4GGAA

Structural analysis of human cdc20 supports multi-site degron recognition by apc/c
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
314
structure length
314
Chain Sequence
CRYIPSLPDRILDAPEIRNDYYLNLVDWSSGNVLAVALDNSVYLWSASSGDILQLLQMEQPGEYISSVAWIKEGNYLAVGTSSAEVQLWDVQQQKRLRNMTSHSARVGSLSWNSYILSSGSRSGHIHHHDVRVAEHHVATLSGHSQEVCGLRWAPDGRHLASGGNDNLVNVWPSAPGEGGWVPLQTFTQHQGAVKAVAWCPWQSNVLATGGGTSDRHIRIWNVCSGACLSAVDAHSQVCSILWSPHYKELISGHGFAQNQLVIWKYPTMAKVAELKGHTSRVLSLTMSPDGATVASAAADETLRLWRCFELDPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division cycle protein 20 homolog
publication title Structural analysis of human Cdc20 supports multisite degron recognition by APC/C.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 76
structure length 314
sequence length 314
ec nomenclature
pdb deposition date 2012-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
A PF12894 ANAPC4_WD40 Anaphase-promoting complex subunit 4 WD40 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4ggaA00
3BG0A 3KRWB 4G56B 4FWWA 4PSWB 3EWEA 3MKQA 2H68A 5I5IA 3I8EA 4A09A 5CYKB 3SMRA 4CY1A 4CI1A 2I3SA 4A08B 2AGLA 3EI1A 1JMZB 2H47A 4AEZA 1K8KC 2IAAA 5SXMA 4ERQA 5EM2B 3AL8A 3PSLA 1SQJA 1L0QA 3RFGA 3K26A 4U1EI 3IIYA 4ZN4A 2J57G 3ZWLB 5EM2A 3V7DB 2AQ5A 1VYHC 2OJYA 4CY3A 4X60B 3UVLA 3U4YA 3MXXA 3AH8B 3EU7A 3EI2B 2CO0C 2H3XA 2HKMA 2GNQA 4GZ8A 3I89A 3EMHA 3I8CA 3SJLD 2Z2PA 1OLZA 2H6KA 3DM0A 3F3GA 4A7JA 3I7OA 4GM3A 4JSXC 5IT9g 3E0CA 5IJ7E 5GMKn 4JT5C 4ZOYA 2YNPA 4ERYA 3I7HA 3EI3B 3PVUB 1SQ9A 4H5JA 4D0KA 2XL2A 3PE7A 3RN1D 3EI4A 5FA5B 3B7FA 3SHFA 4E54B 4A0AB 3VH0A 1K32A 5GSAA 2PM7B 4IMMA 2G9AA 3EI3A 1XIPA 3UR4A 3SLED 2GC7A 1GG2B 5TEFA 4PC0A 2PBIB 4E54A 2IUPA 4A0AA 3VGZA 3NVNA 5H14A 3AL9A 2Z2OA 5JWZA 5IC7A 2IWKA 1ERJA 4J79A 5EAMA 5K1CC 3UVNA 2B5LA 5GXIA 4N14A 3FRXA 3RFHA 3JZGA 4K3ID 2HJBA 4CI2A 5C9ZB 4L9OA 5EMMB 3DWLC 3I7NA 2AGZA 4LG8A 3JZHA 1NEXB 3DXMC 2H13A 3PXSD 3SBRA 2H6QA 2PM6B 3I7PA 4J78A 1GP2B 3JZNA 4O9DA 2CO0A 4ES0A 4CY5A 5EMKB 2H9PA 1QNIA 4I79A 4J77A 1GXRA 3PXTD 5FKRA 3MMYA 4PSXB 5I5MA 5FLXg 1JJUB 3P4FA 4QL1A 5I5JA 5CYKA 2YNNA 4E5ZB 4OZUA 3PXWD 4J82A 4A08A 2CE9A 4GQBB 4A11B 2OVPB 4FA5D 2I0TA 3NVQA 4O1QD 5CXCB 3BG1A 4H5IA 3I7KA 3OKYB 3EG6A 3DXKC 3ORVD 4FHLA 3L4MD 2OK4A 4J86A 4AOWA 2OVQB 3IJ1A 4PBZA 2I3TA 3CIKB 4IA9A 5FXYA 5EAPA 4JXMA 1JMXB 2J56H 1GOTB 4J8GA 5IGOA 2OVRB 3EI2A 4X3EA 2P9KC 4GQ2P 2CN3A 5HYNB 2AH1A 3W15A 5HE0B 2QXVA 1YFQA 4TZ4A 4CZXA 5CXBB 1U4CA 4PXWA 4GMBA 3C9CA 4GGAA 3I7LA 2AGXA 4JSPC 3MKSB 3N0DA 2HYEA 2P9UC 2P9SC 4FAVD 3CFSB 3CFVA 5THAA 3SFZA 3K27A 2IUVA 4ESGA 4QT8A 2XU7A 3ULEC 4FA1D 2XYIA 1MDAH 3PSCB 2IURA 1JOFA 3OKTA 3UVKA 4L3HD 4XEIC 5GXHA 3RSEC 4FA9D 2IUQA 2BCJB 3L4OD 5KDOB 2CE8A 4FB1D 4FAND 2EBSA 3BWSA 5HE3B 4EWRA 3AFCA 1PBYB 3JRPA 4X63B 3ODTA 2HESX 5HQGA 3GREA 1A0RB 1N6DA 4J0XA 1PEVA 4GGDA 5TDHB 2J55H 3OW8A 2H14A 3C75H 2HXCA 2H9LA 4A2LA 4A0BB 5H17A 4BL0A 4GQ1A 2HJ4A 3JROA 2PM9B 3JB9L 4J73A 3UVOA 4NSXA 4CI3A 4L3GD 2UZYB 4JD2C 3SN6B 2IWFA 4UI9R 5TF2A 5FKSA 4ERZA 3N0EA 2O9KA 5FKQA 4ZOZA 1PI6A 3C5MA 2B5NA 2Q7QA 4A09B 2YB8B 2TRCB 3RRMC 2I0RA 4CI8A 2BBKH 3J81g 2Z2NA 2OK6A 2B4EA 2YBAA 1MG3A 3SBPA 5FKTA 3EI1B 4XYIA 3FM0A 3A0FA 3V9FA 3V5WB 4K3JB 2MTAH 3AL8B 3UKUC 1MG2A 5C2WB 3UKRC 4FA4D 3MZLA 5C2VB 4L1QD 4E5ZA 4U7AA 4Y5RD 4A11A 4JSVC 5CXCA 3OKYA 4CZYA 5AMSA 1TYQC 4LGNA 3IJCA 2XL3A 4D6VA 4ZOXA 1SHYB 2P9LC 3FGBA 4O45A 4J81A 2AGWA 3SXTD 1RI6A 