1C9LA

Peptide-in-groove interactions link target proteins to the b-propeller of clathrin
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
357
structure length
357
Chain Sequence
QILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Peptide-in-groove interactions link target proteins to the beta-propeller of clathrin.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis/exocytosis
molecule keywords CLATHRIN
total genus 78
structure length 357
sequence length 357
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01394 Clathrin_propel Clathrin propeller repeat
A PF09268 Clathrin-link Clathrin, heavy-chain linker
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.110 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Clathrin heavy-chain terminal domain 1c9lA00
3GD1I 5M5VA 1C9IA 4G55A 1BPOA 1C9LA 5M5UA 5M5SA 5M5RA 1UTCA 2XZGA 3GC3B 5M61A 5M5TA
chains in the Genus database with same CATH superfamily
1JJUB 5FQDA 5FXYA 5IJ8E 4GM9A 4CI8A 5GXIA 3EI3B 1PBYB 3N0EA 2PM9A 3O4HA 4D0KA 2H14A 2OIZA 4G55A 3FCSA 3ZDXA 4A2MA 3DM0A 4GM3A 4A08B 5CXBA 3MZKA 1XKSA 3GD1I 3KRXB 2VDOA 5THAA 4A08A 3OKYB 3ZWLB 4DNWA 4ZOVA 3O4JA 4L3HD 3DDUA 2Z2NA 4U7AA 3OF7A 3VI4A 4QQEA 3ULEC 4GQBB 3FCUA 4HDJA 4WK0A 5GSAA 4ZN4A 3I7PA 4J8GA 4AN0A 2GC7A 2IURA 2BKLA 5FKQA 3JZHA 4ZOXA 2CO0C 3MVDK 4A09B 1PGUA 1UOOA 3MZLA 5EALA 4WJKA 2W18A 5FFGA 5M5TA 4FWWA 3I89A 3VGZA 1B9XA 2IAAA 2QXVA 1M1XA 4DNVA 4I79A 2HJBA 1E8NA 3ZE1A 4AOWA 1GOTB 2G9AA 5E6UA 1UTCA 5HYNB 5FFOA 3RN0D 2XL3A 4J0WA 4J78A 4IA9A 3I8CA 2IUPA 4NENA 2QZPA 4EWRA 2I3TA 4A2LA 3VH0A 3T3PA 1JV2A 3C99A 3MUNA 2G99A 3IURA 4JXMA 2B4EA 2OVQB 1JMXB 1NR0A 2EIBA 4ES0A 2VDPA 4MMYA 4L9OA 2J55H 1JMZB 3V4VA 1H2ZA 3K71A 2UZYB 5AFU3 3RSEC 4LGNA 2PM6B 3B7FA 3C5MA 3MMYA 4Z7OA 2P9LC 1N6DA 2HU7A 4K3JB 4FA9D 1JTDB 2XYIA 4KFMB 5GMKn 4LG8A 4RE5A 1PI6A 3OW8A 1K32A 4BP8A 3IJCA 3SLED 2O9KA 2HU5A 4J84A 1TYEA 4A0AA 3FM0A 3L4OD 4JHNA 1O6FA 4A7JA 4Z7QA 1N6FA 4CI3A 4A0AB 2EBSA 1U4CA 3DXKC 