4EWRA

X-ray structure of wdr5-setd1a win motif peptide binary complex
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
304
structure length
304
Chain Sequence
VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/transferase
molecule keywords WD repeat-containing protein 5
publication title Structural basis for WDR5 interaction (Win) motif recognition in human SET1 family histone methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
total genus 102
structure length 304
sequence length 304
ec nomenclature
pdb deposition date 2012-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4ewrA00
4L1QD 3PE7A 4PXWA 3PSLA 1A0RB 2O9KA 3RRMC 5GXIA 5HE0B 3I2NA 5EMJB 4J8BA 4JSVC 1SHYB 1JOFA 5AJAA 4MK0B 3I8CA 4GM8A 5K19A 3JPXA 5H1MA 4ES0A 5FQDA 2G9AA 5EAPA 3I7PA 3UVMA 2B5NA 3MXXA 4CZXA 2B4EA 4PBZA 3FGBA 3K27A 3CFVA 2P9NC 2PBIB 3I7LA 5C2WB 4O3TB 4ZOXA 3VH0A 3A0FA 4HDJA 2AGYA 3SMRA 5IC7A 5CXCB 3EI3A 3UVLA 5FA5B 4JSXC 3L4MD 3EWEA 2I0SA 5IGQA 3EI2A 4QQEA 2AGZA 3BG1A 4JT6C 2EBSA 3AL9A 4BUJC 2QXVA 2IAAA 4IMMA 1ERJA 2TRCB 2OVPB 4OWRA 4J0XA 1TYQC 2QC5A 2GC4A 4CZYA 2PM9B 1MDAH 5CXBB 2P9LC 4G56B 5K1CC 5GMKn 5GXHA 1L0QA 3ULEC 4CZVA 4GGDA 4JD2C 4JT5C 4D6VA 3C9CA 1VYHC 3RN0D 2OIZA 3IKOA 3OKYB 1XKSA 5A2Qg 2IWKA 3I8EA 4XEIC 5CXCA 1PI6A 1K32A 1PEVA 4J84A 5EM2A 3RFGA 3JRPA 2XL3A 4A0BA 4D0KA 3SBRA 3SXTD 4QT8A 2I0RA 1R5MA 3OW8A 5HQGA 3E0CA 4CY1A 4A08A 2P9KC 3MKSB 5I5MA 3EI1B 3PXTD 2IURA 5KDOB 4K3JB 3SVWD 4ERYA 3IJ1A 2HKRA 3C99A 4J8GA 2HKMA 4ZOZA 3CFSB 3CIKB 4AOWA 3GFCA 4X61B 3RLMD 4FAVD 2H47A 2AGXA 3AL8A 4A2LA 1U4CA 3MMYA 4R7AB 4X60B 3V7DB 3AH8B 1NR0A 3JB9L 2CN3A 5H14A 5EMMB 5FKSA 4NSXA 3DXKC 3JAMg 4U1EI 4JXMA 4L3GD 1K8KC 1TBGA 2AGLA 4QRJA 2IUQA 2I3TA 2HJBA 5CYKB 2YBAA 2H13A 2CO0A 2P9UC 4H5JA 3C75H 2Z2PA 4E5ZA 3P4FA 2Z2NA 4GMBA 4X3EA 4J73A 3PSCB 4O3UB 3DWLC 2W18A 3DXMC 2OK6A 3L4OD 4A11A 4FB1D 1OLZA 2AH0A 