4GGAA

Structural analysis of human cdc20 supports multi-site degron recognition by apc/c
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
314
structure length
314
Chain Sequence
CRYIPSLPDRILDAPEIRNDYYLNLVDWSSGNVLAVALDNSVYLWSASSGDILQLLQMEQPGEYISSVAWIKEGNYLAVGTSSAEVQLWDVQQQKRLRNMTSHSARVGSLSWNSYILSSGSRSGHIHHHDVRVAEHHVATLSGHSQEVCGLRWAPDGRHLASGGNDNLVNVWPSAPGEGGWVPLQTFTQHQGAVKAVAWCPWQSNVLATGGGTSDRHIRIWNVCSGACLSAVDAHSQVCSILWSPHYKELISGHGFAQNQLVIWKYPTMAKVAELKGHTSRVLSLTMSPDGATVASAAADETLRLWRCFELDPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cell division cycle protein 20 homolog
publication title Structural analysis of human Cdc20 supports multisite degron recognition by APC/C.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 76
structure length 314
sequence length 314
ec nomenclature
pdb deposition date 2012-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
A PF12894 ANAPC4_WD40 Anaphase-promoting complex subunit 4 WD40 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4ggaA00
2B5MA 4NSXA 5EMJB 5H1MA 5H17A 4D6VA 3JZGA 3DSMA 3IKOA 3CFVA 3FRXA 1N6EA 2TRCB 4AEZA 4XYIA 5FKTA 2HXCA 2Z2OA 3RFGA 5EM2B 5CXCB 3EU7A 4GM9A 4O3UB 3UVNA 3AH8B 4A2MA 2AQ5A 2PM9A 3RFHA 3F3PA 3SXTD 2AGLA 4MK0B 1B9XA 2H9MA 2UZXB 3OL2B 4EWRA 4D0KA 4FA5D 4GGAA 2H13A 3MKSB 4K3ID 4A11B 4X63B 3I7OA 2YB8B 4JXMA 1TYQC 4X60B 4CC9A 4PSWB 4A0AA 4FHLA 5HE2B 2PM6B 5GMKn 1JOFA 2GNQA 3B7FA 3SVWD 2I0SA 2AGYA 4J86A 5CYKB 1RI6A 1SHYB 2G99A 3I7KA 2P9IC 3SBPA 3IJ1A 2BBKH 4H5IA 4J79A 1FWXA 5EM2A 5CXCA 3U4YA 2I3SA 4ZN4A 4L9OA 4JSXC 2P9NC 2OVQB 3SJLD 3OKWA 4GMBA 4J0WA 1PGUA 2IUQA 3SCYA 3OL2A 2YNOA 4J8BA 3PXSD 4FWWA 5H14A 2IWKA 4QQEA 4A11A 4L3GD 2IWFA 3OW8A 2PBIB 3EWEA 1SQJA 5IGQA 1K32A 2MTAH 4A09B 1K8KC 3RN1D 2IUPA 3FGBA 2YNNA 4FAND 2GC4A 4BL0A 3PSLA 5CYKA 3IIWA 5TF2A 2YNPA 4O3TB 1NEXB 3CIKB 3PXWD 2Z2NA 1GXRA 4A0BA 4AOWA 4A7JA 3C99A 1XHMA 3ORVD 5TDHB 3JZHA 4JSPC 4BUJC 4J87A 5IGOA 5HE3B 5HE1B 5FKSA 3MZLA 3L4MD 1N6FA 2B4EA 4CY5A 4A2LA 3RMZD 3UVKA 3J81g 4LG9A 5I5JA 4PSXB 5HQGA 4O1QD 4CI2A 3ODTA 3EI2B 5CXBB 2XL2A 4OZUA 4GQBB 3DXKC 5TEFA 3NVNA 4X3EA 4J81A 3A0FA 4QT8A 4J84A 3SN6B 4TZ4A 1L0QA 2HJ4A 4FA1D 3JROA 4X61B 2J57G 2H6KA 3K26A 3KRXB 2IUVA 1NR0A 3IJ0A 3BG0A 3I7LA 3V9FA 1GG2B 4J8GA 4CZVA 2CN2A 3PXTD 4GGDA 4CY3A 3VA6A 2B5NA 4CY1A 3RRMC 5C2VB 3F3FA 4CY2A 5FKQA 4J73A 5FXYA 3PVWB 3JB9L 5EAMA 3EI2A 5C2WB 3VGZA 4ZOVA 4GM8A 4Z8LA 3JRPA 3PVUB 1ERJA 3DWLC 4E5ZB 1OMWB 4GM3A 5SXMA 4YVDA 1VYHC 3DM0A 5I5IA 3FM0A 3NVXA 2QXVA 3UKUC 2XYIA 1MDAH 2CNXA 2AH1A 5HE0B 2H9NA 2OK6A 2W18A 4Y5RD 4FA4D 5GXHA 3I7PA 3EI4B 2H6NA 2H68A 1JMZB 4CI1A 4KFMB 3VH0A 3BWSA 3RSEC 2J55H 2OVRB 4J77A 2XL3A 3OKYB 2J56H 1TBGA 5EMMB 4JSNC 4QRJA 1PI6A 2H9LA 3I7HA 4IMMA 3RN0D 4R7AB 2H14A 3AL9A 1QNIA 4JT5C 4A08B 3MMYA 4PBYA 3SLED 4E5ZA 4E54B 5EMLB 3L4OD 4ES0A 2H6QA 3C5MA 3OKTA 2IURA 4U1EI 5IJ7E 4ZOYA 3UKRC 5FLXg 4L3HD 1PEVA 2AGXA 5KDOB 3E0CA 1S4UX 4ERZA 2HKMA 5GSAA 4PNKB 4ERQA 4L1QD 3EI4A 4PC0A 4I79A 5AMSA 4ZOZA 4H5JA 3C75H 3UR4A 4CZYA 4A09A 2Z2PA 3EG6A 3UVOA 2P9UC 5THAA 4CI8A 4CI3A 5HYNB 5EMKB 5K19A 3JZNA 1OLZA 3UVMA 2G9AA 4PXWA 4CZXA 4A08A 2P9KC 1XKSA 3I89A 2OK4A 5EAPA 3ULEC 3J80g 4QL1A 3OTTA 2YBAA 2Q7QA 3NVQA 2P9LC 3JAMg 3KRWB 3PE7A 1MG2A 4J82A 2I0TA 4LG8A 2P9SC 2CO0A 2CE8A 4ESGA 4J78A 4GZ8A 3UVLA 4XYHA 4FA9D 4PBZA 2XU7A 4GQ1A 3GFCA 4JD2C 3SMRA 5EALA 1YFQA 5EARA 3AL8B 5IC7A 4O9DA 2H47A 3AFCA 2HYEA 2IAAA 4GQ2P 1Q47A 