3OKWA 5E6SA 3RFGA 3O4GA 1RI6A 4IRZA 4A11B 3MKSB 3JAMg 2AGWA 3ZDZA 5KDOB 4PBYA 4QL1A 2YMUA 4ERQA 3PSCB 4G1MA 1B9YA 4J81A 4J8BA 2YNPA 3EI4B 3OKTA 4Z8LA 2Z2OA 5IGQA 3JROA 3RMZD 3SBRA 4ZOZA 1O6GA 3ZE2A 4R7AB 5IGOA 3SBQA 4FAND 5HDBA 3UKUC 4GZ8A 3KCIA 1K8KC 4FB1D 1VE6A 4RE6A 4XYHA 3BG0A 3JPXA 3F3FA 4JSNC 4PBZA 4G56B 5E6RA 4QT8A 4CZYA 4CI2A 1QFMA 2CN2A 3C75H 4BCCA 1GXRA 2OJYA 3T3MA 4AEZA 3ZDYA 4MK0B 2H47A 5M5RA 3K72A 3IUJA 3SWSD 1SQ9A 4PSWB 3RRMC 4A09A 4X3EA 1K3IA 3I8EA 4PSXB 2CN3A 4GQ2P 5C86A 1U8CA 3EWEA 2AQ5A 4E54B 2AGYA 4AX4A 4CI1A 2AGZA 2HKRA 4FHLA 5SXMA 3AH8B 3VA6A 2QR5A 4K3ID 5HE2B 2JKXA 4BL0A 3UR4A 2P9PC 2MTAH 1SQJA 1MG3A 5FKSA 4CY3A 4LG9A 3V4PA 2VDRA 3I2NA 4J0XA 1C9LA 3SMRA 3EMHA 4GGAA 2OK4A 3V7DB 5EMMB 3IJ0A 3EG6A 2GC4A 2P9NC 3EI2B 4A11A 5K19A 2VZ1A 4Z7NA 1PEVA 2J57G 1QFSA 3IUMA 3QHYB 5I5IA 4D6VA 1XHMA 2P9IC 3ODTA 3RFHA 1TYQC 5A2Qg 4O9DA 2HYEA 1C9IA 4G1EA 4BCBA 3IIYA 2AGXA 1MDAH 2UZXB 3GC3B 4WK4A 2H6NA 4O02A 2BCJB 2YBAA 2VDQA 1QNIA 3SBPA 2CE8A 1GOFA 4GM8A 5K1CC 3ZE0A 2AH0A 4ERYA 1JOFA 3IUQA 1S4UX 4UM8A 3JZNA 3HFQA 4UI9R 5FLXg 3I7NA 3I7OA 2HKMA 2XZGA 1XIPA 3BWSA 3CIKB 3KRWB 4AMZA 4QRJA 3K26A 3EQ7A 1NEXB 3J81g 2B5LA 4L1MA 2AH1A 4CY2A 2WQ8A 3DWLC 4GGCA 3NIGA 1A0RB 4H5IA 4CC9A 2VZ3A 4PC0A 1VE7A 2H9LA 3IVMA 3PXWD 3NIDA 3JRPA 3PVUB 4ERZA 1H2WA 2HU8A 4DNUA 5TEFA 5IJ7E 4GMBA 2P9SC 1L0QA 3PSLA 3UVOA 4BUJC 3OTTA 5C2VB 5H1MA 1U2VC 5EMJB 2H68A 1VZ2A 1OLZA 2GNQA 3IULA 2I3SA 4AMYA 2TRCB 2H9PA 3OL2A 1UOPA 3AFCA 2H6KA 2CO0A 2HXCA 3E0CA 3QI0A 2Q7QA 3DXMC 5CXBB 4BH6A 3SVWD 4X63B 3U4YA 4QAMA 3N0DA 5EMLB 2IWKA 5H14A 4JHPC 2OVPB 4WK2A 2Z2PA 2EICA 3W15A 3UKRC 2H3XA 4E54A 1VYHC 5M61A 1TBGA 1Q47A 2PM7B 3AL9A 3I7HA 1YR2A 4JT6C 2IWFA 2YNNA 3C9CA 4Y5RD 5FKRA 2I0SA 4J77A 4J79A 4A0BA 5EAMA 3MUOA 1H2YA 3AL8B 2IUQA 2XL2A 3OKYA 1MG2A 5M5UA 3ORVD 5HE3B 3F3GA 4CZXA 4ZOYA 3CFVA 3AL8A 2BBKH 3L4MD 4YVDA 1GP2B 4NAAA 3IKOA 3EI2A 2VDMA 5TF2A 4O2WA 4OZUA 5GXHA 5C92A 5IT9g 5M5SA 1L5GA 4X60B 3SJLD 1I2MB 5HE0B 1ERJA 4PXWA 