1C9LA

Peptide-in-groove interactions link target proteins to the b-propeller of clathrin
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
357
structure length
357
Chain Sequence
QILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Peptide-in-groove interactions link target proteins to the beta-propeller of clathrin.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Endocytosis/exocytosis
molecule keywords CLATHRIN
total genus 78
structure length 357
sequence length 357
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-08-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01394 Clathrin_propel Clathrin propeller repeat
A PF09268 Clathrin-link Clathrin, heavy-chain linker
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.110 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Clathrin heavy-chain terminal domain 1c9lA00
5M5RA 1C9IA 5M5VA 5M5TA 5M61A 1UTCA 3GC3B 5M5SA 4G55A 1BPOA 2XZGA 3GD1I 5M5UA 1C9LA
chains in the Genus database with same CATH superfamily
5THAA 1R5MA 5I5IA 3EI2A 5GXHA 4O9DA 1FWXA 2AGWA 4QRJA 4BCCA 3IVMA 3RN1D 3MXXA 5EMJB 3UVNA 4ZOZA 2EIBA 4GGDA 1UOQA 3OL2A 3SN6B 1N6FA 4Z7NA 5FXYA 3V5WB 2OIZA 1QFMA 3IULA 3BG0A 3V7DB 2QR5A 2EIDA 2OK4A 5HDBA 3EWEA 3JROA 4Z8LA 5FQDA 4A0AA 3IJEA 5GMKn 4NSXA 2H6NA 5HE2B 5M5RA 4YVDA 5EMLB 3IUQA 3PE7A 3RMZD 3ZE0A 1YFQA 3RSEC 5CYKA 4FB1D 5HQGA 2GC7A 2XYIA 1VE6A 1A0RB 3MVDK 4J8GA 3K27A 1BPOA 1GXRA 1JMZB 4D0KA 2UZYB 4PSXB 3U4YA 1M1XA 2QC5A 3SFZA 2XZGA 5CXCA 3FGBA 3V4PA 1U4CA 1VZ3A 2VDPA 1E8NA 5EARA 3UVLA 3RLMD 3ODTA 3K26A 3HFQA 4X61B 1JOFA 2EBSA 4GMBA 5H14A 2PBIB 3BG1A 3MUNA 2PM6B 5TEFA 4ZN4A 2CE8A 5TDHB 4GQ2P 5EMKB 1OMWB 5H17A 4AEZA 4MK0B 4CZVA 3E0CA 3EQ8A 3UVOA 1A12A 4L1QD 1GOFA 3F3PA 4A2MA 3B7FA 1XHMA 4G1EA 5EALA 4J77A 3EI2B 3ZE1A 4JSPC 3KRWB 2TRCB 2BCJB 3I2NA 3SWSD 3K72A 2AH1A 3AFCA 4PSWB 3SLED 4FAVD 2H3XA 5M5VA 2CO0A 4JT6C 3SBRA 3IUMA 3FRXA 1QNIA 2GC4A 3I7HA 4J82A 3AL8A 1L0QA 5SXMA 5FA5B 3OKYB 2VDMA 2B5MA 3EI1A 3NIGA 4MMXA 1I2MB 