  4GM9 A;  4A09 B;  3JZN A;  5CYK A; 
#chains in the Genus database with same CATH topology
 2HKM A;  4FA5 D;  4J82 A;  2IUP A;  5M5V A;  2P9U C;  4QAM A;  4A0B A;  1NEX B;  2CO0 A;  4FHL A;  4GQB B;  1JMX B;  3ZE2 A;  1UOQ A;  3SJL D;  3EI2 B;  3SBR A;  4KFM B;  1UOO A;  1M1X A;  1PEV A;  3I7H A;  5C86 A;  3DM0 A;  5E6S A;  1NR0 A;  3RFH A;  4FAN D;  4CI2 A;  4JD2 C;  4ZOY A;  2IUQ A;  5M5R A;  2H47 A;  3SXT D;  4CY5 A;  4DNV A;  3MVD K;  3EQ8 A;  1JMZ B;  2IAA A;  4CI8 A;  2H9L A;  4ERY A;  3W15 A;  3RLM D;  2VDL A;  4AMZ A;  3SCY A;  1B9Y A;  5AJA A;  2P9L C;  4O2W A;  2HXC A;  3NID A;  2H14 A;  2Z2P A;  3PXS D;  4A08 B;  1Q47 A;  1XKS A;  3ZDZ A;  2HU7 A;  3C9C A;  3EI2 A;  3OL2 A;  4GQ1 A;  4G1M A;  2EIB A;  4FB1 D;  1T2X A;  4N14 A;  5C9Z B;  2H13 A;  4A0B B;  4A7J A;  4D9S A;  3MUO A;  1A12 A;  5EMK B;  3O4I A;  4WK4 A;  4AN0 A;  3ZE1 A;  4ERZ A;  2H68 A;  4J8G A;  3EI1 B;  3NIG A;  1E8M A;  4J78 A;  2IWK A;  3L4O D;  4O3U B;  4E5Z A;  4JT5 C;  5E6R A;  4A0A B;  2Q7Q A;  3O4J A;  5E6U A;  3EI1 A;  2HYE A;  1ERJ A;  1FWX A;  3EG6 A;  4JXM A;  4Y5R D;  5FKT A;  2W18 A;  3DDU A;  3DXM C;  4A08 A;  4I79 A;  3JPX A;  3F3P A;  3RN0 D;  2OK6 A;  4JT6 C;  2EBS A;  2Z2N A;  3HFQ A;  2CN2 A;  4NEN A;  4J87 A;  2OVP B;  4RE5 A;  3EI4 A;  2XE4 A;  4ESG A;  2QC5 A;  4JHP C;  4J86 A;  4Y7R A;  3ZDY A;  3IUR A;  3N0D A;  1QFM A;  4AN1 A;  4JHN A;  2QZP A;  1L0Q A;  5GXI A;  3IJE A;  2YMU A;  3AL9 A;  3I7L A;  4AMY A;  5TEE A;  4D6V A;  5M5U A;  3UKR C;  4X61 B;  2EIE A;  4MMX A;  2MTA H;  3OKY A;  4ERQ A;  4AEZ A;  4AOW A;  3FCS A;  2XZG A;  1PI6 A;  2H6K A;  3QHY B;  4E54 B;  3T3M A;  1GOG A;  2I0S A;  3I7N A;  3NVQ A;  4J0W A;  2UZY B;  3IUQ A;  3SFZ A;  2YNP A;  5B4W A;  4J0X A;  5FFO A;  1SQJ A;  4ZN4 A;  4MK0 B;  4RE6 A;  2XL3 A;  3ZE0 A;  4XEI C;  3NIF A;  2P9P C;  3BG0 A;  5EAR A;  1B9X A;  4G1E A;  2I3S A;  5AMS A;  3V7D B;  1L5G A;  3VGZ A;  3SHF A;  2WQ8 A;  4BH6 A;  3SLE D;  2OVR B;  2HU5 A;  1H2Y A;  3UKU C;  3FRX A;  3RMZ D;  3ZWL B;  3VI3 A;  5C2V B;  1VE6 A;  4BP9 A;  3OF7 A;  3OL2 B;  4LGN A;  5HQG A;  4CZV A;  4QL1 A;  3QI0 A;  1PBY B;  2H6Q A;  4GMB A;  5K19 A;  2VC2 A;  5EAL A;  1VYH C;  