2B5NA 3NVQA 3EU7A 5CYKB 4NC4A 3P4FA 2P9KC 5C2WB 5CXCB 4FA4D 3SCYA 2PM9B 5AMSA 2H6QA 4CZVA 5H17A 4FA5D 3EQ8A 3SHFA 3PVWB 3V9FA 3CFSB 3GREA 4BP9A 5HE1B 3V5WB 3DSMA 4D9SA 2HESX 2I0RA 5TDHB 1E5TA 4BCDA 4J86A 2I0TA 4J87A 2PBIB 3GFCA 4XEIC 2OVRB 4E5ZA 1FWXA 2VDLA 3K27A 3EQ9A 4IMMA 1GG2B 2XU7A 5EAPA 3PXSD 3VI3A 3SFZA 1N6EA 4OWRA 4AN1A 3MXXA 3UVMA 5EM2B 2HJ4A 2CNXA 4O3UB 4JD2C 4CY1A 5FKTA 2VDKA 1YFQA 5B4WA 5I5JA 5EM2A 3I7KA 5TEEA 4PNKB 2EIDA 4NSXA 2B5MA 3MKQA 1SHYB 4MMZA 3UVLA 3NIFA 5AJAA 2EIEA 1OMWB 3EI1A 4L3GD 3EI3A 4XYIA 3F3PA 4GGDA 3JZGA 4FAVD 5EARA 5HQGA 4X61B 5I5MA 3SXTD 3OL2B 4ESGA 4JSVC 3NVNA 2H13A 2OK6A 4FA1D 2IUVA 2H9NA 4J73A 3UVNA 3BG1A 2YB8B 4H5JA 4CY5A 5C9ZB 4MMXA 4NBMA 5JWZA 3IJ1A 4Y7RA 5CYKA 2XDWA 5CXCA 1A12A 1BPOA 2QC5A 2VDNA 3K6SA 3IJEA 1E8MA 2VC2A 4L1QD 3RLMD 1R5MA 2XE4A 2J56H 4JT5C 4TZ4A 3EI1B 3JB9L 3EI4A 1GOHA 1T2XA 4N14A 2CE9A 4GQ1A 1VZ3A 3A0FA 1H2XA 3IUNA 3PE7A 3UVKA 4A0BB 4JSXC 3O4IA 4UM9A 4E5ZB 3FGBA 3FRXA 4O3TB 1P22A 3NVXA 3IIWA 1GOGA 3J80g 2AGLA 5IC7A 5EMKB 2P9UC 2YNOA 3RN1D 3I7LA 5M5VA 4O45A 1UOQA 4O1QD 4U1EI 4J82A 3SN6B 5FA5B 2H9MA 3PXTD 4JSPC
chains in the Genus database with same CATH topology
3GD1I 5M5VA 1C9IA 4G55A 1BPOA 1C9LA 5M5UA 5M5SA 5M5RA 1UTCA 2XZGA 3GC3B 5M61A 5M5TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GD1 I;  5M5V A;  1C9I A;  4G55 A;  1BPO A;  1C9L A;  5M5U A;  5M5S A;  5M5R A;  1UTC A;  2XZG A;  3GC3 B;  5M61 A;  5M5T A; 
#chains in the Genus database with same CATH topology
 1JJU B;  5FQD A;  5FXY A;  5IJ8 E;  4GM9 A;  4CI8 A;  5GXI A;  3EI3 B;  1PBY B;  3N0E A;  2PM9 A;  3O4H A;  4D0K A;  2H14 A;  2OIZ A;  4G55 A;  3FCS A;  3ZDX A;  4A2M A;  3DM0 A;  4GM3 A;  4A08 B;  5CXB A;  3MZK A;  1XKS A;  3GD1 I;  3KRX B;  2VDO A;  5THA A;  4A08 A;  3OKY B;  3ZWL B;  4DNW A;  4ZOV A;  3O4J A;  4L3H D;  3DDU A;  2Z2N A;  4U7A A;  3OF7 A;  3VI4 A;  4QQE A;  3ULE C;  4GQB B;  3FCU A;  4HDJ A;  4WK0 A;  5GSA A;  4ZN4 A;  3I7P A;  4J8G A;  4AN0 