2AQ5A 3VA6A 3K71A 4U7AA 3T3MA 2GNQA 3K6SA 3RFGA 5HE3B 1NEXB 3IKOA 1E8MA 2PM9A 1UTCA 3GC3B 2XU7A 3A0FA 4O45A 3I7NA 4RE5A 5I5MA 5FFGA 2B5LA 4A08A 5E6RA 3EQ7A 2H6QA 1GOGA 2YNNA 4FWWA 3JRPA 2H9MA 2HKMA 3KCIA 4WK0A 3JB9L 4NAAA 5FLXg 1S4UX 4I79A 3I89A 2P9UC 4L9OA 4O1QD 3I7LA 2QXVA 5EMMB 4J0WA 1OLZA 1TBGA 3EG6A 2HKRA 5HE0B 2H47A 3UKUC 4DNWA 1XKSA 4GGAA 4A7JA 3AH8B 2AGLA 3CFVA 3V4VA 1TYEA 4PBZA 1SQJA 2PM9B 4XEIC 2H9NA 3MKQA 3SVWD 4O3TB 2G99A 4G1MA 3T3PA 3DXMC 4DNUA 4Y5RD 3OL2B 4AMYA 3F3FA 4OZUA 2AGZA 3EI3A 1SHYB 4AN0A 1VZ2A 3OF7A 4JSNC 3NIDA 3SBPA 1PI6A 5K19A 4Z7OA 3MZLA 2P9NC 2HJBA 3EMHA 3OW8A 1GOTB 1C9IA 2H68A 4GM3A 1K32A 3GREA 5C2VB 2P9SC 3IURA 4A0BB 4CC9A 1L5GA 3O4GA 4J0XA 2Q7QA 4JT5C 3RN0D 5EAPA 4X3EA 4FA9D 3GFCA 2IWKA 4GQBB 2H14A 4NBMA 4JD2C 4CY3A 3O4JA 4O02A 3SMRA 3OKTA 4FA1D 1N6DA 3PSCB 1JJUB 2IUQA 3BWSA 3FCUA 4ZOYA 4CY2A 4J78A 3SBQA 3PXWD 3N0EA 4TZ4A 3IUJA 2YB8B 4BCDA 4X63B 2PM7B 3IJ1A 3F3GA 4J81A 1K3IA 4U1EI 2I3SA 3JZHA 3MZKA 3AL8B 4UI9R 1JMXB 5AFU3 3IJ0A 5E6UA 2VZ1A 4J73A 4CI1A 3NIFA 4ESGA 1H2XA 3O4IA 3JAMg 3GD1I 3I7OA 3AL9A 3ZDYA 2XL2A 2J55H 3JZGA 2J56H 2P9LC 3CFSB 4JXMA 4A0AB 5IGOA 3NVNA 4QL1A 4UM8A 4IMMA 2Z2PA 4N14A 4NENA 4OWRA 2VDLA 4CY1A 5EM2A 3EI4A 4H5JA 4KFMB 1JV2A 1GP2B 2YNPA 4AMZA 5A2Qg 3RFHA 2BBKH 2I0RA 4AN1A 4GZ8A 1U2VC 2HU5A 2Z2NA 5EAMA 4ERYA 4FAND 1O6FA 4O2WA 3I8CA 1GOHA 3O4HA 4PC0A 5IT9g 2HU8A 4BCBA 2OVPB 1O6GA 2P9KC 5IJ8E 4LG8A 3IUNA 5FKSA 3DSMA 1T2XA 2HXCA 4JHNA 1U8CA 5FKTA 5IJ7E 2VDNA 2CO0C 5CXBA 3L4MD 4PNKB 4CI8A 1NR0A 4J84A 4E5ZA 2G9AA 2EIEA 1VE7A 4CY5A 5CXBB 1SQ9A 2VDQA 2YMUA 3EI1B 4GQ1A 2I0SA 4MMZA 3FCSA 4HDJA 3SXTD 5JWZA 2CE9A 4D6VA 1E5TA 3UR4A 4CZYA 3ZDXA 2IUPA 1B9YA 1XIPA 3PXTD 5K1CC 1C9LA 2UZXB 3V9FA 3VI3A 4L3GD 1PEVA 4WJKA 4NC4A 3DXKC 5C86A 4IA9A 4ERZA 3QI0A 2VZ3A 1H2YA 5TEEA 4O3UB 1N6EA 4A0BA 4CI2A 3EI4B 3I7KA 3C99A 1GG2B 4A11B 3EU7A 2IUVA 5AJAA 4ZOXA 2HESX 5C2WB 3DWLC 4JSXC 4ES0A 5IC7A 3C5MA 5I5JA 4EWRA 4X60B 2BKLA 2W18A 3OKYA 3KRXB 4GGCA 2OVQB 5C9ZB 4E5ZB 