4A09B 3UVKA 2CE9A 3N0DA 4L9OA 3PXWD 3EI4B 3K26A 1MG2A 3BWSA 2H9NA 4BH6A 4CI8A 3SHFA 3F3PA 5GSAA 4J86A 4LGNA 3J81g 5AFU3 3F3GA 4JSNC 2OJYA 5IJ7E 1RI6A 4FA4D 1QNIA 4CY5A 5TDHB 5HE1B 4CY3A 4N14A 4Y7RA 3BG0A 3NVQA 3IJ0A 4FAND 5SXMA 2H9PA 5EALA 3SLED 4K3ID 4L3HD 4J82A 3VGZA 2P9IC 3EI4A 1SQJA 2UZXB 2CO0C 3DSMA 1XIPA 3KRXB 3UR4A 4BL0A 3I7NA 2BBKH 2B5MA 4CY2A 4GGAA 5AMSA 2J55H 5EMLB 3RSEC 2YNOA 5JWZA 1PGUA 3FRXA 3SCYA 2H68A 4ZOVA 2XYIA 2I3SA 3SFZA 3ZWLB 4CI1A 2P9SC 3DM0A 3OKTA 2PM7B 2HESX 4GQ1A 4X63B 2J56H 3PXSD 2IUPA 5FLXg 1N6EA 3B7FA 2H6NA 2PM9A 5CXBA 4XYIA 1XHMA 4PC0A 5IJ8E 3SBPA 2XL2A 3MZKA 2H6KA 4TZ4A 4FA9D 3ORVD 2AQ5A 3PVUB 3OKYA 2IUVA 3RN1D 5IT9g 2H9MA 3EG6A 5C9ZB 3V9FA 3RFHA 2IWFA 5THAA 3EU7A 3N0EA 4U7AA 5EMKB 5HE2B 3MZLA 4JSPC 5H17A 3IJCA 3V5WB 4YVDA 5FKTA 5TEEA 3OKWA 4O1QD 5FKQA 5EARA 4EWRA 3EI1A 5I5IA 2XU7A 1PBYB 3NVNA 2Q7QA 3I7KA 3JZNA 4FWWA 2H6QA 5IGOA 3JROA 5FXYA 1Q47A 3UVNA 1B9YA 4J78A 3SWSD 2H9LA 2PM6B 5TF2A 4IA9A 3W15A 4J77A 2AH1A 1OMWB 3F3FA 3C5MA 1YFQA 4H5IA 4KFMB 4ZOYA 3J80g 4PSXB 3I7HA 2YB8B 1JMXB 3EI3B 5CYKA 4CI2A 1SQ9A 1N6DA 3GREA 5I5JA 5TEFA 4CC9A 3EI2B 2OVRB 3I89A 4XYHA 2P9PC 4E54B 2MTAH 4GQ2P 4PNKB 2G99A 3I7OA 4ERZA 4J81A 1GXRA 4A09A 3IIWA 4Y5RD 3FM0A 3JZHA 4AEZA 2HXCA 2UZYB 1NEXB 1P22A 4A2MA 1JMZB 4PSWB 4Z8LA 2HYEA 5EAMA 2GC7A 3MKQA 2OVQB 5EM2B 2B5LA 4GZ8A 4QL1A 4A0BB 2CNXA 2BCJB 4LG9A 3SN6B 4LG8A 3UKUC 2H3XA 3U4YA 4E54A 4I79A 4A08B 3RMZD 4PBYA 3UKRC 2YMUA 3SJLD 3HFQA 3AFCA 4GM9A 4GM3A 4GGCA 3JZGA 3ODTA 2I0TA 2GNQA 3OL2B 1JJUB 3AL8B 4UI9R 3VA6A 4J79A 4OZUA 1MG3A 3IIYA 5C2VB 2CE8A 4ERQA 4CI3A 1FWXA 1GOTB 4ESGA 5HYNB 4A0AB 1GP2B 2YNNA 2H14A 1N6FA 2OK4A 2YNPA 2J57G 2CN2A 4ZN4A 4J87A 5B4WA 4A7JA 4O9DA 1S4UX 4GQBB 2AGWA 3KRWB 4FA5D 4E5ZB 3OTTA 2HJ4A 5FKRA 4FHLA 3OL2A 3SBQA 3UVOA 4J0WA 1U2VC 3NVXA 4A11B 3PVWB 3EMHA 4FA1D 5HE3B 1B9XA 2Z2OA 4A0AA 4O45A 1GG2B
