4EWRA

X-ray structure of wdr5-setd1a win motif peptide binary complex
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
304
structure length
304
Chain Sequence
VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD repeat-containing protein 5
publication title Structural basis for WDR5 interaction (Win) motif recognition in human SET1 family histone methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/transferase
total genus 102
structure length 304
sequence length 304
ec nomenclature
pdb deposition date 2012-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4ewrA00
3DXMC 3CIKB 4MK0B 2UZXB 3J81g 4IMMA 3JRPA 4J78A 3SN6B 5IC7A 3CFVA 5C2WB 4CZVA 4JT6C 1NR0A 2OJYA 3P4FA 2PM7B 3N0DA 3NVNA 1NEXB 2P9SC 4L9OA 3BG0A 3RFGA 2HYEA 2H68A 4O9DA 5K19A 2OVRB 2AGZA 2YMUA 4FA5D 1SQ9A 4J81A 4J86A 2OVPB 1GXRA 3MMYA 5EALA 4J82A 3EI2B 3DSMA 3PXWD 3PE7A 4GM8A 4G56B 5FKSA 1R5MA 3AL8B 5H1MA 3CFSB 2AGLA 4PC0A 2IWKA 2I3TA 3AL9A 2P9PC 3EI3A 4J0WA 3GREA 5HE0B 3UVNA 3IJ1A 4CY1A 3IIYA 5I5MA 4A08A 2CN2A 4LG8A 2H6QA 3I7HA 4Y5RD 1MG3A 1L0QA 5IJ7E 1PBYB 3IJ0A 2PBIB 3MKSB 4GGCA 2CNXA 3I89A 2OK4A 3SMRA 5I5JA 4JXMA 3U4YA 2I3SA 3SBPA 4J79A 3EI4B 4J73A 4JSXC 3RMZD 2CE8A 4JD2C 3OW8A 1TBGA 3C99A 2MTAH 5EMMB 1A0RB 2H6KA 5THAA 4GGAA 4UI9R 2PM9B 5KDOB 4Y7RA 5EAPA 3W15A 2H9MA 5C9ZB 4A08B 4CY3A 3C9CA 4JSVC 1P22A 3C5MA 5CXCA 3SVWD 1K8KC 2QC5A 5IGQA 2AGYA 4E5ZB 3IIWA 5H17A 1MDAH 3ORVD 2IWFA 4CZXA 3V7DB 3L4MD 4A09B 5FKTA 4J8GA 3SLED 5C2VB 4X60B 4ZOVA 2XL3A 3KRWB 4AEZA 5CXBA 4FAVD 5SXMA 4CI2A 5EAMA 3RFHA 2CO0C 1N6EA 2IUQA 1MG2A 2I0SA 4X61B 3FRXA 4BH6A 3EI2A 5AJAA 3F3GA 2AGWA 3I7NA 4CZYA 3BWSA 3DM0A 4D0KA 3AL8A 5CXCB 2P9NC 4LGNA 2J57G 3UVOA 4GQ1A 3PXTD 1N6FA 2AH0A 1XHMA 4PXWA 1XIPA 4K3JB 3AH8B 4A7JA 5EMLB 5FQDA 4CC9A 4QT8A 4U1EI 3SWSD 5TEFA 4L3GD 2IURA 5CXBB 3L4OD 4FWWA 3JB9L 3EI4A 4CI8A 2XYIA 3I7OA 2YNOA 4O1QD 4JSPC 2B5LA 4ZN4A 4H5JA 5TDHB 4NSXA 1QNIA 3FM0A 5HE1B 2CO0A 3C75H 3I7PA 4FB1D 3F3FA 4H5IA 2PM9A 4FA9D 2AH1A 3UKRC 4PSWB 1PI6A 5GMKn 3PVUB 2YBAA 2XL2A 4CY2A 4GQ2P 4R7AB 3UR4A 1FWXA 3RN0D 3IKOA 4E5ZA 3EI1A 2IUVA 2PM6B 5K1CC 2GC7A 1RI6A 3IJCA 4CI3A 1GP2B 4EWRA 4A09A 3ZWLB 2W18A 3JZNA 2BCJB 3EWEA 3SXTD 2HKMA 1ERJA 1N6DA 4A11B 3MZKA 5FXYA 3RSEC 3PSLA 2Q7QA 2CN3A 3MZLA 2OVQB 3I8CA 1OMWB 3SBQA 3UKUC 3FGBA 4CY5A 3I2NA 4N14A 4X3EA 4GGDA 4E54B 4IA9A 4XYIA 3DXKC 2HESX 3F3PA 2OK6A 5FA5B 4K3ID 3EMHA 4JT5C 4FAND 4GM3A 4BL0A 3EI1B 2HJ4A 2HKRA 4A2LA 5FLXg 2P9LC 4FA4D 4OZUA 3EU7A 3EG6A 2YB8B 2G9AA 2O9KA 2TRCB 3OKYB 4ZOZA 5HE2B 3VA6A 1JOFA 2H9PA 2BBKH 3AFCA 3A0FA 3PVWB 3I7LA 4L1QD 5CYKB 5HE3B 2OIZA 3PXSD 3I7KA 4O45A 5GXIA 4YVDA 3NVXA 3OTTA 5FKRA 2HXCA 3SHFA 1S4UX 1OLZA 2AGXA 4D6VA 5HYNB 3RLMD 4QL1A 2Z2OA 3V9FA 3K27A 1SQJA 3JAMg 2H9LA 2UZYB 2I0TA 2GNQA 3I8EA 3KRXB 1U2VC 1JJUB 4A0AB 5HQGA 4L3HD 4I79A 1JMZB 3UVKA 2G99A 4GMBA 4XEIC 2IUPA 4FHLA 3OKWA 5EMJB 1B9XA 4PSXB 3NVQA 4ZOXA 1U4CA 4QRJA 2AQ5A 4ERQA 2H3XA 4O3UB 3MXXA 4QQEA 3OL2A 4TZ4A 3ODTA 4GZ8A 5TF2A 3JPXA 5AMSA 3MKQA 2H13A 2HJBA 2QXVA 3E0CA 4O3TB 1VYHC 4A11A 2B5MA 1TYQC 4HDJA 2Z2NA 4J77A 3B7FA 5AFU3 2Z2PA 2EBSA 5EM2B 4E54A 3DWLC 2GC4A 5GSAA 2J55H 3BG1A 3RRMC 4ES0A 4A2MA 1Q47A 4PNKB 4PBZA 3OL2B 3OKYA 3JZHA 5IT9g 4BUJC 4XYHA 2YNPA 4A0BA 4CI1A 2B5NA 5CYKA 3SBRA 1XKSA 2H9NA 1JMXB 3RN1D 3UVMA 4ESGA 5H14A 3VGZA 5TEEA 1SHYB 3VH0A 2XU7A 1K32A 3SCYA 2I0RA 3V5WB 2P9UC 4A0AA 3PSCB 2B4EA 4OWRA 4Z8LA 1GG2B 3OKTA 5A2Qg 4ERZA 4J0XA 3EI3B 4J84A 4LG9A 1YFQA 4X63B 5EARA 5B4WA 4ERYA 3HFQA 3JZGA 4A0BB 1PGUA 4J87A 2P9IC 4JSNC 5EMKB 3UVLA 2H6NA 2YNNA 3N0EA 2IAAA 3K26A 2H14A 3GFCA 4GQBB 5JWZA 4GM9A 3ULEC 1GOTB 2H47A 3JROA 5I5IA 3SJLD 1PEVA 4PBYA 5IGOA 4FA1D 2CE9A 4ZOYA 5IJ8E 4KFMB 5GXHA 4U7AA 5EM2A 4AOWA 3J80g 3SFZA 1B9YA 5FKQA 4J8BA 2P9KC 2J56H