5CXBA 1N6DA 2I3TA 4JSVC 2P9PC 3V5WB 5TEEA 1A0RB 3I2NA 2AGWA 3IIYA 3EI3B 2CE9A 3EI1B 2PM7B 1SQ9A 3CFSB 2CN3A 5AJAA 3K27A 2OVPB 3V7DB 3P4FA 4Y7RA 2I0RA 1PBYB 2HJBA 5C9ZB 2H3XA 2GC7A 2O9KA 4G56B 4A0BB 2CO0C 2BCJB 3EMHA 2B5LA 3GREA 5FKRA 3SHFA 3I8CA 5JWZA 3AL8A 3DXMC 2HKRA 4JT6C 5K1CC 4IA9A 2AH0A 2EBSA 3C9CA 2AGZA 1JMXB 4FB1D 3BG1A 1JJUB 4LGNA 5A2Qg 4ERYA 3SWSD 1U2VC 4BH6A 3EI3A 5FQDA 3W15A 5IJ8E 3EI1A 5I5MA 1GP2B 3HFQA 4ZOXA 4XEIC 4U7AA 3ZWLB 4HDJA 1P22A 4FAVD 3MXXA 2YMUA 4O45A 5GXIA 4J0XA 3F3GA 3SBRA 1U4CA 3MZKA 3N0EA 5B4WA 5FA5B 2OJYA 3N0DA 1XIPA 3SFZA 5AFU3 2PM9B 2UZYB 3OKYA 3JPXA 3IJCA 3I8EA 4N14A 1R5MA 3SBQA 1GOTB 1MG3A 4OWRA 3I7NA 3MKQA 3RLMD 2HESX 1B9YA 4UI9R 5IT9g 2OIZA 3PSCB 4GGCA 4E54A 4A0AB 2H9PA 2QC5A 4K3JB
chains in the Genus database with same CATH superfamily
2B5MA 4NSXA 5EMJB 5H1MA 5H17A 4D6VA 3NIDA 3JZGA 3DSMA 3IKOA 2VZ1A 3CFVA 2VDQA 1JTDB 3FRXA 1N6EA 2TRCB 4WK0A 4AEZA 4XYIA 5FKTA 1VZ3A 2HXCA 1TYEA 2Z2OA 3RFGA 5EM2B 5CXCB 4Z7OA 3EU7A 4GM9A 4O3UB 3UVNA 3AH8B 2VC2A 2AQ5A 2PM9A 3RFHA 4A2MA 3F3PA 3SXTD 3GC3B 2AGLA 4MK0B 1B9XA 2H9MA 2UZXB 2XE4A 3OL2B 4EWRA 4BP8A 3MUOA 4D0KA 4FA5D 4GGAA 2H13A 3MKSB 4K3ID 4A11B 4X63B 3I7OA 2YB8B 4JXMA 1TYQC 4X60B 2VDNA 4CC9A 4PSWB 4A0AA 4FHLA 1GOGA 2VZ3A 4UM9A 5HE2B 2PM6B 5GMKn 1JOFA 2GNQA 3K71A 3B7FA 4JHPC 3QI0A 3SVWD 2I0SA 4DNUA 2AGYA 3MUNA 4J86A 5CYKB 1RI6A 1SHYB 2G99A 4G1EA 3I7KA 3IULA 3EQ7A 2P9IC 1E8NA 3SBPA 3IJ1A 2BBKH 4H5IA 4J79A 3NIFA 1FWXA 3ZE2A 5EM2A 5CXCA 3U4YA 1T2XA 2I3SA 4L9OA 4ZN4A 3FCUA 4JSXC 2P9NC 2OVQB 3SJLD 3OKWA 4GMBA 4J0WA 1PGUA 2IUQA 3SCYA 5E6SA 2EIDA 3OL2A 2YNOA 4J8BA 3PXSD 4FWWA 5H14A 2IWKA 4QQEA 4A11A 3ZDXA 4L3GD 2IWFA 3OW8A 1VE6A 2PBIB 4JHNA 5M5VA 2VDPA 3EWEA 1SQJA 5IGQA 1K32A 2MTAH 4A09B 1K8KC 3RN1D 2IUPA 3FGBA 3QHYB 2YNNA 4FAND 2GC4A 4BL0A 3PSLA 5CYKA 3IIWA 2WQ8A 1VZ2A 5TF2A 2YNPA 4O3TB 1NEXB 3CIKB 3PXWD 2Z2NA 1GXRA 4A0BA 3FCSA 4AOWA 4A7JA 3C99A 3O4IA 1XHMA 3ORVD 5TDHB 2XDWA 3JZHA 4G1MA 4BCCA 4JSPC 3V4PA 4BUJC 4J87A 5IGOA 5HE3B 5HE1B 1YR2A 5FKSA 3MZLA 3L4MD 1N6FA 2B4EA 4CY5A 1L5GA 4A2LA 3RMZD 3UVKA 3J81g 4LG9A 5I5JA 4PSXB 5HQGA 4O1QD 4CI2A 4Z7NA 3ODTA 5M5RA 3EI2B 5CXBB 2XL2A 4NBMA 4OZUA 4GQBB 3DXKC 3NIGA 5TEFA 3NVNA 1H2YA 1A12A 4X3EA 4J81A 3A0FA 4QT8A 4J84A 3SN6B 4TZ4A 1M1XA 1L0QA 2HJ4A 3EQ8A 4FA1D 3JROA 4X61B 2J57G 1E5TA 2H6KA 3K26A 3KRXB 3EQ9A 2IUVA 1NR0A 3IJ0A 4Z7QA 3BG0A 3I7LA 3V9FA 1GG2B 2QZPA 4J8GA 4CZVA 2CN2A 3PXTD 4GGDA 4AMZA 4CY3A 3VA6A 2B5NA 4CY1A 3RRMC 3K72A 5C2VB 3F3FA 4CY2A 1E8MA 1H2XA 5FKQA 5E6RA 4NENA 4J73A 5FXYA 3PVWB 4IRZA 3JB9L 5EAMA 3EI2A 5C2WB 3VGZA 4ZOVA 4GM8A 4Z8LA 3IUQA 3JRPA 1ERJA 3DWLC 3PVUB 4E5ZB 1OMWB 4GM3A 5SXMA 4YVDA 1VYHC 3DM0A 5I5IA 1K3IA 3FM0A 3NVXA 2QXVA 3UKUC 2XYIA 1MDAH 2CNXA 2AH1A 1UOOA 5HE0B 1H2ZA 2H9NA 1C9LA 1C9IA 3ZE1A 3VI3A 2OK6A 2W18A 2VDMA 4Y5RD 3IVMA 4BCBA 4FA4D 5GXHA 3I7PA 3IURA 2HU5A 3EI4B 2H6NA 3O4HA 2H68A 1JMZB 4CI1A 4KFMB 3VH0A 5C86A 3BWSA 3RSEC 4RE5A 2J55H 1GOFA 2OVRB 4J77A 2XL3A 3OKYB 2J56H 4AMYA 1TBGA 4AN1A 4JSNC 4QRJA 5EMMB 1PI6A 2H9LA 3I7HA 4IMMA 3RN0D 4R7AB 2VDRA 2H14A 3AL9A 3T3MA 1QNIA 3O4JA 4JT5C 4A08B 3IUMA 1UOQA 3MMYA 4QAMA 3V4VA 4PBYA 3SLED 1VE7A 4E5ZA 4E54B 5EMLB 3L4OD 4ES0A 5HDBA 2H6QA 3C5MA 3OKTA 2IURA 4U1EI 2QR5A 5IJ7E 4ZOYA 5E6UA 3UKRC 5FLXg 4L3HD 1PEVA 2AGXA 5KDOB 3E0CA 1S4UX 4ERZA 1UOPA 2HKMA 5GSAA 4PNKB 4ERQA 4L1QD 3EI4A 4PC0A 1BPOA 4I79A 5AMSA 4WK2A 4ZOZA 4H5JA 4AX4A 3C75H 3UR4A 4CZYA 3DDUA 4NC4A 