chains in the Genus database with same CATH superfamily
4L1QD 3PE7A 4PXWA 3PSLA 1A0RB 3K72A 2O9KA 2XDWA 3RRMC 2HU8A 5GXIA 3K71A 5HE0B 3I2NA 5EMJB 4J8BA 4JSVC 5C86A 1SHYB 2EIEA 1JOFA 4JHNA 5AJAA 4MK0B 1O6GA 3I8CA 4UM9A 4GM8A 5K19A 3JPXA 5H1MA 4ES0A 5FQDA 2G9AA 5EAPA 1GOHA 3I7PA 3IUMA 3UVMA 2B5NA 4MMYA 4BP9A 3MXXA 4CZXA 2B4EA 4PBZA 3FGBA 3K27A 3CFVA 2P9NC 3O4GA 2PBIB 3I7LA 5C2WB 4O3TB 4ZOXA 3VH0A 3A0FA 4HDJA 2VZ3A 2AGYA 3SMRA 5IC7A 5CXCB 3EI3A 3UVLA 5FA5B 4JSXC 3L4MD 2XZGA 2I0SA 3EWEA 5IGQA 3EI2A 5FFOA 4QQEA 3K6SA 1JV2A 2AGZA 3BG1A 4JT6C 2WQ8A 2EBSA 3ZE2A 3IUNA 3EQ9A 3AL9A 4BUJC 2QXVA 2IAAA 4IMMA 1H2WA 1ERJA 2TRCB 2OVPB 4BCCA 4OWRA 4J0XA 1TYQC 3ZDZA 2QC5A 2GC4A 4CZYA 2PM9B 4AN1A 1MDAH 5CXBB 2P9LC 4G56B 5K1CC 5GMKn 5GXHA 1L0QA 3ULEC 3ZE1A 4CZVA 4GGDA 4JD2C 4JT5C 2VDPA 4D6VA 3C9CA 1VYHC 3RN0D 2OIZA 3IKOA 3OKYB 1XKSA 5A2Qg 3EQ7A 2IWKA 3I8EA 4XEIC 5CXCA 1PI6A 1K32A 1PEVA 4J84A 4G55A 5EM2A 3RFGA 3JRPA 2XL3A 4A0BA 4D0KA 5M5TA 3SBRA 3SXTD 4QT8A 2I0RA 1R5MA 3IUQA 3OW8A 5HQGA 3E0CA 4CY1A 2QZPA 4A08A 2P9KC 3V4PA 3MKSB 5M61A 5I5MA 3EI1B 4O2WA 3PXTD 2IURA 5KDOB 4K3JB 3SVWD 4ERYA 1GOFA 3IJ1A 2HKRA 3C99A 2QR5A 4J8GA 2HKMA 4ZOZA 1A12A 1E5TA 3CFSB 3CIKB 4AOWA 3GFCA 4X61B 3RLMD 4FAVD 2H47A 3O4HA 3IVMA 2AGXA 2BKLA 3AL8A 4A2LA 1U4CA 3MMYA 4R7AB 4X60B 3V7DB 3AH8B 4JHPC 1NR0A 3JB9L 2CN3A 1QFMA 5E6RA 5H14A 5EMMB 5FKSA 1K3IA 4NSXA 3DXKC 3VI3A 3ZE0A 3KCIA 3JAMg 4U1EI 4JXMA 3MVDK 3MUNA 4L3GD 1K8KC 1TBGA 2AGLA 4QRJA 2IUQA 2I3TA 4G1EA 2HJBA 4NC4A 5CYKB 2VDMA 2YBAA 2H13A 4QAMA 4AMZA 2CO0A 3IUJA 2P9UC 4H5JA 3OF7A 3QI0A 3C75H 1M1XA 2Z2PA 4E5ZA 3P4FA 2Z2NA 4GMBA 4X3EA 1UOPA 2EIDA 4J73A 3PSCB 4O3UB 3DWLC 2W18A 3DXMC 4BCBA 2OK6A 3L4OD 4A11A 1C9LA 4FB1D 1OLZA 2AH0A 4A09B 3UVKA 2CE9A 3N0DA 4L9OA 3PXWD 2HU5A 3EI4B 3K26A 1MG2A 5HDBA 3BWSA 2H9NA 4BH6A 4CI8A 3SHFA 1C9IA 3F3PA 5GSAA 4J86A 4LGNA 3J81g 5AFU3 3F3GA 4JSNC 2OJYA 5IJ7E 