1C9LA

Peptide-in-groove interactions link target proteins to the b-propeller of clathrin
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
357
structure length
357
Chain Sequence
QILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CLATHRIN
publication title Peptide-in-groove interactions link target proteins to the beta-propeller of clathrin.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis/exocytosis
total genus 78
structure length 357
sequence length 357
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01394 Clathrin_propel Clathrin propeller repeat
A PF09268 Clathrin-link Clathrin, heavy-chain linker
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.110 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Clathrin heavy-chain terminal domain 1c9lA00
1C9IA 1UTCA 4G55A 5M5RA 5M5UA 1C9LA 3GD1I 5M61A 3GC3B 2XZGA 5M5TA 5M5SA 5M5VA 1BPOA
chains in the Genus database with same CATH superfamily
3I7NA 5IC7A 4MMZA 3IJ0A 3IUMA 1U2VC 4EWRA 2AQ5A 3E0CA 1FWXA 1JTDB 4Z7NA 3UR4A 1E5TA 5I5MA 1S4UX 4GMBA 4L3HD 5GXIA 3SN6B 3EI2A 2VDPA 3EI3B 1GOGA 2OK6A 3KRWB 2VDQA 3AH8B 1UOOA 3F3FA 2XE4A 1O6FA 2GC7A 3MXXA 3QHYB 3I7OA 4PNKB 4ERQA 2IUQA 4WK0A 5GXHA 5HE3B 4GM8A 4BP9A 2CNXA 4NAAA 3EI4A 4MMXA 2QC5A 1MG3A 3C5MA 2IURA 4YVDA 4N14A 5K1CC 1MG2A 2P9SC 4J78A 3L4MD 5FKQA 3V9FA 4RE6A 1PBYB 4PC0A 2B4EA 3OKTA 1VZ3A 4JSNC 4WK4A 4UI9R 2IAAA 1OLZA 2QXVA 1Q47A 4CY2A 5C2WB 3IJCA 3ZDZA 1VE6A 1XIPA 4NBMA 3I89A 3C99A 3CIKB 3OW8A 1GXRA 3SMRA 3VGZA 4QT8A 3KCIA 2CE9A 2O9KA 4IMMA 4E54B 2Q7QA 2WQ8A 2MTAH 3ODTA 3VI4A 1E8NA 2I3SA 3N0EA 4J81A 2XZGA 3ULEC 3V5WB 2XL2A 4ES0A 3DDUA 2H68A 5HYNB 1NEXB 3K6SA 2H9NA 4ZOXA 2UZYB 5E6UA 5E6SA 1H2XA 4CC9A 1VZ2A 2VDLA 5IJ7E 2HKMA 3U4YA 2B5MA 4H5IA 3DXMC 4ZOVA 3B7FA 4R7AB 3NIDA 4D9SA 1N6FA 1R5MA 2B5NA 4GZ8A 4KFMB 2P9IC 1U8CA 3AL8A 5FKSA 5HE2B 2HYEA 5M5VA 4J8GA 2IUVA 2OJYA 4O45A 5EALA 3RSEC 2QR5A 4Z7QA 4L1MA 1YR2A 5EMMB 4K3JB 2OK4A 3HFQA 3OTTA 3I8EA 2H6QA 1PI6A 5CYKB 4CZYA 