4EWRA

X-ray structure of wdr5-setd1a win motif peptide binary complex
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
304
structure length
304
Chain Sequence
b'VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD repeat-containing protein 5
publication title Structural basis for WDR5 interaction (Win) motif recognition in human SET1 family histone methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/transferase
total genus 102
structure length 304
sequence length 304
ec nomenclature
pdb deposition date 2012-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4ewrA00
4J81A 3ULEC 4Y5RD 2PM9B 2PM7B 2H9NA 5HYNB 3FRXA 4CI3A 3BWSA 4GGDA 3AL9A 5FKQA 2Q7QA 2GC4A 2OVQB 2GC7A 4EWRA 3OKWA 3RMZD 2W18A 3A0FA 3CFVA 1NR0A 3RFHA 5IC7A 2H6NA 2H9MA 3EI4B 4ZOVA 1YFQA 5IT9g 2XYIA 4YVDA 5I5MA 3C75H 1Q47A 4PSXB 2HESX 4ESGA 4CZYA 1SQ9A 4FA5D 3SMRA 3I7NA 3IJ0A 4A11B 3EI2B 3PVWB 4E54A 3FGBA 2P9NC 2HJ4A 2HXCA 1B9XA 1XKSA 5EMMB 3UKUC 3RN1D 4JSPC 5EARA 5FXYA 3KRXB 4NSXA 5CXCA 3EMHA 5CYKA 1MDAH 1N6FA 2H9LA 4O9DA 2AGYA 4FB1D 2IUPA 2PM6B 2I0TA 3CIKB 3I89A 5GMKn 3PXTD 3V9FA 5AMSA 5I5JA 2I3SA 4ERYA 5FKSA 2TRCB 3EI1B 3I7OA 2H68A 3V7DB 4GGAA 4GQ1A 5H17A 3IKOA 5EMJB 4N14A 4PSWB 3JZNA 4QQEA 4ZOZA 1XHMA 3OL2B 4CI2A 4LGNA 4E5ZB 5FQDA 3AH8B 5CXBA 4O45A 3E0CA 4J8GA 2XL3A 4GMBA 1K32A 4GZ8A 4G56B 4JXMA 1A0RB 1GG2B 2CN3A 2AH0A 5SXMA 3I7PA 3MZLA 4X60B 4U1EI 3I8EA 4J78A 2H47A 3MXXA 2OJYA 5TEFA 3PSCB 3SCYA 1OMWB 1U2VC 4X3EA 2IWFA 3SHFA 1FWXA 3DXMC 4L3GD 2H6QA 4JSVC 1OLZA 1PBYB 4X63B 3RFGA 1P22A 2HKRA 4J73A 3EWEA 3OKYA 2GNQA 3JB9L 1U4CA 3UKRC 1JMZB 2OIZA 3JROA 3UVKA 3DXKC 3N0EA 3UVLA 2PBIB 2B5LA 4LG9A 3PXSD 4HDJA 2CE9A 4A0AA 2HYEA 3PXWD 5C2WB 2XU7A 4A09B 2YNPA 4I79A 3PVUB 4GM8A 1PEVA 3EI3A 3EU7A 2I3TA 2CO0C 3ODTA 1L0QA 3SN6B 2CE8A 2YBAA 3ORVD 4GQ2P 5EMLB 1S4UX 3SJLD 4JSXC 2AGLA 1GP2B 4FAND 3ZWLB 3SFZA 3PSLA 3L4MD 1B9YA 5AJAA 3RLMD 4J77A 5GXIA 3K26A 4Z8LA 4PC0A 2J56H 4A08A 4K3JB 4ZOYA 5TDHB 3CFSB 2AGZA 4J86A 4ES0A 1NEXB 3SXTD 4L9OA 3JZHA 2MTAH 2O9KA 4Y7RA 4CC9A 2Z2NA 3VH0A 5EMKB 2AQ5A 4XYIA 3F3FA 5C9ZB 3KRWB 3BG0A 3PE7A 3UVOA 3MKSB 4A0BA 3C9CA 4E54B 3L4OD 2BBKH 2XL2A 5GSAA 3W15A 3OW8A 3C99A 4PXWA 5CXCB 5KDOB 3N0DA 3RRMC 5CYKB 2J57G 4J79A 4R7AB 4CI8A 3JRPA 2IAAA 3F3PA 4U7AA 4JT5C 4A2MA 2I0SA 3JAMg 5IJ8E 3I7HA 3MKQA 4GM3A 5I5IA 3NVQA 2B5MA 5JWZA 2CNXA 5GXHA 5TEEA 5AFU3 5IGQA 5K19A 5EM2A 3BG1A 3VGZA 3OKTA 3I7LA 2YNNA 1GXRA 3OTTA 3JZGA 4ZOXA 3SBQA 4CY2A 4ERQA 3F3GA 4CY5A 2J55H 5CXBB 5IJ7E 4L1QD 3AL8A 2H13A 1JOFA 2OVPB 4OWRA 4O1QD 5HE3B 1SHYB 4H5IA 4ERZA 1N6EA 5HE2B 4CZVA 2QXVA 4J87A 5EALA 3GREA 2IUVA 4OZUA 1GOTB 4PBZA 2AGXA 2G99A 4QRJA 5H14A 4O3UB 5EAMA 2G9AA 2Z2PA 5B4WA 3C5MA 1JJUB 2PM9A 3IJCA 5HQGA 5EAPA 4GQBB 3SBPA 1XIPA 2BCJB 3OKYB 3IIWA 3SLED 2AH1A 2P9LC 4FA9D 4A0AB 4BUJC 4XEIC 2HJBA 3EI4A 3GFCA 4J82A 5FKRA 3I7KA 4LG8A 3IJ1A 2P9PC 4QL1A 2H9PA 3EI3B 2Z2OA 4J0WA 3UVNA 2IUQA 1PGUA 4FA4D 2OVRB 3NVXA 4A11A 3EI2A 5HE1B 5IGOA 2QC5A 2AGWA 4AOWA 2HKMA 4TZ4A 3EG6A 2H6KA 2I0RA 4A7JA 3AFCA 1MG3A 4CY1A 4CI1A 1K8KC 3DWLC 4A08B 4BL0A 4J84A 5H1MA 2H3XA 1TBGA 4L3HD 4FWWA 1ERJA 3J81g 4IA9A 1JMXB 2IWKA 4X61B 5FKTA 3K27A 2CO0A 2P9IC 4BH6A 4A2LA 2YNOA 2CN2A 3EI1A 2H14A 5C2VB 5TF2A 5THAA 3RSEC 3SBRA 3DM0A 1MG2A 1N6DA 1R5MA 3U4YA 4A0BB 3NVNA 1RI6A 3DSMA 2P9KC 4K3ID 5K1CC 4IMMA 1QNIA 1VYHC 4CY3A 2YB8B 3RN0D 3HFQA 2B4EA 3OL2A 3UR4A 2OK4A 2P9SC 4E5ZA 4J0XA 2YMUA 2B5NA 3MZKA 4H5JA 5FA5B 3P4FA 4XYHA 4UI9R 3V5WB 3J80g 1SQJA 3B7FA 4FA1D 4MK0B 1PI6A 4J8BA 3JPXA 4AEZA 4FAVD 4GGCA 4GM9A 3SVWD 2EBSA 3IIYA 3UVMA 4JD2C 4D6VA 4FHLA 4JT6C 4KFMB 4PNKB 3FM0A 2UZXB 5EM2B 3SWSD 3I8CA 1TYQC 4QT8A 2UZYB 4O3TB 4ZN4A 3MMYA 3I2NA 3VA6A 3AL8B 4PBYA 4A09A 2P9UC 4JSNC 5HE0B 2IURA 2OK6A 4D0KA 5FLXg 5A2Qg 4CZXA