1VE6A 1RI6A 4FA4D 1QNIA 4CY5A 5TDHB 5HE1B 3ZDXA 4CY3A 4DNWA 4N14A 4Y7RA 1T2XA 3BG0A 4MMZA 5C92A 3NVQA 3IJ0A 4FAND 5SXMA 2H9PA 5EALA 3GD1I 3SLED 3T3MA 4K3ID 4L3HD 4J82A 3QHYB 1H2ZA 3VGZA 2P9IC 1BPOA 3EI4A 1SQJA 2UZXB 2CO0C 3DSMA 1XIPA 2HU7A 3KRXB 3UR4A 4BL0A 3I7NA 3IURA 3ZDYA 4DNVA 2BBKH 2B5MA 4CY2A 4GGAA 4AX4A 5AMSA 2J55H 4BP8A 5EMLB 5FFGA 3EQ8A 5E6UA 4MMXA 4Z7NA 4IRZA 3RSEC 2YNOA 4DNUA 1PGUA 3FRXA 3SCYA 5JWZA 2H68A 1L5GA 4ZOVA 2XYIA 2I3SA 3SFZA 3ZWLB 4CI1A 2P9SC 3DM0A 3OKTA 2PM7B 2HESX 4GQ1A 4X63B 2J56H 3PXSD 1O6FA 3IULA 2IUPA 5FLXg 3NIFA 1N6EA 3B7FA 4NAAA 2H6NA 2PM9A 2VDKA 5CXBA 5M5VA 4Z7OA 4NBMA 4XYIA 1XHMA 4PC0A 5IJ8E 3SBPA 1I2MB 2XL2A 2XE4A 3MZKA 2H6KA 4TZ4A 4FA9D 3ORVD 2AQ5A 3PVUB 3OKYA 1UOOA 2IUVA 3RN1D 5M5RA 5IT9g 2H9MA 3EG6A 3MUOA 5C9ZB 3IJEA 1VZ2A 3RFHA 3V9FA 2IWFA 5THAA 4NENA 3EU7A 3GC3B 3N0EA 4U7AA 5EMKB 5HE2B 3MZLA 4JSPC 1VE7A 5H17A 3IJCA 3V5WB 4YVDA 5FKTA 5TEEA 3OKWA 4O1QD 5FKQA 5EARA 4EWRA 3EI1A 5I5IA 2XU7A 1PBYB 4AMYA 3NVNA 2Q7QA 3I7KA 3JZNA 4FWWA 2H6QA 5IGOA 3JROA 5FXYA 1Q47A 3UVNA 1B9YA 4J78A 3SWSD 2VDRA 2H9LA 2PM6B 5TF2A 3FCSA 2JKXA 4IA9A 4WK4A 3W15A 4J77A 2AH1A 5M5SA 1OMWB 3F3FA 3C5MA 1GOGA 1YFQA 5E6SA 4H5IA 4KFMB 4ZOYA 3J80g 4PSXB 3I7HA 2YB8B 1JMXB 3EI3B 5CYKA 2EIBA 4CI2A 1SQ9A 1N6DA 2VZ1A 3GREA 5I5JA 5TEFA 4CC9A 3EI2B 2OVRB 3O4JA 3I89A 1UOQA 4XYHA 2P9PC 4E54B 2MTAH 1VZ3A 4GQ2P 2VDQA 4PNKB 2G99A 4UM8A 3I7OA 4ERZA 4WK0A 4RE6A 4J81A 1QFSA 1GXRA 4A09A 3IIWA 4Y5RD 2VC2A 3FM0A 3JZHA 4AEZA 3FCUA 4WK2A 3NIGA 2HXCA 2UZYB 1NEXB 1P22A 4A2MA 1JMZB 4PSWB 4Z8LA 2HYEA 5EAMA 4WJKA 2GC7A 3MKQA 4O02A 2OVQB 5EM2B 2B5LA 1JTDB 4GZ8A 4QL1A 4A0BB 2CNXA 3VI4A 2BCJB 4LG9A 3SN6B 4LG8A 3UKUC 2H3XA 4D9SA 3U4YA 4G1MA 4E54A 4I79A 4A08B 5M5UA 3RMZD 4PBYA 3UKRC 2YMUA 3SJLD 3HFQA 3AFCA 4GM9A 1E8MA 4RE5A 4GM3A 2EICA 4GGCA 3JZGA 3ODTA 1U8CA 2I0TA 2GNQA 3OL2B 3O4IA 1JJUB 3AL8B 4UI9R 3VA6A 4J79A 