4RE5A 4JXMA 1QFMA 4O1QD 4ZOZA 4AN0A 3EI2B 3PXSD 5HQGA 4E5ZB 4X3EA 4UM9A 1JJUB 1GOTB 1L5GA 3EU7A 2VDKA 5CXCA 4L1QD 4WK2A 4QRJA 3O4IA 4WJKA 3OKYA 3NVQA 5M61A 1XKSA 3RLMD 1JMXB 4J84A 5AMSA 3UVLA 1K32A 3EMHA 4ZOYA 3MKSB 3ZDXA 5EM2A 3EI1A 3IUQA 4CI3A 3ZDYA 3EI4B 3RN0D 3GFCA 2Z2NA 2BKLA 2JKXA 4FA4D 2OVRB 5IGQA 3VH0A 3K71A 3RMZD 1PEVA 4G1EA 3SLED 4UM8A 4JHNA 3ZE2A 4CI2A 3SXTD 5FXYA 4A2LA 1YFQA 4A0BA 1VE7A 1PGUA 1U4CA 3GC3B 4PSWB 2EICA 2XDWA 4PSXB 4ZN4A 3MVDK 2VDOA 1UTCA 2GNQA 1MDAH 5IGOA 3DXKC 5H1MA 4GGAA 5AFU3 2XYIA 3PXWD 5EMJB 4CI8A 4FWWA 5M5UA 3UVNA 3C75H 4GGDA 3DM0A 4CI1A 2P9PC 4BUJC 2AH0A 2J55H 4J77A 2UZXB 1BPOA 3VA6A 4FHLA 4CY3A 1JOFA 2YMUA 4DNVA 4PXWA 4Y5RD 3ZE0A 4NC4A 1B9XA 4JD2C 3T3PA 4DNUA 2EIBA 2HU7A 3PVUB 2P9LC 3OL2B 3JB9L 1B9YA 2PM9A 4AX4A 1TYQC 5C86A 4AEZA 2HU5A 4A11B 4CY1A 2VDMA 1TBGA 3AL8B 4O9DA 1O6GA 3RFGA 4AMYA 4FA9D 3PSCB 3BG0A 1RI6A 1JMZB 4PBYA 4GQBB 3NVXA 2AGXA 4JT6C 4XEIC 3N0DA 5HE1B 4J8BA 3SFZA 2VDRA 5FQDA 3PVWB 1H2ZA 2OVQB 2I0RA 1UOQA 5C92A 3L4OD 4GM9A 3UVKA 2AH1A 4A09B 1K8KC 3BG1A 4JHPC 3EI3A 3FM0A 3VI3A 4CY5A 2HESX 3IVMA 2CO0C 4O3TB 2H47A 3ZE1A 3IKOA 4JSXC 3PSLA 2PBIB 5I5JA 5TDHB 3OF7A 5SXMA 5FLXg 3K26A 5FFGA 5HE0B 3J81g 3OKYB 3IJEA 4OWRA 5H17A 2XL3A 4J79A 2YNOA 2H9MA 4J86A 5EM2B 3KRXB 3EQ9A 4JSPC 3EI1B 1UOPA 5I5IA 3O4JA 3IUJA 3I7LA 3EWEA 1N6EA 3MUOA 5GSAA 1JV2A 3EG6A 1QFSA 2OVPB 2H13A 3SHFA 1GOHA 3MMYA 5M5RA 2HJ4A 2VZ3A 3W15A 3ZWLB 4A0BB 4FAND 2EIEA 3SJLD 4X61B 4BP8A 4AOWA 3PXTD 2GC4A 4GQ1A 1C9IA 4LG8A 4J87A 4G56B 2P9UC 5KDOB 5TF2A 1VYHC 5CXBA 2AGLA 2TRCB 3JZGA 2W18A 4H5JA 4ESGA 1H2YA 4BCDA 3UKUC 4GGCA 1A0RB 4MK0B 4BCBA 2AGZA 3JRPA 2HKRA 4A2MA 2Z2PA 4J0WA 1P22A 5EAPA 4A08A 4JSVC 5FFOA 3SBQA 1K3IA 3IIYA 3QI0A 3RRMC 3O4GA 2H3XA 5EMKB 3K72A 2PM9B 5AJAA 5THAA 1QNIA 5IT9g 1M1XA 3IIWA 1E8MA 2AGYA 5FKTA 2IUPA 3I7KA 4GQ2P 5EARA 5GMKn 4NSXA 4J73A 5JWZA 5C9ZB 5TEEA 4K3ID 2EBSA 4AN1A 3BWSA 3V4PA 2H9LA 5FKRA 2AGWA 3JZNA 4U1EI 3MUNA 2CN3A 4CZXA 3ORVD 4L9OA 5CYKA 1SHYB 2IWFA 