1N6EA 5EMJB 4J87A 3IJ0A 4J0WA 4OWRA 1FWXA 1XHMA 3KRXB 1Q47A 3F3PA 5FQDA 1U2VC 4BH6A 3IIWA 1NR0A 4GGCA 5B4WA 4Y7RA 4JSNC 2GC4A 4J8BA 1N6FA 5IGQA 4KFMB 2P9PC 3IKOA 4CZVA 3JPXA 5CXBA 3EI4B 2AGYA 2UZXB 3F3FA 1S4UX 4ZOVA 3RLMD 3J80g 2B5MA 5EALA 3MZKA 4X61B 5EMLB 2AH0A 5IJ8E 5HE2B 3I2NA 5TEEA 5AJAA 1B9YA 2G99A 4JT6C 4XYHA 5HE1B 1R5MA 4PNKB 4CY2A 1TBGA 5A2Qg 2W18A 2YMUA 2H9NA 3PVWB 3VA6A 4YVDA 1XKSA 3GFCA 3SBQA 3SWSD 4LG9A 5AFU3 2H6NA 4O3TB 3DSMA 4GM9A 3OL2B 3OTTA 5K19A 4J84A 3OKWA 4MK0B 3SVWD 4QRJA 4GM8A 2QC5A 3OL2A 2I0SA 3RMZD 4A0BA 2HKRA 3JAMg 2H9MA 2PM9A 3UVMA 4PBYA 4R7AB 2CNXA 2OIZA 3SCYA 4CC9A 4O3UB 4QQEA 3HFQA 5EARA 4BUJC 1PGUA 2CN2A 2P9IC 4Z8LA 2P9NC 4A2MA 5H1MA 3NVXA 3RN0D 1P22A 1OMWB 1B9XA 3C99A 4HDJA 2YNOA
chains in the Genus database with same CATH superfamily
3BG0A 2QR5A 3KRWB 4G56B 4FWWA 4PSWB 4DNUA 3EWEA 3MKQA 2H68A 5I5IA 3I8EA 4A09A 2VDKA 5E6UA 5CYKB 3SMRA 4CY1A 4CI1A 2VZ1A 2I3SA 4A08B 2AGLA 3EI1A 1JMZB 2H47A 4AEZA 1K8KC 2IAAA 4UM8A 5SXMA 4ERQA 5EM2B 3AL8A 3PSLA 1SQJA 1L0QA 3RFGA 3K26A 4U1EI 3IIYA 4ZN4A 2J57G 4BP9A 3ZWLB 5EM2A 3V7DB 2AQ5A 1VYHC 2OJYA 3V4VA 4CY3A 5M61A 3DDUA 4X60B 1GOGA 3UVLA 3U4YA 3MXXA 3AH8B 3EU7A 3EI2B 2CO0C 2H3XA 4AN0A 2HKMA 2GNQA 4GZ8A 3I89A 4AX4A 3EMHA 3I8CA 3SJLD 3IVMA 2Z2PA 1OLZA 2H6KA 1M1XA 3DM0A 4BP8A 3F3GA 4A7JA 5M5VA 3I7OA 4NAAA 4G1MA 4GM3A 3IUNA 3OF7A 4JSXC 5IT9g 1L5GA 3E0CA 5IJ7E 5GMKn 3VI4A 4JT5C 4ZOYA 4RE6A 5M5RA 1VE7A 2YNPA 4IRZA 4ERYA 3I7HA 3EI3B 3PVUB 1SQ9A 4H5JA 4D0KA 2XL2A 3PE7A 3RN1D 4AMYA 3EI4A 5FA5B 3B7FA 3SHFA 4E54B 4A0AB 2XZGA 3VH0A 4G55A 1K32A 5GSAA 2PM7B 4IMMA 2G9AA 3EI3A 1XIPA 3GC3B 3UR4A 2QZPA 3O4IA 3SLED 2GC7A 1GG2B 5TEFA 4PC0A 3ZE2A 2PBIB 1GOFA 4E54A 2IUPA 4A0AA 3VGZA 3NVNA 5H14A 1UOPA 3AL9A 3O4HA 2Z2OA 3VI3A 5JWZA 5IC7A 2IWKA 1ERJA 4J79A 5EAMA 5K1CC 1U8CA 3NIDA 3UVNA 2B5LA 5GXIA 4N14A 3FRXA 5C86A 4Z7QA 3RFHA 3JZGA 4K3ID 2HJBA 4CI2A 2EIBA 5C9ZB 1O6FA 4L9OA 5EMMB 3DWLC 3I7NA 2AGZA 4LG8A 3JZHA 1VE6A 4BCCA 1NEXB 3DXMC 2H13A 3PXSD 3SBRA 2H6QA 2VDPA 2PM6B 3I7PA 4J78A 1GP2B 3JZNA 4O9DA 2CO0A 4ES0A 4CY5A 5EMKB 2H9PA 1QNIA 4I79A 4J77A 1QFMA 1GXRA 3QHYB 1QFSA 3PXTD 5FKRA 3MMYA 4PSXB 5I5MA 5FLXg 3IJEA 1JJUB 3MVDK 3P4FA 3EQ9A 4QL1A 3IUMA 5I5JA 5CYKA 1H2ZA 2YNNA 4E5ZB 4OZUA 3PXWD 4J82A 4A08A 2CE9A 4GQBB 4A11B 5M5TA 2OVPB 3ZDZA 4FA5D 2I0TA 3NVQA 4O1QD 5CXCB 4D9SA 3BG1A 4H5IA 3I7KA 3OKYB 1T2XA 3EG6A 3DXKC 1K3IA 3ORVD 4FHLA 2XE4A 3L4MD 2OK4A 4J86A 4AOWA 2OVQB 3IJ1A 4PBZA 2I3TA 3CIKB 4IA9A 5FXYA 5EAPA 1VZ3A 1VZ2A 4JXMA 1TYEA 4O02A 1JMXB 2J56H 1GOTB 4J8GA 1JTDB 5IGOA 2OVRB 3EI2A 2XDWA 4WK4A 4X3EA 2P9KC 4GQ2P 2CN3A 5HYNB 2AH1A 3T3PA 1O6GA 3W15A 2VDQA 5HE0B 2QXVA 3IUJA 3K71A 1YFQA 3EQ8A 4TZ4A 3EQ7A 3O4JA 5CXBB 4CZXA 1U4CA 4PXWA 2JKXA 4GMBA 3C9CA 4GGAA 3I7LA 2EICA 2AGXA 4JSPC 3MKSB 2VDNA 3N0DA 2HYEA 2P9UC 2P9SC 1GOHA 4FAVD 3CFSB 1H2WA 4AN1A 3CFVA 5THAA 3SFZA 3K27A 2IUVA 4ESGA 4QT8A 2XU7A 3ULEC 4FA1D 2XYIA 1MDAH 3FCUA 2HU8A 1JV2A 3PSCB 2IURA 1JOFA 3OKTA 3UVKA 4L3HD 4XEIC 2VZ3A 5GXHA 3RSEC 4FA9D 2IUQA 2BCJB 3L4OD 3FCSA 4MMYA 5KDOB 2CE8A 4FB1D 4FAND 2EBSA 3BWSA 5HE3B 4EWRA 3AFCA 1PBYB 3JRPA 4X63B 3ODTA 2HESX 5HQGA 3GREA 1A0RB 1N6DA 3MUOA 4JHNA 4J0XA 1PEVA 4GGDA 5TDHB 2J55H 3OW8A 2H14A 3C75H 2HXCA 2H9LA 4A2LA 4A0BB 2BKLA 5H17A 4BL0A 4GQ1A 2HJ4A 2WQ8A 3JROA 2PM9B 3JB9L 4J73A 3UVOA 4NSXA 4NC4A 4CI3A 1H2YA 4L3GD 2UZYB 3KCIA 4JD2C 3SN6B 2IWFA 4UI9R 5TF2A 5FKSA 4ERZA 3N0EA 4NBMA 2O9KA 5FKQA 1E5TA 3NIGA 