3OW8 A;  5FKQ A;  3UR4 A;  3IIY A;  2JKX A;  1JV2 A;  5CXB A;  2PM7 B;  4L3G D;  5FKS A;  2VDM A;  3IUN A;  4BCB A;  4FAV D;  5GMK n;  5HDB A;  3CIK B;  4Z7N A;  4A0A A;  1TBG A;  2AGZ A;  1MG2 A;  3P4F A;  3JZH A;  4E5Z B;  2I0T A;  3MKQ A;  4CZX A;  2P9K C;  3GFC A;  3V5W B;  4HDJ A;  2VDO A;  3OKT A;  2O9K A;  1O6G A;  3KRW B;  3V9F A;  1R5M A;  2H9M A;  1TYE A;  5IJ7 E;  2H9N A;  2H9P A;  5EAP A;  3RRM C;  5CXC A;  3K26 A;  2VDP A;  2VZ1 A;  3IKO A;  2VDR A;  3EI3 A;  2CE8 A;  2BCJ B;  4ZOZ A;  3JRO A;  2IWF A;  5EM2 B;  4PNK B;  3DWL C;  2XYI A;  2I0R A;  4MMZ A;  1C9L A;  1P22 A;  4BP8 A;  5IC7 A;  2AH1 A;  4A11 A;  4JSX C;  3AL8 B;  4G56 B;  5I5I A;  1H2Z A;  3O4H A;  4XYH A;  5FKR A;  4FA1 D;  4EWR A;  3C99 A;  3MZK A;  4FWW A;  4X60 B;  4UI9 R;  4X63 B;  1MG3 A;  3FGB A;  1GOH A;  5TDH B;  3RN1 D;  3SVW D;  3OKW A;  4MMY A;  3IVM A;  1RI6 A;  4CY1 A;  3MMY A;  3MKS B;  4QT8 A;  1PGU A;  3I8E A;  5JWZ A;  5M61 A;  3KCI A;  3GC3 B;  3ORV D;  4OWR A;  4BUJ C;  3ULE C;  4K3I D;  5CYK B;  2B5M A;  2J55 H;  3PSC B;  2YB8 B;  1JJU B;  3I8C A;  4U1E I;  3A0F A;  5M5S A;  2HES X;  3ZDX A;  2PBI B;  3NVN A;  3BG1 A;  4H5J A;  5SXM A;  2YBA A;  1U8C A;  4GM3 A;  3K71 A;  2P9I C;  3I89 A;  4GGC A;  4DNW A;  3MZL A;  4BCD A;  5A2Q g;  3FM0 A;  1GG2 B;  3VI4 A;  3GRE A;  4D0K A;  1QNI A;  1TYQ C;  2UZX B;  3IIW A;  4OZU A;  2PM9 A;  5I5M A;  3PVU B;  4BCC A;  2GC7 A;  3C5M A;  1VZ2 A;  4ZOV A;  4J79 A;  1H2W A;  2J57 G;  2TRC B;  3PSL A;  1GOT B;  4L9O A;  3SMR A;  2YNN A;  3SBP A;  2OJY A;  3V4V A;  3K6S A;  3JAM g;  4G55 A;  4AX4 A;  3UVN A;  4QQE A;  3EU7 A;  3OTT A;  2B4E A;  3RSE C;  4ZOX A;  1H2X A;  5FA5 B;  3I7O A;  3V4P A;  3SBQ A;  1U2V C;  1N6E A;  3N0E A;  3VH0 A;  2AH0 A;  1UTC A;  2XDW A;  2AGL A;  3CFS B;  3I2N A;  3JRP A;  2CE9 A;  4LG8 A;  4LG9 A;  5FXY A;  1YR2 A;  5C2W B;  3UVK A;  3IJC A;  4GQ2 P;  1XIP A;  4Z7O A;  4GZ8 A;  3EMH A;  4J77 A;  2QXV A;  2J56 H;  3PVW B;  1VE7 A;  3EQ9 A;  4E54 A;  1C9I A;  2H6N A;  4PBZ A;  4JSP C;  4PXW A;  5IGO A;  2H3X A;  3IUM A;  4L3H D;  3UVL A;  3IJ1 A;  1JTD B;  3UVM A;  4IMM A;  5GSA A;  4CI3 A;  2I3T A;  4NAA A;  4PC0 A;  4JSN C;  3IUL A;  2G9A