4A09A 2Z2PA 4WK4A 3EG6A 4WJKA 3UVOA 2P9UC 3T3PA 5THAA 4CI8A 4CI3A 5HYNB 5EMKB 2EIEA 5K19A 3JZNA 1OLZA 3UVMA 2G9AA 4MMYA 4PXWA 4CZXA 4A08A 2P9KC 1XKSA 3I89A 2OK4A 5EAPA 3ULEC 3J80g 4QL1A 4D9SA 3OTTA 2YBAA 4RE6A 2Q7QA 3NVQA 1O6FA 3IUJA 5M5TA 2P9LC 3JAMg 3KRWB 3PE7A 1MG2A 4J82A 2I0TA 4LG8A 2P9SC 2CO0A 2CE8A 4ESGA 2EIBA 4J78A 4GZ8A 3UVLA 4XYHA 4FA9D 4MMXA 3MVDK 4PBZA 2XU7A 4GQ1A 4O02A 3GFCA 4JD2C 2BKLA 4G55A 3SMRA 5EALA 1YFQA 5EARA 1JV2A 3AL8B 5IC7A 3ZDZA 4O9DA 1QFMA 2H47A 3AFCA 2JKXA 2HYEA 2IAAA 3ZE0A 4GQ2P 1Q47A 4UM8A 5FFGA 5CXBA 1N6DA 2I3TA 4JSVC 1UTCA 2P9PC 3V5WB 5TEEA 5C92A 1A0RB 3I2NA 2AGWA 5FFOA 3IIYA 3EI3B 2CE9A 3EI1B 3ZDYA 4L1MA 3GD1I 2PM7B 1SQ9A 3VI4A 3CFSB 2CN3A 5AJAA 3K27A 2OVPB 3V7DB 3P4FA 4Y7RA 2I0RA 1PBYB 2HJBA 5M5UA 5C9ZB 2H3XA 2GC7A 2O9KA 3O4GA 4G56B 2EICA 4A0BB 2CO0C 2BCJB 3EMHA 2B5LA 1QFSA 3GREA 1I2MB 5FKRA 3SHFA 3I8CA 5JWZA 3IUNA 3AL8A 3DXMC 2HKRA 2VDKA 4JT6C 5K1CC 4IA9A 3KCIA 2AH0A 2EBSA 3C9CA 2AGZA 2HU7A 1JMXB 2VDLA 4FB1D 1U8CA 3BG1A 1JJUB 4LGNA 4O2WA 5A2Qg 4ERYA 3SWSD 1U2VC 4BH6A 3EI3A 5FQDA 3W15A 5IJ8E 3EI1A 3IJEA 5I5MA 1GP2B 2VDOA 4BP9A 3HFQA 4ZOXA 1GOHA 4XEIC 4U7AA 3ZWLB 2HU8A 4HDJA 4MMZA 1P22A 4FAVD 3MXXA 2YMUA 4O45A 5GXIA 4J0XA 3F3GA 5M61A 3SBRA 4DNVA 3K6SA 1U4CA 3MZKA 3N0EA 4NAAA 5B4WA 5FA5B 2OJYA 1O6GA 3N0DA 1XIPA 3SFZA 5AFU3 2PM9B 2UZYB 3OF7A 1H2WA 3OKYA 3JPXA 3IJCA 3I8EA 4N14A 1R5MA 3SBQA 1GOTB 1MG3A 5M5SA 4OWRA 3I7NA 3MKQA 3RLMD 2HESX 4BCDA 1B9YA 4UI9R 5IT9g 2OIZA 3PSCB 4GGCA 4AN0A 4E54A 4A0AB 2XZGA 2H9PA 2QC5A 4K3JB 4DNWA
chains in the Genus database with same CATH topology
2B5MA 4NSXA 5EMJB 5H1MA 5H17A 4D6VA 3JZGA 3DSMA 3IKOA 3CFVA 3FRXA 1N6EA 2TRCB 4AEZA 4XYIA 5FKTA 2HXCA 2Z2OA 3RFGA 5EM2B 5CXCB 3EU7A 4GM9A 4O3UB 3UVNA 3AH8B 4A2MA 2AQ5A 2PM9A 3RFHA 3F3PA 3SXTD 2AGLA 4MK0B 1B9XA 2H9MA 2UZXB 3OL2B 4EWRA 4D0KA 4FA5D 4GGAA 2H13A 3MKSB 4K3ID 4A11B 4X63B 3I7OA 2YB8B 4JXMA 1TYQC 4X60B 4CC9A 4PSWB 4A0AA 4FHLA 5HE2B 2PM6B 5GMKn 1JOFA 2GNQA 3B7FA 3SVWD 2I0SA 2AGYA 4J86A 5CYKB 1RI6A 1SHYB 2G99A 3I7KA 2P9IC 3SBPA 3IJ1A 2BBKH 4H5IA 4J79A 1FWXA 5EM2A 5CXCA 3U4YA 2I3SA 4ZN4A 4L9OA 4JSXC 2P9NC 2OVQB 3SJLD 3OKWA 4GMBA 4J0WA 1PGUA 2IUQA 3SCYA 3OL2A 2YNOA 4J8BA 3PXSD 4FWWA 5H14A 2IWKA 4QQEA 4A11A 4L3GD 2IWFA 3OW8A 2PBIB 3EWEA 1SQJA 5IGQA 1K32A 2MTAH 4A09B 1K8KC 3RN1D 2IUPA 3FGBA 2YNNA 4FAND 2GC4A 4BL0A 3PSLA 5CYKA 3IIWA 5TF2A 2YNPA 4O3TB 1NEXB 3CIKB 3PXWD 2Z2NA 1GXRA 4A0BA 4AOWA 4A7JA 3C99A 1XHMA 3ORVD 5TDHB 3JZHA 4JSPC 4BUJC 4J87A 5IGOA 5HE3B 5HE1B 5FKSA 3MZLA 3L4MD 1N6FA 2B4EA 4CY5A 4A2LA 3RMZD 3UVKA 3J81g 4LG9A 5I5JA 4PSXB 5HQGA 4O1QD 4CI2A 3ODTA 3EI2B 5CXBB 2XL2A 4OZUA 4GQBB 3DXKC 5TEFA 3NVNA 4X3EA 4J81A 3A0FA 4QT8A 4J84A 3SN6B 4TZ4A 1L0QA 2HJ4A 4FA1D 3JROA 4X61B 2J57G 2H6KA 3K26A 3KRXB 2IUVA 1NR0A 3IJ0A 3BG0A 3I7LA 3V9FA 1GG2B 4J8GA 4CZVA 2CN2A 3PXTD 4GGDA 4CY3A 3VA6A 2B5NA 4CY1A 3RRMC 5C2VB 3F3FA 4CY2A 5FKQA 4J73A 5FXYA 3PVWB 3JB9L 5EAMA 3EI2A 5C2WB 3VGZA 4ZOVA 4GM8A 4Z8LA 3JRPA 3PVUB 1ERJA 3DWLC 4E5ZB 1OMWB 4GM3A 5SXMA 4YVDA 1VYHC 3DM0A 5I5IA 3FM0A 3NVXA 2QXVA 3UKUC 2XYIA 1MDAH 2CNXA 2AH1A 5HE0B 2H9NA 2OK6A 2W18A 4Y5RD 4FA4D 5GXHA 3I7PA 3EI4B 2H6NA 2H68A 1JMZB 4CI1A 4KFMB 3VH0A 3BWSA 3RSEC 2J55H 2OVRB 4J77A 2XL3A 3OKYB 2J56H 1TBGA 5EMMB 4JSNC 4QRJA 1PI6A 2H9LA 3I7HA 4IMMA 3RN0D 4R7AB 2H14A 3AL9A 1QNIA 4JT5C 4A08B 3MMYA 4PBYA 3SLED 4E5ZA 4E54B 5EMLB 3L4OD 4ES0A 2H6QA 3C5MA 3OKTA 2IURA 4U1EI 5IJ7E 4ZOYA 3UKRC 5FLXg 