1C9LA

Peptide-in-groove interactions link target proteins to the b-propeller of clathrin
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
357
structure length
357
Chain Sequence
QILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis/exocytosis
molecule keywords CLATHRIN
publication title Peptide-in-groove interactions link target proteins to the beta-propeller of clathrin.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 78
structure length 357
sequence length 357
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01394 Clathrin_propel Clathrin propeller repeat
A PF09268 Clathrin-link Clathrin, heavy-chain linker
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.110 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Clathrin heavy-chain terminal domain 1c9lA00
5M5RA 5M5SA 2XZGA 1C9LA 4G55A 1BPOA 5M5UA 1C9IA 3GD1I 1UTCA 3GC3B 5M5VA 5M61A 5M5TA
chains in the Genus database with same CATH superfamily
1GOGA 3KRXB 1N6EA 1K8KC 2HJBA 5E6RA 2HKRA 3ODTA 4OWRA 3GFCA 4J86A 3V7DB 5CXCB 5C2VB 3OL2B 3PXSD 4U7AA 5CYKA 3UKRC 2AGLA 2IUQA 3E0CA 4ZOVA 5M5RA 3K6SA 4DNWA 2QXVA 1SQ9A 3O4HA 3SWSD 3MUNA 1GP2B 1T2XA 3A0FA 3BWSA 3RFHA 2HESX 4FAVD 4L1QD 1VZ3A 3PXTD 3FCUA 3JAMg 2OJYA 3EI1B 4LG9A 4X3EA 3EI3A 3K71A 4GGCA 5IGOA 4O45A 4AX4A 3OW8A 3IUQA 1NR0A 1MG2A 4NBMA 1JTDB 2HJ4A 1JMXB 3CFVA 3EQ9A 4FA4D 4JSPC 3SXTD 1QNIA 3IJ1A 1GXRA 5CXBA 4A2LA 4GMBA 2H6QA 4GGDA 2EIDA 5B4WA 5FXYA 5JWZA 5C86A 1PEVA 4ZOYA 2YNOA 2MTAH 1VYHC 4ERYA 2CNXA 3RSEC 3O4IA 5GXHA 1E8MA 5IJ8E 5C2WB 2YNPA 2GC7A 5HYNB 3O4JA 4BCBA 1GOTB 4Z7NA 4A08B 1Q47A 2Z2PA 2I3TA 4FA1D 3QI0A 3FM0A 3K72A 2QR5A 2P9IC 1MDAH 3J81g 3MZLA 1UTCA 2PM9A 4EWRA 3L4OD 5EALA 5EMMB 4BL0A 3EMHA 1U8CA 2G99A 1OMWB 3IULA 1GG2B 3CIKB 1H2WA 2IUPA 3OKYA 4X63B 2PBIB 5FKSA 4BCDA 2CO0A 2I3SA 1RI6A 4ZOZA 1H2ZA 2P9NC 2UZXB 4JXMA 3I7KA 4RE6A 4E5ZA 1A0RB 3DDUA 3AH8B 3IIWA 4RE5A 3VGZA 5EM2B 4PBYA 5GMKn 2P9PC 3IJCA 2Z2OA 4J77A 4WK4A 2OVQB 3SN6B 3UVOA 2P9UC 4Z7QA 2WQ8A 