chains in the Genus database with same CATH superfamily
3DXMC 3CIKB 4MK0B 3V4VA 2UZXB 3J81g 4AMYA 4IMMA 3FCSA 3JRPA 4DNWA 4J78A 3SN6B 5IC7A 3CFVA 4NENA 5C2WB 2VZ1A 4CZVA 4JT6C 1NR0A 2OJYA 3P4FA 2PM7B 3N0DA 2XE4A 3NVNA 1NEXB 2P9SC 4L9OA 3BG0A 3O4IA 3RFGA 2HYEA 2H68A 4O9DA 2VDKA 2WQ8A 5K19A 3GC3B 2OVRB 2AGZA 2YMUA 4FA5D 1SQ9A 4J81A 4J86A 2OVPB 1GXRA 3MMYA 4MMXA 5EALA 4J82A 3EI2B 2BKLA 3DSMA 3PXWD 3PE7A 4GM8A 4G56B 5FKSA 1E5TA 1R5MA 3AL8B 5H1MA 2HU5A 3CFSB 1GOFA 1A12A 2AGLA 4PC0A 2IWKA 2I3TA 3AL9A 2P9PC 3IVMA 1VE7A 3EI3A 4J0WA 1T2XA 3GREA 5HE0B 3UVNA 3IJ1A 4CY1A 3IIYA 5I5MA 5M5TA 3IULA 4A08A 2CN2A 4LG8A 2H6QA 2VDLA 3I7HA 4UM8A 4Y5RD 1L0QA 1MG3A 5IJ7E 1PBYB 3IJ0A 2PBIB 3MKSB 4GGCA 4MMYA 2CNXA 3I89A 1UTCA 2OK4A 3SMRA 3NIFA 1VZ3A 5I5JA 4JXMA 3U4YA 2I3SA 3SBPA 3K6SA 4J79A 3EI4B 4J73A 1C9LA 3T3PA 4G1MA 4JSXC 3RMZD 1BPOA 2CE8A 3DDUA 5E6SA 4JD2C 3OW8A 1TBGA 3C99A 2MTAH 5EMMB 1A0RB 1O6GA 2H6KA 4JHNA 5THAA 4GGAA 1O6FA 5C86A 3EQ7A 4QAMA 4UI9R 3QI0A 3MVDK 2PM9B 1H2ZA 5KDOB 4Y7RA 5EAPA 3W15A 2H9MA 5C9ZB 4WK0A 4A08B 4CY3A 2EIDA 3C9CA 4JSVC 1JV2A 1P22A 3C5MA 5CXCA 3SVWD 1K8KC 1GOGA 2QC5A 5IGQA 2AGYA 4E5ZB 3IIWA 5H17A 1MDAH 3ORVD 2IWFA 4DNVA 3IJEA 4CZXA 3V7DB 3L4MD 4A09B 5FKTA 4J8GA 3SLED 1JTDB 5C2VB 4X60B 2EICA 5E6UA 4ZOVA 2XL3A 3KRWB 4AEZA 5CXBA 4FAVD 5SXMA 4CI2A 5EAMA 3RFHA 2CO0C 1N6EA 2IUQA 1MG2A 2I0SA 4X61B 3FRXA 4BH6A 3EI2A 2VC2A 5AJAA 3F3GA 2AGWA 3I7NA 1I2MB 4CZYA 3BWSA 3DM0A 4D0KA 3AL8A 5CXCB 4BCBA 2P9NC 4LGNA 2J57G 3UVOA 4GQ1A 4NAAA 3PXTD 3NIDA 1N6FA 2AH0A 1XHMA 4PXWA 1XIPA 3KCIA 4K3JB 4AMZA 3AH8B 4A7JA 5EMLB 5FQDA 4CC9A 4QT8A 4U1EI 3SWSD 2QR5A 5E6RA 3V4PA 5TEFA 4L3GD 2IURA 5CXBB 3L4OD 4FWWA 3JB9L 3EI4A 4CI8A 2XYIA 2HU7A 3I7OA 2YNOA 4O1QD 4JSPC 3ZDYA 2B5LA 4ZN4A 4H5JA 3FCUA 5TDHB 4NSXA 1QNIA 4G55A 3FM0A 5HE1B 2CO0A 3C75H 1UOQA 3I7PA 4FB1D 3F3FA 4H5IA 2PM9A 4FA9D 2AH1A 3UKRC 4PSWB 1PI6A 2VZ3A 5GMKn 3PVUB 4BP8A 2YBAA 2XL2A 3IUNA 4CY2A 4GQ2P 4R7AB 3UR4A 1FWXA 3RN0D 3IKOA 4E5ZA 3VI3A 3EI1A 2IUVA 2PM6B 5K1CC 2GC7A 1K3IA 1RI6A 3IJCA 4CI3A 5M5UA 1GP2B 4EWRA 4A09A 3ZWLB 2W18A 5FFGA 3MUNA 3JZNA 4O02A 2BCJB 3EWEA 3SXTD 2HKMA 1ERJA 1N6DA 4A11B 3MZKA 5FXYA 3RSEC 3PSLA 2VDNA 2Q7QA 2CN3A 3MZLA 2OVQB 3ZDZA 3I8CA 1OMWB 3SBQA 3UKUC 3FGBA 3ZDXA 2XZGA 4CY5A 3I2NA 4N14A 3ZE0A 4X3EA 4GGDA 4E54B 2JKXA 4IA9A 4XYIA 3DXKC 4AX4A 2HESX 3T3MA 3F3PA 2OK6A 4RE6A 5FA5B 4K3ID 3EMHA 4JT5C 4FAND 4GM3A 3ZE2A 4BL0A 3EI1B 2HJ4A 2HKRA 4A2LA 5FLXg 2P9LC 4FA4D 4OZUA 3EU7A 3EG6A 1UOOA 3IUMA 4JHPC 3K72A 1UOPA 4NC4A 2YB8B 2G9AA 4D9SA 2O9KA 1C9IA 2TRCB 3OKYB 4ZOZA 5HE2B 3VA6A 1JOFA 2H9PA 2BBKH 3AFCA 3A0FA 3PVWB 1TYEA 3I7LA 4L1QD 5CYKB 5HE3B 2OIZA 3PXSD 3I7KA 1H2YA 4O45A 5GXIA 4YVDA 3NVXA 3OTTA 5FKRA 2HXCA 3SHFA 5M5RA 1S4UX 1OLZA 3IUJA 2AGXA 4D6VA 5HYNB 3RLMD 4QL1A 2Z2OA 3V9FA 3K27A 1SQJA 4Z7QA 3JAMg 2H9LA 2UZYB 2I0TA 2GNQA 3I8EA 5FFOA 5M5VA 3KRXB 1U2VC 3OF7A 1JJUB 4A0AB 5HQGA 4L3HD 4I79A 1JMZB 4NBMA 3UVKA 2G99A 4GMBA 4XEIC 2IUPA 4FHLA 3GD1I 3OKWA 5EMJB 1B9XA 3K71A 4PSXB 3NIGA 3NVQA 