1C9LA

Peptide-in-groove interactions link target proteins to the b-propeller of clathrin
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
357
structure length
357
Chain Sequence
b'QILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CLATHRIN
publication title Peptide-in-groove interactions link target proteins to the beta-propeller of clathrin.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis/exocytosis
total genus 78
structure length 357
sequence length 357
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01394 Clathrin_propel Clathrin propeller repeat
A PF09268 Clathrin-link Clathrin, heavy-chain linker
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.110 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Clathrin heavy-chain terminal domain 1c9lA00
5M5VA 1C9IA 5M5SA 3GC3B 5M61A 5M5RA 1UTCA 5M5UA 1C9LA 5M5TA 2XZGA 3GD1I 4G55A 1BPOA
chains in the Genus database with same CATH superfamily
3SN6B 4J77A 2I3SA 4X3EA 3RN1D 2VDKA 3IJEA 2IWKA 3SCYA 4ESGA 2AH0A 4PSWB 3NVQA 4KFMB 3EI2B 3IIWA 2UZXB 2H6KA 3J80g 4G56B 1K8KC 4CY5A 3MZLA 1A0RB 3EI2A 1OMWB 5FKTA 4CC9A 3GREA 2IUQA 2HYEA 2IUPA 3IUQA 2GC7A 2TRCB 5M5RA 2XE4A 2VDRA 4FAND 1H2XA 4CY1A 1XKSA 4CZXA 4FA4D 2J55H 5IGOA 4JT5C 1JV2A 4JD2C 2XYIA 3E0CA 5K1CC 3SXTD 3B7FA 3FRXA 3EQ9A 4GGAA 4J79A 1UOQA 3AH8B 1YFQA 1M1XA 4QRJA 5C9ZB 2PM9B 3IJ0A 2PM7B 2CN2A 2YBAA 4X63B 5I5MA 4E54A 3N0DA 2Q7QA 2VDQA 1C9IA 4QAMA 2PM9A 1GXRA 2IAAA 4MK0B 3RRMC 4J86A 2EICA 3PVUB 2HKRA 3ZE2A 3IUNA 2H3XA 2EIBA 4GQ1A 4MMZA 2YMUA 1U4CA 2Z2PA 2Z2OA 4NSXA 5EM2B 4O2WA 3UKRC 5HQGA 2GC4A 4L3HD 1GG2B 4JSVC 4FA1D 5HE1B 4O9DA 4FB1D 4CZVA 3K27A 5CXBB 4AX4A 3ZE0A 4XEIC 3I7KA 4U7AA 4J81A 1JOFA 2H68A 4BP9A 4BCCA 5THAA 2MTAH 1A12A 2J57G 3I7HA 3C99A 3SBRA 1OLZA 5E6UA 5IJ8E 2H9MA 2VDMA 2HJ4A 4XYIA 4ERQA 4CI8A 3K26A 5E6RA 4AN0A 2OIZA 4O3TB 5I5IA 3MVDK 4G1EA 5M5VA 3EI1B 5C92A 1E8NA 5HE3B 4A0BB 3FCUA 3SFZA 3JAMg 3IKOA 5EAPA 5AJAA 5IJ7E 2HXCA 4A0BA 1N6EA 5EMLB 5M5SA 