3AL8B 3ULEC 3I2NA 3EWEA 4CY3A 4X60B 5SXMA 5AJAA 1O6GA 4GM3A 4CZXA 4A11B 4ERQA 3UVKA 1NEXB 1S4UX 4TZ4A 4H5IA 4BCCA 5EARA 1C9IA 4Z8LA 3OKTA 4G1EA 4WK2A 3JPXA 3U4YA 1VE7A 3EI4A 4XEIC 5M61A 2H14A 3PSLA 1B9XA 3I7OA 3VA6A 1JV2A 1B9YA 4BUJC 3JZNA 2B5MA 1I2MB 1UOPA 4XYHA 5HE1B 1FWXA 3JZGA 2QZPA 3K26A 2EIEA 3DXKC 3N0DA 3ZE1A 3NIGA 5M5SA 2PM6B 4AMZA 1SHYB 1SQJA 2J57G 3MZKA 2CE9A 4NAAA 5THAA 5FFOA 3JRPA 5EAMA 1TYQC 3PXWD 4G1MA 3VI3A 4CI1A 2VDOA 3MUOA 4G56B 3UR4A 2H13A 4GGAA 4A0AB 3C5MA 3NVNA 3ZDXA 4MMXA 4PC0A 3SBPA 5HE0B 4MMYA 4NSXA 2IAAA 2H9MA 2XZGA 2XL3A 2VZ1A 4FHLA 3O4GA 5FA5B 2UZYB 5M5VA 5E6UA 4BH6A 2XYIA 1PBYB 4J81A 3IJ0A 4AOWA 2AGXA 4ERZA 4JT6C 5K19A 4GM8A 4BP9A 4K3ID 2G9AA 5HE3B 5EMJB 4D0KA 1PGUA 3W15A 4X61B 5AFU3 4PSXB 4JHNA 5IC7A 3MMYA 1PI6A 1H2YA 3SJLD 5CYKB 4LG8A 4JSVC 3JZHA 4CY5A 4O3UB 3V4PA 3SVWD 2Q7QA 3RRMC 4N14A 1GOFA 2QC5A 3GD1I 5I5JA 4L3GD 3SLED 3EI3B 4CY2A 4O02A 1ERJA 2J55H 3I7HA 2HYEA 4FAND 1BPOA 4J84A 4WK0A 3PSCB 4AMYA 5CXBB 5FKTA 4HDJA 3RLMD 4PNKB 4AN1A 3UVMA 2IWKA 1YFQA 4J8GA 2OVPB 4L9OA 2H9NA 2CO0C 2AQ5A 1K32A 1JOFA 3B7FA 3NIDA 4O1QD 4A2MA 4AEZA 3PVUB 1TYEA 1TBGA 2EIBA 4O9DA 4QAMA 2OIZA 3RFGA 4PSWB 2YMUA 2I0SA 2HU7A 4PXWA 2H6KA 4J73A 4CZVA 3NVQA 3CFSB 3IVMA 2XE4A 4R7AB 5I5IA 2B5LA 2YB8B 4Y7RA 1MG3A 2PM9B 3DWLC 3FGBA 3IUJA 4DNUA 5H1MA 4NC4A 4J0XA 4A09B 2I0RA 1K3IA 4J78A 3EU7A 2W18A 3F3FA 4QRJA 2H9PA 1L0QA 3NIFA 3L4MD 2AH1A 3OF7A 2CN2A 3RMZD 4J0WA 2P9KC 2VDNA 2AGZA 5IGQA 4CY1A 2B5NA 5FQDA 3MKQA 4E5ZB 3T3PA 2VZ3A 3IKOA 3I7PA 2HU8A 4IMMA 4ESGA 2OVRB 4BP8A 4LGNA 4A0BA 3AFCA 3EQ8A 4J8BA 2P9SC 2IUVA 3K27A 5CXCA 3OL2A 4JHPC 5TDHB 5FLXg 2JKXA 3KRWB 4FA5D 4FWWA 3DM0A 3IUMA 4J82A 3C9CA 3AL9A 2XU7A 1E8NA 5HE2B 4JSNC 3SFZA 2VDLA 4UM8A 4D6VA 4DNVA 3EI2B 5HQGA 3EI1A 3EI4B 3RN0D 4E54B 1GOHA 3ZE0A 3PE7A 4GM9A 4JD2C 1XHMA 3DXMC 5HDBA 2VDKA 4J79A 3SMRA 3BG0A 2GNQA 4IA9A 2BBKH 3DSMA 1N6FA 2J56H 2OK4A 2HU5A 2VDPA 3F3GA 4GZ8A 5K1CC 3V9FA 4XYIA 1P22A 3I7LA 3I8CA 5EAPA 4MMZA 3IURA 4FB1D 4OZUA 