1N6DA 4A0AA 3JPXA 3F3PA 5C2VB 4TZ4A 1GG2B 2PM6B 3AFCA 4E5ZA 4XYHA 2H14A 4BCCA 3NVNA 4IA9A 3UKRC 4L3GD 2H6NA 3DWLC 4AMZA 2G99A 4FAVD 4J82A 4D6VA 4G55A 5EAMA 3GREA 2J57G 3T3MA 3EQ7A 3SWSD 4Z8LA 1ERJA 3V4VA 3I7PA 3CFSB 4ERYA 4J0XA 5M5TA 3IJ1A 1NR0A 3SVWD 2VZ1A 1SQJA 4QQEA 2VC2A 3I7HA 2P9KC 2EIDA 3IURA 3UVMA 3FRXA 4U7AA 3JAMg 4QL1A 3NIFA 5H14A 4OZUA 2BBKH 2YNNA 5CXCB 1H2WA 2H9PA 4O3UB 4MMYA 2CO0A 2QZPA 1TYEA 1A12A 3PE7A 4FB1D 3P4FA 4PBZA 3RN1D 5CXBB 4BL0A 4Z7OA 3AL9A 3J80g 2CE8A 4A7JA 5B4WA 2VDNA 3NIGA 3SBPA 5IJ8E 2YNPA 1L0QA 3GD1I 4IRZA 1T2XA 4FA1D 5E6RA 4FA5D 2YB8B 4BH6A 4A08B 3EQ8A 1SQ9A 3RFHA 4I79A 5FA5B 2HXCA 2I0TA 4O2WA 3OL2A 3K27A 3MZKA 4D0KA 4Y7RA 2HU8A 4G1MA 5HDBA 4ERZA 4QAMA 5M5SA 4A11A 4XYIA 2YBAA 2I3TA 2J56H 4LGNA 4O02A 4NENA 1GOFA 3DSMA 3FGBA 2HJBA 2Z2OA 3A0FA 2OIZA 3CFVA 2B5LA 4E54A 2I0SA 3IULA 4X63B 5A2Qg 2IWKA 2P9NC 3FCUA 5TEFA 3MZLA 4A0AB 2XU7A 4X60B 4A09A 3I8CA 3I2NA 2BCJB 3IUNA 2CN2A 4HDJA 3JZHA 3SCYA 2PM7B 2G9AA 1C9LA 3V7DB 5EMLB 1GP2B 3JROA 3SBRA 4DNWA 3OKWA 1XHMA 1OMWB 3UVOA 5K19A 3F3GA 4CZVA 4JT5C 2H6KA 4LG9A 3O4HA 3MKQA 1I2MB 3FCSA 4GM3A 3C9CA
chains in the Genus database with same CATH topology
1C9IA 1UTCA 4G55A 5M5RA 5M5UA 1C9LA 3GD1I 5M61A 3GC3B 2XZGA 5M5TA 5M5SA 5M5VA 1BPOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C9I A;  1UTC A;  4G55 A;  5M5R A;  5M5U A;  1C9L A;  3GD1 I;  5M61 A;  3GC3 B;  2XZG A;  5M5T A;  5M5S A;  5M5V A;  1BPO A; 
#chains in the Genus database with same CATH topology
 3I7N A;  5IC7 A;  4MMZ A;  3IJ0 A;  3IUM A;  1U2V C;  4EWR A;  2AQ5 A;  3E0C A;  1FWX A;  1JTD B;  4Z7N A;  3UR4 A;  1E5T A;  5I5M A;  1S4U X;  4GMB A;  4L3H D;  5GXI A;  3SN6 B;  3EI2 A;  2VDP A;  3EI3 B;  1GOG A;  2OK6 A;  3KRW B;  2VDQ A;  3AH8 B;  1UOO A;  3F3F A;  2XE4 A;  1O6F A;  2GC7 A;  3MXX A;  3QHY B;  3I7O A;  4PNK B;  4ERQ A;  2IUQ A;  4WK0 A;  5GXH A;  5HE3 B;  4GM8 A;  4BP9 A;  2CNX A;  4NAA A;  3EI4 A;  4MMX A;  2QC5 A;  1MG3 A;  3C5M A;  2IUR