chains in the Genus database with same CATH superfamily
4J81A 3EQ7A 3OF7A 3ULEC 4Y5RD 4NAAA 2PM9B 2PM7B 2H9NA 5HYNB 3FRXA 4CI3A 3BWSA 2VDRA 4GGDA 3AL9A 5FKQA 2Q7QA 2GC4A 2OVQB 2GC7A 4EWRA 2EIBA 3OKWA 3GC3B 3RMZD 2W18A 1VE7A 3A0FA 3MUOA 3CFVA 1NR0A 3RFHA 4BCDA 5IC7A 2H6NA 2H9MA 5E6UA 3EI4B 4ZOVA 1GOGA 2WQ8A 1YFQA 3V4VA 1GOFA 5IT9g 2XYIA 4YVDA 3IVMA 5I5MA 3C75H 2QR5A 1Q47A 4PSXB 1UOOA 4G1MA 2HESX 5E6SA 4ESGA 1C9IA 4CZYA 1SQ9A 4FA5D 1U8CA 3SMRA 3I7NA 3IJ0A 4BCBA 4A11B 2XE4A 3EI2B 3ZE2A 3K71A 3PVWB 4E54A 3FGBA 4RE5A 2P9NC 4AX4A 2HJ4A 3ZE0A 2HXCA 1B9XA 1XKSA 5EMMB 3UKUC 3RN1D 4JSPC 4NBMA 5EARA 5FXYA 4DNVA 3KRXB 4NSXA 4O02A 5M5TA 1UOQA 5CXCA 2VZ1A 3EMHA 4L1MA 1MDAH 1N6FA 2H9LA 5CYKA 4O9DA 1QFSA 2AGYA 4FB1D 3EQ9A 4MMXA 2IUPA 2VDMA 2PM6B 2I0TA 3CIKB 3I89A 5GMKn 3PXTD 3V9FA 3ZE1A 5AMSA 1H2XA 4G1EA 4QAMA 5I5JA 2I3SA 4ERYA 5FKSA 2TRCB 3EI1B 3I7OA 2H68A 1L5GA 3V7DB 4GGAA 4GQ1A 5H17A 3IKOA 5EMJB 1VZ3A 4N14A 4PSWB 3JZNA 4QQEA 4ZOZA 1XHMA 3OL2B 4CI2A 4LGNA 4MMYA 4JHNA 5FQDA 3AH8B 4E5ZB 5CXBA 4O45A 4WJKA 4Z7QA 3E0CA 4J8GA 5M61A 2XL3A 5HDBA 4GMBA 1K32A 2XZGA 4G56B 4GZ8A 4JXMA 1A0RB 1GG2B 2CN3A 3K72A 2AH0A 5SXMA 3I7PA 3MZLA 2BKLA 4X60B 3QHYB 4U1EI 3I8EA 4J78A 1E5TA 2H47A 3MXXA 2OJYA 5TEFA 3PSCB 3SCYA 1OMWB 1U2VC 2JKXA 2IWFA 4X3EA 3V4PA 3SHFA 3T3PA 1FWXA 3DXMC 4L3GD 2EIEA 1I2MB 2H6QA 4JSVC 1OLZA 1PBYB 4X63B 3RFGA 1P22A 2HKRA 4J73A 3EWEA 3OKYA 2GNQA 5FFGA 3JB9L 1U4CA 3UKRC 1JMZB 2OIZA 3JROA 3UVKA 3DXKC 3N0EA 2VDPA 3UVLA 3ZDXA 2PBIB 2B5LA 3PXSD 4HDJA 4LG9A 2CE9A 4A0AA 2HYEA 4MMZA 1H2YA 3PXWD 5C2WB 2HU5A 2XU7A 4A09B 2YNPA 4I79A 3PVUB 4GM8A 1PEVA 3EI3A 1H2ZA 3EU7A 2I3TA 3KCIA 1JTDB 2CO0C 3ODTA 1L0QA 1TYEA 4DNUA 1GOHA 3SN6B 2CE8A 2YBAA 3ORVD 4GQ2P 5EMLB 1S4UX 4UM8A 5E6RA 3SJLD 3FCSA 4DNWA 4JSXC 2AGLA 1GP2B 4FAND 4WK2A 3ZWLB 3O4JA 3SFZA 3PSLA 3L4MD 1B9YA 3GD1I 5AJAA 3RLMD 4J77A 5GXIA 3K26A 4Z8LA 4PC0A 2J56H 4NC4A 4A08A 2HU8A 4K3JB 4ZOYA 5TDHB 3CFSB 2AGZA 3IJEA 4J86A 4ES0A 1NEXB 3SXTD 1UTCA 4L9OA 3JZHA 2MTAH 2O9KA 4Y7RA 4CC9A 2Z2NA 3VH0A 1JV2A 5EMKB 1A12A 3QI0A 2AQ5A 4XYIA 2EICA 3F3FA 5C9ZB 3KRWB 3BG0A 3PE7A 3UVOA 2VC2A 3MKSB 3C9CA 4A0BA 4E54B 3L4OD 2VDNA 2BBKH 2XL2A 5GSAA 3W15A 3OW8A 3K6SA 3C99A 4PXWA 5CXCB 5KDOB 3N0DA 3O4HA 3EQ8A 3RRMC 4BP9A 5CYKB 2J57G 2XDWA 4J79A 4R7AB 4Z7OA 1QFMA 3VI4A 4CI8A 3JRPA 2IAAA 3F3PA 4WK0A 4U7AA 4JT5C 4A2MA 1BPOA 2I0SA 3JAMg 5IJ8E 3I7HA 3MKQA 4GM3A 5I5IA 3NVQA 2B5MA 5JWZA 2CNXA 5GXHA 5FFOA 5TEEA 2HU7A 5AFU3 5IGQA 5K19A 1O6GA 3BG1A 5EM2A 1C9LA 3VGZA 1E8MA 3OKTA 3I7LA 2YNNA 1GXRA 3OTTA 3JZGA 4ZOXA 3SBQA 3IULA 4AN1A 4CY2A 4ERQA 3NIFA 3F3GA 4CY5A 2J55H 5CXBB 5M5SA 5IJ7E 4L1QD 4RE6A 3NIGA 3AL8A 2H13A 5M5RA 1JOFA 2OVPB 4OWRA 4O1QD 5HE3B 1SHYB 4H5IA 4ERZA 1N6EA 4BCCA 5HE2B 4CZVA 2QXVA 4J87A 5EALA 3GREA 2IUVA 4OZUA 4AN0A 4IRZA 1GOTB 5C92A 4PBZA 2AGXA 2G99A 1YR2A 4QRJA 5H14A 4O3UB 5EAMA 1T2XA 2G9AA 2Z2PA 5B4WA 3C5MA 1JJUB 2PM9A 3IJCA 5HQGA 5EAPA 4GQBB 3NIDA 3SBPA 1XIPA 2BCJB 3OKYB 3IIWA 3SLED 2AH1A 3T3MA 1VE6A 3VI3A 2P9LC 4FA9D 4A0AB 