4ZOZA 1PI6A 3C5MA 2B5NA 5M5UA 2Q7QA 4A09B 2YB8B 2TRCB 3RRMC 2I0RA 3ZDYA 4O2WA 4CI8A 2BBKH 3J81g 2Z2NA 4L1MA 2OK6A 2B4EA 2YBAA 1MG3A 3SBPA 5FKTA 3EI1B 4WK0A 4XYIA 2VDLA 3K72A 3FM0A 4BCBA 3A0FA 3V9FA 3V5WB 4Z7NA 4K3JB 2MTAH 3AL8B 3UKUC 4MMZA 3ZDXA 1MG2A 5C2WB 3UKRC 4FA4D 4WK2A 3MZLA 5HDBA 5C2VB 1C9LA 4L1QD 2VDOA 4E5ZA 4U7AA 4Y5RD 4A11A 4JSVC 4AMZA 1I2MB 5CXCA 3OKYA 4CZYA 5AMSA 1TYQC 3GD1I 4LGNA 3IJCA 2XL3A 1UTCA 4D6VA 3NIFA 2VDRA 4ZOXA 5M5SA 1SHYB 2P9LC 3FGBA 4O45A 4WJKA 4J81A 2AGWA 3SXTD 1RI6A 1N6EA 5EMJB 2HU7A 4J87A 3IJ0A 4J0WA 4MMXA 4OWRA 1FWXA 1XHMA 3KRXB 1Q47A 5E6SA 3F3PA 5FQDA 1U2VC 4JHPC 4BH6A 3IIWA 3T3MA 1NR0A 3ZE1A 4GGCA 5B4WA 4Y7RA 4JSNC 2VDMA 2GC4A 4J8BA 3QI0A 3IURA 3O4GA 1N6FA 2HU5A 5IGQA 4KFMB 2P9PC 3IKOA 4CZVA 3JPXA 2VC2A 3K6SA 5CXBA 3EI4B 2AGYA 2UZXB 1H2XA 3F3FA 4NENA 1UOQA 1S4UX 4ZOVA 3RLMD 2B5MA 3J80g 5EALA 3MUNA 3IUQA 3MZKA 4X61B 5EMLB 4G1EA 2AH0A 5IJ8E 5HE2B 1E8NA 3I2NA 5TEEA 5AJAA 1UOOA 2EIEA 1B9YA 2G99A 4JT6C 4XYHA 5HE1B 1R5MA 4PNKB 4CY2A 1TBGA 4UM9A 5A2Qg 2W18A 2YMUA 2H9NA 3PVWB 3ZE0A 3VA6A 4YVDA 1XKSA 1YR2A 3GFCA 3SBQA 3SWSD 5C92A 4LG9A 5AFU3 4RE5A 2H6NA 4O3TB 3DSMA 4GM9A 3OL2B 3OTTA 4QAMA 5K19A 2EIDA 4J84A 3OKWA 4MK0B 4Z7OA 3SVWD 1BPOA 1A12A 1E8MA 4GM8A 4QRJA 2QC5A 3OL2A 2I0SA 5E6RA 3RMZD 4DNWA 4A0BA 3IULA 2HKRA 3JAMg 2H9MA 2PM9A 3UVMA 4PBYA 4R7AB 4BCDA 2CNXA 2OIZA 3SCYA 4CC9A 4O3UB 4QQEA 3HFQA 5EARA 3V4PA 1PGUA 5FFGA 4BUJC 4DNVA 2CN2A 5FFOA 2P9IC 4Z8LA 2P9NC 1C9IA 5H1MA 4A2MA 3NVXA 3RN0D 1P22A 1OMWB 1B9XA 3C99A 4HDJA 2YNOA
chains in the Genus database with same CATH topology
3BG0A 3KRWB 4G56B 4FWWA 4PSWB 3EWEA 3MKQA 2H68A 5I5IA 3I8EA 4A09A 5CYKB 3SMRA 4CY1A 4CI1A 2I3SA 4A08B 2AGLA 3EI1A 1JMZB 2H47A 4AEZA 1K8KC 2IAAA 5SXMA 4ERQA 5EM2B 3AL8A 3PSLA 1SQJA 1L0QA 3RFGA 3K26A 4U1EI 3IIYA 4ZN4A 2J57G 3ZWLB 5EM2A 3V7DB 2AQ5A 1VYHC 2OJYA 4CY3A 4X60B 3UVLA 3U4YA 3MXXA 3AH8B 3EU7A 3EI2B 2CO0C 2H3XA 2HKMA 2GNQA 4GZ8A 3I89A 3EMHA 3I8CA 3SJLD 2Z2PA 1OLZA 2H6KA 3DM0A 3F3GA 4A7JA 3I7OA 4GM3A 4JSXC 5IT9g 3E0CA 5IJ7E 5GMKn 4JT5C 4ZOYA 2YNPA 4ERYA 3I7HA 3EI3B 3PVUB 1SQ9A 4H5JA 4D0KA 2XL2A 3PE7A 3RN1D 3EI4A 5FA5B 3B7FA 3SHFA 4E54B 4A0AB 3VH0A 1K32A 5GSAA 2PM7B 4IMMA 2G9AA 3EI3A 1XIPA 3UR4A 3SLED 2GC7A 1GG2B 5TEFA 4PC0A 2PBIB 4E54A 2IUPA 4A0AA 3VGZA 3NVNA 5H14A 3AL9A 2Z2OA 5JWZA 5IC7A 2IWKA 1ERJA 4J79A 5EAMA 5K1CC 3UVNA 2B5LA 5GXIA 4N14A 3FRXA 3RFHA 3JZGA 4K3ID 2HJBA 4CI2A 5C9ZB 4L9OA 5EMMB 3DWLC 3I7NA 2AGZA 4LG8A 3JZHA 1NEXB 3DXMC 2H13A 3PXSD 3SBRA 2H6QA 2PM6B 3I7PA 4J78A 1GP2B 3JZNA 4O9DA 2CO0A 4ES0A 4CY5A 5EMKB 2H9PA 1QNIA 4I79A 4J77A 1GXRA 3PXTD 5FKRA 3MMYA 4PSXB 5I5MA 5FLXg 1JJUB 3P4FA 4QL1A 5I5JA 5CYKA 2YNNA 4E5ZB 4OZUA 3PXWD 4J82A 4A08A 2CE9A 4GQBB 4A11B 2OVPB 4FA5D 2I0TA 3NVQA 4O1QD 5CXCB 3BG1A 4H5IA 3I7KA 3OKYB 3EG6A 3DXKC 3ORVD 4FHLA 3L4MD 2OK4A 4J86A 4AOWA 2OVQB 3IJ1A 4PBZA 2I3TA 3CIKB 4IA9A 5FXYA 5EAPA 4JXMA 1JMXB 2J56H 1GOTB 4J8GA 5IGOA 2OVRB 3EI2A 4X3EA 2P9KC 4GQ2P 2CN3A 5HYNB 2AH1A 3W15A 5HE0B 2QXVA 1YFQA 4TZ4A 4CZXA 5CXBB 1U4CA 4PXWA 4GMBA 3C9CA 4GGAA 3I7LA 2AGXA 4JSPC 3MKSB 3N0DA 2HYEA 2P9UC 2P9SC 4FAVD 3CFSB 3CFVA 5THAA 3SFZA 3K27A 2IUVA 4ESGA 4QT8A 2XU7A 3ULEC 4FA1D 2XYIA 1MDAH 3PSCB 2IURA 1JOFA 3OKTA 3UVKA 4L3HD 4XEIC 5GXHA 3RSEC 4FA9D 2IUQA 2BCJB 3L4OD 5KDOB 2CE8A 4FB1D 4FAND 2EBSA 3BWSA 5HE3B 4EWRA 3AFCA 1PBYB 3JRPA 4X63B 3ODTA 2HESX 5HQGA 3GREA 1A0RB 1N6DA 4J0XA 1PEVA 4GGDA 5TDHB 2J55H 3OW8A 2H14A 3C75H 