2H9LA 2Z2NA 4O2WA 2VDMA 3N0EA 1E5TA 3ORVD 4ZOXA 5FKQA 4A08A 2CE8A 2AH0A 4NENA 2TRCB 4GQ1A 4CI2A 5GXIA 4UM9A 4JSXC 3OKWA 2O9KA 1OLZA 3T3MA 2HXCA 3VI4A 4ZN4A 5A2Qg 4K3JB 2VDQA 3JB9L 3P4FA 1JMZB 4UI9R 4L1MA 4GQBB 4QT8A 3ZDYA 3EG6A 2BCJB 2IURA 5C92A 1U4CA 4FA9D 3FRXA 4GQ2P 4CZYA 1U2VC 3GREA 3FCSA 3V4VA 4WJKA 1M1XA 1UOOA 2OK6A 2EBSA 2H6NA 3HFQA 1H2XA 3IJEA 3NVXA 3OTTA 1A12A 3PVWB 5H17A 5GSAA 1QFSA 3J80g 5H14A 4CI8A 5EM2A 4QL1A 3IUNA 2BKLA 5AMSA 5KDOB 2XL2A 3SBQA 3RN1D 2YNNA 4KFMB 2B4EA 5C9ZB 3ZWLB 4D9SA 3AL8A 5IT9g 3MXXA 5EMLB 4A11A 1JJUB 4A09A 3SBRA 1C9LA 5E6SA 1O6FA 3C99A 4A7JA 4Z7OA 4PBZA 5EMKB 2H68A 2YBAA 1R5MA 2PM7B 2I0TA 3IIYA 3I89A 1VE6A 5M5UA 4CI3A 3UVNA 1YR2A 3SCYA 1QFMA 3OKYB 2EICA 1VZ2A 3KCIA 5TF2A 4JT5C 4O3TB 2H47A 3V5WB 4IRZA 3BG1A 4L3HD 1UOQA 2CN3A 1XKSA 5TEFA 4U1EI 5FKRA 3UVLA 1XIPA 5M5TA 2AGYA 4ES0A 5I5MA 5TEEA 4MK0B 3EI2A 4YVDA 2H3XA 4A0AA 3ZE2A 2XDWA 2VC2A 5FFGA 4I79A 2P9LC 3MVDK 3SHFA 4E54A 3I7NA 1L5GA 3VH0A 3JROA 4G55A 4QQEA 4H5JA 4J87A 4AN0A 2AGWA 2GC4A 4Y5RD 3F3PA 3ZDZA 3MKSB 4CC9A 2VDRA 3C75H 3I8EA 2HKMA 3QHYB 1N6DA 3UKUC 2IWFA 3EQ7A 3GC3B 5IJ7E 4A0BB
chains in the Genus database with same CATH topology
5M5RA 5M5SA 2XZGA 1C9LA 4G55A 1BPOA 5M5UA 1C9IA 3GD1I 1UTCA 3GC3B 5M5VA 5M61A 5M5TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M5R A;  5M5S A;  2XZG A;  1C9L A;  4G55 A;  1BPO A;  5M5U A;  1C9I A;  3GD1 I;  1UTC A;  3GC3 B;  5M5V A;  5M61 A;  5M5T A; 
#chains in the Genus database with same CATH topology
 1GOG A;  3KRX B;  1N6E A;  1K8K C;  2HJB A;  5E6R A;  2HKR A;  3ODT A;  4OWR A;  3GFC A;  4J86 A;  3V7D B;  5CXC B;  5C2V B;  3OL2 B;  3PXS D;  4U7A A;  5CYK A;  3UKR C;  2AGL A;  2IUQ A;  3E0C A;  4ZOV A;  5M5R A;  3K6S A;  4DNW A;  2QXV A;  1SQ9 A;  3O4H A;  3SWS D;  3MUN A;  1GP2 B;  1T2X A;  3A0F A;  3BWS A;  3RFH A;  2HES X;  4FAV D;  4L1Q D;  1VZ3 A;  3PXT D;  3FCU A;  3JAM g;  2OJY A;  3EI1 B;  4LG9 A;  4X3E A;  3EI3 A;  3K71 A;  4GGC A;  5IGO A;  