4BUJC 4XEIC 2HJBA 3EI4A 3GFCA 4J82A 5FKRA 3I7KA 4LG8A 3IJ1A 2P9PC 4QL1A 2H9PA 3EI3B 2EIDA 5C86A 2Z2OA 4J0WA 3UVNA 1E8NA 2IUQA 1PGUA 4FA4D 2OVRB 4AMYA 3NVXA 4A11A 3EI2A 5HE1B 5IGOA 2QC5A 2AGWA 4AOWA 1K3IA 2HKMA 4TZ4A 3EG6A 2H6KA 3IUQA 4D9SA 3IUJA 2I0RA 4A7JA 3AFCA 1MG3A 4JHPC 3O4GA 4CY1A 4Z7NA 4CI1A 1K8KC 3DWLC 4A08B 4BL0A 4J84A 5H1MA 2H3XA 1TBGA 4L3HD 4FWWA 1ERJA 3IUNA 3ZDYA 3J81g 2VDLA 4IA9A 1JMXB 2IWKA 4X61B 5FKTA 2VDKA 1H2WA 3K27A 2CO0A 2P9IC 4BH6A 4A2LA 2YNOA 4WK4A 2CN2A 3EI1A 2H14A 4O2WA 5C2VB 5TF2A 5THAA 3O4IA 3RSEC 3SBRA 3DM0A 1UOPA 1MG2A 1N6DA 1R5MA 3U4YA 3IURA 4A0BB 3NVNA 1RI6A 3DSMA 2P9KC 4K3ID 5K1CC 4AMZA 4IMMA 1QNIA 1VYHC 3DDUA 2YB8B 4CY3A 3MVDK 3RN0D 3HFQA 2B4EA 3OL2A 3UR4A 2OK4A 2P9SC 4E5ZA 4J0XA 2YMUA 2B5NA 3MZKA 4H5JA 5FA5B 3P4FA 4XYHA 3MUNA 4UI9R 3V5WB 3J80g 1SQJA 3B7FA 4FA1D 4MK0B 1O6FA 1PI6A 3ZDZA 4J8BA 3JPXA 4NENA 4AEZA 4GGCA 4GM9A 4FAVD 3SVWD 2EBSA 2VZ3A 5M5UA 3IIYA 3UVMA 4JD2C 4D6VA 4FHLA 4JT6C 4KFMB 4PNKB 2QZPA 3FM0A 2UZXB 5M5VA 5EM2B 3IUMA 3SWSD 3I8CA 1TYQC 4QT8A 2UZYB 4O3TB 4ZN4A 3MMYA 3FCUA 4G55A 3I2NA 3VA6A 4BP8A 2VDQA 3AL8B 4PBYA 4A09A 2P9UC 4JSNC 5HE0B 1VZ2A 2IURA 2OK6A 4D0KA 1M1XA 4UM9A 5FLXg 5A2Qg 4CZXA 2VDOA
chains in the Genus database with same CATH topology
4J81A 3ULEC 4Y5RD 2PM9B 2PM7B 2H9NA 5HYNB 3FRXA 4CI3A 3BWSA 4GGDA 3AL9A 5FKQA 2Q7QA 2GC4A 2OVQB 2GC7A 4EWRA 3OKWA 3RMZD 2W18A 3A0FA 3CFVA 1NR0A 3RFHA 5IC7A 2H6NA 2H9MA 3EI4B 4ZOVA 1YFQA 5IT9g 2XYIA 4YVDA 5I5MA 3C75H 1Q47A 4PSXB 2HESX 4ESGA 4CZYA 1SQ9A 4FA5D 3SMRA 3I7NA 3IJ0A 4A11B 3EI2B 3PVWB 4E54A 3FGBA 2P9NC 2HJ4A 2HXCA 1B9XA 1XKSA 5EMMB 3UKUC 3RN1D 4JSPC 5EARA 5FXYA 3KRXB 4NSXA 5CXCA 3EMHA 5CYKA 1MDAH 1N6FA 2H9LA 4O9DA 2AGYA 4FB1D 2IUPA 2PM6B 2I0TA 3CIKB 3I89A 5GMKn 3PXTD 3V9FA 5AMSA 5I5JA 2I3SA 4ERYA 5FKSA 2TRCB 3EI1B 3I7OA 2H68A 3V7DB 4GGAA 4GQ1A 5H17A 3IKOA 5EMJB 4N14A 4PSWB 3JZNA 4QQEA 4ZOZA 1XHMA 3OL2B 4CI2A 4LGNA 4E5ZB 5FQDA 3AH8B 5CXBA 4O45A 3E0CA 4J8GA 2XL3A 4GMBA 1K32A 4GZ8A 4G56B 4JXMA 1A0RB 1GG2B 2CN3A 2AH0A 5SXMA 3I7PA 3MZLA 4X60B 4U1EI 3I8EA 4J78A 2H47A 3MXXA 2OJYA 5TEFA 3PSCB 3SCYA 1OMWB 1U2VC 4X3EA 2IWFA 3SHFA 1FWXA 3DXMC 4L3GD 2H6QA 4JSVC 1OLZA 1PBYB 4X63B 3RFGA 1P22A 2HKRA 4J73A 3EWEA 3OKYA 2GNQA 3JB9L 1U4CA 3UKRC 1JMZB 2OIZA 3JROA 3UVKA 3DXKC 3N0EA 3UVLA 2PBIB 2B5LA 4LG9A 3PXSD 4HDJA 2CE9A 4A0AA 2HYEA 3PXWD 5C2WB 2XU7A 4A09B 2YNPA 4I79A 3PVUB 4GM8A 1PEVA 3EI3A 3EU7A 2I3TA 2CO0C 3ODTA 1L0QA 3SN6B 2CE8A 2YBAA 3ORVD 4GQ2P 5EMLB 1S4UX 3SJLD 4JSXC 2AGLA 1GP2B 4FAND 3ZWLB 3SFZA 3PSLA 3L4MD 1B9YA 5AJAA 3RLMD 4J77A 5GXIA 3K26A 4Z8LA 4PC0A 2J56H 4A08A 4K3JB 4ZOYA 5TDHB 3CFSB 2AGZA 4J86A 4ES0A 1NEXB 3SXTD 4L9OA 3JZHA 2MTAH 2O9KA 4Y7RA 4CC9A 2Z2NA 3VH0A 5EMKB 2AQ5A 4XYIA 3F3FA 5C9ZB 3KRWB 3BG0A 3PE7A 3UVOA 3MKSB 4A0BA 3C9CA 4E54B 3L4OD 2BBKH 2XL2A 5GSAA 3W15A 3OW8A 3C99A 4PXWA 5CXCB 5KDOB 3N0DA 3RRMC 5CYKB 2J57G 4J79A 4R7AB 4CI8A 3JRPA 2IAAA 3F3PA 4U7AA 4JT5C 4A2MA 2I0SA 3JAMg 5IJ8E 3I7HA 3MKQA 4GM3A 5I5IA 3NVQA 2B5MA 5JWZA 2CNXA 5GXHA 5TEEA 5AFU3 5IGQA 5K19A 5EM2A 3BG1A 3VGZA 3OKTA 3I7LA 2YNNA 1GXRA 3OTTA 3JZGA 4ZOXA 3SBQA 4CY2A 4ERQA 3F3GA 4CY5A 2J55H 5CXBB 5IJ7E 4L1QD 3AL8A 2H13A 1JOFA 2OVPB 4OWRA 4O1QD 5HE3B 1SHYB 4H5IA 4ERZA 1N6EA 5HE2B 4CZVA 2QXVA 4J87A 5EALA 3GREA 2IUVA 4OZUA 1GOTB 4PBZA 2AGXA 2G99A 4QRJA 5H14A 4O3UB 5EAMA 2G9AA 2Z2PA 5B4WA 3C5MA 1JJUB 2PM9A 3IJCA 5HQGA 