4L3HD 1PEVA 2AGXA 5KDOB 3E0CA 1S4UX 4ERZA 2HKMA 5GSAA 4PNKB 4ERQA 4L1QD 3EI4A 4PC0A 4I79A 5AMSA 4ZOZA 4H5JA 3C75H 3UR4A 4CZYA 4A09A 2Z2PA 3EG6A 3UVOA 2P9UC 5THAA 4CI8A 4CI3A 5HYNB 5EMKB 5K19A 3JZNA 1OLZA 3UVMA 2G9AA 4PXWA 4CZXA 4A08A 2P9KC 1XKSA 3I89A 2OK4A 5EAPA 3ULEC 3J80g 4QL1A 3OTTA 2YBAA 2Q7QA 3NVQA 2P9LC 3JAMg 3KRWB 3PE7A 1MG2A 4J82A 2I0TA 4LG8A 2P9SC 2CO0A 2CE8A 4ESGA 4J78A 4GZ8A 3UVLA 4XYHA 4FA9D 4PBZA 2XU7A 4GQ1A 3GFCA 4JD2C 3SMRA 5EALA 1YFQA 5EARA 3AL8B 5IC7A 4O9DA 2H47A 3AFCA 2HYEA 2IAAA 4GQ2P 1Q47A 5CXBA 1N6DA 2I3TA 4JSVC 2P9PC 3V5WB 5TEEA 1A0RB 3I2NA 2AGWA 3IIYA 3EI3B 2CE9A 3EI1B 2PM7B 1SQ9A 3CFSB 2CN3A 5AJAA 3K27A 2OVPB 3V7DB 3P4FA 4Y7RA 2I0RA 1PBYB 2HJBA 5C9ZB 2H3XA 2GC7A 2O9KA 4G56B 4A0BB 2CO0C 2BCJB 3EMHA 2B5LA 3GREA 5FKRA 3SHFA 3I8CA 5JWZA 3AL8A 3DXMC 2HKRA 4JT6C 5K1CC 4IA9A 2AH0A 2EBSA 3C9CA 2AGZA 1JMXB 4FB1D 3BG1A 1JJUB 4LGNA 5A2Qg 4ERYA 3SWSD 1U2VC 4BH6A 3EI3A 5FQDA 3W15A 5IJ8E 3EI1A 5I5MA 1GP2B 3HFQA 4ZOXA 4XEIC 4U7AA 3ZWLB 4HDJA 1P22A 4FAVD 3MXXA 2YMUA 4O45A 5GXIA 4J0XA 3F3GA 3SBRA 1U4CA 3MZKA 3N0EA 5B4WA 5FA5B 2OJYA 3N0DA 1XIPA 3SFZA 5AFU3 2PM9B 2UZYB 3OKYA 3JPXA 3IJCA 3I8EA 4N14A 1R5MA 3SBQA 1GOTB 1MG3A 4OWRA 3I7NA 3MKQA 3RLMD 2HESX 1B9YA 4UI9R 5IT9g 2OIZA 3PSCB 4GGCA 4E54A 4A0AB 2H9PA 2QC5A 4K3JB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B5M A;  4NSX A;  5EMJ B;  5H1M A;  5H17 A;  4D6V A;  3JZG A;  3DSM A;  3IKO A;  3CFV A;  3FRX A;  1N6E A;  2TRC B;  4AEZ A;  4XYI A;  5FKT A;  2HXC A;  2Z2O A;  3RFG A;  5EM2 B;  5CXC B;  3EU7 A;  4GM9 A;  4O3U B;  3UVN A;  3AH8 B;  4A2M A;  2AQ5 A;  2PM9 A;  3RFH A;  3F3P A;  3SXT D;  2AGL A;  4MK0 B;  1B9X A;  2H9M A;  2UZX B;  3OL2 B;  4EWR A;  4D0K A;  4FA5 D;  4GGA A;  2H13 A;  3MKS B;  4K3I D;  4A11 B;  4X63 B;  3I7O A;  2YB8 B;  4JXM A;  1TYQ C;  4X60 B;  4CC9 A;  4PSW B;  4A0A A;  4FHL A;  5HE2 B;  2PM6 B;  5GMK n;  1JOF A;  2GNQ A;  3B7F A;  3SVW D;  2I0S A;  2AGY A;  4J86 A;  5CYK B;  1RI6 A;  1SHY B;  2G99 A;  3I7K A;  2P9I C;  3SBP A;  3IJ1 A;  2BBK H;  4H5I A;  4J79 A;  1FWX A;  5EM2 A;  5CXC A;  3U4Y A;  2I3S A;  4ZN4 A;  4L9O A;  4JSX C;  2P9N C;  2OVQ B;  3SJL D;  3OKW A;  4GMB A;  4J0W A;  1PGU A;  2IUQ A;  3SCY A;  3OL2 A;  2YNO A;  4J8B A;  3PXS D;  4FWW A;  5H14 A;  2IWK A;  4QQE A;  4A11 A;  4L3G D;  2IWF A;  3OW8 A;  2PBI B;  3EWE A;  1SQJ A;  5IGQ A;  1K32 A;  2MTA H;  4A09 B;  1K8K C;  3RN1 D;  2IUP A;  3FGB A;  2YNN A;  4FAN D;  2GC4 A;  4BL0 A;  3PSL A;  5CYK A;  3IIW A;  5TF2 A;  2YNP A;  4O3T B;  1NEX B;  3CIK B;  3PXW D;  2Z2N A;  1GXR A;  4A0B A;  4AOW A;  4A7J A;  3C99 A;  1XHM A;  3ORV D;  5TDH B;  3JZH A;  4JSP C;  4BUJ C;  4J87 A;  5IGO A;  5HE3 B;  5HE1 B;  5FKS A;  3MZL A;  3L4M D;  1N6F A;  2B4E A;  4CY5 A;  4A2L A;  3RMZ D;  3UVK A;  3J81 g;  4LG9 A;  5I5J A;  4PSX B;  5HQG A;  4O1Q D;  4CI2 A;  3ODT A;  3EI2 B;  5CXB B;  2XL2 A;  4OZU A;  4GQB B;  3DXK C;  5TEF A;  3NVN A;  4X3E A;  4J81 A;  3A0F A;  4QT8 A;  4J84 A;  3SN6 B;  4TZ4 A;  1L0Q A;  2HJ4 A;  4FA1 D;  3JRO A;  4X61 B;  2J57 G;  2H6K A;  3K26 A;  3KRX B;  2IUV A;  1NR0 A;  3IJ0 A;  3BG0 A;  3I7L A;  3V9F A;  1GG2 B;  4J8G A;  4CZV A;  2CN2 A;  3PXT D;  4GGD A;  4CY3 A;  3VA6 A;  2B5N A;  4CY1 A;  3RRM C;  5C2V B;  3F3F A;  4CY2 A;  5FKQ A;  4J73 A;  5FXY A;  3PVW B;  3JB9 L;  5EAM A;  3EI2 A;  5C2W B;  3VGZ A;  4ZOV A;  4GM8 A;  4Z8L A;  3JRP A;  3PVU B;  1ERJ A;  