4FHLA 3MMYA 4G55A 3N0DA 5M5SA 1TYQC 2OVRB 4G56B 4J87A 4PXWA 4CI3A 5GXIA 4DNVA 3EQ9A 3MUOA 3PVWB 2H13A 5E6SA 4WK2A 2VDOA 4ZOVA 3SHFA 4FA5D 3FM0A 5IGQA 1JTDB 1YR2A 4BUJC 4ERQA 4WK4A 4AX4A 4A2LA 1UOOA 2AGYA 3J80g 3OTTA 4D9SA 2I3TA 5CYKB 4Z7QA 4GM8A 4AOWA 2B5NA 3IIWA 4IRZA 3SCYA 5H1MA 5M5UA 4A09B 3UVMA 2IWFA 3C75H 1MG2A 2O9KA 3QHYB 4GM9A 3VGZA 2VDRA 2B4EA 5TF2A 4FA4D 2Z2OA 3P4FA 4BP8A 2XL3A 1K8KC 2I0TA 2YNOA 3RRMC 2XDWA 1Q47A 3PSLA 4CZXA 3J81g 3VH0A 2OJYA 2IURA 5KDOB 4L3HD 1QFSA 3PVUB 4H5IA 5FKRA 3SJLD 2AGXA 3OKWA 4JSVC 4RE6A 3CIKB 2VC2A 2H9PA 4QT8A 1P22A 5M5TA 3C9CA 3EI3B 2P9PC 3JZNA 3IIYA 3I7PA 2WQ8A 3NVXA 4A09A 4J79A 2P9IC 4K3ID 1PGUA 3ZE2A 2JKXA 1B9XA 1ERJA 4XYIA 1PBYB 4K3JB 3NVQA 4PBYA 3VI4A 2CNXA 2H9LA 1MG3A 4XYHA 2AH0A 4LG9A 3ZDZA 5HYNB 1VYHC 3JPXA 2CN3A 5B4WA 2CN2A 4LGNA 4QAMA 2VDKA 5C92A 2YBAA 4L1MA 1RI6A 3L4OD 1H2ZA 2J57G 3DM0A 4BL0A 5FKQA 3UKRC 5FFOA 4BH6A 2XE4A 4Y7RA 5HE1B 4JHPC 1UOPA 4UM9A 2H6KA 3I8EA 2OK6A 3ULEC 5EM2B 2HYEA 2QZPA 3DDUA 5M61A 3IJCA 2HJ4A 3ORVD 5GSAA 4J86A 3UVKA 3MKSB 4E54B 1MDAH 2HU7A 3PXSD 5CXCB 4A11A 4R7AB 3W15A 4BP9A 4A08B 1H2WA 4QQEA 5AMSA 2EICA 3ZWLB 2IAAA 4MMYA 2MTAH 4J8BA 4E54A
chains in the Genus database with same CATH topology
5M5RA 1C9IA 5M5VA 5M5TA 5M61A 1UTCA 3GC3B 5M5SA 4G55A 1BPOA 2XZGA 3GD1I 5M5UA 1C9LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M5R A;  1C9I A;  5M5V A;  5M5T A;  5M61 A;  1UTC A;  3GC3 B;  5M5S A;  4G55 A;  1BPO A;  2XZG A;  3GD1 I;  5M5U A;  1C9L A; 
#chains in the Genus database with same CATH topology
 5THA A;  1R5M A;  5I5I A;  3EI2 A;  5GXH A;  4O9D A;  1FWX A;  2AGW A;  4QRJ A;  4BCC A;  3IVM A;  3RN1 D;  3MXX A;  5EMJ B;  3UVN A;  4ZOZ A;  2EIB A;  4GGD A;  1UOQ A;  3OL2 A;  3SN6 B;  1N6F A;  4Z7N A;  5FXY A;  3V5W B;  2OIZ A;  1QFM A;  3IUL A;  3BG0 A;  3V7D B;  2QR5 A;  2EID A;  2OK4 A;  5HDB A;  3EWE A;  3JRO A;  4Z8L A;  5FQD A;  4A0A A;  3IJE A;  5GMK n;  4NSX A;  2H6N A;  5HE2 B;  5M5R A;  4YVD A;  5EML B;  3IUQ A;  