5EAPA 4GQBB 3SBPA 1XIPA 2BCJB 3OKYB 3IIWA 3SLED 2AH1A 2P9LC 4FA9D 4A0AB 4BUJC 4XEIC 2HJBA 3EI4A 3GFCA 4J82A 5FKRA 3I7KA 4LG8A 3IJ1A 2P9PC 4QL1A 2H9PA 3EI3B 2Z2OA 4J0WA 3UVNA 2IUQA 1PGUA 4FA4D 2OVRB 3NVXA 4A11A 3EI2A 5HE1B 5IGOA 2QC5A 2AGWA 4AOWA 2HKMA 4TZ4A 3EG6A 2H6KA 2I0RA 4A7JA 3AFCA 1MG3A 4CY1A 4CI1A 1K8KC 3DWLC 4A08B 4BL0A 4J84A 5H1MA 2H3XA 1TBGA 4L3HD 4FWWA 1ERJA 3J81g 4IA9A 1JMXB 2IWKA 4X61B 5FKTA 3K27A 2CO0A 2P9IC 4BH6A 4A2LA 2YNOA 2CN2A 3EI1A 2H14A 5C2VB 5TF2A 5THAA 3RSEC 3SBRA 3DM0A 1MG2A 1N6DA 1R5MA 3U4YA 4A0BB 3NVNA 1RI6A 3DSMA 2P9KC 4K3ID 5K1CC 4IMMA 1QNIA 1VYHC 4CY3A 2YB8B 3RN0D 3HFQA 2B4EA 3OL2A 3UR4A 2OK4A 2P9SC 4E5ZA 4J0XA 2YMUA 2B5NA 3MZKA 4H5JA 5FA5B 3P4FA 4XYHA 4UI9R 3V5WB 3J80g 1SQJA 3B7FA 4FA1D 4MK0B 1PI6A 4J8BA 3JPXA 4AEZA 4FAVD 4GGCA 4GM9A 3SVWD 2EBSA 3IIYA 3UVMA 4JD2C 4D6VA 4FHLA 4JT6C 4KFMB 4PNKB 3FM0A 2UZXB 5EM2B 3SWSD 3I8CA 1TYQC 4QT8A 2UZYB 4O3TB 4ZN4A 3MMYA 3I2NA 3VA6A 3AL8B 4PBYA 4A09A 2P9UC 4JSNC 5HE0B 2IURA 2OK6A 4D0KA 5FLXg 5A2Qg 4CZXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J81 A;  3ULE C;  4Y5R D;  2PM9 B;  2PM7 B;  2H9N A;  5HYN B;  3FRX A;  4CI3 A;  3BWS A;  4GGD A;  3AL9 A;  5FKQ A;  2Q7Q A;  2GC4 A;  2OVQ B;  2GC7 A;  4EWR A;  3OKW A;  3RMZ D;  2W18 A;  3A0F A;  3CFV A;  1NR0 A;  3RFH A;  5IC7 A;  2H6N A;  2H9M A;  3EI4 B;  4ZOV A;  1YFQ A;  5IT9 g;  2XYI A;  4YVD A;  5I5M A;  3C75 H;  1Q47 A;  4PSX B;  2HES X;  4ESG A;  4CZY A;  1SQ9 A;  4FA5 D;  3SMR A;  3I7N A;  3IJ0 A;  4A11 B;  3EI2 B;  3PVW B;  4E54 A;  3FGB A;  2P9N C;  2HJ4 A;  2HXC A;  1B9X A;  1XKS A;  5EMM B;  3UKU C;  3RN1 D;  4JSP C;  5EAR A;  5FXY A;  3KRX B;  4NSX A;  5CXC A;  3EMH A;  5CYK A;  1MDA H;  1N6F A;  2H9L A;  4O9D A;  2AGY A;  4FB1 D;  2IUP A;  2PM6 B;  2I0T A;  3CIK B;  3I89 A;  5GMK n;  3PXT D;  3V9F A;  5AMS A;  5I5J A;  2I3S A;  4ERY A;  5FKS A;  2TRC B;  3EI1 B;  3I7O A;  2H68 A;  3V7D B;  4GGA A;  4GQ1 A;  5H17 A;  3IKO A;  5EMJ B;  4N14 A;  4PSW B;  3JZN A;  4QQE A;  4ZOZ A;  1XHM A;  3OL2 B;  4CI2 A;  4LGN A;  4E5Z B;  5FQD A;  3AH8 B;  5CXB A;  4O45 A;  3E0C A;  4J8G A;  2XL3 A;  4GMB A;  1K32 A;  4GZ8 A;  4G56 B;  4JXM A;  1A0R B;  1GG2 B;  2CN3 A;  2AH0 A;  5SXM A;  3I7P A;  3MZL A;  4X60 B;  4U1E I;  3I8E A;  4J78 A;  2H47 A;  3MXX A;  2OJY A;  5TEF A;  3PSC B;  3SCY A;  1OMW B;  1U2V C;  4X3E A;  2IWF A;  3SHF A;  1FWX A;  3DXM C;  4L3G D;  2H6Q A;  4JSV C;  1OLZ A;  1PBY B;  4X63 B;  3RFG A;  1P22 A;  2HKR A;  4J73 A;  3EWE A;  3OKY A;  2GNQ A;  3JB9 L;  1U4C A;  3UKR C;  1JMZ B;  2OIZ A;  3JRO A;  3UVK A;  3DXK C;  3N0E A;  3UVL A;  2PBI B;  2B5L A;  4LG9 A;  3PXS D;  4HDJ A;  2CE9 A;  4A0A A;  2HYE A;  3PXW D;  5C2W B;  2XU7 A;  4A09 B;  2YNP A;  4I79 A;  3PVU B;  4GM8 A;  1PEV A;  3EI3 A;  3EU7 A;  2I3T A;  2CO0 C;  3ODT A;  1L0Q A;  3SN6 B;  2CE8 A;  2YBA A;  3ORV D;  4GQ2 P;  5EML B;  1S4U X;  3SJL D;  4JSX C;  2AGL A;  1GP2 B;  4FAN D;  3ZWL B;  3SFZ A;  3PSL A;  3L4M D;  1B9Y A;  5AJA A;  3RLM D;  4J77 A;  5GXI A;  3K26 A;  4Z8L A;  4PC0 A;  2J56 H;  4A08 A;  4K3J B;  4ZOY A;  5TDH B;  3CFS B;  2AGZ A;  4J86 A;  4ES0 A;  1NEX B;  3SXT D;  4L9O A;  3JZH A;  2MTA H;  2O9K A;  4Y7R A;  4CC9 A;  2Z2N A;  3VH0 A;  5EMK B;  2AQ5 A;  4XYI A;  3F3F A;  5C9Z B;  3KRW B;  3BG0 A;  3PE7 A;  3UVO A;  3MKS B;  4A0B A;  3C9C A;  4E54 B;  3L4O D;  