3UVMA 4A2MA 3NIFA 3IULA 2XZGA 4GGCA 5IGQA 3DDUA 3VI4A 4BUJC 4BL0A 2BCJB 3RLMD 3JROA 4JSPC 2OK6A 4RE6A 4D9SA 4AMYA 3I89A 2AGYA 4J8GA 5TF2A 5C86A 4A08A 4X61B 5H17A 4PBZA 1L5GA 4A2LA 3VA6A 3DXMC 3DM0A 4E5ZB 4ZOXA 2HU8A 2IUVA 3CIKB 5HE0B 4AN1A 4WJKA 4BH6A 4ZOYA 3QHYB 4E5ZA 4JT6C 2HESX 2HJBA 4GQ2P 3V4VA 3T3PA 3CFSB 5CYKB 4JXMA 4U1EI 1NR0A 4ZOVA 5CYKA 2AGXA 1GOFA 3K71A 3HFQA 4CI3A 5FXYA 3L4OD 3EI3B 1VZ2A 1N6FA 4G1MA 5IT9g 2CNXA 4GM3A 2VZ1A 4FA9D 2G9AA 4A7JA 4A09B 3MUOA 3IURA 2OJYA 2EIDA 3IUJA 4A09A 3FCSA 5GXIA 1XHMA 1SQ9A 2XL3A 3SWSD 1O6GA 4N14A 3ZWLB 4K3JB 2P9UC 3BG0A 2YNOA 3JB9L 3MZKA 4J8BA 3N0EA 5CXCB 3PXSD 5FKQA 2QR5A 3OL2B 3MMYA 3IIYA 2AGWA 4I79A 4ZN4A 5CXCA 3OL2A 3PXWD 1VE7A 3UKUC 2VZ3A 4HDJA 3L4MD 2I0TA 4WK2A 3OTTA 4EWRA 1L0QA 2VDLA 3JRPA 3V9FA 1JJUB 3CFVA 4OZUA 4J84A 1NEXB 3QI0A 2WQ8A 3NVXA 3OKTA 3RN0D 1YR2A 3IJ1A 4FAVD 4OWRA 5GMKn 4O45A 3SVWD 1R5MA 2YB8B 1O6FA 4PBYA 4TZ4A 4D0KA 2HKMA 4J73A 1H2ZA 3FM0A 5EM2A 3IUMA 3FGBA 3RFGA 1ERJA 3V4PA 4NENA 1TYEA 4A0AB 5HYNB 3ORVD 2P9NC 4GGDA 5IC7A 3SBPA 2H47A 5CXBA 5EMJB 3C75H 4CY3A 4Z8LA 4UM9A 5SXMA 1MG3A 2CE9A 3K6SA 3VI3A 3AL9A 1VZ3A 4Y7RA 5AMSA 1UOPA 5I5JA 4Z7OA 4K3ID 1H2WA 5KDOB 2B5LA 3ODTA 5FKRA 4CI2A 3A0FA 1T2XA 4Z7NA 3UVLA 3EI1A 4AEZA 5GSAA 4LGNA 5TEEA 3EU7A 4BCDA 3EWEA 4DNUA 1VYHC 2HU7A 1H2YA 1QFSA 3GD1I 2BBKH 2JKXA 3O4HA 4BCBA 3GC3B 4X60B 3PE7A 1PI6A 1QFMA 3JZGA 2BKLA 4FWWA 3RSEC 3ZE1A 4GZ8A 2CE8A 2G99A 4WK0A 5FQDA 3JPXA 2VDPA 5M5UA 3OKYB 1K32A 3IJCA 3JZNA 5FFOA 1Q47A 2AH1A 2OVQB 4MMYA 4DNVA 5EALA 4GMBA 1VE6A 3PXTD 4J82A 2H14A 3OW8A 3F3FA 1JMXB 4JHPC 2AGLA 4DNWA 1K3IA 1N6DA 4H5JA 3SBQA 5EMMB 2B5MA 3F3PA 3VGZA 3I2NA 1B9YA 3EI3A 3KCIA 1C9LA 1GOHA 3EG6A 4A11B 2H13A 4GQBB 5FA5B 3PVWB 3NIGA 2OVPB 4QL1A 3RMZD 3I7OA 1E8MA 3MKSB 2XU7A 4RE5A 1QNIA 2W18A 3VH0A 1S4UX 2I0RA 5E6SA 4CZYA 1PEVA 3UVOA 2PBIB 5EAMA 5JWZA 2CO0A 1SHYB 3SJLD 1BPOA 4UM8A 2EBSA 3K72A 4WK4A 3SLED 1B9XA 4CI1A 3ULEC 3V7DB 5C2WB 2J56H 3MUNA 3OKWA 1U2VC 3RFHA 4MMXA 3MKQA 4FHLA 4LG9A 