3PE7 A;  3RMZ D;  3ZE0 A;  1YFQ A;  3RSE C;  5CYK A;  4FB1 D;  5HQG A;  2GC7 A;  2XYI A;  1VE6 A;  1A0R B;  3MVD K;  4J8G A;  3K27 A;  1BPO A;  1GXR A;  1JMZ B;  4D0K A;  2UZY B;  4PSX B;  3U4Y A;  1M1X A;  2QC5 A;  3SFZ A;  2XZG A;  5CXC A;  3FGB A;  3V4P A;  1U4C A;  1VZ3 A;  2VDP A;  1E8N A;  5EAR A;  3UVL A;  3RLM D;  3ODT A;  3K26 A;  3HFQ A;  4X61 B;  1JOF A;  2EBS A;  4GMB A;  5H14 A;  2PBI B;  3BG1 A;  3MUN A;  2PM6 B;  5TEF A;  4ZN4 A;  2CE8 A;  5TDH B;  4GQ2 P;  5EMK B;  1OMW B;  5H17 A;  4AEZ A;  4MK0 B;  4CZV A;  3E0C A;  3EQ8 A;  3UVO A;  1A12 A;  4L1Q D;  1GOF A;  3F3P A;  4A2M A;  3B7F A;  1XHM A;  4G1E A;  5EAL A;  4J77 A;  3EI2 B;  3ZE1 A;  4JSP C;  3KRW B;  2TRC B;  2BCJ B;  3I2N A;  3SWS D;  3K72 A;  2AH1 A;  3AFC A;  4PSW B;  3SLE D;  4FAV D;  2H3X A;  5M5V A;  2CO0 A;  4JT6 C;  3SBR A;  3IUM A;  3FRX A;  1QNI A;  2GC4 A;  3I7H A;  4J82 A;  3AL8 A;  1L0Q A;  5SXM A;  5FA5 B;  3OKY B;  2VDM A;  2B5M A;  3EI1 A;  3NIG A;  4MMX A;  1I2M B;  2AQ5 A;  3VA6 A;  3K71 A;  4U7A A;  3T3M A;  2GNQ A;  3K6S A;  3RFG A;  5HE3 B;  1NEX B;  3IKO A;  1E8M A;  2PM9 A;  1UTC A;  3GC3 B;  2XU7 A;  3A0F A;  4O45 A;  3I7N A;  4RE5 A;  5I5M A;  5FFG A;  2B5L A;  4A08 A;  5E6R A;  3EQ7 A;  2H6Q A;  1GOG A;  2YNN A;  4FWW A;  3JRP A;  2H9M A;  2HKM A;  3KCI A;  4WK0 A;  3JB9 L;  4NAA A;  5FLX g;  1S4U X;  4I79 A;  3I89 A;  2P9U C;  4L9O A;  4O1Q D;  3I7L A;  2QXV A;  5EMM B;  4J0W A;  1OLZ A;  1TBG A;  3EG6 A;  2HKR A;  5HE0 B;  2H47 A;  3UKU C;  4DNW A;  1XKS A;  4GGA A;  4A7J A;  3AH8 B;  2AGL A;  3CFV A;  3V4V A;  1TYE A;  4PBZ A;  1SQJ A;  2PM9 B;  4XEI C;  2H9N A;  3MKQ A;  3SVW D;  4O3T B;  2G99 A;  4G1M A;  3T3P A;  3DXM C;  4DNU A;  4Y5R D;  3OL2 B;  4AMY A;  3F3F A;  4OZU A;  2AGZ A;  3EI3 A;  1SHY B;  4AN0 A;  1VZ2 A;  3OF7 A;  4JSN C;  3NID A;  3SBP A;  1PI6 A;  5K19 A;  4Z7O A;  3MZL A;  2P9N C;  2HJB A;  3EMH A;  3OW8 A;  1GOT B;  1C9I A;  2H68 A;  4GM3 A;  1K32 A;  3GRE A;  5C2V B;  