4ZOXA 1U4CA 4QRJA 2AQ5A 4ERQA 2VDPA 2H3XA 4O3UB 3EQ9A 3MXXA 4QQEA 2VDMA 3OL2A 4TZ4A 4Z7OA 3ODTA 4GZ8A 5TF2A 3JPXA 5AMSA 3MKQA 2H13A 2HJBA 2QXVA 1VZ2A 3E0CA 4O3TB 4WK4A 1VYHC 4A11A 4BCDA 2B5MA 1TYQC 4HDJA 2Z2NA 4J77A 3B7FA 3O4GA 5AFU3 2Z2PA 2EBSA 2EIBA 5EM2B 4E54A 3DWLC 2GC4A 1H2XA 1L5GA 5GSAA 2J55H 3BG1A 2VDRA 4G1EA 4IRZA 3RRMC 4RE5A 4ES0A 4A2MA 1Q47A 4PNKB 4PBZA 3IUQA 3OL2B 3OKYA 5C92A 3JZHA 1QFMA 2EIEA 5IT9g 4BUJC 4L1MA 1U8CA 2XDWA 5HDBA 4XYHA 4WK2A 2YNPA 4A0BA 4CI1A 2B5NA 5CYKA 3SBRA 1XKSA 2H9NA 1JMXB 3RN1D 3UVMA 4ESGA 2VDQA 5H14A 3VGZA 4DNUA 5TEEA 5M5SA 1E8MA 1QFSA 1GOHA 3QHYB 1SHYB 3VH0A 2XU7A 1VE6A 1K32A 2VDOA 3SCYA 4UM9A 5M61A 2I0RA 3V5WB 2P9UC 4A0AA 3PSCB 2B4EA 4OWRA 4AN1A 4BCCA 4Z8LA 1GG2B 3OKTA 5A2Qg 4ERZA 4J0XA 3EI3B 1M1XA 4WJKA 4O2WA 4Z7NA 4J84A 3IURA 1YFQA 4LG9A 4X63B 5EARA 5B4WA 4ERYA 3HFQA 3JZGA 1YR2A 4A0BB 1E8NA 1PGUA 3EQ8A 4J87A 2P9IC 4JSNC 5EMKB 3UVLA 2H6NA 2YNNA 3N0EA 2IAAA 1H2WA 3K26A 2H14A 3GFCA 4GQBB 5JWZA 4GM9A 3ULEC 4AN0A 3MUOA 1GOTB 2H47A 3JROA 5I5IA 3ZE1A 3SJLD 4MMZA 1PEVA 4PBYA 2QZPA 5IGOA 4FA1D 2CE9A 4ZOYA 5IJ8E 4KFMB 5GXHA 4U7AA 5EM2A 3VI4A 4AOWA 2HU8A 3J80g 4BP9A 3SFZA 1B9YA 3O4HA 3O4JA 5FKQA 4J8BA 2P9KC 2J56H
chains in the Genus database with same CATH topology
3DXMC 3CIKB 4MK0B 2UZXB 3J81g 4IMMA 3JRPA 4J78A 3SN6B 5IC7A 3CFVA 5C2WB 4CZVA 4JT6C 1NR0A 2OJYA 3P4FA 2PM7B 3N0DA 3NVNA 1NEXB 2P9SC 4L9OA 3BG0A 3RFGA 2HYEA 2H68A 4O9DA 5K19A 2OVRB 2AGZA 2YMUA 4FA5D 1SQ9A 4J81A 4J86A 2OVPB 1GXRA 3MMYA 5EALA 4J82A 3EI2B 3DSMA 3PXWD 3PE7A 4GM8A 4G56B 5FKSA 1R5MA 3AL8B 5H1MA 3CFSB 2AGLA 4PC0A 2IWKA 2I3TA 3AL9A 2P9PC 3EI3A 4J0WA 3GREA 5HE0B 3UVNA 3IJ1A 4CY1A 3IIYA 5I5MA 4A08A 2CN2A 4LG8A 2H6QA 3I7HA 4Y5RD 1MG3A 1L0QA 5IJ7E 1PBYB 3IJ0A 2PBIB 3MKSB 4GGCA 2CNXA 3I89A 2OK4A 3SMRA 5I5JA 4JXMA 3U4YA 2I3SA 3SBPA 4J79A 3EI4B 4J73A 4JSXC 3RMZD 2CE8A 4JD2C 3OW8A 1TBGA 3C99A 2MTAH 5EMMB 1A0RB 2H6KA 5THAA 4GGAA 4UI9R 2PM9B 5KDOB 4Y7RA 5EAPA 3W15A 2H9MA 5C9ZB 4A08B 4CY3A 3C9CA 4JSVC 1P22A 3C5MA 5CXCA 3SVWD 1K8KC 2QC5A 5IGQA 2AGYA 4E5ZB 3IIWA 5H17A 1MDAH 3ORVD 2IWFA 4CZXA 3V7DB 3L4MD 4A09B 5FKTA 4J8GA 3SLED 5C2VB 4X60B 4ZOVA 2XL3A 3KRWB 4AEZA 5CXBA 4FAVD 5SXMA 4CI2A 5EAMA 3RFHA 2CO0C 1N6EA 2IUQA 1MG2A 2I0SA 4X61B 3FRXA 4BH6A 3EI2A 5AJAA 3F3GA 2AGWA 3I7NA 4CZYA 3BWSA 3DM0A 4D0KA 3AL8A 5CXCB 2P9NC 4LGNA 2J57G 3UVOA 4GQ1A 3PXTD 1N6FA 2AH0A 1XHMA 4PXWA 1XIPA 4K3JB 3AH8B 4A7JA 5EMLB 5FQDA 4CC9A 4QT8A 4U1EI 3SWSD 5TEFA 4L3GD 2IURA 5CXBB 3L4OD 4FWWA 3JB9L 3EI4A 4CI8A 2XYIA 3I7OA 2YNOA 4O1QD 4JSPC 2B5LA 4ZN4A 4H5JA 5TDHB 4NSXA 1QNIA 3FM0A 5HE1B 2CO0A 3C75H 3I7PA 4FB1D 3F3FA 4H5IA 2PM9A 4FA9D 2AH1A 3UKRC 4PSWB 1PI6A 5GMKn 3PVUB 2YBAA 2XL2A 4CY2A 4GQ2P 4R7AB 3UR4A 1FWXA 3RN0D 3IKOA 4E5ZA 3EI1A 2IUVA 2PM6B 5K1CC 2GC7A 1RI6A 3IJCA 4CI3A 1GP2B 4EWRA 4A09A 3ZWLB 2W18A 3JZNA 2BCJB 3EWEA 3SXTD 2HKMA 1ERJA 1N6DA 4A11B 3MZKA 5FXYA 3RSEC 3PSLA 2Q7QA 2CN3A 3MZLA 2OVQB 3I8CA 1OMWB 3SBQA 3UKUC 3FGBA 4CY5A 3I2NA 4N14A 4X3EA 4GGDA 4E54B 4IA9A 4XYIA 3DXKC 2HESX 3F3PA 2OK6A 5FA5B 4K3ID 3EMHA 4JT5C 4FAND 4GM3A 4BL0A 3EI1B 2HJ4A 2HKRA 4A2LA 5FLXg 2P9LC 4FA4D 4OZUA 3EU7A 3EG6A 2YB8B 2G9AA 2O9KA 2TRCB 3OKYB 4ZOZA 5HE2B 3VA6A 1JOFA 2H9PA 2BBKH 3AFCA 3A0FA 3PVWB 3I7LA 4L1QD 5CYKB 5HE3B 2OIZA 3PXSD 3I7KA 4O45A 5GXIA 4YVDA 3NVXA 3OTTA 5FKRA 2HXCA 3SHFA 1S4UX 1OLZA 2AGXA 4D6VA 5HYNB 3RLMD 4QL1A 2Z2OA 3V9FA 3K27A 