2BBK H;  2XL2 A;  5GSA A;  3W15 A;  3OW8 A;  3C99 A;  4PXW A;  5CXC B;  5KDO B;  3N0D A;  3RRM C;  5CYK B;  2J57 G;  4J79 A;  4R7A B;  4CI8 A;  3JRP A;  2IAA A;  3F3P A;  4U7A A;  4JT5 C;  4A2M A;  2I0S A;  3JAM g;  5IJ8 E;  3I7H A;  3MKQ A;  4GM3 A;  5I5I A;  3NVQ A;  2B5M A;  5JWZ A;  2CNX A;  5GXH A;  5TEE A;  5AFU 3;  5IGQ A;  5K19 A;  5EM2 A;  3BG1 A;  3VGZ A;  3OKT A;  3I7L A;  2YNN A;  1GXR A;  3OTT A;  3JZG A;  4ZOX A;  3SBQ A;  4CY2 A;  4ERQ A;  3F3G A;  4CY5 A;  2J55 H;  5CXB B;  5IJ7 E;  4L1Q D;  3AL8 A;  2H13 A;  1JOF A;  2OVP B;  4OWR A;  4O1Q D;  5HE3 B;  1SHY B;  4H5I A;  4ERZ A;  1N6E A;  5HE2 B;  4CZV A;  2QXV A;  4J87 A;  5EAL A;  3GRE A;  2IUV A;  4OZU A;  1GOT B;  4PBZ A;  2AGX A;  2G99 A;  4QRJ A;  5H14 A;  4O3U B;  5EAM A;  2G9A A;  2Z2P A;  5B4W A;  3C5M A;  1JJU B;  2PM9 A;  3IJC A;  5HQG A;  5EAP A;  4GQB B;  3SBP A;  1XIP A;  2BCJ B;  3OKY B;  3IIW A;  3SLE D;  2AH1 A;  2P9L C;  4FA9 D;  4A0A B;  4BUJ C;  4XEI C;  2HJB A;  3EI4 A;  3GFC A;  4J82 A;  5FKR A;  3I7K A;  4LG8 A;  3IJ1 A;  2P9P C;  4QL1 A;  2H9P A;  3EI3 B;  2Z2O A;  4J0W A;  3UVN A;  2IUQ A;  1PGU A;  4FA4 D;  2OVR B;  3NVX A;  4A11 A;  3EI2 A;  5HE1 B;  5IGO A;  2QC5 A;  2AGW A;  4AOW A;  2HKM A;  4TZ4 A;  3EG6 A;  2H6K A;  2I0R A;  4A7J A;  3AFC A;  1MG3 A;  4CY1 A;  4CI1 A;  1K8K C;  3DWL C;  4A08 B;  4BL0 A;  4J84 A;  5H1M A;  2H3X A;  1TBG A;  4L3H D;  4FWW A;  1ERJ A;  3J81 g;  4IA9 A;  1JMX B;  2IWK A;  4X61 B;  5FKT A;  3K27 A;  2CO0 A;  2P9I C;  4BH6 A;  4A2L A;  2YNO A;  2CN2 A;  3EI1 A;  2H14 A;  5C2V B;  5TF2 A;  5THA A;  3RSE C;  3SBR A;  3DM0 A;  1MG2 A;  1N6D A;  1R5M A;  3U4Y A;  4A0B B;  3NVN A;  1RI6 A;  3DSM A;  2P9K C;  4K3I D;  5K1C C;  4IMM A;  1QNI A;  1VYH C;  4CY3 A;  2YB8 B;  3RN0 D;  3HFQ A;  2B4E A;  3OL2 A;  3UR4 A;  2OK4 A;  2P9S C;  4E5Z A;  4J0X A;  2YMU A;  2B5N A;  3MZK A;  4H5J A;  5FA5 B;  3P4F A;  4XYH A;  4UI9 R;  3V5W B;  3J80 g;  1SQJ A;  3B7F A;  4FA1 D;  4MK0 B;  1PI6 A;  4J8B A;  3JPX A;  4AEZ A;  4FAV D;  4GGC A;  4GM9 A;  3SVW D;  2EBS A;  3IIY A;  3UVM A;  4JD2 C;  4D6V A;  4FHL A;  4JT6 C;  4KFM B;  4PNK B;  3FM0 A;  2UZX B;  5EM2 B;  3SWS D;  3I8C A;  1TYQ C;  4QT8 A;  2UZY B;  4O3T B;  4ZN4 A;  3MMY A;  3I2N A;  3VA6 A;  3AL8 B;  4PBY A;  4A09 A;  2P9U C;  4JSN C;  5HE0 B;  2IUR A;  2OK6 A;  4D0K A;  5FLX g;  5A2Q g;  4CZX A; 
#chains in the Genus database with same CATH topology
 4J81 A;  3EQ7 A;  3OF7 A;  3ULE C;  4Y5R D;  4NAA A;  2PM9 B;  2PM7 B;  2H9N A;  5HYN B;  3FRX A;  4CI3 A;  3BWS A;  2VDR A;  4GGD A;  3AL9 A;  5FKQ A;  2Q7Q A;  2GC4 A;  2OVQ B;  2GC7 A;  4EWR A;  2EIB A;  3OKW A;  3GC3 B;  3RMZ D;  2W18 A;  1VE7 A;  3A0F A;  3MUO A;  3CFV A;  1NR0 A;  3RFH A;  4BCD A;  5IC7 A;  2H6N A;  2H9M A;  5E6U A;  3EI4 B;  4ZOV A;  1GOG A;  2WQ8 A;  1YFQ A;  3V4V A;  1GOF A;  5IT9 g;  2XYI A;  4YVD A;  3IVM A;  5I5M A;  3C75 H;  2QR5 A;  1Q47 A;  4PSX B;  1UOO A;  4G1M A;  2HES X;  5E6S A;  4ESG A;  1C9I A;  4CZY A;  1SQ9 A;  4FA5 D;  1U8C A;  3SMR A;  3I7N A;  3IJ0 A;  4BCB A;  4A11 B;  2XE4 A;  3EI2 B;  3ZE2 A;  3K71 A;  3PVW B;  4E54 A;  3FGB A;  4RE5 A;  2P9N C;  4AX4 A;  2HJ4 A;  3ZE0 A;  2HXC A;  1B9X A;  1XKS A;  5EMM B;  3UKU C;  3RN1 D;  4JSP C;  4NBM A;  5EAR A;  5FXY A;  4DNV A;  3KRX B;  4NSX A;  4O02 A;  5M5T A;  1UOQ A;  5CXC