4OZUA 1E8NA 1MG3A 2VDLA 3IIYA 5C2VB 2CE8A 4BCDA 4ERQA 4CI3A 1FWXA 1GOTB 4ESGA 5HYNB 4A0AB 2VDOA 1GP2B 3V4VA 2YNNA 2H14A 1N6FA 3NIDA 4AN0A 2OK4A 2YNPA 2J57G 2CN2A 4ZN4A 4Z7QA 4J87A 5B4WA 4A7JA 4O9DA 4L1MA 1S4UX 1YR2A 4GQBB 2AGWA 1H2YA 3KRWB 4FA5D 1UTCA 3T3PA 4E5ZB 3OTTA 2HJ4A 5FKRA 4FHLA 2VDNA 3OL2A 3SBQA 3UVOA 4J0WA 1U2VC 1TYEA 3NVXA 4A11B 3PVWB 3EMHA 1H2XA 4FA1D 5HE3B 1B9XA 2Z2OA 4A0AA 4O45A 3DDUA 1GG2B
chains in the Genus database with same CATH topology
4L1QD 3PE7A 4PXWA 3PSLA 1A0RB 2O9KA 3RRMC 5GXIA 5HE0B 3I2NA 5EMJB 4J8BA 4JSVC 1SHYB 1JOFA 5AJAA 4MK0B 3I8CA 4GM8A 5K19A 3JPXA 5H1MA 4ES0A 5FQDA 2G9AA 5EAPA 3I7PA 3UVMA 2B5NA 3MXXA 4CZXA 2B4EA 4PBZA 3FGBA 3K27A 3CFVA 2P9NC 2PBIB 3I7LA 5C2WB 4O3TB 4ZOXA 3VH0A 3A0FA 4HDJA 2AGYA 3SMRA 5IC7A 5CXCB 3EI3A 3UVLA 5FA5B 4JSXC 3L4MD 3EWEA 2I0SA 5IGQA 3EI2A 4QQEA 2AGZA 3BG1A 4JT6C 2EBSA 3AL9A 4BUJC 2QXVA 2IAAA 4IMMA 1ERJA 2TRCB 2OVPB 4OWRA 4J0XA 1TYQC 2QC5A 2GC4A 4CZYA 2PM9B 1MDAH 5CXBB 2P9LC 4G56B 5K1CC 5GMKn 5GXHA 1L0QA 3ULEC 4CZVA 4GGDA 4JD2C 4JT5C 4D6VA 3C9CA 1VYHC 3RN0D 2OIZA 3IKOA 3OKYB 1XKSA 5A2Qg 2IWKA 3I8EA 4XEIC 5CXCA 1PI6A 1K32A 1PEVA 4J84A 5EM2A 3RFGA 3JRPA 2XL3A 4A0BA 4D0KA 3SBRA 3SXTD 4QT8A 2I0RA 1R5MA 3OW8A 5HQGA 3E0CA 4CY1A 4A08A 2P9KC 3MKSB 5I5MA 3EI1B 3PXTD 2IURA 5KDOB 4K3JB 3SVWD 4ERYA 3IJ1A 2HKRA 3C99A 4J8GA 2HKMA 4ZOZA 3CFSB 3CIKB 4AOWA 3GFCA 4X61B 3RLMD 4FAVD 2H47A 2AGXA 3AL8A 4A2LA 1U4CA 3MMYA 4R7AB 4X60B 3V7DB 3AH8B 1NR0A 3JB9L 2CN3A 5H14A 5EMMB 5FKSA 4NSXA 3DXKC 3JAMg 4U1EI 4JXMA 4L3GD 1K8KC 1TBGA 2AGLA 4QRJA 2IUQA 2I3TA 2HJBA 5CYKB 2YBAA 2H13A 2CO0A 2P9UC 4H5JA 3C75H 2Z2PA 4E5ZA 3P4FA 2Z2NA 4GMBA 4X3EA 4J73A 3PSCB 4O3UB 3DWLC 2W18A 3DXMC 2OK6A 3L4OD 4A11A 4FB1D 1OLZA 2AH0A 4A09B 3UVKA 2CE9A 3N0DA 4L9OA 3PXWD 3EI4B 3K26A 1MG2A 3BWSA 2H9NA 4BH6A 4CI8A 3SHFA 3F3PA 5GSAA 4J86A 4LGNA 3J81g 5AFU3 3F3GA 4JSNC 2OJYA 5IJ7E 