A;  2GC7 A;  2IUR A;  2BKL A;  5FKQ A;  3JZH A;  4ZOX A;  2CO0 C;  3MVD K;  4A09 B;  1PGU A;  1UOO A;  3MZL A;  5EAL A;  4WJK A;  2W18 A;  5FFG A;  5M5T A;  4FWW A;  3I89 A;  3VGZ A;  1B9X A;  2IAA A;  2QXV A;  1M1X A;  4DNV A;  4I79 A;  2HJB A;  1E8N A;  3ZE1 A;  4AOW A;  1GOT B;  2G9A A;  5E6U A;  1UTC A;  5HYN B;  5FFO A;  3RN0 D;  2XL3 A;  4J0W A;  4J78 A;  4IA9 A;  3I8C A;  2IUP A;  4NEN A;  2QZP A;  4EWR A;  2I3T A;  4A2L A;  3VH0 A;  3T3P A;  1JV2 A;  3C99 A;  3MUN A;  2G99 A;  3IUR A;  4JXM A;  2B4E A;  2OVQ B;  1JMX B;  1NR0 A;  2EIB A;  4ES0 A;  2VDP A;  4MMY A;  4L9O A;  2J55 H;  1JMZ B;  3V4V A;  1H2Z A;  3K71 A;  2UZY B;  5AFU 3;  3RSE C;  4LGN A;  2PM6 B;  3B7F A;  3C5M A;  3MMY A;  4Z7O A;  2P9L C;  1N6D A;  2HU7 A;  4K3J B;  4FA9 D;  1JTD B;  2XYI A;  4KFM B;  5GMK n;  4LG8 A;  4RE5 A;  1PI6 A;  3OW8 A;  1K32 A;  4BP8 A;  3IJC A;  3SLE D;  2O9K A;  2HU5 A;  4J84 A;  1TYE A;  4A0A A;  3FM0 A;  3L4O D;  4JHN A;  1O6F A;  4A7J A;  4Z7Q A;  1N6F A;  4CI3 A;  4A0A B;  2EBS A;  1U4C A;  3DXK C;  3OKW A;  5E6S A;  3RFG A;  3O4G A;  1RI6 A;  4IRZ A;  4A11 B;  3MKS B;  3JAM g;  2AGW A;  3ZDZ A;  5KDO B;  4PBY A;  4QL1 A;  2YMU A;  4ERQ A;  3PSC B;  4G1M A;  1B9Y A;  4J81 A;  4J8B A;  2YNP A;  3EI4 B;  3OKT A;  4Z8L A;  2Z2O A;  5IGQ A;  3JRO A;  3RMZ D;  3SBR A;  4ZOZ A;  1O6G A;  3ZE2 A;  4R7A B;  5IGO A;  3SBQ A;  4FAN D;  5HDB A;  3UKU C;  4GZ8 A;  3KCI A;  1K8K C;  4FB1 D;  1VE6 A;  4RE6 A;  4XYH A;  3BG0 A;  3JPX A;  3F3F A;  4JSN C;  4PBZ A;  4G56 B;  5E6R A;  4QT8 A;  4CZY A;  4CI2 A;  1QFM A;  2CN2 A;  3C75 H;  4BCC A;  1GXR A;  2OJY A;  3T3M A;  4AEZ A;  3ZDY A;  4MK0 B;  2H47 A;  5M5R A;  3K72 A;  3IUJ A;  3SWS D;  1SQ9 A;  4PSW B;  3RRM C;  4A09 A;  4X3E A;  1K3I A;  3I8E A;  4PSX B;  2CN3 A;  4GQ2 P;  5C86 A;  1U8C A;  3EWE A;  2AQ5 A;  4E54 B;  2AGY A;  4AX4 A;  4CI1 A;  2AGZ A;  2HKR A;  4FHL A;  5SXM A;  3AH8 B;  3VA6 A;  2QR5 A;  4K3I D;  5HE2 B;  2JKX A;  4BL0 