4GGAA

Structural analysis of human cdc20 supports multi-site degron recognition by apc/c
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
314
structure length
314
Chain Sequence
CRYIPSLPDRILDAPEIRNDYYLNLVDWSSGNVLAVALDNSVYLWSASSGDILQLLQMEQPGEYISSVAWIKEGNYLAVGTSSAEVQLWDVQQQKRLRNMTSHSARVGSLSWNSYILSSGSRSGHIHHHDVRVAEHHVATLSGHSQEVCGLRWAPDGRHLASGGNDNLVNVWPSAPGEGGWVPLQTFTQHQGAVKAVAWCPWQSNVLATGGGTSDRHIRIWNVCSGACLSAVDAHSQVCSILWSPHYKELISGHGFAQNQLVIWKYPTMAKVAELKGHTSRVLSLTMSPDGATVASAAADETLRLWRCFELDPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of human Cdc20 supports multisite degron recognition by APC/C.
pubmed doi rcsb
molecule keywords Cell division cycle protein 20 homolog
molecule tags Cell cycle
source organism Homo sapiens
total genus 76
structure length 314
sequence length 314
ec nomenclature
pdb deposition date 2012-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
A PF12894 ANAPC4_WD40 Anaphase-promoting complex subunit 4 WD40 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4ggaA00
4GM8A 4Z8LA 2AH1A 2CNXA 4J84A 3PSLA 5IC7A 5TF2A 2AH0A 2XU7A 1JOFA 4PC0A 4GGAA 2IURA 5I5JA 4JSXC 2GNQA 4ZOYA 4H5IA 4J73A 3I8EA 3SMRA 5FKTA 2H9PA 1MG2A 4N14A 2XYIA 4CZVA 4A08A 3MZKA 3I8CA 3AH8B 1U2VC 2CN2A 2OK4A 5GMKn 4A0BB 2H3XA 4FB1D 1OLZA 3JZHA 3FM0A 1FWXA 1ERJA 3FGBA 4OWRA 3BWSA 2P9SC 3V9FA 3C99A 3OKYB 3RN0D 4CI8A 2CN3A 3PVWB 3W15A 5EMJB 3F3PA 4U1EI 5A2Qg 2PM9A 4J87A 3PXSD 3IJCA 5C9ZB 3JAMg 2H13A 4L3GD 4JSNC 3CFVA 4Y5RD 4JT5C 2YB8B 1PBYB 2G9AA 4QL1A 3UVLA 5EARA 5IGOA 3EI2A 2AQ5A 2H9MA 2H9LA 2AGWA 2P9IC 2AGLA 2BCJB 3GREA 2CE9A 3EG6A 2H47A 3SXTD 1JMXB 1GXRA 4ESGA 1SQ9A 4O9DA 1VYHC 5HE3B 2I0TA 5EALA 4ZN4A 4JXMA 3NVQA 4J8GA 4FA5D 3JPXA 5FLXg 4CY1A 4NSXA 3OL2A 5K1CC 4E54A 3KRXB 3N0EA 3UR4A 4A08B 4JT6C 3RRMC 5FXYA 2P9UC 3RN1D 4A11A 1N6EA 3OTTA 4O3TB 2I0RA 4GMBA 4X61B 1PGUA 4IMMA 3JZGA 4A2LA 3DSMA 3PSCB 4FA1D 2AGZA 2XL2A 4X3EA 3PXTD 3FRXA 3UKUC 5CXBA 5KDOB 1GOTB 1K8KC 3UVOA 5HE0B 4ERQA 2B5NA 2IWFA 3V7DB 2PM9B 5JWZA 2P9LC 4GGCA 2Z2PA 2EBSA 5EM2A 4O45A 3VA6A 4CY2A 3EI2B 1B9YA 4YVDA 4ZOXA 4A2MA 3L4MD 3MKSB 3UVMA 2YMUA 3JB9L 3SBPA 4D6VA 3I7PA 2Q7QA 4E5ZA 3DXKC 4LGNA 4GQBB 4UI9R 2QC5A 2HESX 5TDHB 3EWEA 5HYNB 1YFQA 3IJ0A 4CI2A 5H14A 2CO0A 3UKRC 3ULEC 1TYQC 4QRJA 3AL8A 3PXWD 1R5MA 5GSAA 5B4WA 1Q47A 3IJ1A 3OL2B 4GM9A 4J81A 4E54B 4PNKB 5I5IA 2B5MA 3ZWLB 4MK0B 3C9CA 3RSEC 4PSWB 4L3HD 4A11B 4G56B 3C75H 3I7HA 2IUVA 3E0CA 5SXMA 4CZYA 3UVKA 2J55H 3JROA 4A09A 5CXBB 4O3UB 3RLMD 2H9NA 2YBAA 3MKQA 4J78A 4O1QD 3SBRA 3KRWB 5C2VB 5H17A 4X63B 5EM2B 3N0DA 4OZUA 2PBIB 4QT8A 3BG0A 4J0XA 2GC4A 4PBZA 2J56H 5IJ7E 1N6FA 3PE7A 4A7JA 2B5LA 5AJAA 4E5ZB 4IA9A 4PXWA 1PI6A 1K32A 2YNPA 2Z2OA 3RFGA 4J82A 2PM7B 2HJ4A 5CYKA 3ORVD 3I7NA 2AGYA 2UZXB 2OJYA 3AL8B 3OW8A 3K26A 4CY5A 2OVQB 3CFSB 5FKRA 5FKSA 4CI3A 1NEXB 2B4EA 3F3FA 2I3SA 1SQJA 4JD2C 5I5MA 3NVXA 4ZOZA 1B9XA 5AMSA 2I3TA 3EI3A 3SJLD 3MXXA 4ERZA 5C2WB 4X60B 2HKMA 3MZLA 1GG2B 4H5JA 5TEEA 3J80g 2H68A 4A09B 4ZOVA 3SLED 5FKQA 4CY3A 2HJBA 5GXHA 2CO0C 2P9PC 4FAVD 2W18A 4FWWA 4QQEA 4XEIC 3UVNA 4J0WA 3I89A 2H6KA 3K27A 5IGQA 1GP2B 3I7OA 3RMZD 2HYEA 1MDAH 4GQ2P 3DXMC 4L9OA 4CC9A 3DM0A 4J79A 1OMWB 3AL9A 3SWSD 3C5MA 4BUJC 4L1QD 5EAPA 4FA9D 4HDJA 4CZXA 4GQ1A 4LG8A 2OVPB 4BH6A 4XYHA 4FA4D 3L4OD 3OKTA 2Z2NA 1A0RB 3SFZA 4CI1A 5CYKB 4XYIA 5HE2B 5GXIA 3SCYA 1P22A 5EMKB 4ERYA 4LG9A 2YNNA 4I79A 4PBYA 3SHFA 3I7LA 5FA5B 3BG1A 2IAAA 5IJ8E 3B7FA 