1RI6A 4FA4D 1QNIA 4CY5A 5TDHB 5HE1B 4CY3A 4N14A 4Y7RA 3BG0A 3NVQA 3IJ0A 4FAND 5SXMA 2H9PA 5EALA 3SLED 4K3ID 4L3HD 4J82A 3VGZA 2P9IC 3EI4A 1SQJA 2UZXB 2CO0C 3DSMA 1XIPA 3KRXB 3UR4A 4BL0A 3I7NA 2BBKH 2B5MA 4CY2A 4GGAA 5AMSA 2J55H 5EMLB 3RSEC 2YNOA 5JWZA 1PGUA 3FRXA 3SCYA 2H68A 4ZOVA 2XYIA 2I3SA 3SFZA 3ZWLB 4CI1A 2P9SC 3DM0A 3OKTA 2PM7B 2HESX 4GQ1A 4X63B 2J56H 3PXSD 2IUPA 5FLXg 1N6EA 3B7FA 2H6NA 2PM9A 5CXBA 4XYIA 1XHMA 4PC0A 5IJ8E 3SBPA 2XL2A 3MZKA 2H6KA 4TZ4A 4FA9D 3ORVD 2AQ5A 3PVUB 3OKYA 2IUVA 3RN1D 5IT9g 2H9MA 3EG6A 5C9ZB 3V9FA 3RFHA 2IWFA 5THAA 3EU7A 3N0EA 4U7AA 5EMKB 5HE2B 3MZLA 4JSPC 5H17A 3IJCA 3V5WB 4YVDA 5FKTA 5TEEA 3OKWA 4O1QD 5FKQA 5EARA 4EWRA 3EI1A 5I5IA 2XU7A 1PBYB 3NVNA 2Q7QA 3I7KA 3JZNA 4FWWA 2H6QA 5IGOA 3JROA 5FXYA 1Q47A 3UVNA 1B9YA 4J78A 3SWSD 2H9LA 2PM6B 5TF2A 4IA9A 3W15A 4J77A 2AH1A 1OMWB 3F3FA 3C5MA 1YFQA 4H5IA 4KFMB 4ZOYA 3J80g 4PSXB 3I7HA 2YB8B 1JMXB 3EI3B 5CYKA 4CI2A 1SQ9A 1N6DA 3GREA 5I5JA 5TEFA 4CC9A 3EI2B 2OVRB 3I89A 4XYHA 2P9PC 4E54B 2MTAH 4GQ2P 4PNKB 2G99A 3I7OA 4ERZA 4J81A 1GXRA 4A09A 3IIWA 4Y5RD 3FM0A 3JZHA 4AEZA 2HXCA 2UZYB 1NEXB 1P22A 4A2MA 1JMZB 4PSWB 4Z8LA 2HYEA 5EAMA 2GC7A 3MKQA 2OVQB 5EM2B 2B5LA 4GZ8A 4QL1A 4A0BB 2CNXA 2BCJB 4LG9A 3SN6B 4LG8A 3UKUC 2H3XA 3U4YA 4E54A 4I79A 4A08B 3RMZD 4PBYA 3UKRC 2YMUA 3SJLD 3HFQA 3AFCA 4GM9A 4GM3A 4GGCA 3JZGA 3ODTA 2I0TA 2GNQA 3OL2B 1JJUB 3AL8B 4UI9R 3VA6A 4J79A 4OZUA 1MG3A 3IIYA 5C2VB 2CE8A 4ERQA 4CI3A 1FWXA 1GOTB 4ESGA 5HYNB 4A0AB 1GP2B 2YNNA 2H14A 1N6FA 2OK4A 2YNPA 2J57G 2CN2A 4ZN4A 4J87A 5B4WA 4A7JA 4O9DA 1S4UX 4GQBB 2AGWA 3KRWB 4FA5D 4E5ZB 3OTTA 2HJ4A 5FKRA 4FHLA 3OL2A 3SBQA 3UVOA 4J0WA 1U2VC 3NVXA 4A11B 3PVWB 3EMHA 4FA1D 5HE3B 1B9XA 2Z2OA 4A0AA 4O45A 1GG2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L1Q D;  3PE7 A;  4PXW A;  3PSL A;  1A0R B;  2O9K A;  3RRM C;  5GXI A;  5HE0 B;  3I2N A;  5EMJ B;  4J8B