A;  2VZ1 A;  3EMH A;  4L1M A;  1MDA H;  1N6F A;  2H9L A;  5CYK A;  4O9D A;  1QFS A;  2AGY A;  4FB1 D;  3EQ9 A;  4MMX A;  2IUP A;  2VDM A;  2PM6 B;  2I0T A;  3CIK B;  3I89 A;  5GMK n;  3PXT D;  3V9F A;  3ZE1 A;  5AMS A;  1H2X A;  4G1E A;  4QAM A;  5I5J A;  2I3S A;  4ERY A;  5FKS A;  2TRC B;  3EI1 B;  3I7O A;  2H68 A;  1L5G A;  3V7D B;  4GGA A;  4GQ1 A;  5H17 A;  3IKO A;  5EMJ B;  1VZ3 A;  4N14 A;  4PSW B;  3JZN A;  4QQE A;  4ZOZ A;  1XHM A;  3OL2 B;  4CI2 A;  4LGN A;  4MMY A;  4JHN A;  5FQD A;  3AH8 B;  4E5Z B;  5CXB A;  4O45 A;  4WJK A;  4Z7Q A;  3E0C A;  4J8G A;  5M61 A;  2XL3 A;  5HDB A;  4GMB A;  1K32 A;  2XZG A;  4G56 B;  4GZ8 A;  4JXM A;  1A0R B;  1GG2 B;  2CN3 A;  3K72 A;  2AH0 A;  5SXM A;  3I7P A;  3MZL A;  2BKL A;  4X60 B;  3QHY B;  4U1E I;  3I8E A;  4J78 A;  1E5T A;  2H47 A;  3MXX A;  2OJY A;  5TEF A;  3PSC B;  3SCY A;  1OMW B;  1U2V C;  2JKX A;  2IWF A;  4X3E A;  3V4P A;  3SHF A;  3T3P A;  1FWX A;  3DXM C;  4L3G D;  2EIE A;  1I2M B;  2H6Q A;  4JSV C;  1OLZ A;  1PBY B;  4X63 B;  3RFG A;  1P22 A;  2HKR A;  4J73 A;  3EWE A;  3OKY A;  2GNQ A;  5FFG A;  3JB9 L;  1U4C A;  3UKR C;  1JMZ B;  2OIZ A;  3JRO A;  3UVK A;  3DXK C;  3N0E A;  2VDP A;  3UVL A;  3ZDX A;  2PBI B;  2B5L A;  3PXS D;  4HDJ A;  4LG9 A;  2CE9 A;  4A0A A;  2HYE A;  4MMZ A;  1H2Y A;  3PXW D;  5C2W B;  2HU5 A;  2XU7 A;  4A09 B;  2YNP A;  4I79 A;  3PVU B;  4GM8 A;  1PEV A;  3EI3 A;  1H2Z A;  3EU7 A;  2I3T A;  3KCI A;  1JTD B;  2CO0 C;  3ODT A;  1L0Q A;  1TYE A;  4DNU A;  1GOH A;  3SN6 B;  2CE8 A;  2YBA A;  3ORV D;  4GQ2 P;  5EML B;  1S4U X;  4UM8 A;  5E6R A;  3SJL D;  3FCS A;  4DNW A;  4JSX C;  2AGL A;  1GP2 B;  4FAN D;  4WK2 A;  3ZWL B;  3O4J A;  3SFZ A;  3PSL A;  3L4M D;  1B9Y A;  3GD1 I;  5AJA A;  3RLM D;  4J77 A;  5GXI A;  3K26 A;  4Z8L A;  4PC0 A;  2J56 H;  4NC4 A;  4A08 A;  2HU8 A;  4K3J B;  4ZOY A;  5TDH B;  3CFS B;  2AGZ A;  3IJE A;  4J86 A;  4ES0 A;  1NEX B;  3SXT D;  1UTC A;  4L9O A;  3JZH A;  2MTA H;  2O9K A;  4Y7R A;  4CC9 A;  2Z2N A;  3VH0 A;  1JV2 A;  5EMK B;  1A12 A;  3QI0 A;  2AQ5 A;  4XYI A;  2EIC A;  3F3F A;  5C9Z B;  3KRW B;  3BG0 A;  3PE7 A;  3UVO A;  2VC2 A;  3MKS B;  3C9C A;  4A0B A;  4E54 B;  3L4O D;  2VDN A;  2BBK H;  2XL2 A;  5GSA A;  3W15 A;  3OW8 A;  3K6S A;  3C99 A;  4PXW A;  5CXC B;  5KDO B;  3N0D A;  3O4H A;  3EQ8 A;  3RRM C;  4BP9 A;  5CYK B;  2J57 G;  2XDW A;  4J79 A;  4R7A B;  4Z7O A;  1QFM A;  3VI4 A;  4CI8 A;  3JRP A;  2IAA A;  3F3P A;  4WK0 A;  4U7A A;  4JT5 C;  4A2M A;  1BPO A;  2I0S A;  3JAM g;  5IJ8 E;  3I7H A;  3MKQ A;  4GM3 A;  5I5I A;  3NVQ A;  2B5M A;  5JWZ A;  2CNX A;  5GXH A;  5FFO A;  5TEE A;  2HU7 A;  5AFU 3;  5IGQ A;  5K19 A;  1O6G A;  3BG1 A;  5EM2 A;  1C9L A;  3VGZ A;  1E8M A;  3OKT A;  3I7L A;  2YNN A;  1GXR A;  3OTT A;  3JZG A;  4ZOX A;  3SBQ A;  3IUL A;  4AN1 A;  4CY2 A;  4ERQ A;  3NIF A;  3F3G A;  4CY5 A;  2J55 H;  5CXB B;  5M5S A;  5IJ7 E;  4L1Q D;  4RE6 A;  3NIG A;  3AL8 A;  2H13 A;  5M5R A;  1JOF A;  2OVP B;  4OWR A;  4O1Q D;  5HE3 B;  1SHY B;  4H5I A;  4ERZ A;  1N6E A;  4BCC A;  5HE2 B;  4CZV A;  2QXV A;  4J87 A;  5EAL A;  3GRE A;  2IUV A;  4OZU A;  4AN0 A;  4IRZ A;  1GOT B;  5C92 A;  4PBZ A;  2AGX A;  2G99 A;  1YR2 A;  4QRJ A;  5H14 A;  4O3U B;  5EAM A;  1T2X A;  2G9A A;  2Z2P A;  5B4W A;  3C5M A;  1JJU B;  2PM9 A;  3IJC A;  5HQG A;  5EAP A;  4GQB B;  3NID