4NBMA 3PSCB 3ZDZA 2IWFA 3UR4A 4GM9A 3OF7A 2I3TA 4AOWA 2Z2NA 3UVNA 4FA5D 4Y5RD 2IURA 3KRWB 1MG2A 3I8CA 3I7NA 3GFCA 1PGUA 1UTCA 3C5MA 2QZPA 2UZYB 4QT8A 2B5NA 2H9LA 4QQEA 3ZDXA 4ERZA 2H9NA 4D6VA 3O4GA 4PNKB 4E54B 3W15A 5H1MA 1GOTB 3P4FA 3EQ8A 2QXVA 1UOOA 4O02A 2P9IC 4ZOZA 4J87A 3I7LA 2B4EA 2YNPA 4O1QD 2VC2A 3ZDYA 5AFU3 5GXHA 1TBGA 3DSMA 5H14A 4A0AA 2H6QA 4J0XA 4NAAA 3EQ7A 3T3MA 1TYQC 2QC5A 5EMKB 4J78A 1MDAH 5FKSA 2XL2A 1JTDB 2HU5A 2OVRB 1U8CA 2PM6B 3DWLC 4Z7QA 2GNQA 2XDWA 5TEFA 4G55A 3EI4B 2H9PA 5HE2B 3I8EA 4R7AB 3J81g 3EI4A 3O4JA 4XYHA 1SQJA 1XIPA 3AFCA 1FWXA 2EIEA 3V5WB 3O4IA 3IVMA 4H5IA 4NC4A 1GOGA 4PSXB 2P9KC 3NVNA 3PSLA 4BP8A 2P9SC 2YNNA 2AGZA 3C9CA 5K19A 4YVDA 5B4WA 5TDHB 4O3UB 3SMRA 4IMMA 4AMZA 4UI9R 2CO0C 1GP2B 1I2MB 1PBYB 2VDNA 3AL8B 3F3GA 3UVKA 2AQ5A 4CY2A 3U4YA 2OK4A 4JHNA 4JSNC 4L1QD 3AL8A 4L3GD 5EARA 3OKYA 3SHFA 4JSXC 3EMHA 5A2Qg 1P22A 2H6NA 5C2VB 4ES0A 1E5TA 3JZHA 2P9LC 4L1MA 2CN3A 4LG8A 4ERYA 5FLXg 4IA9A 4J0WA 4A08B 3DXKC 5M5TA 4PC0A 2P9PC 5FFGA 1JMZB 4PXWA 3BWSA 4GM8A 2VDOA 4L9OA 5HDBA 3KRXB 3NIDA 2O9KA 3MXXA 5M61A 2I0SA 1RI6A 3BG1A 3I7PA 4IRZA 4A11A
chains in the Genus database with same CATH topology
5M5VA 1C9IA 5M5SA 3GC3B 5M61A 5M5RA 1UTCA 5M5UA 1C9LA 5M5TA 2XZGA 3GD1I 4G55A 1BPOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M5V A;  1C9I A;  5M5S A;  3GC3 B;  5M61 A;  5M5R A;  1UTC A;  5M5U A;  1C9L A;  5M5T A;  2XZG A;  3GD1 I;  4G55 A;  1BPO A; 
#chains in the Genus database with same CATH topology
 3SN6 B;  4J77 A;  2I3S A;  4X3E A;  3RN1 D;  2VDK A;  3IJE A;  2IWK A;  3SCY A;  4ESG A;  2AH0 A;  4PSW B;  3NVQ A;  4KFM B;  3EI2 B;  3IIW A;  2UZX B;  2H6K A;  3J80 g;  4G56 B;  1K8K C;  4CY5 A;  3MZL A;  1A0R B;  3EI2 A;  1OMW B;  5FKT A;  4CC9 A;  3GRE A;  2IUQ A;  2HYE A;  2IUP A;  3IUQ A;  2GC7 A;  2TRC B;  5M5R A;  2XE4 A;  2VDR A;  4FAN D;  1H2X A;  4CY1 A;  1XKS A;  4CZX A;  4FA4 D;  2J55 H;  5IGO A;  4JT5 C;  1JV2 A;  4JD2 C;  2XYI A;  3E0C A;  5K1C