1SQJA 3JAMg 2H9LA 2UZYB 2I0TA 2GNQA 3I8EA 3KRXB 1U2VC 1JJUB 4A0AB 5HQGA 4L3HD 4I79A 1JMZB 3UVKA 2G99A 4GMBA 4XEIC 2IUPA 4FHLA 3OKWA 5EMJB 1B9XA 4PSXB 3NVQA 4ZOXA 1U4CA 4QRJA 2AQ5A 4ERQA 2H3XA 4O3UB 3MXXA 4QQEA 3OL2A 4TZ4A 3ODTA 4GZ8A 5TF2A 3JPXA 5AMSA 3MKQA 2H13A 2HJBA 2QXVA 3E0CA 4O3TB 1VYHC 4A11A 2B5MA 1TYQC 4HDJA 2Z2NA 4J77A 3B7FA 5AFU3 2Z2PA 2EBSA 5EM2B 4E54A 3DWLC 2GC4A 5GSAA 2J55H 3BG1A 3RRMC 4ES0A 4A2MA 1Q47A 4PNKB 4PBZA 3OL2B 3OKYA 3JZHA 5IT9g 4BUJC 4XYHA 2YNPA 4A0BA 4CI1A 2B5NA 5CYKA 3SBRA 1XKSA 2H9NA 1JMXB 3RN1D 3UVMA 4ESGA 5H14A 3VGZA 5TEEA 1SHYB 3VH0A 2XU7A 1K32A 3SCYA 2I0RA 3V5WB 2P9UC 4A0AA 3PSCB 2B4EA 4OWRA 4Z8LA 1GG2B 3OKTA 5A2Qg 4ERZA 4J0XA 3EI3B 4J84A 4LG9A 1YFQA 4X63B 5EARA 5B4WA 4ERYA 3HFQA 3JZGA 4A0BB 1PGUA 4J87A 2P9IC 4JSNC 5EMKB 3UVLA 2H6NA 2YNNA 3N0EA 2IAAA 3K26A 2H14A 3GFCA 4GQBB 5JWZA 4GM9A 3ULEC 1GOTB 2H47A 3JROA 5I5IA 3SJLD 1PEVA 4PBYA 5IGOA 4FA1D 2CE9A 4ZOYA 5IJ8E 4KFMB 5GXHA 4U7AA 5EM2A 4AOWA 3J80g 3SFZA 1B9YA 5FKQA 4J8BA 2P9KC 2J56H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DXM C;  3CIK B;  4MK0 B;  2UZX B;  3J81 g;  4IMM A;  3JRP A;  4J78 A;  3SN6 B;  5IC7 A;  3CFV A;  5C2W B;  4CZV A;  4JT6 C;  1NR0 A;  2OJY A;  3P4F A;  2PM7 B;  3N0D A;  3NVN A;  1NEX B;  2P9S C;  4L9O A;  3BG0 A;  3RFG A;  2HYE A;  2H68 A;  4O9D A;  5K19 A;  2OVR B;  2AGZ A;  2YMU A;  4FA5 D;  1SQ9 A;  4J81 A;  4J86 A;  2OVP B;  1GXR A;  3MMY A;  5EAL A;  4J82 A;  3EI2 B;  3DSM A;  3PXW D;  3PE7 A;  4GM8 A;  4G56 B;  5FKS A;  1R5M A;  3AL8 B;  5H1M A;  3CFS B;  2AGL A;  4PC0 A;  2IWK A;  2I3T A;  3AL9 A;  2P9P C;  3EI3 A;  4J0W A;  3GRE A;  5HE0 B;  3UVN A;  3IJ1 A;  4CY1 A;  3IIY A;  5I5M A;  4A08 A;  2CN2 A;  4LG8 A;  2H6Q A;  3I7H A;  4Y5R D;  1MG3 A;  1L0Q A;  5IJ7 E;  1PBY B;  3IJ0 A;  2PBI B;  3MKS B;  4GGC A;  2CNX A;  3I89 A;  2OK4 A;  3SMR A;  5I5J A;  4JXM A;  3U4Y A;  2I3S A;  3SBP A;  4J79 A;  3EI4 B;  4J73 A;  4JSX C;  3RMZ D;  2CE8 A;  4JD2 C;  3OW8 A;  1TBG A;  3C99 A;  2MTA H;  5EMM B;  1A0R B;  2H6K A;  5THA A;  4GGA A;  4UI9 R;  2PM9 B;  5KDO B;  4Y7R A;  5EAP A;  3W15 A;  2H9M A;  5C9Z B;  4A08 B;  4CY3 A;  3C9C A;  4JSV C;  1P22 A;  3C5M A;  5CXC A;  3SVW D;  1K8K C;  2QC5 A;  5IGQ A;  2AGY A;  4E5Z B;  3IIW A;  5H17 A;  1MDA H;  3ORV D;  2IWF A;  4CZX A;  3V7D B;  3L4M D;  4A09 B;  5FKT A;  4J8G A;  3SLE D;  5C2V B;  4X60 B;  4ZOV A;  2XL3 A;  3KRW B;  4AEZ A;  5CXB A;  4FAV D;  5SXM A;  4CI2 A;  5EAM A;  3RFH A;  2CO0 C;  1N6E A;  2IUQ A;  1MG2 A;  2I0S A;  4X61 B;  3FRX A;  4BH6 A;  3EI2 A;  5AJA A;  3F3G A;  2AGW A;  3I7N A;  4CZY A;  3BWS A;  3DM0 A;  4D0K A;  3AL8 A;  5CXC B;  2P9N C;  4LGN A;  2J57 G;  3UVO A;  4GQ1 A;  3PXT D;  1N6F A;  2AH0 A;  1XHM A;  4PXW A;  1XIP A;  4K3J B;  3AH8 B;  4A7J A;  5EML B;  5FQD A;  4CC9 A;  4QT8 A;  4U1E I;  3SWS D;  5TEF A;  4L3G D;  2IUR A;  5CXB B;  3L4O D;  4FWW A;  3JB9 L;  3EI4 A;  4CI8 A;  2XYI A;  3I7O A;  2YNO A;  4O1Q D;  4JSP C;  2B5L A;  4ZN4 A;  4H5J A;  5TDH B;  4NSX A;  1QNI A;  3FM0 A;  5HE1 B;  2CO0 A;  3C75 H;  3I7P A;  4FB1 D;  3F3F A;  4H5I A;  2PM9 A;  4FA9 D;  2AH1 A;  3UKR C;  4PSW B;  1PI6 A;  5GMK n;  3PVU B;  2YBA A;  2XL2 A;  4CY2 A;  4GQ2 P;  4R7A B;  3UR4 A;  1FWX A;  3RN0 D;  3IKO A;  4E5Z A;  3EI1 A;  2IUV A;  2PM6 B;  5K1C C;  2GC7 A;  1RI6 A;  3IJC A;  4CI3 A;  1GP2 B;  