A;  4GGD A;  4DNU A;  3J81 g;  5EMJ B;  5HE2 B;  4CC9 A;  5TF2 A;  3PE7 A;  4Z7Q A;  2B5L A;  3AL8 A;  3NVX A;  2PM6 B;  3EWE A;  4R7A B;  3BWS A;  5TEF A;  1I2M B;  4PBY A;  5THA A;  4FA4 D;  4FA9 D;  2BBK H;  5IT9 g;  2VDK A;  5IGQ A;  3IUJ A;  3MUN A;  4O1Q D;  5H14 A;  2HU8 A;  2B5N A;  2XU7 A;  3E0C A;  4WK2 A;  1MDA H;  3PXT D;  2IUV A;  5EM2 A;  4IRZ A;  4O45 A;  5C92 A;  3MXX A;  4U7A A;  1U4C A;  4XYI A;  4BL0 A;  3K72 A;  1E5T A;  4CZY A;  1GOF A;  1YFQ A;  4J81 A;  3T3P A;  5KDO B;  4J73 A;  4YVD A;  4CY2 A;  2VZ3 A;  4A2L A;  2HJB A;  4NBM A;  1N6F A;  2IUR A;  3DSM A;  4GM8 A;  1GP2 B;  4L1Q D;  3UVO A;  4ES0 A;  2OK4 A;  3C75 H;  2Z2O A;  1E8N A;  3O4G A;  3EQ7 A;  5AFU 3;  2EID A;  4J8B A;  3L4M D;  3B7F A;  2XL2 A;  2HJ4 A;  1XHM A;  1SHY B;  4K3J B;  5EML B;  2QR5 A;  3PXW D;  3U4Y A;  5IJ8 E;  4H5I A;  3F3G A;  4TZ4 A;  4A11 B;  1A0R B;  4JSV C;  1BPO A;  4O02 A;  4PSX B;  1O6F A;  3J80 g;  3AFC A;  4GGA A;  3GD1 I;  2CN3 A;  4L1M A;  2OVQ B;  5K1C C;  1VZ3 A;  2PM9 B;  5HE1 B;  4NSX A;  5I5J A;  5M5T A;  3DXK C;  3SN6 B;  3RFG A;  3EI3 B;  5FQD A;  2P9N C;  4IA9 A;  1QFS A;  3KRX B;  2HKR A;  5H1M A;  2CNX A;  4CI1 A;  5EMM B;  3OKY B;  3ODT A;  2CO0 C;  2AGW A;  4PSW B;  1OLZ A;  3FCU A;  4X3E A;  2BKL A;  2GC4 A;  2YNO A;  4Z8L A;  5GXH A;  4NC4 A;  3F3F A;  2AGY A;  1SQ9 A;  2OIZ A;  4WK0 A;  3VA6 A;  2P9S C;  2G99 A;  5HYN B;  5CXB B;  4J84 A;  3JZG A;  1UOP A;  3K27 A;  5HE3 B;  3AH8 B;  5CXC B;  1K3I A;  4QRJ A;  1OMW B;  2VDN A;  4WJK A;  2AGX A;  5H17 A;  3I7K A;  4A09 A;  1K8K C;  4UM9 A;  2VDQ A;  1N6D A;  3I7P A;  1S4U X;  5HE0 B;  2GNQ A;  3IJ0 A;  3SWS D;  1K32 A;  4CY3 A;  4O9D A;  4A2M A;  5FLX g;  2EIC A;  1GXR A;  1JOF A;  3CFV A;  2AQ5 A;  4O3T B;  5EAM A;  3EI4 B;  5FFG A;  4GM9 A;  4A09 B;  3JZN A;  5CYK A;  4UM8 A;  3JB9 L; 
#chains in the Genus database with same CATH homology