2P9S C;  3IUR A;  4A0B B;  4CC9 A;  1L5G A;  3O4G A;  4J0X A;  2Q7Q A;  4JT5 C;  3RN0 D;  5EAP A;  4X3E A;  4FA9 D;  3GFC A;  2IWK A;  4GQB B;  2H14 A;  4NBM A;  4JD2 C;  4CY3 A;  3O4J A;  4O02 A;  3SMR A;  3OKT A;  4FA1 D;  1N6D A;  3PSC B;  1JJU B;  2IUQ A;  3BWS A;  3FCU A;  4ZOY A;  4CY2 A;  4J78 A;  3SBQ A;  3PXW D;  3N0E A;  4TZ4 A;  3IUJ A;  2YB8 B;  4BCD A;  4X63 B;  2PM7 B;  3IJ1 A;  3F3G A;  4J81 A;  1K3I A;  4U1E I;  2I3S A;  3JZH A;  3MZK A;  3AL8 B;  4UI9 R;  1JMX B;  5AFU 3;  3IJ0 A;  5E6U A;  2VZ1 A;  4J73 A;  4CI1 A;  3NIF A;  4ESG A;  1H2X A;  3O4I A;  3JAM g;  3GD1 I;  3I7O A;  3AL9 A;  3ZDY A;  2XL2 A;  2J55 H;  3JZG A;  2J56 H;  2P9L C;  3CFS B;  4JXM A;  4A0A B;  5IGO A;  3NVN A;  4QL1 A;  4UM8 A;  4IMM A;  2Z2P A;  4N14 A;  4NEN A;  4OWR A;  2VDL A;  4CY1 A;  5EM2 A;  3EI4 A;  4H5J A;  4KFM B;  1JV2 A;  1GP2 B;  2YNP A;  4AMZ A;  5A2Q g;  3RFH A;  2BBK H;  2I0R A;  4AN1 A;  4GZ8 A;  1U2V C;  2HU5 A;  2Z2N A;  5EAM A;  4ERY A;  4FAN D;  1O6F A;  4O2W A;  3I8C A;  1GOH A;  3O4H A;  4PC0 A;  5IT9 g;  2HU8 A;  4BCB A;  2OVP B;  1O6G A;  2P9K C;  5IJ8 E;  4LG8 A;  3IUN A;  5FKS A;  3DSM A;  1T2X A;  2HXC A;  4JHN A;  1U8C A;  5FKT A;  5IJ7 E;  2VDN A;  2CO0 C;  5CXB A;  3L4M D;  4PNK B;  4CI8 A;  1NR0 A;  4J84 A;  4E5Z A;  2G9A A;  2EIE A;  1VE7 A;  4CY5 A;  5CXB B;  1SQ9 A;  2VDQ A;  2YMU A;  3EI1 B;  4GQ1 A;  2I0S A;  4MMZ A;  3FCS A;  4HDJ A;  3SXT D;  5JWZ A;  2CE9 A;  4D6V A;  1E5T A;  3UR4 A;  4CZY A;  3ZDX A;  2IUP A;  1B9Y A;  1XIP A;  3PXT D;  5K1C C;  1C9L A;  2UZX B;  3V9F A;  3VI3 A;  4L3G D;  1PEV A;  4WJK A;  4NC4 A;  3DXK C;  5C86 A;  4IA9 A;  4ERZ A;  3QI0 A;  2VZ3 A;  1H2Y A;  5TEE A;  4O3U B;  1N6E A;  4A0B A;  4CI2 A;  3EI4 B;  3I7K A;  3C99 A;  1GG2 B;  4A11 B;  3EU7 A;  2IUV A;  5AJA A;  4ZOX A;  2HES X;  5C2W B;  3DWL C;  4JSX C;  4ES0 A;  5IC7 A;  3C5M A;  5I5J A;  4EWR A;  4X60 B;  2BKL A;  2W18 A;  3OKY A;  3KRX B;  4GGC A;  2OVQ B;  5C9Z B;  4E5Z B;  