2HXCA 2H9LA 4A2LA 4A0BB 5H17A 4BL0A 4GQ1A 2HJ4A 3JROA 2PM9B 3JB9L 4J73A 3UVOA 4NSXA 4CI3A 4L3GD 2UZYB 4JD2C 3SN6B 2IWFA 4UI9R 5TF2A 5FKSA 4ERZA 3N0EA 2O9KA 5FKQA 4ZOZA 1PI6A 3C5MA 2B5NA 2Q7QA 4A09B 2YB8B 2TRCB 3RRMC 2I0RA 4CI8A 2BBKH 3J81g 2Z2NA 2OK6A 2B4EA 2YBAA 1MG3A 3SBPA 5FKTA 3EI1B 4XYIA 3FM0A 3A0FA 3V9FA 3V5WB 4K3JB 2MTAH 3AL8B 3UKUC 1MG2A 5C2WB 3UKRC 4FA4D 3MZLA 5C2VB 4L1QD 4E5ZA 4U7AA 4Y5RD 4A11A 4JSVC 5CXCA 3OKYA 4CZYA 5AMSA 1TYQC 4LGNA 3IJCA 2XL3A 4D6VA 4ZOXA 1SHYB 2P9LC 3FGBA 4O45A 4J81A 2AGWA 3SXTD 1RI6A 1N6EA 5EMJB 4J87A 3IJ0A 4J0WA 4OWRA 1FWXA 1XHMA 3KRXB 1Q47A 3F3PA 5FQDA 1U2VC 4BH6A 3IIWA 1NR0A 4GGCA 5B4WA 4Y7RA 4JSNC 2GC4A 4J8BA 1N6FA 5IGQA 4KFMB 2P9PC 3IKOA 4CZVA 3JPXA 5CXBA 3EI4B 2AGYA 2UZXB 3F3FA 1S4UX 4ZOVA 3RLMD 3J80g 2B5MA 5EALA 3MZKA 4X61B 5EMLB 2AH0A 5IJ8E 5HE2B 3I2NA 5TEEA 5AJAA 1B9YA 2G99A 4JT6C 4XYHA 5HE1B 1R5MA 4PNKB 4CY2A 1TBGA 5A2Qg 2W18A 2YMUA 2H9NA 3PVWB 3VA6A 4YVDA 1XKSA 3GFCA 3SBQA 3SWSD 4LG9A 5AFU3 2H6NA 4O3TB 3DSMA 4GM9A 3OL2B 3OTTA 5K19A 4J84A 3OKWA 4MK0B 3SVWD 4QRJA 4GM8A 2QC5A 3OL2A 2I0SA 3RMZD 4A0BA 2HKRA 3JAMg 2H9MA 2PM9A 3UVMA 4PBYA 4R7AB 2CNXA 2OIZA 3SCYA 4CC9A 4O3UB 4QQEA 3HFQA 5EARA 4BUJC 1PGUA 2CN2A 2P9IC 4Z8LA 2P9NC 4A2MA 5H1MA 3NVXA 3RN0D 1P22A 1OMWB 1B9XA 3C99A 4HDJA 2YNOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BG0 A;  3KRW B;  4G56 B;  4FWW A;  4PSW B;  3EWE A;  3MKQ A;  2H68 A;  5I5I A;  3I8E A;  4A09 A;  5CYK B;  3SMR A;  4CY1 A;  4CI1 A;  2I3S A;  4A08 B;  2AGL A;  3EI1 A;  1JMZ B;  2H47 A;  4AEZ A;  1K8K C;  2IAA A;  5SXM A;  4ERQ A;  5EM2 B;  3AL8 A;  3PSL A;  1SQJ A;  1L0Q A;  3RFG A;  3K26 A;  4U1E I;  3IIY A;  4ZN4 A;  2J57 G;  3ZWL B;  5EM2 A;  3V7D B;  2AQ5 A;  1VYH C;  2OJY A;  4CY3 A;  4X60 B;  3UVL A;  3U4Y A;  3MXX A;  3AH8 B;  3EU7 A;  3EI2 B;  2CO0 C;  2H3X A;  2HKM A;  2GNQ A;  4GZ8 A;  3I89 A;  3EMH A;  3I8C A;  3SJL D;  2Z2P A;  1OLZ A;  2H6K A;  3DM0 A;  3F3G A;  4A7J A;  3I7O A;  4GM3 A;  4JSX C;  5IT9 g;  3E0C A;  5IJ7 E;  5GMK n;  4JT5 C;  4ZOY A;  2YNP A;  4ERY A;  3I7H A;  3EI3 B;  3PVU B;  1SQ9 A;  4H5J A;  4D0K A;  2XL2 A;  3PE7 A;  3RN1 D;  3EI4 A;  5FA5 B;  3B7F A;  3SHF A;  4E54 B;  4A0A B;  3VH0 A;  1K32 A;  5GSA A;  2PM7 B;  4IMM A;  2G9A A;  3EI3 A;  1XIP A;  3UR4 A;  3SLE D;  2GC7 A;  1GG2 B;  5TEF A;  4PC0 A;  2PBI B;  4E54 A;  2IUP A;  4A0A A;  3VGZ A;  3NVN A;  5H14 A;  3AL9 A;  2Z2O A;  5JWZ A;  5IC7 A;  2IWK A;  1ERJ A;  4J79 A;  5EAM A;  5K1C C;  3UVN A;  2B5L A;  5GXI A;  4N14 A;  3FRX A;  3RFH A;  3JZG A;  4K3I D;  2HJB A;  4CI2 A;  5C9Z B;  4L9O A;  5EMM B;  3DWL C;  3I7N A;  2AGZ A;  4LG8 A;  3JZH A;  1NEX B;  3DXM C;  2H13 A;  3PXS D;  3SBR A;  2H6Q A;  2PM6 B;  3I7P A;  4J78 A;  1GP2 B;  3JZN A;  4O9D A;  2CO0 A;  4ES0 A;  4CY5 A;  5EMK B;  2H9P A;  1QNI A;  4I79 A;  4J77 A;  1GXR A;  3PXT D;  5FKR A;  3MMY A;  4PSX B;  5I5M A;  5FLX g;  1JJU B;  3P4F A;  4QL1 A;  5I5J A;  5CYK A;  2YNN A;  4E5Z B;  4OZU A;  3PXW D;  4J82 A;  4A08 A;  2CE9 A;  4GQB B;  4A11 B;  2OVP B;  4FA5 D;  2I0T A;  3NVQ A;  4O1Q D;  5CXC B;  3BG1 A;  4H5I A;  3I7K A;  3OKY B;  3EG6 A;  3DXK C;  3ORV D;  4FHL A;  3L4M D;  2OK4 A;  4J86 A;  4AOW A;  2OVQ B;  3IJ1 A;  4PBZ A;  2I3T A;  3CIK B;  4IA9 A;  5FXY A;  5EAP A;  4JXM A;  1JMX B;  2J56 H;  1GOT B;  4J8G A;  5IGO A;  2OVR B;  3EI2 A;  4X3E A;  2P9K C;  4GQ2 P;  2CN3 A;  5HYN B;  2AH1 A;  3W15 A;  