A;  3SBP A;  1XIP A;  2BCJ B;  3OKY B;  3IIW A;  3SLE D;  2AH1 A;  3T3M A;  1VE6 A;  3VI3 A;  2P9L C;  4FA9 D;  4A0A B;  4BUJ C;  4XEI C;  2HJB A;  3EI4 A;  3GFC A;  4J82 A;  5FKR A;  3I7K A;  4LG8 A;  3IJ1 A;  2P9P C;  4QL1 A;  2H9P A;  3EI3 B;  2EID A;  5C86 A;  2Z2O A;  4J0W A;  3UVN A;  1E8N A;  2IUQ A;  1PGU A;  4FA4 D;  2OVR B;  4AMY A;  3NVX A;  4A11 A;  3EI2 A;  5HE1 B;  5IGO A;  2QC5 A;  2AGW A;  4AOW A;  1K3I A;  2HKM A;  4TZ4 A;  3EG6 A;  2H6K A;  3IUQ A;  4D9S A;  3IUJ A;  2I0R A;  4A7J A;  3AFC A;  1MG3 A;  4JHP C;  3O4G A;  4CY1 A;  4Z7N A;  4CI1 A;  1K8K C;  3DWL C;  4A08 B;  4BL0 A;  4J84 A;  5H1M A;  2H3X A;  1TBG A;  4L3H D;  4FWW A;  1ERJ A;  3IUN A;  3ZDY A;  3J81 g;  2VDL A;  4IA9 A;  1JMX B;  2IWK A;  4X61 B;  5FKT A;  2VDK A;  1H2W A;  3K27 A;  2CO0 A;  2P9I C;  4BH6 A;  4A2L A;  2YNO A;  4WK4 A;  2CN2 A;  3EI1 A;  2H14 A;  4O2W A;  5C2V B;  5TF2 A;  5THA A;  3O4I A;  3RSE C;  3SBR A;  3DM0 A;  1UOP A;  1MG2 A;  1N6D A;  1R5M A;  3U4Y A;  3IUR A;  4A0B B;  3NVN A;  1RI6 A;  3DSM A;  2P9K C;  4K3I D;  5K1C C;  4AMZ A;  4IMM A;  1QNI A;  1VYH C;  3DDU A;  2YB8 B;  4CY3 A;  3MVD K;  3RN0 D;  3HFQ A;  2B4E A;  3OL2 A;  3UR4 A;  2OK4 A;  2P9S C;  4E5Z A;  4J0X A;  2YMU A;  2B5N A;  3MZK A;  4H5J A;  5FA5 B;  3P4F A;  4XYH A;  3MUN A;  4UI9 R;  3V5W B;  3J80 g;  1SQJ A;  3B7F A;  4FA1 D;  4MK0 B;  1O6F A;  1PI6 A;  3ZDZ A;  4J8B A;  3JPX A;  4NEN A;  4AEZ A;  4GGC A;  4GM9 A;  4FAV D;  3SVW D;  2EBS A;  2VZ3 A;  5M5U A;  3IIY A;  3UVM A;  4JD2 C;  4D6V A;  4FHL A;  4JT6 C;  4KFM B;  4PNK B;  2QZP A;  3FM0 A;  2UZX B;  5M5V A;  5EM2 B;  3IUM A;  3SWS D;  3I8C A;  1TYQ C;  4QT8 A;  2UZY B;  4O3T B;  4ZN4 A;  3MMY A;  3FCU A;  4G55 A;  3I2N A;  3VA6 A;  4BP8 A;  2VDQ A;  3AL8 B;  4PBY A;  4A09 A;  2P9U C;  4JSN C;  5HE0 B;  1VZ2 A;  2IUR A;  2OK6 A;  4D0K A;  1M1X A;  4UM9 A;  5FLX g;  5A2Q g;  4CZX A;  2VDO A; 
#chains in the Genus database with same CATH homology
 4J81 A;  3ULE C;  4Y5R D;  2PM9 B;  2PM7 B;  2H9N A;  5HYN B;  3FRX A;  4CI3 A;  3BWS A;  4GGD A;  3AL9 A;  5FKQ A;  2Q7Q A;  2GC4 A;  2OVQ B;  2GC7 A;  4EWR A;  3OKW A;  3RMZ D;  2W18 A;  3A0F A;  3CFV A;  1NR0 A;  3RFH A;  5IC7 A;  2H6N A;  2H9M A;  3EI4 B;  4ZOV A;  1YFQ A;  5IT9 g;  2XYI A;  4YVD A;  5I5M A;  3C75 H;  1Q47 A;  4PSX B;  2HES X;  4ESG A;  4CZY A;  1SQ9 A;  4FA5 D;  3SMR A;  3I7N A;  3IJ0 A;  4A11 B;  3EI2 B;  3PVW B;  4E54 A;  3FGB A;  2P9N C;  2HJ4 A;  2HXC A;  1B9X A;  1XKS A;  5EMM B;  3UKU C;  3RN1 D;  4JSP C;  5EAR A;  5FXY A;  3KRX B;  4NSX A;  5CXC A;  3EMH A;  5CYK A;  1MDA H;  1N6F A;  2H9L A;  4O9D A;  2AGY A;  4FB1 D;  2IUP A;  2PM6 B;  2I0T A;  3CIK B;  3I89 A;  5GMK n;  3PXT D;  3V9F A;  5AMS A;  5I5J A;  2I3S A;  4ERY A;  5FKS A;  2TRC B;  3EI1 B;  3I7O A;  2H68 A;  3V7D B;  4GGA A;  4GQ1 A;  5H17 A;  3IKO A;  5EMJ B;  4N14 A;  4PSW B;  3JZN A;  4QQE A;  4ZOZ A;  1XHM A;  3OL2 B;  4CI2 A;  4LGN A;  4E5Z B;  5FQD A;  3AH8 B;  5CXB A;  4O45 A;  3E0C A;  4J8G A;  2XL3 A;  4GMB A;  1K32 A;  4GZ8 A;  4G56 B;  4JXM A;  1A0R B;  1GG2 B;  2CN3 A;  2AH0 A;  5SXM A;  3I7P A;  3MZL A;  4X60 B;  4U1E I;  3I8E A;  4J78 A;  2H47 A;  3MXX A;  2OJY A;  5TEF A;  3PSC B;  3SCY A;  1OMW B;  1U2V C;  4X3E A;  2IWF A;  3SHF A;  1FWX A;  3DXM C;  4L3G D;  2H6Q A;  4JSV C;  1OLZ A;  1PBY B;  