 2HKM A;  4FA5 D;  4J82 A;  2IUP A;  2P9U C;  4A0B A;  1NEX B;  2CO0 A;  4FHL A;  4GQB B;  1JMX B;  3SJL D;  3EI2 B;  3SBR A;  4KFM B;  1PEV A;  3I7H A;  3DM0 A;  1NR0 A;  3RFH A;  4FAN D;  4CI2 A;  4JD2 C;  4ZOY A;  2IUQ A;  2H47 A;  3SXT D;  4CY5 A;  1JMZ B;  2IAA A;  4CI8 A;  2H9L A;  4ERY A;  3W15 A;  3RLM D;  3SCY A;  1B9Y A;  5AJA A;  2P9L C;  2HXC A;  2H14 A;  2Z2P A;  3PXS D;  4A08 B;  1Q47 A;  1XKS A;  3C9C A;  3EI2 A;  3OL2 A;  4GQ1 A;  4FB1 D;  4N14 A;  5C9Z B;  2H13 A;  4A0B B;  4A7J A;  5EMK B;  4ERZ A;  2H68 A;  4J8G A;  3EI1 B;  4J78 A;  2IWK A;  3L4O D;  4O3U B;  4E5Z A;  4JT5 C;  4A0A B;  2Q7Q A;  3EI1 A;  2HYE A;  1ERJ A;  1FWX A;  3EG6 A;  4JXM A;  4Y5R D;  5FKT A;  2W18 A;  3DXM C;  4A08 A;  4I79 A;  3JPX A;  3F3P A;  3RN0 D;  2OK6 A;  4JT6 C;  2EBS A;  2Z2N A;  3HFQ A;  2CN2 A;  4J87 A;  2OVP B;  3EI4 A;  4ESG A;  2QC5 A;  4J86 A;  4Y7R A;  3N0D A;  1L0Q A;  5GXI A;  2YMU A;  3AL9 A;  3I7L A;  5TEE A;  4D6V A;  3UKR C;  4X61 B;  2MTA H;  3OKY A;  4ERQ A;  4AEZ A;  4AOW A;  1PI6 A;  2H6K A;  4E54 B;  2I0S A;  3NVQ A;  3I7N A;  4J0W A;  2UZY B;  3SFZ A;  2YNP A;  5B4W A;  4J0X A;  1SQJ A;  4ZN4 A;  4MK0 B;  2XL3 A;  4XEI C;  2P9P C;  3BG0 A;  5EAR A;  1B9X A;  2I3S A;  5AMS A;  3V7D B;  3VGZ A;  3SHF A;  4BH6 A;  3SLE D;  2OVR B;  3UKU C;  3FRX A;  3RMZ D;  3ZWL B;  5C2V B;  3OL2 B;  5HQG A;  4LGN A;  4CZV A;  3JB9 L;  4QL1 A;  4GMB A;  1PBY B;  2H6Q A;  5K19 A;  5EAL A;  1VYH C;  3OW8 A;  5FKQ A;  3UR4 A;  3IIY A;  5CXB A;  2PM7 B;  4L3G D;  5FKS A;  5GMK n;  4FAV D;  3CIK B;  4A0A A;  1TBG A;  2AGZ A;  1MG2 A;  3P4F A;  3JZH A;  4E5Z B;  2I0T A;  3MKQ A;  4CZX A;  2P9K C;  3GFC A;  3V5W B;  4HDJ A;  3OKT A;  2O9K A;  3KRW B;  3V9F A;  1R5M A;  2H9M A;  5IJ7 E;  2H9N A;  2H9P A;  5EAP A;  3RRM C;  5CXC A;  3K26 A;  3IKO A;  3EI3 A;  2CE8 A;  2BCJ B;  4ZOZ A;  3JRO A;  2IWF A;  5EM2 B;  4PNK B;  3DWL C;  2XYI A;  2I0R A;  1P22 A;  5IC7 A;  2AH1 A;  4A11 A;  4JSX C;  3AL8 B;  4G56 B;  5I5I A;  4XYH A;  5FKR A;  4FA1 D;  4EWR A;  3C99 A;  3MZK A;  4FWW A;  4X60 B;  4UI9 R;  4X63 B;  1MG3 A;  3FGB A;  5TDH B;  3RN1 D;  3SVW D;  3OKW A;  1RI6 A;  4CY1 A;  3MMY A;  3MKS B;  4QT8 A;  1PGU A;  3I8E A;  5JWZ A;  3ORV D;  4OWR A;  4BUJ C;  3ULE C;  4K3I D;  5CYK B;  2B5M A;  2J55 H;  3PSC B;  2YB8 B;  1JJU B;  3I8C A;  4U1E I;  3A0F A;  2HES X;  2PBI B;  3NVN A;  3BG1 A;  4H5J A;  5SXM A;  2YBA A;  4GM3 A;  2P9I C;  3I89 A;  4GGC A;  3MZL A;  5A2Q g;  3FM0 A;  1GG2 B;  