3VGZA 1XKSA 5EAMA 1MG3A 4TZ4A 2HXCA 3DWLC 1QNIA 3EI4A 3RFHA 3AFCA 4KFMB 3JRPA 1NR0A 5CXCA 2J57G 3EI3B 3A0FA 3CIKB 1TBGA 3IIWA 5AFU3 1U4CA 4EWRA 4K3JB 2YNOA 2OIZA 1L0QA 4A0AA 1RI6A 1JJUB 5EMMB 3OKWA 4FHLA 4AEZA 3EMHA 4PSXB 3IKOA 2IWKA 2OK6A 2I0SA 4Y7RA 3EI1A 3SVWD 2IUQA 4BL0A 3F3GA 2OVRB 3J81g 2BBKH 4U7AA 5EMLB 2IUPA 3V5WB 1PEVA 2G99A 3SBQA 1XHMA 4J8BA 3ODTA 2O9KA 3VH0A 1XIPA 5HE1B 2MTAH 3I7KA 2GC7A 1JMZB 3SN6B 5FQDA 5H1MA 4D0KA 4JSVC 3U4YA 2CE8A 4J77A 2PM6B 5IT9g 4JSPC 4A0BA 1S4UX 2P9NC 5THAA 2P9KC 3EI4B 2QXVA 4GGDA 5CXCB 4AOWA 4R7AB 1SHYB 4FAND 4J86A 2XL3A 3OKYA 3HFQA 2AGXA 5TEFA 4GM3A 3EU7A 3P4FA 2H6QA 4A0AB 2UZYB 2TRCB 2H14A 3JZNA 2HKRA 3EI1B 1N6DA 3GFCA 3MMYA 5HQGA 4ES0A 3NVNA 5K19A 3PVUB 4K3ID 2H6NA 3IIYA 4GZ8A 3I2NA
chains in the Genus database with same CATH superfamily
3IVMA 4GM8A 4Z8LA 2AH1A 2CNXA 4J84A 4G1EA 2XE4A 3PSLA 5IC7A 1H2ZA 5TF2A 2AH0A 2XU7A 1JOFA 4PC0A 4GGAA 2IURA 5I5JA 1JTDB 4JSXC 2GNQA 4ZOYA 4H5IA 2EIDA 4J73A 3I8EA 3SMRA 5FKTA 2H9PA 1MG2A 4MMZA 4N14A 2XYIA 4CZVA 4NBMA 4A08A 3MZKA 3I8CA 1O6FA 3AH8B 1U2VC 2CN2A 2OK4A 4RE5A 5GMKn 4A0BB 2H3XA 1U8CA 4FB1D 1OLZA 3JZHA 3FM0A 1FWXA 5M5UA 1UOOA 1ERJA 3VI4A 4DNUA 3FGBA 3ZDYA 4OWRA 3BWSA 2P9SC 3V9FA 3C99A 3OKYB 1VE6A 3RN0D 4CI8A 2CN3A 3PVWB 3W15A 5EMJB 3F3PA 4U1EI 5A2Qg 4O2WA 2PM9A 4J87A 3PXSD 3IJCA 5C9ZB 3IUQA 3JAMg 2H13A 1H2WA 4L3GD 4JSNC 3CFVA 4Y5RD 4JT5C 2YB8B 1PBYB 2G9AA 3NIGA 4QL1A 3UVLA 5EARA 5IGOA 3ZDZA 2AQ5A 2H9MA 3EI2A 2H9LA 2AGWA 2P9IC 2AGLA 2BCJB 3OF7A 3GREA 1C9IA 2QZPA 3K72A 2VDQA 2CE9A 3EG6A 2H47A 3SXTD 1JMXB 1GXRA 4ESGA 2HU7A 1SQ9A 2QR5A 3ZDXA 4O9DA 1H2YA 1VYHC 5HE3B 2I0TA 5EALA 5M5SA 4ZN4A 4JXMA 3EQ9A 4DNVA 4G1MA 3NVQA 4J8GA 4FA5D 3JPXA 5FFGA 3T3PA 5FLXg 4WJKA 4CY1A 4NSXA 3OL2A 4MMYA 5K1CC 4E54A 1E5TA 3KRXB 3N0EA 3UR4A 4A08B 1GOFA 4JT6C 3RRMC 5FXYA 2VZ3A 2P9UC 3RN1D 4A11A 5E6UA 1N6EA 1VE7A 3OTTA 4O3TB 2I0RA 4GMBA 4X61B 1PGUA 4IMMA 3JZGA 3NIFA 5M5RA 4A2LA 3DSMA 3PSCB 4FA1D 2AGZA 2XL2A 4X3EA 3PXTD 3MVDK 3FRXA 3UKUC 5CXBA 5KDOB 1GOTB 1K8KC 3UVOA 5C86A 2BKLA 5HE0B 4ERQA 2B5NA 4UM8A 2IWFA 3V7DB 2PM9B 5JWZA 4WK0A 2P9LC 4GGCA 2Z2PA 2EBSA 3V4PA 5EM2A 4O45A 4BP8A 3VA6A 4CY2A 3EI2B 1B9YA 3ZE0A 4YVDA 1T2XA 4ZOXA 2HU8A 4A2MA 3L4MD 3MKSB 3UVMA 2YMUA 3JB9L 3SBPA 4D6VA 3I7PA 2Q7QA 4E5ZA 3DXKC 4LGNA 3NIDA 4GQBB 4UI9R 2QC5A 2HESX 1O6GA 5TDHB 3EWEA 5HYNB 1YFQA 3IJ0A 4CI2A 5H14A 2CO0A 2XDWA 3UKRC 3ULEC 1TYQC 4QRJA 3AL8A 3PXWD 4NAAA 1R5MA 3MUOA 5GSAA 5B4WA 1Q47A 1VZ3A 3IJ1A 3OL2B 5M5VA 4GM9A 4J81A 4E54B 4PNKB 5I5IA 1QFMA 2EIEA 2B5MA 3ZWLB 1UOQA 4MK0B 3C9CA 3RSEC 4PSWB 4L3HD 4A11B 4G56B 3C75H 3I7HA 2IUVA 3E0CA 1L5GA 3QI0A 5SXMA 4CZYA 2VDRA 3UVKA 2J55H 3JROA 4A09A 2VZ1A 5CXBB 4O3UB 3RLMD 2H9NA 2YBAA 3MKQA 4J78A 4O1QD 3O4HA 2EIBA 3SBRA 3KRWB 5C2VB 2VC2A 5H17A 4X63B 5EM2B 3N0DA 4OZUA 2PBIB 4QT8A 1BPOA 3BG0A 2GC4A 4J0XA 4IRZA 4AN0A 4PBZA 2J56H 5IJ7E 1N6FA 4WK4A 3PE7A 2VDKA 5C92A 4A7JA 2B5LA 1UOPA 5AJAA 4E5ZB 4IA9A 4PXWA 1PI6A 1K32A 2YNPA 2Z2OA 3RFGA 4J82A 2PM7B 1I2MB 5M5TA 2HJ4A 5CYKA 3ORVD 3I7NA 4L1MA 2AGYA 2UZXB 4JHNA 2OJYA 3AL8B 3OW8A 4BCDA 3K26A 4CY5A 2OVQB 3CFSB 5FKRA 3O4GA 5FKSA 4CI3A 1NEXB 2B4EA 3F3FA 2I3SA 1SQJA 4JD2C 5I5MA 3IURA 3NVXA 4ZOZA 1JV2A 1B9XA 5E6SA 3K6SA 1UTCA 5AMSA 5FFOA 2I3TA 3EI3A 3SJLD 4NC4A 3MXXA 4ERZA 5C2WB 4X60B 3T3MA 2HKMA 3MZLA 1GG2B 4H5JA 5TEEA 3J80g 2H68A 1C9LA 4RE6A 4A09B 4AN1A 4ZOVA 4WK2A 4BP9A 3SLED 3IULA 5FKQA 4CY3A 2HJBA 5GXHA 2CO0C 2P9PC 3GD1I 