3DWL C;  4E5Z B;  1OMW B;  4GM3 A;  5SXM A;  4YVD A;  1VYH C;  3DM0 A;  5I5I A;  3FM0 A;  3NVX A;  2QXV A;  3UKU C;  2XYI A;  1MDA H;  2CNX A;  2AH1 A;  5HE0 B;  2H9N A;  2OK6 A;  2W18 A;  4Y5R D;  4FA4 D;  5GXH A;  3I7P A;  3EI4 B;  2H6N A;  2H68 A;  1JMZ B;  4CI1 A;  4KFM B;  3VH0 A;  3BWS A;  3RSE C;  2J55 H;  2OVR B;  4J77 A;  2XL3 A;  3OKY B;  2J56 H;  1TBG A;  5EMM B;  4JSN C;  4QRJ A;  1PI6 A;  2H9L A;  3I7H A;  4IMM A;  3RN0 D;  4R7A B;  2H14 A;  3AL9 A;  1QNI A;  4JT5 C;  4A08 B;  3MMY A;  4PBY A;  3SLE D;  4E5Z A;  4E54 B;  5EML B;  3L4O D;  4ES0 A;  2H6Q A;  3C5M A;  3OKT A;  2IUR A;  4U1E I;  5IJ7 E;  4ZOY A;  3UKR C;  5FLX g;  4L3H D;  1PEV A;  2AGX A;  5KDO B;  3E0C A;  1S4U X;  4ERZ A;  2HKM A;  5GSA A;  4PNK B;  4ERQ A;  4L1Q D;  3EI4 A;  4PC0 A;  4I79 A;  5AMS A;  4ZOZ A;  4H5J A;  3C75 H;  3UR4 A;  4CZY A;  4A09 A;  2Z2P A;  3EG6 A;  3UVO A;  2P9U C;  5THA A;  4CI8 A;  4CI3 A;  5HYN B;  5EMK B;  5K19 A;  3JZN A;  1OLZ A;  3UVM A;  2G9A A;  4PXW A;  4CZX A;  4A08 A;  2P9K C;  1XKS A;  3I89 A;  2OK4 A;  5EAP A;  3ULE C;  3J80 g;  4QL1 A;  3OTT A;  2YBA A;  2Q7Q A;  3NVQ A;  2P9L C;  3JAM g;  3KRW B;  3PE7 A;  1MG2 A;  4J82 A;  2I0T A;  4LG8 A;  2P9S C;  2CO0 A;  2CE8 A;  4ESG A;  4J78 A;  4GZ8 A;  3UVL A;  4XYH A;  4FA9 D;  4PBZ A;  2XU7 A;  4GQ1 A;  3GFC A;  4JD2 C;  3SMR A;  5EAL A;  1YFQ A;  5EAR A;  3AL8 B;  5IC7 A;  4O9D A;  2H47 A;  3AFC A;  2HYE A;  2IAA A;  4GQ2 P;  1Q47 A;  5CXB A;  1N6D A;  2I3T A;  4JSV C;  2P9P C;  3V5W B;  5TEE A;  1A0R B;  3I2N A;  2AGW A;  3IIY A;  3EI3 B;  2CE9 A;  3EI1 B;  2PM7 B;  1SQ9 A;  3CFS B;  2CN3 A;  5AJA A;  3K27 A;  2OVP B;  3V7D B;  3P4F A;  4Y7R A;  2I0R A;  1PBY B;  2HJB A;  5C9Z B;  2H3X A;  2GC7 A;  2O9K A;  4G56 B;  4A0B B;  2CO0 C;  2BCJ B;  3EMH A;  2B5L A;  3GRE A;  5FKR A;  3SHF A;  3I8C A;  5JWZ A;  3AL8 A;  3DXM C;  2HKR A;  4JT6 C;  5K1C C;  4IA9 A;  2AH0 A;  2EBS A;  3C9C A;  2AGZ A;  1JMX B;  4FB1 D;  3BG1 A;  1JJU B;  4LGN A;  5A2Q g;  4ERY A;  3SWS D;  1U2V C;  4BH6 A;  3EI3 A;  5FQD A;  3W15 A;  5IJ8 E;  3EI1 A;  5I5M A;  1GP2 B;  3HFQ A;  4ZOX A;  4XEI C;  4U7A A;  3ZWL B;  4HDJ A;  1P22 A;  4FAV D;  3MXX A;  2YMU A;  4O45 A;  5GXI A;  4J0X A;  3F3G A;  3SBR A;  1U4C A;  3MZK A;  3N0E A;  5B4W A;  5FA5 B;  2OJY A;  3N0D A;  1XIP A;  3SFZ A;  5AFU 3;  2PM9 B;  2UZY B;  3OKY A;  3JPX A;  3IJC A;  3I8E A;  4N14 A;  1R5M A;  3SBQ A;  1GOT B;  1MG3 A;  4OWR A;  3I7N A;  3MKQ A;  3RLM D;  2HES X;  1B9Y A;  4UI9 R;  5IT9 g;  2OIZ A;  3PSC B;  4GGC A;  4E54 A;  4A0A B;  2H9P A;  2QC5 A;  4K3J B; 
#chains in the Genus database with same CATH topology
 2B5M A;  4NSX A;  5EMJ B;  5H1M A;  5H17 A;  4D6V A;  3NID A;  3JZG A;  3DSM A;  3IKO A;  2VZ1 A;  3CFV A;  2VDQ A;  1JTD B;  3FRX A;  1N6E A;  2TRC B;  4WK0 A;  4AEZ A;  4XYI A;  5FKT A;  1VZ3 A;  2HXC A;  1TYE A;  2Z2O A;  3RFG A;  5EM2 B;  5CXC B;  4Z7O A;  3EU7 A;  4GM9 A;  4O3U B;  3UVN A;  3AH8 B;  2VC2 A;  2AQ5 A;  2PM9 A;  3RFH A;  4A2M A;  3F3P A;  3SXT D;  3GC3 B;  2AGL A;  4MK0 B;  1B9X A;  2H9M A;  2UZX B;  2XE4 A;  3OL2 B;  4EWR A;  4BP8 A;  3MUO A;  4D0K A;  4FA5 D;  4GGA A;  2H13 A;  3MKS B;  4K3I D;  4A11 B;  4X63 B;  3I7O A;  2YB8 B;  4JXM A;  1TYQ C;  4X60 B;  2VDN A;  4CC9 A;  4PSW B;  4A0A A;  4FHL A;  1GOG A;  2VZ3 A;  4UM9 A;  5HE2 B;  2PM6 B;  5GMK n;  1JOF A;  2GNQ A;  3K71 A;  3B7F A;  4JHP