3GRE A;  4D0K A;  1QNI A;  1TYQ C;  2UZX B;  3IIW A;  4OZU A;  2PM9 A;  5I5M A;  3PVU B;  2GC7 A;  3C5M A;  4ZOV A;  4J79 A;  2J57 G;  2TRC B;  3PSL A;  1GOT B;  4L9O A;  3SMR A;  2YNN A;  3SBP A;  2OJY A;  3JAM g;  3UVN A;  4QQE A;  3EU7 A;  3OTT A;  2B4E A;  3RSE C;  4ZOX A;  5FA5 B;  3I7O A;  3SBQ A;  1U2V C;  1N6E A;  3N0E A;  3VH0 A;  2AH0 A;  4LG8 A;  2AGL A;  3CFS B;  3I2N A;  2CE9 A;  3JRP A;  4LG9 A;  5FXY A;  5C2W B;  3UVK A;  3IJC A;  4GQ2 P;  1XIP A;  4GZ8 A;  3EMH A;  4J77 A;  2QXV A;  2J56 H;  3PVW B;  4E54 A;  2H6N A;  4PBZ A;  4JSP C;  4PXW A;  5IGO A;  2H3X A;  4L3H D;  3UVL A;  3IJ1 A;  3UVM A;  4IMM A;  5GSA A;  4CI3 A;  2I3T A;  4PC0 A;  4JSN C;  2G9A A;  4GGD A;  3J81 g;  5EMJ B;  5HE2 B;  4CC9 A;  5TF2 A;  3PE7 A;  2B5L A;  3AL8 A;  3NVX A;  2PM6 B;  3EWE A;  4R7A B;  3BWS A;  5TEF A;  4PBY A;  5THA A;  4FA4 D;  4FA9 D;  5IT9 g;  2BBK H;  5IGQ A;  4O1Q D;  5H14 A;  2B5N A;  2XU7 A;  3E0C A;  1MDA H;  3PXT D;  2IUV A;  5EM2 A;  4O45 A;  3MXX A;  4U7A A;  1U4C A;  4XYI A;  4BL0 A;  4CZY A;  1YFQ A;  4J81 A;  5KDO B;  4J73 A;  4YVD A;  4CY2 A;  4A2L A;  2HJB A;  1N6F A;  2IUR A;  3DSM A;  4GM8 A;  1GP2 B;  4L1Q D;  3UVO A;  4ES0 A;  2OK4 A;  3C75 H;  2Z2O A;  5AFU 3;  4J8B A;  3L4M D;  3B7F A;  2XL2 A;  2HJ4 A;  1XHM A;  1SHY B;  4K3J B;  5EML B;  3PXW D;  3U4Y A;  5IJ8 E;  4H5I A;  3F3G A;  4TZ4 A;  4A11 B;  1A0R B;  4JSV C;  4PSX B;  3J80 g;  3AFC A;  4GGA A;  2CN3 A;  2OVQ B;  5K1C C;  2PM9 B;  5HE1 B;  4NSX A;  5I5J A;  3DXK C;  3SN6 B;  3RFG A;  3EI3 B;  5FQD A;  2P9N C;  4IA9 A;  3KRX B;  2HKR A;  5H1M A;  2CNX A;  4CI1 A;  5EMM B;  3OKY B;  3ODT A;  2CO0 C;  2AGW A;  4PSW B;  1OLZ A;  4X3E A;  2GC4 A;  2YNO A;  4Z8L A;  5GXH A;  3F3F A;  2AGY A;  1SQ9 A;  2OIZ A;  3VA6 A;  2P9S C;  2G99 A;  5HYN B;  5CXB B;  4J84 A;  3JZG A;  3K27 A;  5HE3 B;  3AH8 B;  5CXC B;  4QRJ A;  1OMW B;  5H17 A;  2AGX A;  3I7K A;  4A09 A;  1K8K C;  1N6D A;  3I7P A;  1S4U X;  5HE0 B;  2GNQ A;  3IJ0 A;  3SWS D;  1K32 A;  4CY3 A;  4O9D A;  4A2M A;  5FLX g;  1GXR A;  1JOF A;  3CFV A;  2AQ5 A;  4O3T B;  5EAM A;  3EI4 B;  4GM9 A;  4A09 B;  3JZN A;  5CYK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...