A;  3UR4 A;  2P9P C;  2MTA H;  1SQJ A;  1MG3 A;  5FKS A;  4CY3 A;  4LG9 A;  3V4P A;  2VDR A;  3I2N A;  4J0X A;  1C9L A;  3SMR A;  3EMH A;  4GGA A;  2OK4 A;  3V7D B;  5EMM B;  3IJ0 A;  3EG6 A;  2GC4 A;  2P9N C;  3EI2 B;  4A11 A;  5K19 A;  2VZ1 A;  4Z7N A;  1PEV A;  2J57 G;  1QFS A;  3IUM A;  3QHY B;  5I5I A;  4D6V A;  1XHM A;  2P9I C;  3ODT A;  3RFH A;  1TYQ C;  5A2Q g;  4O9D A;  2HYE A;  1C9I A;  4G1E A;  4BCB A;  3IIY A;  2AGX A;  1MDA H;  2UZX B;  3GC3 B;  4WK4 A;  2H6N A;  4O02 A;  2BCJ B;  2YBA A;  2VDQ A;  1QNI A;  3SBP A;  2CE8 A;  1GOF A;  4GM8 A;  5K1C C;  3ZE0 A;  2AH0 A;  4ERY A;  1JOF A;  3IUQ A;  1S4U X;  4UM8 A;  3JZN A;  3HFQ A;  4UI9 R;  5FLX g;  3I7N A;  3I7O A;  2HKM A;  2XZG A;  1XIP A;  3BWS A;  3CIK B;  3KRW B;  4AMZ A;  4QRJ A;  3K26 A;  3EQ7 A;  1NEX B;  3J81 g;  2B5L A;  4L1M A;  2AH1 A;  4CY2 A;  2WQ8 A;  3DWL C;  4GGC A;  3NIG A;  1A0R B;  4H5I A;  4CC9 A;  2VZ3 A;  4PC0 A;  1VE7 A;  2H9L A;  3IVM A;  3PXW D;  3NID A;  3JRP A;  3PVU B;  4ERZ A;  1H2W A;  2HU8 A;  4DNU A;  5TEF A;  5IJ7 E;  4GMB A;  2P9S C;  1L0Q A;  3PSL A;  3UVO A;  4BUJ C;  3OTT A;  5C2V B;  5H1M A;  1U2V C;  5EMJ B;  2H68 A;  1VZ2 A;  1OLZ A;  2GNQ A;  3IUL A;  2I3S A;  4AMY A;  2TRC B;  2H9P A;  3OL2 A;  1UOP A;  3AFC A;  2H6K A;  2CO0 A;  2HXC A;  3E0C A;  3QI0 A;  2Q7Q A;  3DXM C;  5CXB B;  4BH6 A;  3SVW D;  4X63 B;  3U4Y A;  4QAM A;  3N0D A;  5EML B;  2IWK A;  5H14 A;  4JHP C;  2OVP B;  4WK2 A;  2Z2P A;  2EIC A;  3W15 A;  3UKR C;  2H3X A;  4E54 A;  1VYH C;  5M61 A;  1TBG A;  1Q47 A;  2PM7 B;  3AL9 A;  3I7H A;  1YR2 A;  4JT6 C;  2IWF A;  2YNN A;  3C9C A;  4Y5R D;  5FKR A;  2I0S A;  4J77 A;  4J79 A;  4A0B A;  5EAM A;  3MUO A;  1H2Y A;  3AL8 B;  2IUQ A;  2XL2 A;  3OKY A;  1MG2 A;  5M5U A;  3ORV D;  5HE3 B;  3F3G A;  4CZX A;  4ZOY A;  3CFV A;  3AL8 A;  2BBK H;  3L4M D;  4YVD A;  1GP2 B;  4NAA A;  3IKO A;  3EI2 A;  2VDM A;  5TF2 A;  4O2W A;  4OZU A;  5GXH A;  5C92 A;  5IT9 g;  5M5S A;  