4EWR A;  4A09 A;  3ZWL B;  2W18 A;  3JZN A;  2BCJ B;  3EWE A;  3SXT D;  2HKM A;  1ERJ A;  1N6D A;  4A11 B;  3MZK A;  5FXY A;  3RSE C;  3PSL A;  2Q7Q A;  2CN3 A;  3MZL A;  2OVQ B;  3I8C A;  1OMW B;  3SBQ A;  3UKU C;  3FGB A;  4CY5 A;  3I2N A;  4N14 A;  4X3E A;  4GGD A;  4E54 B;  4IA9 A;  4XYI A;  3DXK C;  2HES X;  3F3P A;  2OK6 A;  5FA5 B;  4K3I D;  3EMH A;  4JT5 C;  4FAN D;  4GM3 A;  4BL0 A;  3EI1 B;  2HJ4 A;  2HKR A;  4A2L A;  5FLX g;  2P9L C;  4FA4 D;  4OZU A;  3EU7 A;  3EG6 A;  2YB8 B;  2G9A A;  2O9K A;  2TRC B;  3OKY B;  4ZOZ A;  5HE2 B;  3VA6 A;  1JOF A;  2H9P A;  2BBK H;  3AFC A;  3A0F A;  3PVW B;  3I7L A;  4L1Q D;  5CYK B;  5HE3 B;  2OIZ A;  3PXS D;  3I7K A;  4O45 A;  5GXI A;  4YVD A;  3NVX A;  3OTT A;  5FKR A;  2HXC A;  3SHF A;  1S4U X;  1OLZ A;  2AGX A;  4D6V A;  5HYN B;  3RLM D;  4QL1 A;  2Z2O A;  3V9F A;  3K27 A;  1SQJ A;  3JAM g;  2H9L A;  2UZY B;  2I0T A;  2GNQ A;  3I8E A;  3KRX B;  1U2V C;  1JJU B;  4A0A B;  5HQG A;  4L3H D;  4I79 A;  1JMZ B;  3UVK A;  2G99 A;  4GMB A;  4XEI C;  2IUP A;  4FHL A;  3OKW A;  5EMJ B;  1B9X A;  4PSX B;  3NVQ A;  4ZOX A;  1U4C A;  4QRJ A;  2AQ5 A;  4ERQ A;  2H3X A;  4O3U B;  3MXX A;  4QQE A;  3OL2 A;  4TZ4 A;  3ODT A;  4GZ8 A;  5TF2 A;  3JPX A;  5AMS A;  3MKQ A;  2H13 A;  2HJB A;  2QXV A;  3E0C A;  4O3T B;  1VYH C;  4A11 A;  2B5M A;  1TYQ C;  4HDJ A;  2Z2N A;  4J77 A;  3B7F A;  5AFU 3;  2Z2P A;  2EBS A;  5EM2 B;  4E54 A;  3DWL C;  2GC4 A;  5GSA A;  2J55 H;  3BG1 A;  3RRM C;  4ES0 A;  4A2M A;  1Q47 A;  4PNK B;  4PBZ A;  3OL2 B;  3OKY A;  3JZH A;  5IT9 g;  4BUJ C;  4XYH A;  2YNP A;  4A0B A;  4CI1 A;  2B5N A;  5CYK A;  3SBR A;  1XKS A;  2H9N A;  1JMX B;  3RN1 D;  3UVM A;  4ESG A;  5H14 A;  3VGZ A;  5TEE A;  1SHY B;  3VH0 A;  2XU7 A;  1K32 A;  3SCY A;  2I0R A;  3V5W B;  2P9U C;  4A0A A;  3PSC B;  2B4E A;  4OWR A;  4Z8L A;  1GG2 B;  3OKT A;  5A2Q g;  4ERZ A;  4J0X A;  3EI3 B;  4J84 A;  4LG9 A;  1YFQ A;  4X63 B;  5EAR A;  5B4W A;  4ERY A;  3HFQ A;  3JZG A;  4A0B B;  1PGU A;  4J87 A;  2P9I C;  4JSN C;  5EMK B;  3UVL A;  2H6N A;  2YNN A;  3N0E A;  2IAA A;  3K26 A;  2H14 A;  3GFC A;  4GQB B;  5JWZ A;  4GM9 A;  3ULE C;  1GOT B;  2H47 A;  3JRO A;  5I5I A;  3SJL D;  1PEV A;  4PBY A;  5IGO A;  4FA1 D;  2CE9 A;  4ZOY A;  5IJ8 E;  4KFM B;  5GXH A;  4U7A A;  5EM2 A;  4AOW A;  3J80 g;  3SFZ A;  1B9Y A;  5FKQ A;  4J8B A;  2P9K C;  2J56 H; 
#chains in the Genus database with same CATH topology
 3DXM C;  3CIK B;  4MK0 B;  3V4V A;  2UZX B;  3J81 g;  4AMY A;  4IMM A;  3FCS A;  3JRP A;  4DNW A;  4J78 A;  3SN6 B;  5IC7 A;  3CFV A;  4NEN A;  5C2W B;  2VZ1 A;  4CZV A;  4JT6 C;  1NR0 A;  2OJY A;  3P4F A;  2PM7 B;  3N0D A;  2XE4 A;  3NVN A;  1NEX B;  2P9S C;  4L9O A;  3BG0 A;  3O4I A;  3RFG A;  2HYE A;  2H68 A;  4O9D A;  2VDK A;  2WQ8 A;  5K19 A;  3GC3 B;  2OVR B;  2AGZ A;  2YMU A;  4FA5 D;  1SQ9 A;  4J81 A;  4J86 A;  2OVP B;  1GXR A;  3MMY A;  4MMX A;  5EAL A;  4J82 A;  3EI2 B;  2BKL A;  3DSM A;  3PXW D;  3PE7 A;  4GM8 A;  4G56 B;  5FKS A;  1E5T A;  1R5M A;  3AL8 B;  5H1M A;  2HU5 A;  3CFS B;  1GOF A;  1A12 A;  2AGL A;  4PC0 A;  2IWK A;  2I3T A;  3AL9 A;  2P9P C;  3IVM A;  1VE7 A;  3EI3 A;  4J0W A;  1T2X A;  3GRE A;  5HE0 B;  3UVN A;  3IJ1 A;  4CY1 A;  3IIY A;  5I5M A;  5M5T A;  3IUL A;  4A08 A;  2CN2 A;  4LG8 A;  2H6Q A;  2VDL A;  3I7H A;  4UM8 A;  4Y5R D;  1L0Q