4O45 A;  4AX4 A;  3OW8 A;  3IUQ A;  1NR0 A;  1MG2 A;  4NBM A;  1JTD B;  2HJ4 A;  1JMX B;  3CFV A;  3EQ9 A;  4FA4 D;  4JSP C;  3SXT D;  1QNI A;  3IJ1 A;  1GXR A;  5CXB A;  4A2L A;  4GMB A;  2H6Q A;  4GGD A;  2EID A;  5B4W A;  5FXY A;  5JWZ A;  5C86 A;  1PEV A;  4ZOY A;  2YNO A;  2MTA H;  1VYH C;  4ERY A;  2CNX A;  3RSE C;  3O4I A;  5GXH A;  1E8M A;  5IJ8 E;  5C2W B;  2YNP A;  2GC7 A;  5HYN B;  3O4J A;  4BCB A;  1GOT B;  4Z7N A;  4A08 B;  1Q47 A;  2Z2P A;  2I3T A;  4FA1 D;  3QI0 A;  3FM0 A;  3K72 A;  2QR5 A;  2P9I C;  1MDA H;  3J81 g;  3MZL A;  1UTC A;  2PM9 A;  4EWR A;  3L4O D;  5EAL A;  5EMM B;  4BL0 A;  3EMH A;  1U8C A;  2G99 A;  1OMW B;  3IUL A;  1GG2 B;  3CIK B;  1H2W A;  2IUP A;  3OKY A;  4X63 B;  2PBI B;  5FKS A;  4BCD A;  2CO0 A;  2I3S A;  1RI6 A;  4ZOZ A;  1H2Z A;  2P9N C;  2UZX B;  4JXM A;  3I7K A;  4RE6 A;  4E5Z A;  1A0R B;  3DDU A;  3AH8 B;  3IIW A;  4RE5 A;  3VGZ A;  5EM2 B;  4PBY A;  5GMK n;  2P9P C;  3IJC A;  2Z2O A;  4J77 A;  4WK4 A;  2OVQ B;  3SN6 B;  3UVO A;  2P9U C;  4Z7Q A;  2WQ8 A;  3AL8 B;  3ULE C;  3I2N A;  3EWE A;  4CY3 A;  4X60 B;  5SXM A;  5AJA A;  1O6G A;  4GM3 A;  4CZX A;  4A11 B;  4ERQ A;  3UVK A;  1NEX B;  1S4U X;  4TZ4 A;  4H5I A;  4BCC A;  5EAR A;  1C9I A;  4Z8L A;  3OKT A;  4G1E A;  4WK2 A;  3JPX A;  3U4Y A;  1VE7 A;  3EI4 A;  4XEI C;  5M61 A;  2H14 A;  3PSL A;  1B9X A;  3I7O A;  3VA6 A;  1JV2 A;  1B9Y A;  4BUJ C;  3JZN A;  2B5M A;  1I2M B;  1UOP A;  4XYH A;  5HE1 B;  1FWX A;  3JZG A;  2QZP A;  3K26 A;  2EIE A;  3DXK C;  3N0D A;  3ZE1 A;  3NIG A;  5M5S A;  2PM6 B;  4AMZ A;  1SHY B;  1SQJ A;  2J57 G;  3MZK A;  2CE9 A;  4NAA A;  5THA A;  5FFO A;  3JRP A;  5EAM A;  1TYQ C;  3PXW D;  4G1M A;  3VI3 A;  4CI1 A;  2VDO A;  3MUO A;  4G56 B;  3UR4 A;  2H13 A;  4GGA A;  4A0A B;  3C5M A;  3NVN A;  3ZDX A;  4MMX A;  4PC0 A;  3SBP A;  5HE0 B;  4MMY A;  4NSX A;  2IAA A;  2H9M A;  2XZG A;  2XL3 A;  2VZ1 A;  4FHL A;  3O4G A;  5FA5 B;  2UZY B;  5M5V A;  5E6U A;  4BH6 A;  