1L5G A;  4X60 B;  3SJL D;  1I2M B;  5HE0 B;  1ERJ A;  4PXW A;  2B5N A;  3NVQ A;  3EU7 A;  5CYK B;  4NC4 A;  3P4F A;  2P9K C;  5C2W B;  5CXC B;  4FA4 D;  3SCY A;  2PM9 B;  5AMS A;  2H6Q A;  4CZV A;  5H17 A;  4FA5 D;  3EQ8 A;  3SHF A;  3PVW B;  3V9F A;  3CFS B;  3GRE A;  4BP9 A;  5HE1 B;  3V5W B;  3DSM A;  4D9S A;  2HES X;  2I0R A;  5TDH B;  1E5T A;  4BCD A;  4J86 A;  2I0T A;  4J87 A;  2PBI B;  3GFC A;  4XEI C;  2OVR B;  4E5Z A;  1FWX A;  2VDL A;  3K27 A;  3EQ9 A;  4IMM A;  1GG2 B;  2XU7 A;  5EAP A;  3PXS D;  3VI3 A;  3SFZ A;  1N6E A;  4OWR A;  4AN1 A;  3MXX A;  3UVM A;  5EM2 B;  2HJ4 A;  2CNX A;  4O3U B;  4JD2 C;  4CY1 A;  5FKT A;  2VDK A;  1YFQ A;  5B4W A;  5I5J A;  5EM2 A;  3I7K A;  5TEE A;  4PNK B;  2EID A;  4NSX A;  2B5M A;  3MKQ A;  1SHY B;  4MMZ A;  3UVL A;  3NIF A;  5AJA A;  2EIE A;  1OMW B;  3EI1 A;  4L3G D;  3EI3 A;  4XYI A;  3F3P A;  4GGD A;  3JZG A;  4FAV D;  5EAR A;  5HQG A;  4X61 B;  5I5M A;  3SXT D;  3OL2 B;  4ESG A;  4JSV C;  3NVN A;  2H13 A;  2OK6 A;  4FA1 D;  2IUV A;  2H9N A;  4J73 A;  3UVN A;  3BG1 A;  2YB8 B;  4H5J A;  4CY5 A;  5C9Z B;  4MMX A;  4NBM A;  5JWZ A;  3IJ1 A;  4Y7R A;  5CYK A;  2XDW A;  5CXC A;  1A12 A;  1BPO A;  2QC5 A;  2VDN A;  3K6S A;  3IJE A;  1E8M A;  2VC2 A;  4L1Q D;  3RLM D;  1R5M A;  2XE4 A;  2J56 H;  4JT5 C;  4TZ4 A;  3EI1 B;  3JB9 L;  3EI4 A;  1GOH A;  1T2X A;  4N14 A;  2CE9 A;  4GQ1 A;  1VZ3 A;  3A0F A;  1H2X A;  3IUN A;  3PE7 A;  3UVK A;  4A0B B;  4JSX C;  3O4I A;  4UM9 A;  4E5Z B;  3FGB A;  3FRX A;  4O3T B;  1P22 A;  3NVX A;  3IIW A;  1GOG A;  3J80 g;  2AGL A;  5IC7 A;  5EMK B;  2P9U C;  2YNO A;  3RN1 D;  3I7L A;  5M5V A;  4O45 A;  1UOQ A;  4O1Q D;  4U1E I;  4J82 A;  3SN6 B;  5FA5 B;  2H9M A;  3PXT D;  4JSP C; 
#chains in the Genus database with same CATH homology
 3GD1 I;  5M5V A;  1C9I A;  4G55 A;  1BPO A;  1C9L A;  5M5U A;  5M5S A;  5M5R A;  1UTC A;  2XZG A;  3GC3 B;  5M61 A;  5M5T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...