C;  3SXT D;  3B7F A;  3FRX A;  3EQ9 A;  4GGA A;  4J79 A;  1UOQ A;  3AH8 B;  1YFQ A;  1M1X A;  4QRJ A;  5C9Z B;  2PM9 B;  3IJ0 A;  2PM7 B;  2CN2 A;  2YBA A;  4X63 B;  5I5M A;  4E54 A;  3N0D A;  2Q7Q A;  2VDQ A;  1C9I A;  4QAM A;  2PM9 A;  1GXR A;  2IAA A;  4MK0 B;  3RRM C;  4J86 A;  2EIC A;  3PVU B;  2HKR A;  3ZE2 A;  3IUN A;  2H3X A;  2EIB A;  4GQ1 A;  4MMZ A;  2YMU A;  1U4C A;  2Z2P A;  2Z2O A;  4NSX A;  5EM2 B;  4O2W A;  3UKR C;  5HQG A;  2GC4 A;  4L3H D;  1GG2 B;  4JSV C;  4FA1 D;  5HE1 B;  4O9D A;  4FB1 D;  4CZV A;  3K27 A;  5CXB B;  4AX4 A;  3ZE0 A;  4XEI C;  3I7K A;  4U7A A;  4J81 A;  1JOF A;  2H68 A;  4BP9 A;  4BCC A;  5THA A;  2MTA H;  1A12 A;  2J57 G;  3I7H A;  3C99 A;  3SBR A;  1OLZ A;  5E6U A;  5IJ8 E;  2H9M A;  2VDM A;  2HJ4 A;  4XYI A;  4ERQ A;  4CI8 A;  3K26 A;  5E6R A;  4AN0 A;  2OIZ A;  4O3T B;  5I5I A;  3MVD K;  4G1E A;  5M5V A;  3EI1 B;  5C92 A;  1E8N A;  5HE3 B;  4A0B B;  3FCU A;  3SFZ A;  3JAM g;  3IKO A;  5EAP A;  5AJA A;  5IJ7 E;  2HXC A;  4A0B A;  1N6E A;  5EML B;  5M5S A;  3UVM A;  4A2M A;  3NIF A;  3IUL A;  2XZG A;  4GGC A;  5IGQ A;  3DDU A;  3VI4 A;  4BUJ C;  4BL0 A;  2BCJ B;  3RLM D;  3JRO A;  4JSP C;  2OK6 A;  4RE6 A;  4D9S A;  4AMY A;  3I89 A;  2AGY A;  4J8G A;  5TF2 A;  5C86 A;  4A08 A;  4X61 B;  5H17 A;  4PBZ A;  1L5G A;  4A2L A;  3VA6 A;  3DXM C;  3DM0 A;  4E5Z B;  4ZOX A;  2HU8 A;  2IUV A;  3CIK B;  5HE0 B;  4AN1 A;  4WJK A;  4BH6 A;  4ZOY A;  3QHY B;  4E5Z A;  4JT6 C;  2HES X;  2HJB A;  4GQ2 P;  3V4V A;  3T3P A;  3CFS B;  5CYK B;  4JXM A;  4U1E I;  1NR0 A;  4ZOV A;  5CYK A;  2AGX A;  1GOF A;  3K71 A;  3HFQ A;  4CI3 A;  5FXY A;  3L4O D;  3EI3 B;  1VZ2 A;  1N6F A;  4G1M A;  5IT9 g;  2CNX A;  4GM3 A;  2VZ1 A;  4FA9 D;  2G9A A;  4A7J A;  4A09 B;  3MUO A;  3IUR A;  2OJY A;  2EID A;  3IUJ A;  4A09 A;  3FCS A;  5GXI A;  1XHM A;  1SQ9 A;  2XL3 A;  3SWS D;  1O6G A;  4N14 A;  3ZWL B;  4K3J B;  2P9U C;  3BG0 A;  2YNO A;  3JB9 L;  3MZK A;  4J8B A;  3N0E A;  5CXC