C;  3QI0 A;  3SVW D;  2I0S A;  4DNU A;  2AGY A;  3MUN A;  4J86 A;  5CYK B;  1RI6 A;  1SHY B;  2G99 A;  4G1E A;  3I7K A;  3IUL A;  3EQ7 A;  2P9I C;  1E8N A;  3SBP A;  3IJ1 A;  2BBK H;  4H5I A;  4J79 A;  3NIF A;  1FWX A;  3ZE2 A;  5EM2 A;  5CXC A;  3U4Y A;  1T2X A;  2I3S A;  4L9O A;  4ZN4 A;  3FCU A;  4JSX C;  2P9N C;  2OVQ B;  3SJL D;  3OKW A;  4GMB A;  4J0W A;  1PGU A;  2IUQ A;  3SCY A;  5E6S A;  2EID A;  3OL2 A;  2YNO A;  4J8B A;  3PXS D;  4FWW A;  5H14 A;  2IWK A;  4QQE A;  4A11 A;  3ZDX A;  4L3G D;  2IWF A;  3OW8 A;  1VE6 A;  2PBI B;  4JHN A;  5M5V A;  2VDP A;  3EWE A;  1SQJ A;  5IGQ A;  1K32 A;  2MTA H;  4A09 B;  1K8K C;  3RN1 D;  2IUP A;  3FGB A;  3QHY B;  2YNN A;  4FAN D;  2GC4 A;  4BL0 A;  3PSL A;  5CYK A;  3IIW A;  2WQ8 A;  1VZ2 A;  5TF2 A;  2YNP A;  4O3T B;  1NEX B;  3CIK B;  3PXW D;  2Z2N A;  1GXR A;  4A0B A;  3FCS A;  4AOW A;  4A7J A;  3C99 A;  3O4I A;  1XHM A;  3ORV D;  5TDH B;  2XDW A;  3JZH A;  4G1M A;  4BCC A;  4JSP C;  3V4P A;  4BUJ C;  4J87 A;  5IGO A;  5HE3 B;  5HE1 B;  1YR2 A;  5FKS A;  3MZL A;  3L4M D;  1N6F A;  2B4E A;  4CY5 A;  1L5G A;  4A2L A;  3RMZ D;  3UVK A;  3J81 g;  4LG9 A;  5I5J A;  4PSX B;  5HQG A;  4O1Q D;  4CI2 A;  4Z7N A;  3ODT A;  5M5R A;  3EI2 B;  5CXB B;  2XL2 A;  4NBM A;  4OZU A;  4GQB B;  3DXK C;  3NIG A;  5TEF A;  3NVN A;  1H2Y A;  1A12 A;  4X3E A;  4J81 A;  3A0F A;  4QT8 A;  4J84 A;  3SN6 B;  4TZ4 A;  1M1X A;  1L0Q A;  2HJ4 A;  3EQ8 A;  4FA1 D;  3JRO A;  4X61 B;  2J57 G;  1E5T A;  2H6K A;  3K26 A;  3KRX B;  3EQ9 A;  2IUV A;  1NR0 A;  3IJ0 A;  4Z7Q A;  3BG0 A;  3I7L A;  3V9F A;  1GG2 B;  2QZP A;  4J8G A;  4CZV A;  2CN2 A;  3PXT D;  4GGD A;  4AMZ A;  4CY3 A;  3VA6 A;  2B5N A;  4CY1 A;  3RRM C;  3K72 A;  5C2V B;  3F3F A;  4CY2 A;  1E8M A;  1H2X A;  5FKQ A;  5E6R A;  4NEN A;  4J73 A;  5FXY A;  3PVW B;  4IRZ A;  3JB9 L;  5EAM A;  3EI2 A;  5C2W B;  3VGZ A;  4ZOV A;  4GM8 A;  4Z8L A;  3IUQ A;  3JRP A;  1ERJ A;  3DWL C;  3PVU B;  4E5Z B;  1OMW B;  4GM3 A;  5SXM A;  4YVD A;  1VYH C;  3DM0 A;  5I5I A;  1K3I A;  3FM0 A;  3NVX A;  2QXV A;  3UKU C;  2XYI A;  1MDA H;  2CNX A;  2AH1 A;  1UOO A;  5HE0 B;  1H2Z A;  2H9N A;  1C9L A;  1C9I A;  3ZE1 A;  3VI3 A;  2OK6 A;  2W18 A;  2VDM A;  4Y5R D;  3IVM A;  4BCB A;  4FA4 D;  5GXH A;  3I7P A;  3IUR A;  2HU5 A;  3EI4 B;  2H6N A;  3O4H A;  2H68 A;  1JMZ B;  4CI1 A;  4KFM B;  3VH0 A;  5C86 A;  3BWS A;  3RSE C;  4RE5 A;  2J55 H;  1GOF A;  2OVR B;  4J77 A;  2XL3 A;  3OKY B;  2J56 H;  4AMY A;  1TBG A;  4AN1 A;  4JSN C;  4QRJ A;  5EMM B;  1PI6 A;  2H9L A;  3I7H A;  4IMM A;  3RN0 D;  4R7A B;  2VDR A;  2H14 A;  3AL9 A;  3T3M A;  1QNI A;  3O4J A;  4JT5 C;  4A08 B;  3IUM A;  1UOQ A;  3MMY A;  4QAM A;  3V4V A;  4PBY A;  3SLE D;  1VE7 A;  4E5Z A;  4E54 B;  5EML B;  3L4O D;  4ES0 A;  5HDB A;  2H6Q A;  3C5M A;  3OKT A;  2IUR A;  4U1E I;  2QR5 A;  5IJ7 E;  4ZOY A;  5E6U A;  3UKR C;  5FLX g;  4L3H D;  1PEV A;  2AGX A;  5KDO B;  3E0C A;  1S4U X;  4ERZ A;  1UOP A;  2HKM A;  5GSA A;  4PNK B;  4ERQ A;  4L1Q D;  3EI4 A;  4PC0 A;  1BPO A;  4I79 A;  5AMS A;  4WK2 A;  4ZOZ A;  4H5J A;  4AX4 A;  3C75 H;  3UR4 A;  4CZY A;  3DDU A;  4NC4 A;  4A09 A;  2Z2P A;  4WK4 A;  3EG6 A;  4WJK A;  3UVO A;  2P9U C;  3T3P A;  5THA A;  4CI8 A;  4CI3 A;  5HYN B;  5EMK B;  2EIE A;  5K19 A;  3JZN A;  1OLZ A;  3UVM A;  2G9A A;  4MMY A;  4PXW A;  4CZX A;  4A08 A;  2P9K C;  1XKS A;  3I89 A;  2OK4 A;  5EAP A;  