3VI3A 4FAVD 2W18A 4FWWA 4QQEA 4XEIC 3UVNA 4J0WA 3IUNA 3I89A 2HU5A 3O4IA 2H6KA 1VZ2A 3K27A 1GP2B 2VDNA 3I7OA 1YR2A 3RMZD 5IGQA 2HYEA 4AX4A 1MDAH 3DDUA 3GC3B 3DXMC 4GQ2P 1QFSA 4L9OA 4CC9A 3DM0A 4J79A 5M61A 1OMWB 3AL9A 1H2XA 3EQ8A 5HDBA 1E8NA 3C5MA 3SWSD 4BUJC 5E6RA 4L1QD 5EAPA 4FA9D 4HDJA 4CZXA 4GQ1A 2XZGA 4LG8A 4Z7QA 3KCIA 2OVPB 4BH6A 1M1XA 4XYHA 4FA4D 3L4OD 3OKTA 4UM9A 2Z2NA 1A0RB 3SFZA 4CI1A 4Z7OA 5CYKB 4XYIA 5HE2B 2VDMA 3QHYB 1E8MA 5GXIA 3SCYA 1P22A 5EMKB 3MUNA 4ERYA 4LG9A 2YNNA 4I79A 4PBYA 3SHFA 3I7LA 5FA5B 4D9SA 4O02A 3BG1A 2IAAA 5IJ8E 3B7FA 3VGZA 1XKSA 5EAMA 1MG3A 4TZ4A 2HXCA 3DWLC 3ZE2A 1QNIA 3EI4A 3RFHA 3AFCA 3JRPA 4KFMB 1NR0A 5CXCA 2J57G 3EI3B 3A0FA 3CIKB 1TBGA 3IIWA 5AFU3 1U4CA 4EWRA 4K3JB 2YNOA 2OIZA 1L0QA 4A0AA 1RI6A 1JJUB 5EMMB 3OKWA 4FHLA 4AEZA 3EMHA 4PSXB 3IKOA 2IWKA 2OK6A 2I0SA 4Y7RA 3EI1A 1A12A 3SVWD 2IUQA 3K71A 4BL0A 3EQ7A 3F3GA 2OVRB 3J81g 2BBKH 1TYEA 4U7AA 2EICA 2VDOA 5EMLB 2IUPA 4BCCA 4G55A 3IJEA 3V5WB 1PEVA 2G99A 3FCSA 3SBQA 1XHMA 3IUMA 4J8BA 3ODTA 2O9KA 2VDPA 3VH0A 2VDLA 4JHPC 1XIPA 5HE1B 2MTAH 3I7KA 2GC7A 1JMZB 3SN6B 5FQDA 5H1MA 4D0KA 4JSVC 2WQ8A 3U4YA 2CE8A 4J77A 2PM6B 3IUJA 5IT9g 4JSPC 4A0BA 1S4UX 2P9NC 5THAA 2P9KC 3ZE1A 1GOGA 3EI4B 4MMXA 2QXVA 4GGDA 5CXCB 4AOWA 4R7AB 1SHYB 4FAND 4J86A 2XL3A 3OKYA 3HFQA 2AGXA 4Z7NA 5TEFA 4GM3A 3EU7A 3P4FA 2H6QA 4NENA 4A0AB 2UZYB 2TRCB 2H14A 4AMYA 3JZNA 4QAMA 1K3IA 2JKXA 4BCBA 2HKRA 1GOHA 3EI1B 1N6DA 3GFCA 3MMYA 5HQGA 4ES0A 3O4JA 3NVNA 4AMZA 3V4VA 5K19A 3PVUB 4K3ID 2H6NA 3FCUA 3IIYA 4GZ8A 3I2NA 4DNWA
chains in the Genus database with same CATH topology
4GM8A 4Z8LA 2AH1A 2CNXA 4J84A 3PSLA 5IC7A 5TF2A 2AH0A 2XU7A 1JOFA 4PC0A 4GGAA 2IURA 5I5JA 4JSXC 2GNQA 4ZOYA 4H5IA 4J73A 3I8EA 3SMRA 5FKTA 2H9PA 1MG2A 4N14A 2XYIA 4CZVA 4A08A 3MZKA 3I8CA 3AH8B 1U2VC 2CN2A 2OK4A 5GMKn 4A0BB 2H3XA 4FB1D 1OLZA 3JZHA 3FM0A 1FWXA 1ERJA 3FGBA 4OWRA 3BWSA 2P9SC 3V9FA 3C99A 3OKYB 3RN0D 4CI8A 2CN3A 3PVWB 3W15A 5EMJB 3F3PA 4U1EI 5A2Qg 2PM9A 4J87A 3PXSD 3IJCA 5C9ZB 3JAMg 2H13A 4L3GD 4JSNC 3CFVA 4Y5RD 4JT5C 2YB8B 1PBYB 2G9AA 4QL1A 3UVLA 5EARA 5IGOA 3EI2A 2AQ5A 2H9MA 2H9LA 2AGWA 2P9IC 2AGLA 2BCJB 3GREA 2CE9A 3EG6A 2H47A 3SXTD 1JMXB 1GXRA 4ESGA 1SQ9A 4O9DA 1VYHC 5HE3B 2I0TA 5EALA 4ZN4A 4JXMA 3NVQA 4J8GA 4FA5D 3JPXA 5FLXg 4CY1A 4NSXA 3OL2A 5K1CC 4E54A 3KRXB 3N0EA 3UR4A 4A08B 4JT6C 3RRMC 5FXYA 2P9UC 3RN1D 4A11A 1N6EA 3OTTA 4O3TB 2I0RA 4GMBA 4X61B 1PGUA 4IMMA 3JZGA 4A2LA 3DSMA 3PSCB 4FA1D 2AGZA 2XL2A 4X3EA 3PXTD 3FRXA 3UKUC 5CXBA 5KDOB 1GOTB 1K8KC 3UVOA 5HE0B 4ERQA 2B5NA 2IWFA 3V7DB 2PM9B 5JWZA 2P9LC 4GGCA 2Z2PA 2EBSA 5EM2A 4O45A 3VA6A 4CY2A 3EI2B 1B9YA 4YVDA 4ZOXA 4A2MA 3L4MD 3MKSB 3UVMA 2YMUA 3JB9L 3SBPA 4D6VA 3I7PA 2Q7QA 4E5ZA 3DXKC 4LGNA 4GQBB 4UI9R 2QC5A 2HESX 5TDHB 3EWEA 5HYNB 1YFQA 3IJ0A 4CI2A 5H14A 2CO0A 3UKRC 3ULEC 1TYQC 4QRJA 3AL8A 3PXWD 1R5MA 5GSAA 5B4WA 1Q47A 3IJ1A 3OL2B 4GM9A 4J81A 4E54B 4PNKB 5I5IA 2B5MA 3ZWLB 4MK0B 3C9CA 3RSEC 4PSWB 4L3HD 4A11B 4G56B 3C75H 3I7HA 2IUVA 3E0CA 5SXMA 4CZYA 3UVKA 2J55H 3JROA 4A09A 5CXBB 4O3UB 3RLMD 2H9NA 2YBAA 3MKQA 4J78A 4O1QD 3SBRA 3KRWB 5C2VB 5H17A 4X63B 5EM2B 3N0DA 4OZUA 2PBIB 4QT8A 3BG0A 4J0XA 2GC4A 4PBZA 2J56H 5IJ7E 1N6FA 3PE7A 4A7JA 2B5LA 5AJAA 4E5ZB 4IA9A 4PXWA 1PI6A 1K32A 2YNPA 2Z2OA 3RFGA 4J82A 2PM7B 2HJ4A 5CYKA 3ORVD 3I7NA 2AGYA 2UZXB 2OJYA 3AL8B 3OW8A 3K26A 4CY5A 2OVQB 3CFSB 5FKRA 5FKSA 4CI3A 1NEXB 2B4EA 3F3FA 2I3SA 1SQJA 4JD2C 5I5MA 3NVXA 4ZOZA 1B9XA 5AMSA 