5HE0 B;  2QXV A;  1YFQ A;  4TZ4 A;  4CZX A;  5CXB B;  1U4C A;  4PXW A;  4GMB A;  3C9C A;  4GGA A;  3I7L A;  2AGX A;  4JSP C;  3MKS B;  3N0D A;  2HYE A;  2P9U C;  2P9S C;  4FAV D;  3CFS B;  3CFV A;  5THA A;  3SFZ A;  3K27 A;  2IUV A;  4ESG A;  4QT8 A;  2XU7 A;  3ULE C;  4FA1 D;  2XYI A;  1MDA H;  3PSC B;  2IUR A;  1JOF A;  3OKT A;  3UVK A;  4L3H D;  4XEI C;  5GXH A;  3RSE C;  4FA9 D;  2IUQ A;  2BCJ B;  3L4O D;  5KDO B;  2CE8 A;  4FB1 D;  4FAN D;  2EBS A;  3BWS A;  5HE3 B;  4EWR A;  3AFC A;  1PBY B;  3JRP A;  4X63 B;  3ODT A;  2HES X;  5HQG A;  3GRE A;  1A0R B;  1N6D A;  4J0X A;  1PEV A;  4GGD A;  5TDH B;  2J55 H;  3OW8 A;  2H14 A;  3C75 H;  2HXC A;  2H9L A;  4A2L A;  4A0B B;  5H17 A;  4BL0 A;  4GQ1 A;  2HJ4 A;  3JRO A;  2PM9 B;  3JB9 L;  4J73 A;  3UVO A;  4NSX A;  4CI3 A;  4L3G D;  2UZY B;  4JD2 C;  3SN6 B;  2IWF A;  4UI9 R;  5TF2 A;  5FKS A;  4ERZ A;  3N0E A;  2O9K A;  5FKQ A;  4ZOZ A;  1PI6 A;  3C5M A;  2B5N A;  2Q7Q A;  4A09 B;  2YB8 B;  2TRC B;  3RRM C;  2I0R A;  4CI8 A;  2BBK H;  3J81 g;  2Z2N A;  2OK6 A;  2B4E A;  2YBA A;  1MG3 A;  3SBP A;  5FKT A;  3EI1 B;  4XYI A;  3FM0 A;  3A0F A;  3V9F A;  3V5W B;  4K3J B;  2MTA H;  3AL8 B;  3UKU C;  1MG2 A;  5C2W B;  3UKR C;  4FA4 D;  3MZL A;  5C2V B;  4L1Q D;  4E5Z A;  4U7A A;  4Y5R D;  4A11 A;  4JSV C;  5CXC A;  3OKY A;  4CZY A;  5AMS A;  1TYQ C;  4LGN A;  3IJC A;  2XL3 A;  4D6V A;  4ZOX A;  1SHY B;  2P9L C;  3FGB A;  4O45 A;  4J81 A;  2AGW A;  3SXT D;  1RI6 A;  1N6E A;  5EMJ B;  4J87 A;  3IJ0 A;  4J0W A;  4OWR A;  1FWX A;  1XHM A;  3KRX B;  1Q47 A;  3F3P A;  5FQD A;  1U2V C;  4BH6 A;  3IIW A;  1NR0 A;  4GGC A;  5B4W A;  4Y7R A;  4JSN C;  2GC4 A;  4J8B A;  1N6F A;  5IGQ A;  4KFM B;  2P9P C;  3IKO A;  4CZV A;  3JPX A;  5CXB A;  3EI4 B;  2AGY A;  2UZX B;  3F3F A;  1S4U X;  4ZOV A;  3RLM D;  3J80 g;  2B5M A;  5EAL A;  3MZK A;  4X61 B;  5EML B;  2AH0 A;  5IJ8 E;  5HE2 B;  3I2N A;  5TEE A;  5AJA A;  1B9Y A;  2G99 A;  4JT6 C;  4XYH A;  5HE1 B;  1R5M A;  4PNK B;  4CY2 A;  1TBG A;  5A2Q g;  2W18 A;  2YMU A;  2H9N A;  3PVW B;  3VA6 A;  4YVD A;  1XKS A;  3GFC A;  3SBQ A;  3SWS D;  4LG9 A;  5AFU 3;  2H6N A;  4O3T B;  3DSM A;  4GM9 A;  3OL2 B;  3OTT A;  5K19 A;  4J84 A;  3OKW A;  4MK0 B;  3SVW D;  4QRJ A;  4GM8 A;  2QC5 A;  3OL2 A;  2I0S A;  3RMZ D;  4A0B A;  2HKR A;  3JAM g;  2H9M A;  2PM9 A;  3UVM A;  4PBY A;  4R7A B;  2CNX A;  2OIZ A;  3SCY A;  4CC9 A;  4O3U B;  4QQE A;  3HFQ A;  5EAR A;  4BUJ C;  1PGU A;  2CN2 A;  2P9I C;  4Z8L A;  2P9N C;  4A2M A;  5H1M A;  3NVX A;  3RN0 D;  1P22 A;  1OMW B;  1B9X A;  3C99 A;  4HDJ A;  2YNO A; 
#chains in the Genus database with same CATH topology
 3BG0 A;  2QR5 A;  3KRW B;  4G56 B;  4FWW A;  4PSW B;  4DNU A;  3EWE A;  3MKQ A;  2H68 A;  5I5I A;  3I8E A;  4A09 A;  2VDK A;  5E6U A;  5CYK B;  3SMR A;  4CY1 A;  4CI1 A;  2VZ1 A;  2I3S A;  4A08 B;  2AGL A;  3EI1 A;  1JMZ B;  2H47 A;  4AEZ A;  1K8K C;  2IAA A;  4UM8 A;  5SXM A;  4ERQ A;  5EM2 B;  3AL8 A;  3PSL A;  1SQJ A;  1L0Q A;  3RFG A;  3K26 A;  4U1E I;  3IIY A;  4ZN4 A;  2J57 G;  4BP9 A;  3ZWL B;  5EM2 A;  3V7D B;  2AQ5 A;  1VYH C;  2OJY A;  3V4V A;  4CY3 A;  5M61 A;  3DDU A;  4X60 B;  1GOG A;  3UVL A;  3U4Y A;  3MXX A;  3AH8 B;  3EU7 A;  3EI2 B;  2CO0 C;  2H3X A;  4AN0 A;  2HKM A;  2GNQ A;  4GZ8 A;  3I89 A;  4AX4 A;  3EMH A;  3I8C A;  3SJL D;  3IVM A;  2Z2P A;  1OLZ A;  2H6K A;  1M1X A;  3DM0 A;  4BP8 A;  3F3G A;  4A7J A;  5M5V A;  3I7O A;  4NAA A;  4G1M A;  4GM3 A;  3IUN A;  3OF7 A;  4JSX C;  5IT9 g;  1L5G A;  3E0C A;  5IJ7 E;  5GMK n;  3VI4 A;  4JT5 C;  4ZOY A;  4RE6 A;  5M5R A;  1VE7 A;  2YNP A;  4IRZ A;  4ERY A;  3I7H A;  3EI3 B;  3PVU B;  1SQ9 A;  4H5J A;  4D0K A;  2XL2 A;  3PE7 A;  3RN1 D;  4AMY A;  3EI4 A;  5FA5 B;  3B7F A;  3SHF A;  4E54 B;  4A0A B;  2XZG A;  3VH0 A;  4G55 A;  1K32 A;  5GSA A;  2PM7 B;  4IMM A;  2G9A A;  3EI3 A;  1XIP A;  3GC3 B;  3UR4 A;  2QZP A;  3O4I A;  3SLE D;  2GC7 A;  1GG2 B;  5TEF A;  4PC0 A;  3ZE2 A;  2PBI B;  1GOF A;  4E54 A;  2IUP A;  4A0A A;  3VGZ A;  3NVN A;  5H14 A;  1UOP A;  3AL9 A;  3O4H A;  2Z2O A;  3VI3 A;  5JWZ A;  5IC7 A;  2IWK A;  1ERJ A;  4J79 A;  5EAM A;  5K1C C;  1U8C A;  3NID A;  3UVN A;  2B5L A;  5GXI A;  4N14 A;  3FRX A;  5C86 A;  4Z7Q A;  3RFH A;  3JZG A;  4K3I D;  2HJB A;  4CI2 A;  2EIB A;  5C9Z B;  1O6F A;  4L9O A;  5EMM B;  3DWL C;  3I7N A;  2AGZ A;  4LG8 A;  3JZH A;  1VE6 A;  4BCC A;  1NEX B;  3DXM C;  2H13 A;  3PXS D;  3SBR A;  2H6Q A;  2VDP A;  2PM6 B;  3I7P A;  4J78 A;  1GP2 B;  3JZN A;  4O9D A;  2CO0 A;  4ES0 A;  4CY5 A;  5EMK B;  2H9P A;  1QNI A;  4I79 A;  4J77 A;  1QFM A;  1GXR A;  3QHY B;  1QFS A;  3PXT D;  5FKR A;  3MMY A;  4PSX B;  5I5M A;  5FLX g;  3IJE A;  1JJU B;  3MVD K;  3P4F A;  3EQ9 A;  4QL1 A;  3IUM A;  5I5J A;  5CYK A;  1H2Z A;  2YNN A;  4E5Z B;  4OZU A;  3PXW D;  4J82 A;  4A08 A;  2CE9 A;  4GQB B;  4A11 B;  5M5T A;  2OVP B;  3ZDZ A;  4FA5 D;  2I0T A;  3NVQ A;  4O1Q D;  5CXC B;  4D9S A;  3BG1 A;  4H5I A;  3I7K A;  3OKY B;  1T2X A;  3EG6 A;  3DXK C;  1K3I A;  3ORV D;  4FHL A;  2XE4 A;  3L4M D;  2OK4 A;  4J86 A;  4AOW A;  2OVQ B;  3IJ1 A;  4PBZ A;  2I3T A;  3CIK B;  4IA9 A;  5FXY A;  5EAP A;  1VZ3 A;  1VZ2 A;  4JXM A;  1TYE A;  4O02 A;  1JMX B;  2J56 H;  1GOT B;  4J8G A;  1JTD B;  5IGO A;  2OVR B;  3EI2 A;  2XDW A;  4WK4 A;  4X3E A;  2P9K C;  4GQ2 P;  2CN3 A;  5HYN B;  2AH1 A;  3T3P A;  1O6G A;  3W15 A;  2VDQ A;  5HE0 B;  2QXV A;  3IUJ A;  3K71 A;  1YFQ A;  3EQ8 A;  4TZ4 A;  3EQ7 A;  3O4J A;  5CXB B;  4CZX A;  1U4C A;  4PXW A;  2JKX A;  4GMB A;  3C9C A;  4GGA A;  3I7L A;  2EIC A;  2AGX A;  4JSP C;  3MKS B;  2VDN A;  3N0D A;  2HYE A;  2P9U C;  2P9S C;  1GOH A;  4FAV D;  3CFS B;  1H2W A;  4AN1 A;  3CFV A;  5THA A;  3SFZ A;  3K27 A;  2IUV A;  4ESG A;  4QT8 A;  2XU7 A;  3ULE C;  4FA1 D;  2XYI A;  1MDA H;  3FCU A;  2HU8 A;  1JV2 A;  3PSC B;  2IUR A;  1JOF A;  3OKT A;  3UVK A;  4L3H D;  4XEI C;  2VZ3 A;  5GXH A;  3RSE C;  4FA9 D;  2IUQ A;  2BCJ B;  3L4O D;  3FCS A;  4MMY A;  5KDO B;  2CE8 A;  4FB1 D;  4FAN D;  2EBS A;  3BWS A;  5HE3 B;  4EWR A;  3AFC A;  1PBY B;  3JRP A;  4X63 B;  3ODT A;  2HES X;  5HQG A;  3GRE A;  1A0R B;  1N6D A;  3MUO A;  4JHN A;  4J0X A;  1PEV A;  4GGD A;  5TDH B;  2J55 H;  3OW8 A;  2H14 A;  3C75 H;  2HXC A;  2H9L A;  4A2L A;  4A0B B;  2BKL A;  5H17 A;  4BL0 A;  4GQ1 A;  2HJ4 A;  2WQ8 A;  3JRO A;  2PM9 B;  3JB9 L;  4J73 A;  3UVO A;  4NSX A;  4NC4 A;  4CI3 A;  1H2Y A;  4L3G D;  2UZY B;  3KCI A;  4JD2 C;  3SN6 B;  2IWF A;  4UI9 R;  5TF2 A;  5FKS A;  4ERZ A;  3N0E A;  4NBM A;  2O9K A;  5FKQ A;  1E5T A;  3NIG A;  4ZOZ A;  1PI6 A;  3C5M A;  2B5N A;  5M5U A;  2Q7Q A;  4A09 B;  2YB8 B;  2TRC B;  3RRM C;  2I0R A;  3ZDY A;  4O2W A;  4CI8 A;  2BBK H;  3J81 g;  2Z2N A;  4L1M A;  2OK6 A;  2B4E A;  2YBA A;  1MG3 A;  3SBP A;  5FKT A;  3EI1 B;  4WK0 A;  4XYI A;  