2XYI A;  1PBY B;  4J81 A;  3IJ0 A;  4AOW A;  2AGX A;  4ERZ A;  4JT6 C;  5K19 A;  4GM8 A;  4BP9 A;  4K3I D;  2G9A A;  5HE3 B;  5EMJ B;  4D0K A;  1PGU A;  3W15 A;  4X61 B;  5AFU 3;  4PSX B;  4JHN A;  5IC7 A;  3MMY A;  1PI6 A;  1H2Y A;  3SJL D;  5CYK B;  4LG8 A;  4JSV C;  3JZH A;  4CY5 A;  4O3U B;  3V4P A;  3SVW D;  2Q7Q A;  3RRM C;  4N14 A;  1GOF A;  2QC5 A;  3GD1 I;  5I5J A;  4L3G D;  3SLE D;  3EI3 B;  4CY2 A;  4O02 A;  1ERJ A;  2J55 H;  3I7H A;  2HYE A;  4FAN D;  1BPO A;  4J84 A;  4WK0 A;  3PSC B;  4AMY A;  5CXB B;  5FKT A;  4HDJ A;  3RLM D;  4PNK B;  4AN1 A;  3UVM A;  2IWK A;  1YFQ A;  4J8G A;  2OVP B;  4L9O A;  2H9N A;  2CO0 C;  2AQ5 A;  1K32 A;  1JOF A;  3B7F A;  3NID A;  4O1Q D;  4A2M A;  4AEZ A;  3PVU B;  1TYE A;  1TBG A;  2EIB A;  4O9D A;  4QAM A;  2OIZ A;  3RFG A;  4PSW B;  2YMU A;  2I0S A;  2HU7 A;  4PXW A;  2H6K A;  4J73 A;  4CZV A;  3NVQ A;  3CFS B;  3IVM A;  2XE4 A;  4R7A B;  5I5I A;  2B5L A;  2YB8 B;  4Y7R A;  1MG3 A;  2PM9 B;  3DWL C;  3FGB A;  3IUJ A;  4DNU A;  5H1M A;  4NC4 A;  4J0X A;  4A09 B;  2I0R A;  1K3I A;  4J78 A;  3EU7 A;  2W18 A;  3F3F A;  4QRJ A;  2H9P A;  1L0Q A;  3NIF A;  3L4M D;  2AH1 A;  3OF7 A;  2CN2 A;  3RMZ D;  4J0W A;  2P9K C;  2VDN A;  2AGZ A;  5IGQ A;  4CY1 A;  2B5N A;  5FQD A;  3MKQ A;  4E5Z B;  3T3P A;  2VZ3 A;  3IKO A;  3I7P A;  2HU8 A;  4IMM A;  4ESG A;  2OVR B;  4BP8 A;  4LGN A;  4A0B A;  3AFC A;  3EQ8 A;  4J8B A;  2P9S C;  2IUV A;  3K27 A;  5CXC A;  3OL2 A;  4JHP C;  5TDH B;  5FLX g;  2JKX A;  3KRW B;  4FA5 D;  4FWW A;  3DM0 A;  3IUM A;  4J82 A;  3C9C A;  3AL9 A;  2XU7 A;  1E8N A;  5HE2 B;  4JSN C;  3SFZ A;  2VDL A;  4UM8 A;  4D6V A;  4DNV A;  3EI2 B;  5HQG A;  3EI1 A;  3EI4 B;  3RN0 D;  4E54 B;  1GOH A;  3ZE0 A;  3PE7 A;  4GM9 A;  4JD2 C;  1XHM A;  3DXM C;  5HDB A;  2VDK A;  4J79 A;  3SMR A;  3BG0 A;  2GNQ A;  4IA9 A;  2BBK H;  3DSM A;  1N6F A;  2J56 H;  2OK4 A;  2HU5 A;  2VDP A;  3F3G A;  4GZ8 A;  5K1C C;  3V9F A;  4XYI A;  1P22 A;  3I7L A;  