2I3TA 3EI3A 3SJLD 3MXXA 4ERZA 5C2WB 4X60B 2HKMA 3MZLA 1GG2B 4H5JA 5TEEA 3J80g 2H68A 4A09B 4ZOVA 3SLED 5FKQA 4CY3A 2HJBA 5GXHA 2CO0C 2P9PC 4FAVD 2W18A 4FWWA 4QQEA 4XEIC 3UVNA 4J0WA 3I89A 2H6KA 3K27A 5IGQA 1GP2B 3I7OA 3RMZD 2HYEA 1MDAH 4GQ2P 3DXMC 4L9OA 4CC9A 3DM0A 4J79A 1OMWB 3AL9A 3SWSD 3C5MA 4BUJC 4L1QD 5EAPA 4FA9D 4HDJA 4CZXA 4GQ1A 4LG8A 2OVPB 4BH6A 4XYHA 4FA4D 3L4OD 3OKTA 2Z2NA 1A0RB 3SFZA 4CI1A 5CYKB 4XYIA 5HE2B 5GXIA 3SCYA 1P22A 5EMKB 4ERYA 4LG9A 2YNNA 4I79A 4PBYA 3SHFA 3I7LA 5FA5B 3BG1A 2IAAA 5IJ8E 3B7FA 3VGZA 1XKSA 5EAMA 1MG3A 4TZ4A 2HXCA 3DWLC 1QNIA 3EI4A 3RFHA 3AFCA 4KFMB 3JRPA 1NR0A 5CXCA 2J57G 3EI3B 3A0FA 3CIKB 1TBGA 3IIWA 5AFU3 1U4CA 4EWRA 4K3JB 2YNOA 2OIZA 1L0QA 4A0AA 1RI6A 1JJUB 5EMMB 3OKWA 4FHLA 4AEZA 3EMHA 4PSXB 3IKOA 2IWKA 2OK6A 2I0SA 4Y7RA 3EI1A 3SVWD 2IUQA 4BL0A 3F3GA 2OVRB 3J81g 2BBKH 4U7AA 5EMLB 2IUPA 3V5WB 1PEVA 2G99A 3SBQA 1XHMA 4J8BA 3ODTA 2O9KA 3VH0A 1XIPA 5HE1B 2MTAH 3I7KA 2GC7A 1JMZB 3SN6B 5FQDA 5H1MA 4D0KA 4JSVC 3U4YA 2CE8A 4J77A 2PM6B 5IT9g 4JSPC 4A0BA 1S4UX 2P9NC 5THAA 2P9KC 3EI4B 2QXVA 4GGDA 5CXCB 4AOWA 4R7AB 1SHYB 4FAND 4J86A 2XL3A 3OKYA 3HFQA 2AGXA 5TEFA 4GM3A 3EU7A 3P4FA 2H6QA 4A0AB 2UZYB 2TRCB 2H14A 3JZNA 2HKRA 3EI1B 1N6DA 3GFCA 3MMYA 5HQGA 4ES0A 3NVNA 5K19A 3PVUB 4K3ID 2H6NA 3IIYA 4GZ8A 3I2NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GM8 A;  4Z8L A;  2AH1 A;  2CNX A;  4J84 A;  3PSL A;  5IC7 A;  5TF2 A;  2AH0 A;  2XU7 A;  1JOF A;  4PC0 A;  4GGA A;  2IUR A;  5I5J A;  4JSX C;  2GNQ A;  4ZOY A;  4H5I A;  4J73 A;  3I8E A;  3SMR A;  5FKT A;  2H9P A;  1MG2 A;  4N14 A;  2XYI A;  4CZV A;  4A08 A;  3MZK A;  3I8C A;  3AH8 B;  1U2V C;  2CN2 A;  2OK4 A;  5GMK n;  4A0B B;  2H3X A;  4FB1 D;  1OLZ A;  3JZH A;  3FM0 A;  1FWX A;  1ERJ A;  3FGB A;  4OWR A;  3BWS A;  2P9S C;  3V9F A;  3C99 A;  3OKY B;  3RN0 D;  4CI8 A;  2CN3 A;  3PVW B;  3W15 A;  5EMJ B;  3F3P A;  4U1E I;  5A2Q g;  2PM9 A;  4J87 A;  3PXS D;  3IJC A;  5C9Z B;  3JAM g;  2H13 A;  4L3G D;  4JSN C;  3CFV A;  4Y5R D;  4JT5 C;  2YB8 B;  1PBY B;  2G9A A;  4QL1 A;  3UVL A;  5EAR A;  5IGO A;  3EI2 A;  2AQ5 A;  2H9M A;  2H9L A;  2AGW A;  2P9I C;  2AGL A;  2BCJ B;  3GRE A;  2CE9 A;  3EG6 A;  2H47 A;  3SXT D;  1JMX B;  1GXR A;  4ESG A;  1SQ9 A;  4O9D A;  1VYH C;  5HE3 B;  2I0T A;  5EAL A;  4ZN4 A;  4JXM A;  3NVQ A;  4J8G A;  4FA5 D;  3JPX A;  5FLX g;  4CY1 A;  4NSX A;  3OL2 A;  5K1C C;  4E54 A;  3KRX B;  3N0E A;  3UR4 A;  4A08 B;  4JT6 C;  3RRM C;  5FXY A;  2P9U C;  3RN1 D;  4A11 A;  1N6E A;  3OTT A;  4O3T B;  2I0R A;  4GMB A;  4X61 B;  1PGU A;  4IMM A;  3JZG A;  4A2L A;  3DSM A;  3PSC B;  4FA1 D;  2AGZ A;  2XL2 A;  4X3E A;  3PXT D;  3FRX A;  3UKU C;  5CXB A;  5KDO B;  1GOT B;  1K8K C;  3UVO A;  5HE0 B;  4ERQ A;  2B5N A;  2IWF A;  3V7D B;  2PM9 B;  5JWZ A;  2P9L C;  4GGC A;  2Z2P A;  2EBS A;  5EM2 A;  4O45 A;  3VA6 A;  4CY2 A;  3EI2 B;  1B9Y A;  4YVD A;  4ZOX A;  4A2M A;  3L4M D;  3MKS B;  3UVM A;  2YMU A;  3JB9 L;  3SBP A;  4D6V A;  3I7P A;  2Q7Q A;  4E5Z A;  3DXK C;  4LGN A;  4GQB B;  4UI9 R;  2QC5 A;  2HES X;  5TDH B;  3EWE A;  5HYN B;  1YFQ A;  3IJ0 A;  4CI2 A;  5H14 A;  2CO0 A;  3UKR C;  3ULE C;  1TYQ C;  4QRJ A;  3AL8 A;  3PXW D;  1R5M A;  5GSA A;  5B4W A;  1Q47 A;  3IJ1 A;  3OL2 B;  4GM9 A;  4J81 A;  4E54 B;  4PNK B;  5I5I A;  2B5M A;  3ZWL B;  4MK0 B;  3C9C A;  3RSE C;  4PSW B;  4L3H D;  4A11 B;  4G56 B;  3C75 H;  3I7H A;  2IUV A;  3E0C A;  5SXM