A;  1MG3 A;  5IJ7 E;  1PBY B;  3IJ0 A;  2PBI B;  3MKS B;  4GGC A;  4MMY A;  2CNX A;  3I89 A;  1UTC A;  2OK4 A;  3SMR A;  3NIF A;  1VZ3 A;  5I5J A;  4JXM A;  3U4Y A;  2I3S A;  3SBP A;  3K6S A;  4J79 A;  3EI4 B;  4J73 A;  1C9L A;  3T3P A;  4G1M A;  4JSX C;  3RMZ D;  1BPO A;  2CE8 A;  3DDU A;  5E6S A;  4JD2 C;  3OW8 A;  1TBG A;  3C99 A;  2MTA H;  5EMM B;  1A0R B;  1O6G A;  2H6K A;  4JHN A;  5THA A;  4GGA A;  1O6F A;  5C86 A;  3EQ7 A;  4QAM A;  4UI9 R;  3QI0 A;  3MVD K;  2PM9 B;  1H2Z A;  5KDO B;  4Y7R A;  5EAP A;  3W15 A;  2H9M A;  5C9Z B;  4WK0 A;  4A08 B;  4CY3 A;  2EID A;  3C9C A;  4JSV C;  1JV2 A;  1P22 A;  3C5M A;  5CXC A;  3SVW D;  1K8K C;  1GOG A;  2QC5 A;  5IGQ A;  2AGY A;  4E5Z B;  3IIW A;  5H17 A;  1MDA H;  3ORV D;  2IWF A;  4DNV A;  3IJE A;  4CZX A;  3V7D B;  3L4M D;  4A09 B;  5FKT A;  4J8G A;  3SLE D;  1JTD B;  5C2V B;  4X60 B;  2EIC A;  5E6U A;  4ZOV A;  2XL3 A;  3KRW B;  4AEZ A;  5CXB A;  4FAV D;  5SXM A;  4CI2 A;  5EAM A;  3RFH A;  2CO0 C;  1N6E A;  2IUQ A;  1MG2 A;  2I0S A;  4X61 B;  3FRX A;  4BH6 A;  3EI2 A;  2VC2 A;  5AJA A;  3F3G A;  2AGW A;  3I7N A;  1I2M B;  4CZY A;  3BWS A;  3DM0 A;  4D0K A;  3AL8 A;  5CXC B;  4BCB A;  2P9N C;  4LGN A;  2J57 G;  3UVO A;  4GQ1 A;  4NAA A;  3PXT D;  3NID A;  1N6F A;  2AH0 A;  1XHM A;  4PXW A;  1XIP A;  3KCI A;  4K3J B;  4AMZ A;  3AH8 B;  4A7J A;  5EML B;  5FQD A;  4CC9 A;  4QT8 A;  4U1E I;  3SWS D;  2QR5 A;  5E6R A;  3V4P A;  5TEF A;  4L3G D;  2IUR A;  5CXB B;  3L4O D;  4FWW A;  3JB9 L;  3EI4 A;  4CI8 A;  2XYI A;  2HU7 A;  3I7O A;  2YNO A;  4O1Q D;  4JSP C;  3ZDY A;  2B5L A;  4ZN4 A;  4H5J A;  3FCU A;  5TDH B;  4NSX A;  1QNI A;  4G55 A;  3FM0 A;  5HE1 B;  2CO0 A;  3C75 H;  1UOQ A;  3I7P A;  4FB1 D;  3F3F A;  4H5I A;  2PM9 A;  4FA9 D;  2AH1 A;  3UKR C;  4PSW B;  1PI6 A;  2VZ3 A;  5GMK n;  3PVU B;  4BP8 A;  2YBA A;  2XL2 A;  3IUN A;  4CY2 A;  4GQ2 P;  4R7A B;  3UR4 A;  1FWX A;  3RN0 D;  3IKO A;  4E5Z A;  3VI3 A;  3EI1 A;  2IUV A;  2PM6 B;  5K1C C;  2GC7 A;  1K3I A;  1RI6 A;  3IJC A;  4CI3 A;  5M5U A;  1GP2 B;  4EWR A;  4A09 A;  3ZWL B;  2W18 A;  5FFG A;  3MUN A;  3JZN A;  4O02 A;  2BCJ B;  3EWE A;  3SXT D;  2HKM A;  1ERJ A;  1N6D A;  4A11 B;  3MZK A;  5FXY A;  3RSE C;  3PSL A;  2VDN A;  2Q7Q A;  2CN3 A;  3MZL A;  2OVQ B;  3ZDZ A;  3I8C A;  1OMW B;  3SBQ A;  3UKU C;  3FGB A;  3ZDX A;  2XZG A;  4CY5 A;  3I2N A;  4N14 A;  3ZE0 A;  4X3E A;  4GGD A;  4E54 B;  2JKX A;  4IA9 A;  4XYI A;  3DXK C;  4AX4 A;  2HES X;  3T3M A;  3F3P A;  2OK6 A;  4RE6 A;  5FA5 B;  4K3I D;  3EMH A;  4JT5 C;  4FAN D;  4GM3 A;  3ZE2 A;  4BL0 A;  3EI1 B;  2HJ4 A;  2HKR A;  4A2L A;  5FLX g;  2P9L C;  4FA4 D;  4OZU A;  3EU7 A;  3EG6 A;  1UOO A;  3IUM A;  4JHP C;  3K72 A;  1UOP A;  4NC4 A;  2YB8 B;  2G9A A;  4D9S A;  2O9K A;  1C9I A;  2TRC B;  3OKY B;  4ZOZ A;  5HE2 B;  3VA6 A;  1JOF A;  2H9P A;  2BBK H;  3AFC A;  3A0F A;  3PVW B;  1TYE A;  3I7L A;  4L1Q D;  5CYK B;  5HE3 B;  2OIZ A;  3PXS D;  3I7K A;  1H2Y A;  4O45 A;  5GXI A;  4YVD A;  3NVX A;  3OTT A;  5FKR A;  2HXC A;  3SHF A;  5M5R A;  1S4U X;  1OLZ A;  3IUJ A;  2AGX A;  4D6V A;  5HYN B;  3RLM D;  4QL1 A;  2Z2O A;  3V9F A;  3K27 A;  1SQJ A;  4Z7Q A;  3JAM g;  2H9L A;  2UZY B;  2I0T A;  2GNQ A;  3I8E A;  5FFO A;  5M5V A;  3KRX B;  1U2V C;  3OF7 A;  1JJU B;  4A0A B;  5HQG A;  4L3H D;  4I79 A;  1JMZ B;  4NBM A;  3UVK