A;  4YVD A;  4N14 A;  5K1C C;  1MG2 A;  2P9S C;  4J78 A;  3L4M D;  5FKQ A;  3V9F A;  4RE6 A;  1PBY B;  4PC0 A;  2B4E A;  3OKT A;  1VZ3 A;  4JSN C;  4WK4 A;  4UI9 R;  2IAA A;  1OLZ A;  2QXV A;  1Q47 A;  4CY2 A;  5C2W B;  3IJC A;  3ZDZ A;  1VE6 A;  1XIP A;  4NBM A;  3I89 A;  3C99 A;  3CIK B;  3OW8 A;  1GXR A;  3SMR A;  3VGZ A;  4QT8 A;  3KCI A;  2CE9 A;  2O9K A;  4IMM A;  4E54 B;  2Q7Q A;  2WQ8 A;  2MTA H;  3ODT A;  3VI4 A;  1E8N A;  2I3S A;  3N0E A;  4J81 A;  2XZG A;  3ULE C;  3V5W B;  2XL2 A;  4ES0 A;  3DDU A;  2H68 A;  5HYN B;  1NEX B;  3K6S A;  2H9N A;  4ZOX A;  2UZY B;  5E6U A;  5E6S A;  1H2X A;  4CC9 A;  1VZ2 A;  2VDL A;  5IJ7 E;  2HKM A;  3U4Y A;  2B5M A;  4H5I A;  3DXM C;  4ZOV A;  3B7F A;  4R7A B;  3NID A;  4D9S A;  1N6F A;  1R5M A;  2B5N A;  4GZ8 A;  4KFM B;  2P9I C;  1U8C A;  3AL8 A;  5FKS A;  5HE2 B;  2HYE A;  5M5V A;  4J8G A;  2IUV A;  2OJY A;  4O45 A;  5EAL A;  3RSE C;  2QR5 A;  4Z7Q A;  4L1M A;  1YR2 A;  5EMM B;  4K3J B;  2OK4 A;  3HFQ A;  3OTT A;  3I8E A;  2H6Q A;  1PI6 A;  5CYK B;  4CZY A;  4RE5 A;  4JXM A;  1QFM A;  4O1Q D;  4ZOZ A;  4AN0 A;  3EI2 B;  3PXS D;  5HQG A;  4E5Z B;  4X3E A;  4UM9 A;  1JJU B;  1GOT B;  1L5G A;  3EU7 A;  2VDK A;  5CXC A;  4L1Q D;  4WK2 A;  4QRJ A;  3O4I A;  4WJK A;  3OKY A;  3NVQ A;  5M61 A;  1XKS A;  3RLM D;  1JMX B;  4J84 A;  5AMS A;  3UVL A;  1K32 A;  3EMH A;  4ZOY A;  3MKS B;  3ZDX A;  5EM2 A;  3EI1 A;  3IUQ A;  4CI3 A;  3ZDY A;  3EI4 B;  3RN0 D;  3GFC A;  2Z2N A;  2BKL A;  2JKX A;  4FA4 D;  2OVR B;  5IGQ A;  3VH0 A;  3K71 A;  3RMZ D;  1PEV A;  4G1E A;  3SLE D;  4UM8 A;  4JHN A;  3ZE2 A;  4CI2 A;  3SXT D;  5FXY A;  4A2L A;  1YFQ A;  4A0B A;  1VE7 A;  1PGU A;  1U4C A;  3GC3 B;  4PSW B;  2EIC A;  2XDW A;  4PSX B;  4ZN4 A;  3MVD K;  2VDO A;  1UTC A;  2GNQ A;  1MDA H;  5IGO A;  3DXK C;  5H1M A;  4GGA A;  5AFU 3;  2XYI A;  3PXW D;  5EMJ B;  4CI8 A;  4FWW A;  5M5U A;  3UVN A;  3C75 H;  4GGD A;  3DM0 A;  4CI1 A;  2P9P C;  4BUJ C;  2AH0 A;  2J55 