2VDL A;  3K72 A;  3FM0 A;  4BCB A;  3A0F A;  3V9F A;  3V5W B;  4Z7N A;  4K3J B;  2MTA H;  3AL8 B;  3UKU C;  4MMZ A;  3ZDX A;  1MG2 A;  5C2W B;  3UKR C;  4FA4 D;  4WK2 A;  3MZL A;  5HDB A;  5C2V B;  1C9L A;  4L1Q D;  2VDO A;  4E5Z A;  4U7A A;  4Y5R D;  4A11 A;  4JSV C;  4AMZ A;  1I2M B;  5CXC A;  3OKY A;  4CZY A;  5AMS A;  1TYQ C;  3GD1 I;  4LGN A;  3IJC A;  2XL3 A;  1UTC A;  4D6V A;  3NIF A;  2VDR A;  4ZOX A;  5M5S A;  1SHY B;  2P9L C;  3FGB A;  4O45 A;  4WJK A;  4J81 A;  2AGW A;  3SXT D;  1RI6 A;  1N6E A;  5EMJ B;  2HU7 A;  4J87 A;  3IJ0 A;  4J0W A;  4MMX A;  4OWR A;  1FWX A;  1XHM A;  3KRX B;  1Q47 A;  5E6S A;  3F3P A;  5FQD A;  1U2V C;  4JHP C;  4BH6 A;  3IIW A;  3T3M A;  1NR0 A;  3ZE1 A;  4GGC A;  5B4W A;  4Y7R A;  4JSN C;  2VDM A;  2GC4 A;  4J8B A;  3QI0 A;  3IUR A;  3O4G A;  1N6F A;  2HU5 A;  5IGQ A;  4KFM B;  2P9P C;  3IKO A;  4CZV A;  3JPX A;  2VC2 A;  3K6S A;  5CXB A;  3EI4 B;  2AGY A;  2UZX B;  1H2X A;  3F3F A;  4NEN A;  1UOQ A;  1S4U X;  4ZOV A;  3RLM D;  2B5M A;  3J80 g;  5EAL A;  3MUN A;  3IUQ A;  3MZK A;  4X61 B;  5EML B;  4G1E A;  2AH0 A;  5IJ8 E;  5HE2 B;  1E8N A;  3I2N A;  5TEE A;  5AJA A;  1UOO A;  2EIE A;  1B9Y A;  2G99 A;  4JT6 C;  4XYH A;  5HE1 B;  1R5M A;  4PNK B;  4CY2 A;  1TBG A;  4UM9 A;  5A2Q g;  2W18 A;  2YMU A;  2H9N A;  3PVW B;  3ZE0 A;  3VA6 A;  4YVD A;  1XKS A;  1YR2 A;  3GFC A;  3SBQ A;  3SWS D;  5C92 A;  4LG9 A;  5AFU 3;  4RE5 A;  2H6N A;  4O3T B;  3DSM A;  4GM9 A;  3OL2 B;  3OTT A;  4QAM A;  5K19 A;  2EID A;  4J84 A;  3OKW A;  4MK0 B;  4Z7O A;  3SVW D;  1BPO A;  1A12 A;  1E8M A;  4GM8 A;  4QRJ A;  2QC5 A;  3OL2 A;  2I0S A;  5E6R A;  3RMZ D;  4DNW A;  4A0B A;  3IUL A;  2HKR A;  3JAM g;  2H9M A;  2PM9 A;  3UVM A;  4PBY A;  4R7A B;  4BCD A;  2CNX A;  2OIZ A;  3SCY A;  4CC9 A;  4O3U B;  4QQE A;  3HFQ A;  5EAR A;  3V4P A;  1PGU A;  5FFG A;  4BUJ C;  4DNV A;  2CN2 A;  5FFO A;  2P9I C;  4Z8L A;  2P9N C;  1C9I A;  5H1M A;  4A2M A;  3NVX A;  3RN0 D;  1P22 A;  1OMW B;  1B9X A;  3C99 A;  4HDJ A;  2YNO A; 
#chains in the Genus database with same CATH homology
 3BG0 A;  3KRW B;  4G56 B;  4FWW A;  4PSW B;  3EWE A;  3MKQ A;  2H68 A;  5I5I A;  3I8E A;  4A09 A;  5CYK B;  3SMR A;  4CY1 A;  4CI1 A;  2I3S A;  4A08 B;  2AGL A;  3EI1 A;  1JMZ B;  2H47 A;  4AEZ A;  1K8K C;  2IAA A;  5SXM A;  4ERQ A;  5EM2 B;  3AL8 A;  3PSL A;  1SQJ A;  1L0Q A;  3RFG A;  3K26 A;  4U1E I;  3IIY A;  4ZN4 A;  2J57 G;  3ZWL B;  5EM2 A;  3V7D B;  2AQ5 A;  1VYH C;  2OJY A;  4CY3 A;  4X60 B;  3UVL A;  3U4Y A;  3MXX A;  3AH8 B;  3EU7 A;  3EI2 B;  2CO0 C;  2H3X A;  2HKM A;  2GNQ A;  4GZ8 A;  3I89 A;  3EMH A;  3I8C A;  3SJL D;  2Z2P A;  1OLZ A;  2H6K A;  3DM0 A;  3F3G A;  4A7J A;  3I7O A;  4GM3 A;  4JSX C;  5IT9 g;  3E0C A;  5IJ7 E;  5GMK n;  4JT5 C;  4ZOY A;  2YNP A;  4ERY A;  3I7H A;  3EI3 B;  3PVU B;  1SQ9 A;  4H5J A;  4D0K A;  2XL2 A;  3PE7 A;  3RN1 D;  3EI4 A;  5FA5 B;  3B7F A;  3SHF A;  4E54 B;  4A0A B;  3VH0 A;  1K32 A;  5GSA A;  2PM7 B;  4IMM A;  2G9A A;  3EI3 A;  1XIP A;  3UR4 A;  3SLE D;  2GC7 A;  1GG2 B;  5TEF A;  4PC0 A;  2PBI B;  4E54 A;  2IUP A;  4A0A A;  3VGZ A;  3NVN A;  5H14 A;  3AL9 A;  2Z2O A;  5JWZ A;  5IC7 A;  2IWK A;  1ERJ A;  4J79 A;  5EAM A;  5K1C C;  3UVN A;  2B5L A;  5GXI A;  4N14 A;  3FRX A;  3RFH A;  3JZG A;  4K3I D;  2HJB A;  4CI2 A;  5C9Z B;  4L9O A;  5EMM B;  3DWL C;  3I7N A;  2AGZ A;  4LG8 A;  3JZH A;  1NEX B;  