4FHL A;  3MMY A;  4G55 A;  3N0D A;  5M5S A;  1TYQ C;  2OVR B;  4G56 B;  4J87 A;  4PXW A;  4CI3 A;  5GXI A;  4DNV A;  3EQ9 A;  3MUO A;  3PVW B;  2H13 A;  5E6S A;  4WK2 A;  2VDO A;  4ZOV A;  3SHF A;  4FA5 D;  3FM0 A;  5IGQ A;  1JTD B;  1YR2 A;  4BUJ C;  4ERQ A;  4WK4 A;  4AX4 A;  4A2L A;  1UOO A;  2AGY A;  3J80 g;  3OTT A;  4D9S A;  2I3T A;  5CYK B;  4Z7Q A;  4GM8 A;  4AOW A;  2B5N A;  3IIW A;  4IRZ A;  3SCY A;  5H1M A;  5M5U A;  4A09 B;  3UVM A;  2IWF A;  3C75 H;  1MG2 A;  2O9K A;  3QHY B;  4GM9 A;  3VGZ A;  2VDR A;  2B4E A;  5TF2 A;  4FA4 D;  2Z2O A;  3P4F A;  4BP8 A;  2XL3 A;  1K8K C;  2I0T A;  2YNO A;  3RRM C;  2XDW A;  1Q47 A;  3PSL A;  4CZX A;  3J81 g;  3VH0 A;  2OJY A;  2IUR A;  5KDO B;  4L3H D;  1QFS A;  3PVU B;  4H5I A;  5FKR A;  3SJL D;  2AGX A;  3OKW A;  4JSV C;  4RE6 A;  3CIK B;  2VC2 A;  2H9P A;  4QT8 A;  1P22 A;  5M5T A;  3C9C A;  3EI3 B;  2P9P C;  3JZN A;  3IIY A;  3I7P A;  2WQ8 A;  3NVX A;  4A09 A;  4J79 A;  2P9I C;  4K3I D;  1PGU A;  3ZE2 A;  2JKX A;  1B9X A;  1ERJ A;  4XYI A;  1PBY B;  4K3J B;  3NVQ A;  4PBY A;  3VI4 A;  2CNX A;  2H9L A;  1MG3 A;  4XYH A;  2AH0 A;  4LG9 A;  3ZDZ A;  5HYN B;  1VYH C;  3JPX A;  2CN3 A;  5B4W A;  2CN2 A;  4LGN A;  4QAM A;  2VDK A;  5C92 A;  2YBA A;  4L1M A;  1RI6 A;  3L4O D;  1H2Z A;  2J57 G;  3DM0 A;  4BL0 A;  5FKQ A;  3UKR C;  5FFO A;  4BH6 A;  2XE4 A;  4Y7R A;  5HE1 B;  4JHP C;  1UOP A;  4UM9 A;  2H6K A;  3I8E A;  2OK6 A;  3ULE C;  5EM2 B;  2HYE A;  2QZP A;  3DDU A;  5M61 A;  3IJC A;  2HJ4 A;  3ORV D;  5GSA A;  4J86 A;  3UVK A;  3MKS B;  4E54 B;  1MDA H;  2HU7 A;  3PXS D;  5CXC B;  4A11 A;  4R7A B;  3W15 A;  4BP9 A;  4A08 B;  1H2W A;  4QQE A;  5AMS A;  2EIC A;  3ZWL B;  2IAA A;  4MMY A;  2MTA H;  4J8B A;  4E54 A; 
#chains in the Genus database with same CATH homology
 5M5R A;  1C9I A;  5M5V A;  5M5T A;  5M61 A;  1UTC A;  3GC3 B;  5M5S A;  4G55 A;  1BPO A;  2XZG A;  3GD1 I;  5M5U A;  1C9L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...