H;  4J77 A;  2UZX B;  1BPO A;  3VA6 A;  4FHL A;  4CY3 A;  1JOF A;  2YMU A;  4DNV A;  4PXW A;  4Y5R D;  3ZE0 A;  4NC4 A;  1B9X A;  4JD2 C;  3T3P A;  4DNU A;  2EIB A;  2HU7 A;  3PVU B;  2P9L C;  3OL2 B;  3JB9 L;  1B9Y A;  2PM9 A;  4AX4 A;  1TYQ C;  5C86 A;  4AEZ A;  2HU5 A;  4A11 B;  4CY1 A;  2VDM A;  1TBG A;  3AL8 B;  4O9D A;  1O6G A;  3RFG A;  4AMY A;  4FA9 D;  3PSC B;  3BG0 A;  1RI6 A;  1JMZ B;  4PBY A;  4GQB B;  3NVX A;  2AGX A;  4JT6 C;  4XEI C;  3N0D A;  5HE1 B;  4J8B A;  3SFZ A;  2VDR A;  5FQD A;  3PVW B;  1H2Z A;  2OVQ B;  2I0R A;  1UOQ A;  5C92 A;  3L4O D;  4GM9 A;  3UVK A;  2AH1 A;  4A09 B;  1K8K C;  3BG1 A;  4JHP C;  3EI3 A;  3FM0 A;  3VI3 A;  4CY5 A;  2HES X;  3IVM A;  2CO0 C;  4O3T B;  2H47 A;  3ZE1 A;  3IKO A;  4JSX C;  3PSL A;  2PBI B;  5I5J A;  5TDH B;  3OF7 A;  5SXM A;  5FLX g;  3K26 A;  5FFG A;  5HE0 B;  3J81 g;  3OKY B;  3IJE A;  4OWR A;  5H17 A;  2XL3 A;  4J79 A;  2YNO A;  2H9M A;  4J86 A;  5EM2 B;  3KRX B;  3EQ9 A;  4JSP C;  3EI1 B;  1UOP A;  5I5I A;  3O4J A;  3IUJ A;  3I7L A;  3EWE A;  1N6E A;  3MUO A;  5GSA A;  1JV2 A;  3EG6 A;  1QFS A;  2OVP B;  2H13 A;  3SHF A;  1GOH A;  3MMY A;  5M5R A;  2HJ4 A;  2VZ3 A;  3W15 A;  3ZWL B;  4A0B B;  4FAN D;  2EIE A;  3SJL D;  4X61 B;  4BP8 A;  4AOW A;  3PXT D;  2GC4 A;  4GQ1 A;  1C9I A;  4LG8 A;  4J87 A;  4G56 B;  2P9U C;  5KDO B;  5TF2 A;  1VYH C;  5CXB A;  2AGL A;  2TRC B;  3JZG A;  2W18 A;  4H5J A;  4ESG A;  1H2Y A;  4BCD A;  3UKU C;  4GGC A;  1A0R B;  4MK0 B;  4BCB A;  2AGZ A;  3JRP A;  2HKR A;  4A2M A;  2Z2P A;  4J0W A;  1P22 A;  5EAP A;  4A08 A;  4JSV C;  5FFO A;  3SBQ A;  1K3I A;  3IIY A;  3QI0 A;  3RRM C;  3O4G A;  2H3X A;  5EMK B;  3K72 A;  2PM9 B;  5AJA A;  5THA A;  1QNI A;  5IT9 g;  1M1X A;  3IIW A;  1E8M A;  2AGY A;  5FKT A;  2IUP A;  3I7K A;  4GQ2 P;  5EAR A;  5GMK n;  4NSX A;  4J73 A;  5JWZ A;  5C9Z B;  5TEE A;  4K3I D;  2EBS A;  4AN1 A;  3BWS A;  3V4P A;  2H9L A;  5FKR A;  2AGW A;  3JZN A;  4U1E I;  3MUN A;  