3I8C A;  5EAP A;  4MMZ A;  3IUR A;  4FB1 D;  4OZU A;  2H9L A;  2Z2N A;  4O2W A;  2VDM A;  3N0E A;  1E5T A;  3ORV D;  4ZOX A;  5FKQ A;  4A08 A;  2CE8 A;  2AH0 A;  4NEN A;  2TRC B;  4GQ1 A;  4CI2 A;  5GXI A;  4UM9 A;  4JSX C;  3OKW A;  2O9K A;  1OLZ A;  3T3M A;  2HXC A;  3VI4 A;  4ZN4 A;  5A2Q g;  4K3J B;  2VDQ A;  3JB9 L;  3P4F A;  1JMZ B;  4UI9 R;  4L1M A;  4GQB B;  4QT8 A;  3ZDY A;  3EG6 A;  2BCJ B;  2IUR A;  5C92 A;  1U4C A;  4FA9 D;  3FRX A;  4GQ2 P;  4CZY A;  1U2V C;  3GRE A;  3FCS A;  3V4V A;  4WJK A;  1M1X A;  1UOO A;  2OK6 A;  2EBS A;  2H6N A;  3HFQ A;  1H2X A;  3IJE A;  3NVX A;  3OTT A;  1A12 A;  3PVW B;  5H17 A;  5GSA A;  1QFS A;  3J80 g;  5H14 A;  4CI8 A;  5EM2 A;  4QL1 A;  3IUN A;  2BKL A;  5AMS A;  5KDO B;  2XL2 A;  3SBQ A;  3RN1 D;  2YNN A;  4KFM B;  2B4E A;  5C9Z B;  3ZWL B;  4D9S A;  3AL8 A;  5IT9 g;  3MXX A;  5EML B;  4A11 A;  1JJU B;  4A09 A;  3SBR A;  1C9L A;  5E6S A;  1O6F A;  3C99 A;  4A7J A;  4Z7O A;  4PBZ A;  5EMK B;  2H68 A;  2YBA A;  1R5M A;  2PM7 B;  2I0T A;  3IIY A;  3I89 A;  1VE6 A;  5M5U A;  4CI3 A;  3UVN A;  1YR2 A;  3SCY A;  1QFM A;  3OKY B;  2EIC A;  1VZ2 A;  3KCI A;  5TF2 A;  4JT5 C;  4O3T B;  2H47 A;  3V5W B;  4IRZ A;  3BG1 A;  4L3H D;  1UOQ A;  2CN3 A;  1XKS A;  5TEF A;  4U1E I;  5FKR A;  3UVL A;  1XIP A;  5M5T A;  2AGY A;  4ES0 A;  5I5M A;  5TEE A;  4MK0 B;  3EI2 A;  4YVD A;  2H3X A;  4A0A A;  3ZE2 A;  2XDW A;  2VC2 A;  5FFG A;  4I79 A;  2P9L C;  3MVD K;  3SHF A;  4E54 A;  3I7N A;  1L5G A;  3VH0 A;  3JRO A;  4G55 A;  4QQE A;  4H5J A;  4J87 A;  4AN0 A;  2AGW A;  2GC4 A;  4Y5R D;  3F3P A;  3ZDZ A;  3MKS B;  4CC9 A;  2VDR A;  3C75 H;  3I8E A;  2HKM A;  3QHY B;  1N6D A;  3UKU C;  2IWF A;  3EQ7 A;  3GC3 B;  5IJ7 E;  4A0B B; 
#chains in the Genus database with same CATH homology
 5M5R A;  5M5S A;  2XZG A;  1C9L A;  4G55 A;  1BPO A;  5M5U A;  1C9I A;  3GD1 I;  1UTC A;  3GC3 B;  5M5V A;  5M61 A;  5M5T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...