A;  2G99 A;  4GMB A;  4XEI C;  2IUP A;  4FHL A;  3GD1 I;  3OKW A;  5EMJ B;  1B9X A;  3K71 A;  4PSX B;  3NIG A;  3NVQ A;  4ZOX A;  1U4C A;  4QRJ A;  2AQ5 A;  4ERQ A;  2VDP A;  2H3X A;  4O3U B;  3EQ9 A;  3MXX A;  4QQE A;  2VDM A;  3OL2 A;  4TZ4 A;  4Z7O A;  3ODT A;  4GZ8 A;  5TF2 A;  3JPX A;  5AMS A;  3MKQ A;  2H13 A;  2HJB A;  2QXV A;  1VZ2 A;  3E0C A;  4O3T B;  4WK4 A;  1VYH C;  4A11 A;  4BCD A;  2B5M A;  1TYQ C;  4HDJ A;  2Z2N A;  4J77 A;  3B7F A;  3O4G A;  5AFU 3;  2Z2P A;  2EBS A;  2EIB A;  5EM2 B;  4E54 A;  3DWL C;  2GC4 A;  1H2X A;  1L5G A;  5GSA A;  2J55 H;  3BG1 A;  2VDR A;  4G1E A;  4IRZ A;  3RRM C;  4RE5 A;  4ES0 A;  4A2M A;  1Q47 A;  4PNK B;  4PBZ A;  3IUQ A;  3OL2 B;  3OKY A;  5C92 A;  3JZH A;  1QFM A;  2EIE A;  5IT9 g;  4BUJ C;  4L1M A;  1U8C A;  2XDW A;  5HDB A;  4XYH A;  4WK2 A;  2YNP A;  4A0B A;  4CI1 A;  2B5N A;  5CYK A;  3SBR A;  1XKS A;  2H9N A;  1JMX B;  3RN1 D;  3UVM A;  4ESG A;  2VDQ A;  5H14 A;  3VGZ A;  4DNU A;  5TEE A;  5M5S A;  1E8M A;  1QFS A;  1GOH A;  3QHY B;  1SHY B;  3VH0 A;  2XU7 A;  1VE6 A;  1K32 A;  2VDO A;  3SCY A;  4UM9 A;  5M61 A;  2I0R A;  3V5W B;  2P9U C;  4A0A A;  3PSC B;  2B4E A;  4OWR A;  4AN1 A;  4BCC A;  4Z8L A;  1GG2 B;  3OKT A;  5A2Q g;  4ERZ A;  4J0X A;  3EI3 B;  1M1X A;  4WJK A;  4O2W A;  4Z7N A;  4J84 A;  3IUR A;  1YFQ A;  4LG9 A;  4X63 B;  5EAR A;  5B4W A;  4ERY A;  3HFQ A;  3JZG A;  1YR2 A;  4A0B B;  1E8N A;  1PGU A;  3EQ8 A;  4J87 A;  2P9I C;  4JSN C;  5EMK B;  3UVL A;  2H6N A;  2YNN A;  3N0E A;  2IAA A;  1H2W A;  3K26 A;  2H14 A;  3GFC A;  4GQB B;  5JWZ A;  4GM9 A;  3ULE C;  4AN0 A;  3MUO A;  1GOT B;  2H47 A;  3JRO A;  5I5I A;  3ZE1 A;  3SJL D;  4MMZ A;  1PEV A;  4PBY A;  2QZP A;  5IGO A;  4FA1 D;  2CE9 A;  4ZOY A;  5IJ8 E;  4KFM B;  5GXH A;  4U7A A;  5EM2 A;  3VI4 A;  4AOW A;  2HU8 A;  3J80 g;  4BP9 A;  3SFZ A;  1B9Y A;  3O4H A;  3O4J A;  5FKQ A;  4J8B A;  2P9K C;  2J56 H; 
#chains in the Genus database with same CATH homology
 3DXM C;  3CIK B;  4MK0 B;  2UZX B;  3J81 g;  4IMM A;  3JRP A;  4J78 A;  3SN6 B;  5IC7 A;  3CFV A;  5C2W B;  4CZV A;  4JT6 C;  1NR0 A;  2OJY A;  3P4F A;  2PM7 B;  3N0D A;  3NVN A;  1NEX B;  2P9S C;  4L9O A;  3BG0 A;  3RFG A;  2HYE A;  2H68 A;  4O9D A;  5K19 A;  2OVR B;  2AGZ A;  2YMU A;  4FA5 D;  1SQ9 A;  4J81 A;  4J86 A;  2OVP B;  1GXR A;  3MMY A;  5EAL A;  4J82 A;  3EI2 B;  3DSM A;  3PXW D;  3PE7 A;  4GM8 A;  4G56 B;  5FKS A;  1R5M A;  3AL8 B;  5H1M A;  3CFS B;  2AGL A;  4PC0 A;  2IWK A;  2I3T A;  3AL9 A;  2P9P C;  3EI3 A;  4J0W A;  3GRE A;  5HE0 B;  3UVN A;  3IJ1 A;  4CY1 A;  3IIY A;  5I5M A;  4A08 A;  2CN2 A;  4LG8 A;  2H6Q A;  3I7H A;  4Y5R D;  1MG3 A;  1L0Q A;  5IJ7 E;  1PBY B;  3IJ0 A;  2PBI B;  3MKS B;  4GGC A;  2CNX A;  3I89 A;  2OK4 A;  3SMR A;  5I5J A;  4JXM A;  3U4Y A;  2I3S A;  3SBP A;  4J79 A;  3EI4 B;  4J73 A;  4JSX C;  3RMZ D;  2CE8 A;  4JD2 C;  3OW8 A;  1TBG A;  3C99 A;  2MTA H;  5EMM B;  1A0R B;  2H6K A;  5THA A;  4GGA A;  4UI9 R;  2PM9 B;  5KDO B;  4Y7R A;  5EAP A;  3W15 A;  2H9M A;  5C9Z B;  4A08 B;  4CY3 A;  3C9C A;  4JSV C;  1P22 A;  3C5M A;  5CXC A;  3SVW D;  1K8K C;  2QC5 A;  5IGQ A;  2AGY A;  4E5Z B;  3IIW A;  5H17 A;  1MDA H;  3ORV D;  2IWF A;  4CZX A;  3V7D B;  3L4M D;  4A09 B;  5FKT A;  4J8G A;  3SLE D;  5C2V B;  4X60 B;  4ZOV A;  2XL3 A;  3KRW B;  4AEZ A;  5CXB A;  4FAV D;  