4X63 B;  3RFG A;  1P22 A;  2HKR A;  4J73 A;  3EWE A;  3OKY A;  2GNQ A;  3JB9 L;  1U4C A;  3UKR C;  1JMZ B;  2OIZ A;  3JRO A;  3UVK A;  3DXK C;  3N0E A;  3UVL A;  2PBI B;  2B5L A;  4LG9 A;  3PXS D;  4HDJ A;  2CE9 A;  4A0A A;  2HYE A;  3PXW D;  5C2W B;  2XU7 A;  4A09 B;  2YNP A;  4I79 A;  3PVU B;  4GM8 A;  1PEV A;  3EI3 A;  3EU7 A;  2I3T A;  2CO0 C;  3ODT A;  1L0Q A;  3SN6 B;  2CE8 A;  2YBA A;  3ORV D;  4GQ2 P;  5EML B;  1S4U X;  3SJL D;  4JSX C;  2AGL A;  1GP2 B;  4FAN D;  3ZWL B;  3SFZ A;  3PSL A;  3L4M D;  1B9Y A;  5AJA A;  3RLM D;  4J77 A;  5GXI A;  3K26 A;  4Z8L A;  4PC0 A;  2J56 H;  4A08 A;  4K3J B;  4ZOY A;  5TDH B;  3CFS B;  2AGZ A;  4J86 A;  4ES0 A;  1NEX B;  3SXT D;  4L9O A;  3JZH A;  2MTA H;  2O9K A;  4Y7R A;  4CC9 A;  2Z2N A;  3VH0 A;  5EMK B;  2AQ5 A;  4XYI A;  3F3F A;  5C9Z B;  3KRW B;  3BG0 A;  3PE7 A;  3UVO A;  3MKS B;  4A0B A;  3C9C A;  4E54 B;  3L4O D;  2BBK H;  2XL2 A;  5GSA A;  3W15 A;  3OW8 A;  3C99 A;  4PXW A;  5CXC B;  5KDO B;  3N0D A;  3RRM C;  5CYK B;  2J57 G;  4J79 A;  4R7A B;  4CI8 A;  3JRP A;  2IAA A;  3F3P A;  4U7A A;  4JT5 C;  4A2M A;  2I0S A;  3JAM g;  5IJ8 E;  3I7H A;  3MKQ A;  4GM3 A;  5I5I A;  3NVQ A;  2B5M A;  5JWZ A;  2CNX A;  5GXH A;  5TEE A;  5AFU 3;  5IGQ A;  5K19 A;  5EM2 A;  3BG1 A;  3VGZ A;  3OKT A;  3I7L A;  2YNN A;  1GXR A;  3OTT A;  3JZG A;  4ZOX A;  3SBQ A;  4CY2 A;  4ERQ A;  3F3G A;  4CY5 A;  2J55 H;  5CXB B;  5IJ7 E;  4L1Q D;  3AL8 A;  2H13 A;  1JOF A;  2OVP B;  4OWR A;  4O1Q D;  5HE3 B;  1SHY B;  4H5I A;  4ERZ A;  1N6E A;  5HE2 B;  4CZV A;  2QXV A;  4J87 A;  5EAL A;  3GRE A;  2IUV A;  4OZU A;  1GOT B;  4PBZ A;  2AGX A;  2G99 A;  4QRJ A;  5H14 A;  4O3U B;  5EAM A;  2G9A A;  2Z2P A;  5B4W A;  3C5M A;  1JJU B;  2PM9 A;  3IJC A;  5HQG A;  5EAP A;  4GQB B;  3SBP A;  1XIP A;  2BCJ B;  3OKY B;  3IIW A;  3SLE D;  2AH1 A;  2P9L C;  4FA9 D;  4A0A B;  4BUJ C;  4XEI C;  2HJB A;  3EI4 A;  3GFC A;  4J82 A;  5FKR A;  3I7K A;  4LG8 A;  3IJ1 A;  2P9P C;  4QL1 A;  2H9P A;  3EI3 B;  2Z2O A;  4J0W A;  3UVN A;  2IUQ A;  1PGU A;  4FA4 D;  2OVR B;  3NVX A;  4A11 A;  3EI2 A;  5HE1 B;  5IGO A;  2QC5 A;  2AGW A;  4AOW A;  2HKM A;  4TZ4 A;  3EG6 A;  2H6K A;  2I0R A;  4A7J A;  3AFC A;  1MG3 A;  4CY1 A;  4CI1 A;  1K8K C;  3DWL C;  4A08 B;  4BL0 A;  4J84 A;  5H1M A;  2H3X A;  1TBG A;  4L3H D;  4FWW A;  1ERJ A;  3J81 g;  4IA9 A;  1JMX B;  2IWK A;  4X61 B;  5FKT A;  3K27 A;  2CO0 A;  2P9I C;  4BH6 A;  4A2L A;  2YNO A;  2CN2 A;  3EI1 A;  2H14 A;  5C2V B;  5TF2 A;  5THA A;  3RSE C;  3SBR A;  3DM0 A;  1MG2 A;  1N6D A;  1R5M A;  3U4Y A;  4A0B B;  3NVN A;  1RI6 A;  3DSM A;  2P9K C;  4K3I D;  5K1C C;  4IMM A;  1QNI A;  1VYH C;  4CY3 A;  2YB8 B;  3RN0 D;  3HFQ A;  2B4E A;  3OL2 A;  3UR4 A;  2OK4 A;  2P9S C;  4E5Z A;  4J0X A;  2YMU A;  2B5N A;  3MZK A;  4H5J A;  5FA5 B;  3P4F A;  4XYH A;  4UI9 R;  3V5W B;  3J80 g;  1SQJ A;  3B7F A;  4FA1 D;  4MK0 B;  1PI6 A;  4J8B A;  3JPX A;  4AEZ A;  4FAV D;  4GGC A;  4GM9 A;  3SVW D;  2EBS A;  3IIY A;  3UVM A;  4JD2 C;  4D6V A;  4FHL A;  4JT6 C;  4KFM B;  4PNK B;  3FM0 A;  2UZX B;  5EM2 B;  3SWS D;  3I8C A;  1TYQ C;  4QT8 A;  2UZY B;  4O3T B;  4ZN4 A;  3MMY A;  3I2N A;  3VA6 A;  3AL8 B;  4PBY A;  4A09 A;  2P9U C;  4JSN C;  5HE0 B;  2IUR A;  2OK6 A;  4D0K A;  5FLX g;  5A2Q g;  4CZX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...