3ULE C;  3J80 g;  4QL1 A;  4D9S A;  3OTT A;  2YBA A;  4RE6 A;  2Q7Q A;  3NVQ A;  1O6F A;  3IUJ A;  5M5T A;  2P9L C;  3JAM g;  3KRW B;  3PE7 A;  1MG2 A;  4J82 A;  2I0T A;  4LG8 A;  2P9S C;  2CO0 A;  2CE8 A;  4ESG A;  2EIB A;  4J78 A;  4GZ8 A;  3UVL A;  4XYH A;  4FA9 D;  4MMX A;  3MVD K;  4PBZ A;  2XU7 A;  4GQ1 A;  4O02 A;  3GFC A;  4JD2 C;  2BKL A;  4G55 A;  3SMR A;  5EAL A;  1YFQ A;  5EAR A;  1JV2 A;  3AL8 B;  5IC7 A;  3ZDZ A;  4O9D A;  1QFM A;  2H47 A;  3AFC A;  2JKX A;  2HYE A;  2IAA A;  3ZE0 A;  4GQ2 P;  1Q47 A;  4UM8 A;  5FFG A;  5CXB A;  1N6D A;  2I3T A;  4JSV C;  1UTC A;  2P9P C;  3V5W B;  5TEE A;  5C92 A;  1A0R B;  3I2N A;  2AGW A;  5FFO A;  3IIY A;  3EI3 B;  2CE9 A;  3EI1 B;  3ZDY A;  4L1M A;  3GD1 I;  2PM7 B;  1SQ9 A;  3VI4 A;  3CFS B;  2CN3 A;  5AJA A;  3K27 A;  2OVP B;  3V7D B;  3P4F A;  4Y7R A;  2I0R A;  1PBY B;  2HJB A;  5M5U A;  5C9Z B;  2H3X A;  2GC7 A;  2O9K A;  3O4G A;  4G56 B;  2EIC A;  4A0B B;  2CO0 C;  2BCJ B;  3EMH A;  2B5L A;  1QFS A;  3GRE A;  1I2M B;  5FKR A;  3SHF A;  3I8C A;  5JWZ A;  3IUN A;  3AL8 A;  3DXM C;  2HKR A;  2VDK A;  4JT6 C;  5K1C C;  4IA9 A;  3KCI A;  2AH0 A;  2EBS A;  3C9C A;  2AGZ A;  2HU7 A;  1JMX B;  2VDL A;  4FB1 D;  1U8C A;  3BG1 A;  1JJU B;  4LGN A;  4O2W A;  5A2Q g;  4ERY A;  3SWS D;  1U2V C;  4BH6 A;  3EI3 A;  5FQD A;  3W15 A;  5IJ8 E;  3EI1 A;  3IJE A;  5I5M A;  1GP2 B;  2VDO A;  4BP9 A;  3HFQ A;  4ZOX A;  1GOH A;  4XEI C;  4U7A A;  3ZWL B;  2HU8 A;  4HDJ A;  4MMZ A;  1P22 A;  4FAV D;  3MXX A;  2YMU A;  4O45 A;  5GXI A;  4J0X A;  3F3G A;  5M61 A;  3SBR A;  4DNV A;  3K6S A;  1U4C A;  3MZK A;  3N0E A;  4NAA A;  5B4W A;  5FA5 B;  2OJY A;  1O6G A;  3N0D A;  1XIP A;  3SFZ A;  5AFU 3;  2PM9 B;  2UZY B;  3OF7 A;  1H2W A;  3OKY A;  3JPX A;  3IJC A;  3I8E A;  4N14 A;  1R5M A;  3SBQ A;  1GOT B;  1MG3 A;  5M5S A;  4OWR A;  3I7N A;  3MKQ A;  3RLM D;  2HES X;  4BCD A;  1B9Y A;  4UI9 R;  5IT9 g;  2OIZ A;  3PSC B;  4GGC A;  4AN0 A;  4E54 A;  4A0A B;  2XZG A;  2H9P A;  2QC5 A;  4K3J B;  4DNW A; 
#chains in the Genus database with same CATH homology
 2B5M A;  4NSX A;  5EMJ B;  5H1M A;  5H17 A;  4D6V A;  3JZG A;  3DSM A;  3IKO A;  3CFV A;  3FRX A;  1N6E A;  2TRC B;  4AEZ A;  4XYI A;  5FKT A;  2HXC A;  2Z2O A;  3RFG A;  5EM2 B;  5CXC B;  3EU7 A;  4GM9 A;  4O3U B;  3UVN A;  3AH8 B;  4A2M A;  2AQ5 A;  2PM9 A;  3RFH A;  3F3P A;  3SXT D;  2AGL A;  4MK0 B;  1B9X A;  2H9M A;  2UZX B;  3OL2 B;  4EWR A;  4D0K A;  4FA5 D;  4GGA A;  2H13 A;  3MKS B;  4K3I D;  4A11 B;  4X63 B;  3I7O A;  2YB8 B;  4JXM A;  1TYQ C;  4X60 B;  4CC9 A;  4PSW B;  4A0A A;  4FHL A;  5HE2 B;  2PM6 B;  5GMK n;  1JOF A;  2GNQ A;  3B7F A;  3SVW D;  2I0S A;  2AGY A;  4J86 A;  5CYK B;  1RI6 A;  1SHY B;  2G99 A;  3I7K A;  2P9I C;  3SBP A;  3IJ1 A;  2BBK H;  4H5I A;  4J79 A;  1FWX A;  5EM2 A;  5CXC A;  3U4Y A;  2I3S A;  4ZN4 A;  4L9O A;  4JSX C;  2P9N C;  2OVQ B;  3SJL D;  3OKW A;  4GMB A;  4J0W A;  1PGU A;  2IUQ A;  3SCY A;  3OL2 A;  2YNO A;  4J8B A;  3PXS D;  4FWW A;  5H14 A;  2IWK A;  4QQE A;  4A11 A;  4L3G D;  2IWF A;  3OW8 A;  2PBI B;  3EWE A;  1SQJ A;  5IGQ A;  1K32 A;  2MTA H;  4A09 B;  1K8K C;  3RN1 D;  2IUP A;  3FGB A;  2YNN A;  4FAN D;  2GC4 A;  4BL0 A;  3PSL A;  5CYK A;  3IIW A;  5TF2 A;  2YNP A;  4O3T B;  1NEX B;  3CIK B;  3PXW D;  2Z2N A;  1GXR A;  4A0B A;  4AOW A;  4A7J A;  3C99 A;  1XHM A;  3ORV D;  5TDH B;  3JZH A;  4JSP C;  4BUJ C;  4J87 A;  5IGO A;  5HE3 B;  5HE1 B;  5FKS A;  3MZL A;  3L4M D;  1N6F A;  2B4E A;  4CY5 A;  4A2L A;  3RMZ D;  3UVK A;  3J81 g;  4LG9 A;  5I5J A;  4PSX B;  5HQG A;  4O1Q D;  4CI2 A;  3ODT A;  3EI2 B;  5CXB B;  2XL2 A;  4OZU A;  4GQB B;  3DXK C;  5TEF A;  3NVN A;  4X3E A;  4J81 A;  3A0F A;  4QT8 A;  4J84 A;  3SN6 B;  4TZ4 A;  1L0Q A;  2HJ4 A;  4FA1 D;  3JRO A;  4X61 B;  2J57 G;  2H6K A;  3K26 A;  3KRX B;  2IUV A;  1NR0 A;  3IJ0 A;  3BG0 A;  3I7L A;  3V9F A;  1GG2 B;  4J8G A;  4CZV A;  2CN2 A;  3PXT D;  4GGD A;  4CY3 A;  3VA6 A;  2B5N A;  4CY1 A;  3RRM C;  5C2V B;  3F3F A;  4CY2 A;  5FKQ A;  4J73 A;  5FXY A;  3PVW B;  3JB9 L;  5EAM A;  3EI2 A;  5C2W B;  3VGZ A;  4ZOV A;  4GM8 A;  4Z8L A;  3JRP A;  3PVU B;  1ERJ A;  3DWL C;  4E5Z B;  1OMW B;  4GM3 A;  5SXM A;  4YVD A;  1VYH C;  3DM0 A;  5I5I A;  3FM0 A;  3NVX A;  2QXV A;  3UKU C;  2XYI A;  1MDA H;  2CNX A;  2AH1 A;  5HE0 B;  2H9N A;  2OK6 A;  2W18 A;  4Y5R D;  4FA4 D;  5GXH A;  3I7P A;  3EI4 B;  2H6N A;  2H68 A;  1JMZ B;  4CI1 A;  4KFM B;  3VH0 A;  3BWS A;  3RSE C;  2J55 H;  2OVR B;  4J77 A;  2XL3 A;  3OKY B;  2J56 H;  1TBG A;  5EMM B;  4JSN C;  4QRJ A;  1PI6 A;  2H9L A;  3I7H A;  4IMM A;  3RN0 D;  4R7A B;  2H14 A;  3AL9 A;  1QNI A;  4JT5 C;  4A08 B;  3MMY A;  4PBY A;  3SLE D;  4E5Z A;  4E54 B;  5EML B;  3L4O D;  4ES0 A;  2H6Q A;  3C5M A;  3OKT A;  2IUR A;  4U1E I;  5IJ7 E;  4ZOY A;  3UKR C;  5FLX g;  4L3H D;  1PEV A;  2AGX A;  5KDO B;  3E0C A;  1S4U X;  4ERZ A;  2HKM A;  5GSA A;  4PNK B;  4ERQ A;  4L1Q D;  3EI4 A;  4PC0 A;  4I79 A;  5AMS A;  4ZOZ A;  4H5J A;  3C75 H;  3UR4 A;  4CZY A;  4A09 A;  2Z2P A;  3EG6 A;  3UVO A;  2P9U C;  5THA A;  4CI8 A;  4CI3 A;  5HYN B;  5EMK B;  5K19 A;  3JZN A;  1OLZ A;  3UVM A;  2G9A A;  4PXW A;  4CZX A;  4A08 A;  2P9K C;  1XKS A;  3I89 A;  2OK4 A;  5EAP A;  3ULE C;  3J80 g;  4QL1 A;  3OTT A;  2YBA A;  2Q7Q A;  3NVQ A;  2P9L C;  3JAM g;  3KRW B;  3PE7 A;  1MG2 A;  4J82 A;  2I0T A;  4LG8 A;  2P9S C;  2CO0 A;  2CE8 A;  4ESG A;  4J78 A;  4GZ8 A;  3UVL A;  4XYH A;  4FA9 D;  4PBZ A;  2XU7 A;  4GQ1 A;  3GFC A;  4JD2 C;  3SMR A;  5EAL A;  1YFQ A;  5EAR A;  3AL8 B;  5IC7 A;  4O9D A;  2H47 A;  3AFC A;  2HYE A;  2IAA A;  4GQ2 P;  1Q47 A;  5CXB A;  1N6D A;  2I3T A;  4JSV C;  2P9P C;  3V5W B;  5TEE A;  1A0R B;  3I2N A;  2AGW A;  3IIY A;  3EI3 B;  2CE9 A;  3EI1 B;  2PM7 B;  1SQ9 A;  3CFS B;  2CN3 A;  5AJA A;  3K27 A;  2OVP B;  3V7D B;  3P4F A;  4Y7R A;  2I0R A;  1PBY B;  2HJB A;  5C9Z B;  2H3X A;  2GC7 A;  2O9K A;  4G56 B;  4A0B B;  2CO0 C;  2BCJ B;  3EMH A;  2B5L A;  3GRE A;  5FKR A;  3SHF A;  3I8C A;  5JWZ A;  3AL8 A;  3DXM C;  2HKR A;  4JT6 C;  5K1C C;  4IA9 A;  2AH0 A;  2EBS A;  3C9C A;  2AGZ A;  1JMX B;  4FB1 D;  3BG1 A;  1JJU B;  4LGN A;  5A2Q g;  4ERY A;  3SWS D;  1U2V C;  4BH6 A;  3EI3 A;  5FQD A;  3W15 A;  5IJ8 E;  3EI1 A;  5I5M A;  1GP2 B;  3HFQ A;  4ZOX A;  4XEI C;  4U7A A;  3ZWL B;  4HDJ A;  1P22 A;  4FAV D;  3MXX A;  2YMU A;  4O45 A;  5GXI A;  4J0X A;  3F3G A;  3SBR A;  1U4C A;  3MZK A;  3N0E A;  5B4W A;  5FA5 B;  2OJY A;  3N0D A;  1XIP A;  3SFZ A;  5AFU 3;  2PM9 B;  2UZY B;  3OKY A;  3JPX A;  3IJC A;  3I8E A;  4N14 A;  1R5M A;  3SBQ A;  1GOT B;  1MG3 A;  4OWR A;  3I7N A;  3MKQ A;  3RLM D;  2HES X;  1B9Y A;  4UI9 R;  5IT9 g;  2OIZ A;  3PSC B;  4GGC A;  4E54 A;  4A0A B;  2H9P A;  2QC5 A;  4K3J B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...