3DXM C;  2H13 A;  3PXS D;  3SBR A;  2H6Q A;  2PM6 B;  3I7P A;  4J78 A;  1GP2 B;  3JZN A;  4O9D A;  2CO0 A;  4ES0 A;  4CY5 A;  5EMK B;  2H9P A;  1QNI A;  4I79 A;  4J77 A;  1GXR A;  3PXT D;  5FKR A;  3MMY A;  4PSX B;  5I5M A;  5FLX g;  1JJU B;  3P4F A;  4QL1 A;  5I5J A;  5CYK A;  2YNN A;  4E5Z B;  4OZU A;  3PXW D;  4J82 A;  4A08 A;  2CE9 A;  4GQB B;  4A11 B;  2OVP B;  4FA5 D;  2I0T A;  3NVQ A;  4O1Q D;  5CXC B;  3BG1 A;  4H5I A;  3I7K A;  3OKY B;  3EG6 A;  3DXK C;  3ORV D;  4FHL A;  3L4M D;  2OK4 A;  4J86 A;  4AOW A;  2OVQ B;  3IJ1 A;  4PBZ A;  2I3T A;  3CIK B;  4IA9 A;  5FXY A;  5EAP A;  4JXM A;  1JMX B;  2J56 H;  1GOT B;  4J8G A;  5IGO A;  2OVR B;  3EI2 A;  4X3E A;  2P9K C;  4GQ2 P;  2CN3 A;  5HYN B;  2AH1 A;  3W15 A;  5HE0 B;  2QXV A;  1YFQ A;  4TZ4 A;  4CZX A;  5CXB B;  1U4C A;  4PXW A;  4GMB A;  3C9C A;  4GGA A;  3I7L A;  2AGX A;  4JSP C;  3MKS B;  3N0D A;  2HYE A;  2P9U C;  2P9S C;  4FAV D;  3CFS B;  3CFV A;  5THA A;  3SFZ A;  3K27 A;  2IUV A;  4ESG A;  4QT8 A;  2XU7 A;  3ULE C;  4FA1 D;  2XYI A;  1MDA H;  3PSC B;  2IUR A;  1JOF A;  3OKT A;  3UVK A;  4L3H D;  4XEI C;  5GXH A;  3RSE C;  4FA9 D;  2IUQ A;  2BCJ B;  3L4O D;  5KDO B;  2CE8 A;  4FB1 D;  4FAN D;  2EBS A;  3BWS A;  5HE3 B;  4EWR A;  3AFC A;  1PBY B;  3JRP A;  4X63 B;  3ODT A;  2HES X;  5HQG A;  3GRE A;  1A0R B;  1N6D A;  4J0X A;  1PEV A;  4GGD A;  5TDH B;  2J55 H;  3OW8 A;  2H14 A;  3C75 H;  2HXC A;  2H9L A;  4A2L A;  4A0B B;  5H17 A;  4BL0 A;  4GQ1 A;  2HJ4 A;  3JRO A;  2PM9 B;  3JB9 L;  4J73 A;  3UVO A;  4NSX A;  4CI3 A;  4L3G D;  2UZY B;  4JD2 C;  3SN6 B;  2IWF A;  4UI9 R;  5TF2 A;  5FKS A;  4ERZ A;  3N0E A;  2O9K A;  5FKQ A;  4ZOZ A;  1PI6 A;  3C5M A;  2B5N A;  2Q7Q A;  4A09 B;  2YB8 B;  2TRC B;  3RRM C;  2I0R A;  4CI8 A;  2BBK H;  3J81 g;  2Z2N A;  2OK6 A;  2B4E A;  2YBA A;  1MG3 A;  3SBP A;  5FKT A;  3EI1 B;  4XYI A;  3FM0 A;  3A0F A;  3V9F A;  3V5W B;  4K3J B;  2MTA H;  3AL8 B;  3UKU C;  1MG2 A;  5C2W B;  3UKR C;  4FA4 D;  3MZL A;  5C2V B;  4L1Q D;  4E5Z A;  4U7A A;  4Y5R D;  4A11 A;  4JSV C;  5CXC A;  3OKY A;  4CZY A;  5AMS A;  1TYQ C;  4LGN A;  3IJC A;  2XL3 A;  4D6V A;  4ZOX A;  1SHY B;  2P9L C;  3FGB A;  4O45 A;  4J81 A;  2AGW A;  3SXT D;  1RI6 A;  1N6E A;  5EMJ B;  4J87 A;  3IJ0 A;  4J0W A;  4OWR A;  1FWX A;  1XHM A;  3KRX B;  1Q47 A;  3F3P A;  5FQD A;  1U2V C;  4BH6 A;  3IIW A;  1NR0 A;  4GGC A;  5B4W A;  4Y7R A;  4JSN C;  2GC4 A;  4J8B A;  1N6F A;  5IGQ A;  4KFM B;  2P9P C;  3IKO A;  4CZV A;  3JPX A;  5CXB A;  3EI4 B;  2AGY A;  2UZX B;  3F3F A;  1S4U X;  4ZOV A;  3RLM D;  3J80 g;  2B5M A;  5EAL A;  3MZK A;  4X61 B;  5EML B;  2AH0 A;  5IJ8 E;  5HE2 B;  3I2N A;  5TEE A;  5AJA A;  1B9Y A;  2G99 A;  4JT6 C;  4XYH A;  5HE1 B;  1R5M A;  4PNK B;  4CY2 A;  1TBG A;  5A2Q g;  2W18 A;  2YMU A;  2H9N A;  3PVW B;  3VA6 A;  4YVD A;  1XKS A;  3GFC A;  3SBQ A;  3SWS D;  4LG9 A;  5AFU 3;  2H6N A;  4O3T B;  3DSM A;  4GM9 A;  3OL2 B;  3OTT A;  5K19 A;  4J84 A;  3OKW A;  4MK0 B;  3SVW D;  4QRJ A;  4GM8 A;  2QC5 A;  3OL2 A;  2I0S A;  3RMZ D;  4A0B A;  2HKR A;  3JAM g;  2H9M A;  2PM9 A;  3UVM A;  4PBY A;  4R7A B;  2CNX A;  2OIZ A;  3SCY A;  4CC9 A;  4O3U B;  4QQE A;  3HFQ A;  5EAR A;  4BUJ C;  1PGU A;  2CN2 A;  2P9I C;  4Z8L A;  2P9N C;  4A2M A;  5H1M A;  3NVX A;  3RN0 D;  1P22 A;  1OMW B;  1B9X A;  3C99 A;  4HDJ A;  2YNO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...