2CN3 A;  4CZX A;  3ORV D;  4L9O A;  5CYK A;  1SHY B;  2IWF A;  1N6D A;  4A0A A;  3JPX A;  3F3P A;  5C2V B;  4TZ4 A;  1GG2 B;  2PM6 B;  3AFC A;  4E5Z A;  4XYH A;  2H14 A;  4BCC A;  3NVN A;  4IA9 A;  3UKR C;  4L3G D;  2H6N A;  3DWL C;  4AMZ A;  2G99 A;  4FAV D;  4J82 A;  4D6V A;  4G55 A;  5EAM A;  3GRE A;  2J57 G;  3T3M A;  3EQ7 A;  3SWS D;  4Z8L A;  1ERJ A;  3V4V A;  3I7P A;  3CFS B;  4ERY A;  4J0X A;  5M5T A;  3IJ1 A;  1NR0 A;  3SVW D;  2VZ1 A;  1SQJ A;  4QQE A;  2VC2 A;  3I7H A;  2P9K C;  2EID A;  3IUR A;  3UVM A;  3FRX A;  4U7A A;  3JAM g;  4QL1 A;  3NIF A;  5H14 A;  4OZU A;  2BBK H;  2YNN A;  5CXC B;  1H2W A;  2H9P A;  4O3U B;  4MMY A;  2CO0 A;  2QZP A;  1TYE A;  1A12 A;  3PE7 A;  4FB1 D;  3P4F A;  4PBZ A;  3RN1 D;  5CXB B;  4BL0 A;  4Z7O A;  3AL9 A;  3J80 g;  2CE8 A;  4A7J A;  5B4W A;  2VDN A;  3NIG A;  3SBP A;  5IJ8 E;  2YNP A;  1L0Q A;  3GD1 I;  4IRZ A;  1T2X A;  4FA1 D;  5E6R A;  4FA5 D;  2YB8 B;  4BH6 A;  4A08 B;  3EQ8 A;  1SQ9 A;  3RFH A;  4I79 A;  5FA5 B;  2HXC A;  2I0T A;  4O2W A;  3OL2 A;  3K27 A;  3MZK A;  4D0K A;  4Y7R A;  2HU8 A;  4G1M A;  5HDB A;  4ERZ A;  4QAM A;  5M5S A;  4A11 A;  4XYI A;  2YBA A;  2I3T A;  2J56 H;  4LGN A;  4O02 A;  4NEN A;  1GOF A;  3DSM A;  3FGB A;  2HJB A;  2Z2O A;  3A0F A;  2OIZ A;  3CFV A;  2B5L A;  4E54 A;  2I0S A;  3IUL A;  4X63 B;  5A2Q g;  2IWK A;  2P9N C;  3FCU A;  5TEF A;  3MZL A;  4A0A B;  2XU7 A;  4X60 B;  4A09 A;  3I8C A;  3I2N A;  2BCJ B;  3IUN A;  2CN2 A;  4HDJ A;  3JZH A;  3SCY A;  2PM7 B;  2G9A A;  1C9L A;  3V7D B;  5EML B;  1GP2 B;  3JRO A;  3SBR A;  4DNW A;  3OKW A;  1XHM A;  1OMW B;  3UVO A;  5K19 A;  3F3G A;  4CZV A;  4JT5 C;  2H6K A;  4LG9 A;  3O4H A;  3MKQ A;  1I2M B;  3FCS A;  4GM3 A;  3C9C A; 
#chains in the Genus database with same CATH homology
 1C9I A;  1UTC A;  4G55 A;  5M5R A;  5M5U A;  1C9L A;  3GD1 I;  5M61 A;  3GC3 B;  2XZG A;  5M5T A;  5M5S A;  5M5V A;  1BPO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...