A;  4CZY A;  3UVK A;  2J55 H;  3JRO A;  4A09 A;  5CXB B;  4O3U B;  3RLM D;  2H9N A;  2YBA A;  3MKQ A;  4J78 A;  4O1Q D;  3SBR A;  3KRW B;  5C2V B;  5H17 A;  4X63 B;  5EM2 B;  3N0D A;  4OZU A;  2PBI B;  4QT8 A;  3BG0 A;  4J0X A;  2GC4 A;  4PBZ A;  2J56 H;  5IJ7 E;  1N6F A;  3PE7 A;  4A7J A;  2B5L A;  5AJA A;  4E5Z B;  4IA9 A;  4PXW A;  1PI6 A;  1K32 A;  2YNP A;  2Z2O A;  3RFG A;  4J82 A;  2PM7 B;  2HJ4 A;  5CYK A;  3ORV D;  3I7N A;  2AGY A;  2UZX B;  2OJY A;  3AL8 B;  3OW8 A;  3K26 A;  4CY5 A;  2OVQ B;  3CFS B;  5FKR A;  5FKS A;  4CI3 A;  1NEX B;  2B4E A;  3F3F A;  2I3S A;  1SQJ A;  4JD2 C;  5I5M A;  3NVX A;  4ZOZ A;  1B9X A;  5AMS A;  2I3T A;  3EI3 A;  3SJL D;  3MXX A;  4ERZ A;  5C2W B;  4X60 B;  2HKM A;  3MZL A;  1GG2 B;  4H5J A;  5TEE A;  3J80 g;  2H68 A;  4A09 B;  4ZOV A;  3SLE D;  5FKQ A;  4CY3 A;  2HJB A;  5GXH A;  2CO0 C;  2P9P C;  4FAV D;  2W18 A;  4FWW A;  4QQE A;  4XEI C;  3UVN A;  4J0W A;  3I89 A;  2H6K A;  3K27 A;  5IGQ A;  1GP2 B;  3I7O A;  3RMZ D;  2HYE A;  1MDA H;  4GQ2 P;  3DXM C;  4L9O A;  4CC9 A;  3DM0 A;  4J79 A;  1OMW B;  3AL9 A;  3SWS D;  3C5M A;  4BUJ C;  4L1Q D;  5EAP A;  4FA9 D;  4HDJ A;  4CZX A;  4GQ1 A;  4LG8 A;  2OVP B;  4BH6 A;  4XYH A;  4FA4 D;  3L4O D;  3OKT A;  2Z2N A;  1A0R B;  3SFZ A;  4CI1 A;  5CYK B;  4XYI A;  5HE2 B;  5GXI A;  3SCY A;  1P22 A;  5EMK B;  4ERY A;  4LG9 A;  2YNN A;  4I79 A;  4PBY A;  3SHF A;  3I7L A;  5FA5 B;  3BG1 A;  2IAA A;  5IJ8 E;  3B7F A;  3VGZ A;  1XKS A;  5EAM A;  1MG3 A;  4TZ4 A;  2HXC A;  3DWL C;  1QNI A;  3EI4 A;  3RFH A;  3AFC A;  4KFM B;  3JRP A;  1NR0 A;  5CXC A;  2J57 G;  3EI3 B;  3A0F A;  3CIK B;  1TBG A;  3IIW A;  5AFU 3;  1U4C A;  4EWR A;  4K3J B;  2YNO A;  2OIZ A;  1L0Q A;  4A0A A;  1RI6 A;  1JJU B;  5EMM B;  3OKW A;  4FHL A;  4AEZ A;  3EMH A;  4PSX B;  3IKO A;  2IWK A;  2OK6 A;  2I0S A;  4Y7R A;  3EI1 A;  3SVW D;  2IUQ A;  4BL0 A;  3F3G A;  2OVR B;  3J81 g;  2BBK H;  4U7A A;  5EML B;  2IUP A;  3V5W B;  1PEV A;  2G99 A;  3SBQ A;  1XHM A;  4J8B A;  3ODT A;  2O9K A;  3VH0 A;  1XIP A;  5HE1 B;  2MTA H;  3I7K A;  2GC7 A;  1JMZ B;  3SN6 B;  5FQD A;  5H1M A;  4D0K A;  4JSV C;  3U4Y A;  2CE8 A;  4J77 A;  2PM6 B;  5IT9 g;  4JSP C;  4A0B A;  1S4U X;  2P9N C;  5THA A;  2P9K C;  3EI4 B;  2QXV A;  4GGD A;  5CXC B;  4AOW A;  4R7A B;  1SHY B;  4FAN D;  4J86 A;  2XL3 A;  3OKY A;  3HFQ A;  2AGX A;  5TEF A;  4GM3 A;  3EU7 A;  3P4F A;  2H6Q A;  4A0A B;  2UZY B;  2TRC B;  2H14 A;  3JZN A;  2HKR A;  3EI1 B;  1N6D A;  3GFC A;  3MMY A;  5HQG A;  4ES0 A;  3NVN A;  5K19 A;  3PVU B;  4K3I D;  2H6N A;  3IIY A;  4GZ8 A;  3I2N A; 
#chains in the Genus database with same CATH topology
 3IVM A;  4GM8 A;  4Z8L A;  2AH1 A;  2CNX A;  4J84 A;  4G1E A;  2XE4 A;  3PSL A;  5IC7 A;  1H2Z A;  5TF2 A;  2AH0 A;  2XU7 A;  1JOF A;  4PC0 A;  4GGA A;  2IUR A;  5I5J A;  1JTD B;  4JSX C;  2GNQ A;  4ZOY A;  4H5I A;  2EID A;  4J73 A;  3I8E A;  3SMR A;  5FKT A;  2H9P A;  1MG2 A;  4MMZ A;  4N14 A;  2XYI A;  4CZV A;  4NBM A;  4A08 A;  3MZK A;  3I8C A;  1O6F A;  3AH8 B;  1U2V C;  2CN2 A;  2OK4 A;  4RE5 A;  5GMK n;  4A0B B;  2H3X A;  1U8C A;  4FB1 D;  1OLZ A;  3JZH A;  3FM0 A;  1FWX A;  5M5U A;  1UOO A;  1ERJ A;  3VI4 A;  4DNU A;  3FGB A;  3ZDY A;  4OWR A;  3BWS A;  2P9S C;  3V9F A;  3C99 A;  3OKY B;  1VE6 A;  3RN0 D;  4CI8 A;  2CN3 A;  3PVW B;  3W15 A;  5EMJ B;  3F3P A;  4U1E I;  5A2Q g;  4O2W A;  2PM9 A;  4J87 A;  