B;  3PXS D;  5FKQ A;  2QR5 A;  3OL2 B;  3MMY A;  3IIY A;  2AGW A;  4I79 A;  4ZN4 A;  5CXC A;  3OL2 A;  3PXW D;  1VE7 A;  3UKU C;  2VZ3 A;  4HDJ A;  3L4M D;  2I0T A;  4WK2 A;  3OTT A;  4EWR A;  1L0Q A;  2VDL A;  3JRP A;  3V9F A;  1JJU B;  3CFV A;  4OZU A;  4J84 A;  1NEX B;  3QI0 A;  2WQ8 A;  3NVX A;  3OKT A;  3RN0 D;  1YR2 A;  3IJ1 A;  4FAV D;  4OWR A;  5GMK n;  4O45 A;  3SVW D;  1R5M A;  2YB8 B;  1O6F A;  4PBY A;  4TZ4 A;  4D0K A;  2HKM A;  4J73 A;  1H2Z A;  3FM0 A;  5EM2 A;  3IUM A;  3FGB A;  3RFG A;  1ERJ A;  3V4P A;  4NEN A;  1TYE A;  4A0A B;  5HYN B;  3ORV D;  2P9N C;  4GGD A;  5IC7 A;  3SBP A;  2H47 A;  5CXB A;  5EMJ B;  3C75 H;  4CY3 A;  4Z8L A;  4UM9 A;  5SXM A;  1MG3 A;  2CE9 A;  3K6S A;  3VI3 A;  3AL9 A;  1VZ3 A;  4Y7R A;  5AMS A;  1UOP A;  5I5J A;  4Z7O A;  4K3I D;  1H2W A;  5KDO B;  2B5L A;  3ODT A;  5FKR A;  4CI2 A;  3A0F A;  1T2X A;  4Z7N A;  3UVL A;  3EI1 A;  4AEZ A;  5GSA A;  4LGN A;  5TEE A;  3EU7 A;  4BCD A;  3EWE A;  4DNU A;  1VYH C;  2HU7 A;  1H2Y A;  1QFS A;  3GD1 I;  2BBK H;  2JKX A;  3O4H A;  4BCB A;  3GC3 B;  4X60 B;  3PE7 A;  1PI6 A;  1QFM A;  3JZG A;  2BKL A;  4FWW A;  3RSE C;  3ZE1 A;  4GZ8 A;  2CE8 A;  2G99 A;  4WK0 A;  5FQD A;  3JPX A;  2VDP A;  5M5U A;  3OKY B;  1K32 A;  3IJC A;  3JZN A;  5FFO A;  1Q47 A;  2AH1 A;  2OVQ B;  4MMY A;  4DNV A;  5EAL A;  4GMB A;  1VE6 A;  3PXT D;  4J82 A;  2H14 A;  3OW8 A;  3F3F A;  1JMX B;  4JHP C;  2AGL A;  4DNW A;  1K3I A;  1N6D A;  4H5J A;  3SBQ A;  5EMM B;  2B5M A;  3F3P A;  3VGZ A;  3I2N A;  1B9Y A;  3EI3 A;  3KCI A;  1C9L A;  1GOH A;  3EG6 A;  4A11 B;  2H13 A;  4GQB B;  5FA5 B;  3PVW B;  3NIG A;  2OVP B;  4QL1 A;  3RMZ D;  3I7O A;  1E8M A;  3MKS B;  2XU7 A;  4RE5 A;  1QNI A;  2W18 A;  3VH0 A;  1S4U X;  2I0R A;  5E6S A;  4CZY A;  1PEV A;  3UVO A;  2PBI B;  5EAM A;  5JWZ A;  2CO0 A;  1SHY B;  3SJL D;  1BPO A;  4UM8 A;  2EBS A;  3K72 A;  4WK4 A;  3SLE D;  1B9X A;  4CI1 A;  3ULE C;  3V7D B;  5C2W B;  2J56 H;  3MUN A;  