5SXM A;  4CI2 A;  5EAM A;  3RFH A;  2CO0 C;  1N6E A;  2IUQ A;  1MG2 A;  2I0S A;  4X61 B;  3FRX A;  4BH6 A;  3EI2 A;  5AJA A;  3F3G A;  2AGW A;  3I7N A;  4CZY A;  3BWS A;  3DM0 A;  4D0K A;  3AL8 A;  5CXC B;  2P9N C;  4LGN A;  2J57 G;  3UVO A;  4GQ1 A;  3PXT D;  1N6F A;  2AH0 A;  1XHM A;  4PXW A;  1XIP A;  4K3J B;  3AH8 B;  4A7J A;  5EML B;  5FQD A;  4CC9 A;  4QT8 A;  4U1E I;  3SWS D;  5TEF A;  4L3G D;  2IUR A;  5CXB B;  3L4O D;  4FWW A;  3JB9 L;  3EI4 A;  4CI8 A;  2XYI A;  3I7O A;  2YNO A;  4O1Q D;  4JSP C;  2B5L A;  4ZN4 A;  4H5J A;  5TDH B;  4NSX A;  1QNI A;  3FM0 A;  5HE1 B;  2CO0 A;  3C75 H;  3I7P A;  4FB1 D;  3F3F A;  4H5I A;  2PM9 A;  4FA9 D;  2AH1 A;  3UKR C;  4PSW B;  1PI6 A;  5GMK n;  3PVU B;  2YBA A;  2XL2 A;  4CY2 A;  4GQ2 P;  4R7A B;  3UR4 A;  1FWX A;  3RN0 D;  3IKO A;  4E5Z A;  3EI1 A;  2IUV A;  2PM6 B;  5K1C C;  2GC7 A;  1RI6 A;  3IJC A;  4CI3 A;  1GP2 B;  4EWR A;  4A09 A;  3ZWL B;  2W18 A;  3JZN A;  2BCJ B;  3EWE A;  3SXT D;  2HKM A;  1ERJ A;  1N6D A;  4A11 B;  3MZK A;  5FXY A;  3RSE C;  3PSL A;  2Q7Q A;  2CN3 A;  3MZL A;  2OVQ B;  3I8C A;  1OMW B;  3SBQ A;  3UKU C;  3FGB A;  4CY5 A;  3I2N A;  4N14 A;  4X3E A;  4GGD A;  4E54 B;  4IA9 A;  4XYI A;  3DXK C;  2HES X;  3F3P A;  2OK6 A;  5FA5 B;  4K3I D;  3EMH A;  4JT5 C;  4FAN D;  4GM3 A;  4BL0 A;  3EI1 B;  2HJ4 A;  2HKR A;  4A2L A;  5FLX g;  2P9L C;  4FA4 D;  4OZU A;  3EU7 A;  3EG6 A;  2YB8 B;  2G9A A;  2O9K A;  2TRC B;  3OKY B;  4ZOZ A;  5HE2 B;  3VA6 A;  1JOF A;  2H9P A;  2BBK H;  3AFC A;  3A0F A;  3PVW B;  3I7L A;  4L1Q D;  5CYK B;  5HE3 B;  2OIZ A;  3PXS D;  3I7K A;  4O45 A;  5GXI A;  4YVD A;  3NVX A;  3OTT A;  5FKR A;  2HXC A;  3SHF A;  1S4U X;  1OLZ A;  2AGX A;  4D6V A;  5HYN B;  3RLM D;  4QL1 A;  2Z2O A;  3V9F A;  3K27 A;  1SQJ A;  3JAM g;  2H9L A;  2UZY B;  2I0T A;  2GNQ A;  3I8E A;  3KRX B;  1U2V C;  1JJU B;  4A0A B;  5HQG A;  4L3H D;  4I79 A;  1JMZ B;  3UVK A;  2G99 A;  4GMB A;  4XEI C;  2IUP A;  4FHL A;  3OKW A;  5EMJ B;  1B9X A;  4PSX B;  3NVQ A;  4ZOX A;  1U4C A;  4QRJ A;  2AQ5 A;  4ERQ A;  2H3X A;  4O3U B;  3MXX A;  4QQE A;  3OL2 A;  4TZ4 A;  3ODT A;  4GZ8 A;  5TF2 A;  3JPX A;  5AMS A;  3MKQ A;  2H13 A;  2HJB A;  2QXV A;  3E0C A;  4O3T B;  1VYH C;  4A11 A;  2B5M A;  1TYQ C;  4HDJ A;  2Z2N A;  4J77 A;  3B7F A;  5AFU 3;  2Z2P A;  2EBS A;  5EM2 B;  4E54 A;  3DWL C;  2GC4 A;  5GSA A;  2J55 H;  3BG1 A;  3RRM C;  4ES0 A;  4A2M A;  1Q47 A;  4PNK B;  4PBZ A;  3OL2 B;  3OKY A;  3JZH A;  5IT9 g;  4BUJ C;  4XYH A;  2YNP A;  4A0B A;  4CI1 A;  2B5N A;  5CYK A;  3SBR A;  1XKS A;  2H9N A;  1JMX B;  3RN1 D;  3UVM A;  4ESG A;  5H14 A;  3VGZ A;  5TEE A;  1SHY B;  3VH0 A;  2XU7 A;  1K32 A;  3SCY A;  2I0R A;  3V5W B;  2P9U C;  4A0A A;  3PSC B;  2B4E A;  4OWR A;  4Z8L A;  1GG2 B;  3OKT A;  5A2Q g;  4ERZ A;  4J0X A;  3EI3 B;  4J84 A;  4LG9 A;  1YFQ A;  4X63 B;  5EAR A;  5B4W A;  4ERY A;  3HFQ A;  3JZG A;  4A0B B;  1PGU A;  4J87 A;  2P9I C;  4JSN C;  5EMK B;  3UVL A;  2H6N A;  2YNN A;  3N0E A;  2IAA A;  3K26 A;  2H14 A;  3GFC A;  4GQB B;  5JWZ A;  4GM9 A;  3ULE C;  1GOT B;  2H47 A;  3JRO A;  5I5I A;  3SJL D;  1PEV A;  4PBY A;  5IGO A;  4FA1 D;  2CE9 A;  4ZOY A;  5IJ8 E;  4KFM B;  5GXH A;  4U7A A;  5EM2 A;  4AOW A;  3J80 g;  3SFZ A;  1B9Y A;  5FKQ A;  4J8B A;  2P9K C;  2J56 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...