3PXS D;  3IJC A;  5C9Z B;  3IUQ A;  3JAM g;  2H13 A;  1H2W A;  4L3G D;  4JSN C;  3CFV A;  4Y5R D;  4JT5 C;  2YB8 B;  1PBY B;  2G9A A;  3NIG A;  4QL1 A;  3UVL A;  5EAR A;  5IGO A;  3ZDZ A;  2AQ5 A;  2H9M A;  3EI2 A;  2H9L A;  2AGW A;  2P9I C;  2AGL A;  2BCJ B;  3OF7 A;  3GRE A;  1C9I A;  2QZP A;  3K72 A;  2VDQ A;  2CE9 A;  3EG6 A;  2H47 A;  3SXT D;  1JMX B;  1GXR A;  4ESG A;  2HU7 A;  1SQ9 A;  2QR5 A;  3ZDX A;  4O9D A;  1H2Y A;  1VYH C;  5HE3 B;  2I0T A;  5EAL A;  5M5S A;  4ZN4 A;  4JXM A;  3EQ9 A;  4DNV A;  4G1M A;  3NVQ A;  4J8G A;  4FA5 D;  3JPX A;  5FFG A;  3T3P A;  5FLX g;  4WJK A;  4CY1 A;  4NSX A;  3OL2 A;  4MMY A;  5K1C C;  4E54 A;  1E5T A;  3KRX B;  3N0E A;  3UR4 A;  4A08 B;  1GOF A;  4JT6 C;  3RRM C;  5FXY A;  2VZ3 A;  2P9U C;  3RN1 D;  4A11 A;  5E6U A;  1N6E A;  1VE7 A;  3OTT A;  4O3T B;  2I0R A;  4GMB A;  4X61 B;  1PGU A;  4IMM A;  3JZG A;  3NIF A;  5M5R A;  4A2L A;  3DSM A;  3PSC B;  4FA1 D;  2AGZ A;  2XL2 A;  4X3E A;  3PXT D;  3MVD K;  3FRX A;  3UKU C;  5CXB A;  5KDO B;  1GOT B;  1K8K C;  3UVO A;  5C86 A;  2BKL A;  5HE0 B;  4ERQ A;  2B5N A;  4UM8 A;  2IWF A;  3V7D B;  2PM9 B;  5JWZ A;  4WK0 A;  2P9L C;  4GGC A;  2Z2P A;  2EBS A;  3V4P A;  5EM2 A;  4O45 A;  4BP8 A;  3VA6 A;  4CY2 A;  3EI2 B;  1B9Y A;  3ZE0 A;  4YVD A;  1T2X A;  4ZOX A;  2HU8 A;  4A2M A;  3L4M D;  3MKS B;  3UVM A;  2YMU A;  3JB9 L;  3SBP A;  4D6V A;  3I7P A;  2Q7Q A;  4E5Z A;  3DXK C;  4LGN A;  3NID A;  4GQB B;  4UI9 R;  2QC5 A;  2HES X;  1O6G A;  5TDH B;  3EWE A;  5HYN B;  1YFQ A;  3IJ0 A;  4CI2 A;  5H14 A;  2CO0 A;  2XDW A;  3UKR C;  3ULE C;  1TYQ C;  4QRJ A;  3AL8 A;  3PXW D;  4NAA A;  1R5M A;  3MUO A;  5GSA A;  5B4W A;  1Q47 A;  1VZ3 A;  3IJ1 A;  3OL2 B;  5M5V A;  4GM9 A;  4J81 A;  4E54 B;  4PNK B;  5I5I A;  1QFM A;  2EIE A;  2B5M A;  3ZWL B;  1UOQ A;  4MK0 B;  3C9C A;  3RSE C;  4PSW B;  4L3H D;  4A11 B;  4G56 B;  3C75 H;  3I7H A;  2IUV A;  3E0C A;  1L5G A;  3QI0 A;  5SXM A;  4CZY A;  2VDR A;  3UVK A;  2J55 H;  3JRO A;  4A09 A;  2VZ1 A;  5CXB B;  4O3U B;  3RLM D;  2H9N A;  2YBA A;  3MKQ A;  4J78 A;  4O1Q D;  3O4H A;  2EIB A;  3SBR A;  3KRW B;  5C2V B;  2VC2 A;  5H17 A;  4X63 B;  5EM2 B;  3N0D A;  4OZU A;  2PBI B;  4QT8 A;  1BPO A;  3BG0 A;  2GC4 A;  4J0X A;  4IRZ A;  4AN0 A;  4PBZ A;  2J56 H;  5IJ7 E;  1N6F A;  4WK4 A;  3PE7 A;  2VDK A;  5C92 A;  4A7J A;  2B5L A;  1UOP A;  5AJA A;  4E5Z B;  4IA9 A;  4PXW A;  1PI6 A;  1K32 A;  2YNP A;  2Z2O A;  3RFG A;  4J82 A;  2PM7 B;  1I2M B;  5M5T A;  2HJ4 A;  5CYK A;  3ORV D;  3I7N A;  4L1M A;  2AGY A;  2UZX B;  4JHN A;  2OJY A;  3AL8 B;  3OW8 A;  4BCD A;  3K26 A;  4CY5 A;  2OVQ B;  3CFS B;  5FKR A;  3O4G A;  5FKS A;  4CI3 A;  1NEX B;  2B4E A;  3F3F A;  2I3S A;  1SQJ A;  4JD2 C;  5I5M A;  3IUR A;  3NVX A;  4ZOZ A;  1JV2 A;  1B9X A;  5E6S A;  3K6S A;  1UTC A;  5AMS A;  5FFO A;  2I3T A;  3EI3 A;  3SJL D;  4NC4 A;  3MXX A;  4ERZ A;  5C2W B;  4X60 B;  3T3M A;  2HKM A;  3MZL A;  1GG2 B;  4H5J A;  5TEE A;  3J80 g;  2H68 A;  1C9L A;  4RE6 A;  4A09 B;  4AN1 A;  4ZOV A;  4WK2 A;  4BP9 A;  3SLE D;  3IUL A;  5FKQ A;  4CY3 A;  2HJB A;  5GXH A;  2CO0 C;  2P9P C;  3GD1 I;  3VI3 A;  4FAV D;  2W18 A;  4FWW A;  4QQE A;  4XEI C;  3UVN A;  4J0W A;  3IUN A;  3I89 A;  2HU5 A;  3O4I A;  2H6K A;  1VZ2 A;  3K27 A;  1GP2 B;  2VDN A;  3I7O A;  1YR2 A;  3RMZ D;  5IGQ A;  2HYE A;  4AX4 A;  1MDA H;  3DDU A;  3GC3 B;  3DXM C;  4GQ2 P;  1QFS