3OKW A;  1U2V C;  3RFH A;  4MMX A;  3MKQ A;  4FHL A;  4LG9 A;  4NBM A;  3PSC B;  3ZDZ A;  2IWF A;  3UR4 A;  4GM9 A;  3OF7 A;  2I3T A;  4AOW A;  2Z2N A;  3UVN A;  4FA5 D;  4Y5R D;  2IUR A;  3KRW B;  1MG2 A;  3I8C A;  3I7N A;  3GFC A;  1PGU A;  1UTC A;  3C5M A;  2QZP A;  2UZY B;  4QT8 A;  2B5N A;  2H9L A;  4QQE A;  3ZDX A;  4ERZ A;  2H9N A;  4D6V A;  3O4G A;  4PNK B;  4E54 B;  3W15 A;  5H1M A;  1GOT B;  3P4F A;  3EQ8 A;  2QXV A;  1UOO A;  4O02 A;  2P9I C;  4ZOZ A;  4J87 A;  3I7L A;  2B4E A;  2YNP A;  4O1Q D;  2VC2 A;  3ZDY A;  5AFU 3;  5GXH A;  1TBG A;  3DSM A;  5H14 A;  4A0A A;  2H6Q A;  4J0X A;  4NAA A;  3EQ7 A;  3T3M A;  1TYQ C;  2QC5 A;  5EMK B;  4J78 A;  1MDA H;  5FKS A;  2XL2 A;  1JTD B;  2HU5 A;  2OVR B;  1U8C A;  2PM6 B;  3DWL C;  4Z7Q A;  2GNQ A;  2XDW A;  5TEF A;  4G55 A;  3EI4 B;  2H9P A;  5HE2 B;  3I8E A;  4R7A B;  3J81 g;  3EI4 A;  3O4J A;  4XYH A;  1SQJ A;  1XIP A;  3AFC A;  1FWX A;  2EIE A;  3V5W B;  3O4I A;  3IVM A;  4H5I A;  4NC4 A;  1GOG A;  4PSX B;  2P9K C;  3NVN A;  3PSL A;  4BP8 A;  2P9S C;  2YNN A;  2AGZ A;  3C9C A;  5K19 A;  4YVD A;  5B4W A;  5TDH B;  4O3U B;  3SMR A;  4IMM A;  4AMZ A;  4UI9 R;  2CO0 C;  1GP2 B;  1I2M B;  1PBY B;  2VDN A;  3AL8 B;  3F3G A;  3UVK A;  2AQ5 A;  4CY2 A;  3U4Y A;  2OK4 A;  4JHN A;  4JSN C;  4L1Q D;  3AL8 A;  4L3G D;  5EAR A;  3OKY A;  3SHF A;  4JSX C;  3EMH A;  5A2Q g;  1P22 A;  2H6N A;  5C2V B;  4ES0 A;  1E5T A;  3JZH A;  2P9L C;  4L1M A;  2CN3 A;  4LG8 A;  4ERY A;  5FLX g;  4IA9 A;  4J0W A;  4A08 B;  3DXK C;  5M5T A;  4PC0 A;  2P9P C;  5FFG A;  1JMZ B;  4PXW A;  3BWS A;  4GM8 A;  2VDO A;  4L9O A;  5HDB A;  3KRX B;  3NID A;  2O9K A;  3MXX A;  5M61 A;  2I0S A;  1RI6 A;  3BG1 A;  3I7P A;  4IRZ A;  4A11 A; 
#chains in the Genus database with same CATH homology
 5M5V A;  1C9I A;  5M5S A;  3GC3 B;  5M61 A;  5M5R A;  1UTC A;  5M5U A;  1C9L A;  5M5T A;  2XZG A;  3GD1 I;  4G55 A;  1BPO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...