A;  4L9O A;  4CC9 A;  3DM0 A;  4J79 A;  5M61 A;  1OMW B;  3AL9 A;  1H2X A;  3EQ8 A;  5HDB A;  1E8N A;  3C5M A;  3SWS D;  4BUJ C;  5E6R A;  4L1Q D;  5EAP A;  4FA9 D;  4HDJ A;  4CZX A;  4GQ1 A;  2XZG A;  4LG8 A;  4Z7Q A;  3KCI A;  2OVP B;  4BH6 A;  1M1X A;  4XYH A;  4FA4 D;  3L4O D;  3OKT A;  4UM9 A;  2Z2N A;  1A0R B;  3SFZ A;  4CI1 A;  4Z7O A;  5CYK B;  4XYI A;  5HE2 B;  2VDM A;  3QHY B;  1E8M A;  5GXI A;  3SCY A;  1P22 A;  5EMK B;  3MUN A;  4ERY A;  4LG9 A;  2YNN A;  4I79 A;  4PBY A;  3SHF A;  3I7L A;  5FA5 B;  4D9S A;  4O02 A;  3BG1 A;  2IAA A;  5IJ8 E;  3B7F A;  3VGZ A;  1XKS A;  5EAM A;  1MG3 A;  4TZ4 A;  2HXC A;  3DWL C;  3ZE2 A;  1QNI A;  3EI4 A;  3RFH A;  3AFC A;  3JRP A;  4KFM B;  1NR0 A;  5CXC A;  2J57 G;  3EI3 B;  3A0F A;  3CIK B;  1TBG A;  3IIW A;  5AFU 3;  1U4C A;  4EWR A;  4K3J B;  2YNO A;  2OIZ A;  1L0Q A;  4A0A A;  1RI6 A;  1JJU B;  5EMM B;  3OKW A;  4FHL A;  4AEZ A;  3EMH A;  4PSX B;  3IKO A;  2IWK A;  2OK6 A;  2I0S A;  4Y7R A;  3EI1 A;  1A12 A;  3SVW D;  2IUQ A;  3K71 A;  4BL0 A;  3EQ7 A;  3F3G A;  2OVR B;  3J81 g;  2BBK H;  1TYE A;  4U7A A;  2EIC A;  2VDO A;  5EML B;  2IUP A;  4BCC A;  4G55 A;  3IJE A;  3V5W B;  1PEV A;  2G99 A;  3FCS A;  3SBQ A;  1XHM A;  3IUM A;  4J8B A;  3ODT A;  2O9K A;  2VDP A;  3VH0 A;  2VDL A;  4JHP C;  1XIP A;  5HE1 B;  2MTA H;  3I7K A;  2GC7 A;  1JMZ B;  3SN6 B;  5FQD A;  5H1M A;  4D0K A;  4JSV C;  2WQ8 A;  3U4Y A;  2CE8 A;  4J77 A;  2PM6 B;  3IUJ A;  5IT9 g;  4JSP C;  4A0B A;  1S4U X;  2P9N C;  5THA A;  2P9K C;  3ZE1 A;  1GOG A;  3EI4 B;  4MMX A;  2QXV A;  4GGD A;  5CXC B;  4AOW A;  4R7A B;  1SHY B;  4FAN D;  4J86 A;  2XL3 A;  3OKY A;  3HFQ A;  2AGX A;  4Z7N A;  5TEF A;  4GM3 A;  3EU7 A;  3P4F A;  2H6Q A;  4NEN A;  4A0A B;  2UZY B;  2TRC B;  2H14 A;  4AMY A;  3JZN A;  4QAM A;  1K3I A;  2JKX A;  4BCB A;  2HKR A;  1GOH A;  3EI1 B;  1N6D A;  3GFC A;  3MMY A;  5HQG A;  4ES0 A;  3O4J A;  3NVN A;  4AMZ A;  3V4V A;  5K19 A;  3PVU B;  4K3I D;  2H6N A;  3FCU A;  3IIY A;  4GZ8 A;  3I2N A;  4DNW A; 
#chains in the Genus database with same CATH homology
 4GM8 A;  4Z8L A;  2AH1 A;  2CNX A;  4J84 A;  3PSL A;  5IC7 A;  5TF2 A;  2AH0 A;  2XU7 A;  1JOF A;  4PC0 A;  4GGA A;  2IUR A;  5I5J A;  4JSX C;  2GNQ A;  4ZOY A;  4H5I A;  4J73 A;  3I8E A;  3SMR A;  5FKT A;  2H9P A;  1MG2 A;  4N14 A;  2XYI A;  4CZV A;  4A08 A;  3MZK A;  3I8C A;  3AH8 B;  1U2V C;  2CN2 A;  2OK4 A;  5GMK n;  4A0B B;  2H3X A;  4FB1 D;  1OLZ A;  3JZH A;  3FM0 A;  1FWX A;  1ERJ A;  3FGB A;  4OWR A;  3BWS A;  2P9S C;  3V9F A;  3C99 A;  3OKY B;  3RN0 D;  4CI8 A;  2CN3 A;  3PVW B;  3W15 A;  5EMJ B;  3F3P A;  4U1E I;  5A2Q g;  2PM9 A;  4J87 A;  3PXS D;  3IJC A;  5C9Z B;  3JAM g;  2H13 A;  4L3G D;  4JSN C;  3CFV A;  4Y5R D;  4JT5 C;  2YB8 B;  1PBY B;  2G9A A;  4QL1 A;  3UVL A;  5EAR A;  5IGO A;  3EI2 A;  2AQ5 A;  2H9M A;  2H9L A;  2AGW A;  2P9I C;  2AGL A;  2BCJ B;  3GRE A;  2CE9 A;  3EG6 A;  2H47 A;  3SXT D;  1JMX B;  1GXR A;  4ESG A;  1SQ9 A;  4O9D A;  1VYH C;  5HE3 B;  2I0T A;  5EAL A;  4ZN4 A;  4JXM A;  3NVQ A;  4J8G A;  4FA5 D;  3JPX A;  5FLX g;  4CY1 A;  4NSX A;  3OL2 A;  5K1C C;  4E54 A;  3KRX B;  3N0E A;  3UR4 A;  4A08 B;  4JT6 C;  3RRM C;  5FXY A;  2P9U C;  3RN1 D;  4A11 A;  1N6E A;  3OTT A;  4O3T B;  2I0R A;  4GMB A;  4X61 B;  1PGU A;  4IMM A;  3JZG A;  4A2L A;  3DSM A;  3PSC B;  4FA1 D;  2AGZ A;  2XL2 A;  4X3E A;  3PXT D;  3FRX A;  3UKU C;  5CXB A;  5KDO B;  1GOT B;  1K8K C;  3UVO A;  5HE0 B;  4ERQ A;  2B5N A;  2IWF A;  3V7D B;  2PM9 B;  5JWZ A;  2P9L C;  4GGC A;  2Z2P A;  2EBS A;  5EM2 A;  4O45 A;  3VA6 A;  4CY2 A;  3EI2 B;  1B9Y A;  4YVD A;  4ZOX A;  4A2M A;  3L4M D;  3MKS B;  3UVM A;  2YMU A;  3JB9 L;  3SBP A;  4D6V A;  3I7P A;  2Q7Q A;  4E5Z A;  3DXK C;  4LGN A;  4GQB B;  4UI9 R;  2QC5 A;  2HES X;  5TDH B;  3EWE A;  5HYN B;  1YFQ A;  3IJ0 A;  4CI2 A;  5H14 A;  2CO0 A;  3UKR C;  3ULE C;  1TYQ C;  4QRJ A;  3AL8 A;  3PXW D;  1R5M A;  5GSA A;  5B4W A;  1Q47 A;  3IJ1 A;  3OL2 B;  4GM9 A;  4J81 A;  4E54 B;  4PNK B;  5I5I A;  2B5M A;  3ZWL B;  4MK0 B;  3C9C A;  3RSE C;  4PSW B;  4L3H D;  4A11 B;  4G56 B;  3C75 H;  3I7H A;  2IUV A;  3E0C A;  5SXM A;  4CZY A;  3UVK A;  2J55 H;  3JRO A;  4A09 A;  5CXB B;  4O3U B;  3RLM D;  2H9N A;  2YBA A;  3MKQ A;  4J78 A;  4O1Q D;  3SBR A;  3KRW B;  5C2V B;  5H17 A;  4X63 B;  5EM2 B;  3N0D A;  4OZU A;  2PBI B;  4QT8 A;  3BG0 A;  4J0X A;  2GC4 A;  4PBZ A;  2J56 H;  5IJ7 E;  1N6F A;  3PE7 A;  4A7J A;  2B5L A;  5AJA A;  4E5Z B;  4IA9 A;  4PXW A;  1PI6 A;  1K32 A;  2YNP A;  2Z2O A;  3RFG A;  4J82 A;  2PM7 B;  2HJ4 A;  5CYK A;  3ORV D;  3I7N A;  2AGY A;  2UZX B;  2OJY A;  3AL8 B;  3OW8 A;  3K26 A;  4CY5 A;  2OVQ B;  3CFS B;  5FKR A;  5FKS A;  4CI3 A;  1NEX B;  2B4E A;  3F3F A;  2I3S A;  1SQJ A;  4JD2 C;  5I5M A;  3NVX A;  4ZOZ A;  1B9X A;  5AMS A;  2I3T A;  3EI3 A;  3SJL D;  3MXX A;  4ERZ A;  5C2W B;  4X60 B;  2HKM A;  3MZL A;  1GG2 B;  4H5J A;  5TEE A;  3J80 g;  2H68 A;  4A09 B;  4ZOV A;  3SLE D;  5FKQ A;  4CY3 A;  2HJB A;  5GXH A;  2CO0 C;  2P9P C;  4FAV D;  2W18 A;  4FWW A;  4QQE A;  4XEI C;  3UVN A;  4J0W A;  3I89 A;  2H6K A;  3K27 A;  5IGQ A;  1GP2 B;  3I7O A;  3RMZ D;  2HYE A;  1MDA H;  4GQ2 P;  3DXM C;  4L9O A;  4CC9 A;  3DM0 A;  4J79 A;  1OMW B;  3AL9 A;  3SWS D;  3C5M A;  4BUJ C;  4L1Q D;  5EAP A;  4FA9 D;  4HDJ A;  4CZX A;  4GQ1 A;  4LG8 A;  2OVP B;  4BH6 A;  4XYH A;  4FA4 D;  3L4O D;  3OKT A;  2Z2N A;  1A0R B;  3SFZ A;  4CI1 A;  5CYK B;  4XYI A;  5HE2 B;  5GXI A;  3SCY A;  1P22 A;  5EMK B;  4ERY A;  4LG9 A;  2YNN A;  4I79 A;  4PBY A;  3SHF A;  3I7L A;  5FA5 B;  3BG1 A;  2IAA A;  5IJ8 E;  3B7F A;  3VGZ A;  1XKS A;  5EAM A;  1MG3 A;  4TZ4 A;  2HXC A;  3DWL C;  1QNI A;  3EI4 A;  3RFH A;  3AFC A;  4KFM B;  3JRP A;  1NR0 A;  5CXC A;  2J57 G;  3EI3 B;  3A0F A;  3CIK B;  1TBG A;  3IIW A;  5AFU 3;  1U4C A;  4EWR A;  4K3J B;  2YNO A;  2OIZ A;  1L0Q A;  4A0A A;  1RI6 A;  1JJU B;  5EMM B;  3OKW A;  4FHL A;  4AEZ A;  3EMH A;  4PSX B;  3IKO A;  2IWK A;  2OK6 A;  2I0S A;  4Y7R A;  3EI1 A;  3SVW D;  2IUQ A;  4BL0 A;  3F3G A;  2OVR B;  3J81 g;  2BBK H;  4U7A A;  5EML B;  2IUP A;  3V5W B;  1PEV A;  2G99 A;  3SBQ A;  1XHM A;  4J8B A;  3ODT A;  2O9K A;  3VH0 A;  1XIP A;  5HE1 B;  2MTA H;  3I7K A;  2GC7 A;  1JMZ B;  3SN6 B;  5FQD A;  5H1M A;  4D0K A;  4JSV C;  3U4Y A;  2CE8 A;  4J77 A;  2PM6 B;  5IT9 g;  4JSP C;  4A0B A;  1S4U X;  2P9N C;  5THA A;  2P9K C;  3EI4 B;  2QXV A;  4GGD A;  5CXC B;  4AOW A;  4R7A B;  1SHY B;  4FAN D;  4J86 A;  2XL3 A;  3OKY A;  3HFQ A;  2AGX A;  5TEF A;  4GM3 A;  3EU7 A;  3P4F A;  2H6Q A;  4A0A B;  2UZY B;  2TRC B;  2H14 A;  3JZN A;  2HKR A;  3EI1 B;  1N6D A;  3GFC A;  3MMY A;  5HQG A;  4ES0 A;  3NVN A;  5K19 A;  3PVU B;  4K3I D;  2H6N A;  3IIY A;  4GZ8 A;  3I2N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...