A;  4JSV C;  1SHY B;  1JOF A;  5AJA A;  4MK0 B;  3I8C A;  4GM8 A;  5K19 A;  3JPX A;  5H1M A;  4ES0 A;  5FQD A;  2G9A A;  5EAP A;  3I7P A;  3UVM A;  2B5N A;  3MXX A;  4CZX A;  2B4E A;  4PBZ A;  3FGB A;  3K27 A;  3CFV A;  2P9N C;  2PBI B;  3I7L A;  5C2W B;  4O3T B;  4ZOX A;  3VH0 A;  3A0F A;  4HDJ A;  2AGY A;  3SMR A;  5IC7 A;  5CXC B;  3EI3 A;  3UVL A;  5FA5 B;  4JSX C;  3L4M D;  3EWE A;  2I0S A;  5IGQ A;  3EI2 A;  4QQE A;  2AGZ A;  3BG1 A;  4JT6 C;  2EBS A;  3AL9 A;  4BUJ C;  2QXV A;  2IAA A;  4IMM A;  1ERJ A;  2TRC B;  2OVP B;  4OWR A;  4J0X A;  1TYQ C;  2QC5 A;  2GC4 A;  4CZY A;  2PM9 B;  1MDA H;  5CXB B;  2P9L C;  4G56 B;  5K1C C;  5GMK n;  5GXH A;  1L0Q A;  3ULE C;  4CZV A;  4GGD A;  4JD2 C;  4JT5 C;  4D6V A;  3C9C A;  1VYH C;  3RN0 D;  2OIZ A;  3IKO A;  3OKY B;  1XKS A;  5A2Q g;  2IWK A;  3I8E A;  4XEI C;  5CXC A;  1PI6 A;  1K32 A;  1PEV A;  4J84 A;  5EM2 A;  3RFG A;  3JRP A;  2XL3 A;  4A0B A;  4D0K A;  3SBR A;  3SXT D;  4QT8 A;  2I0R A;  1R5M A;  3OW8 A;  5HQG A;  3E0C A;  4CY1 A;  4A08 A;  2P9K C;  3MKS B;  5I5M A;  3EI1 B;  3PXT D;  2IUR A;  5KDO B;  4K3J B;  3SVW D;  4ERY A;  3IJ1 A;  2HKR A;  3C99 A;  4J8G A;  2HKM A;  4ZOZ A;  3CFS B;  3CIK B;  4AOW A;  3GFC A;  4X61 B;  3RLM D;  4FAV D;  2H47 A;  2AGX A;  3AL8 A;  4A2L A;  1U4C A;  3MMY A;  4R7A B;  4X60 B;  3V7D B;  3AH8 B;  1NR0 A;  3JB9 L;  2CN3 A;  5H14 A;  5EMM B;  5FKS A;  4NSX A;  3DXK C;  3JAM g;  4U1E I;  4JXM A;  4L3G D;  1K8K C;  1TBG A;  2AGL A;  4QRJ A;  2IUQ A;  2I3T A;  2HJB A;  5CYK B;  2YBA A;  2H13 A;  2CO0 A;  2P9U C;  4H5J A;  3C75 H;  2Z2P A;  4E5Z A;  3P4F A;  2Z2N A;  4GMB A;  4X3E A;  4J73 A;  3PSC B;  4O3U B;  3DWL C;  2W18 A;  3DXM C;  2OK6 A;  3L4O D;  4A11 A;  4FB1 D;  1OLZ A;  2AH0 A;  4A09 B;  3UVK A;  2CE9 A;  3N0D A;  4L9O A;  3PXW D;  3EI4 B;  3K26 A;  1MG2 A;  3BWS A;  2H9N A;  4BH6 A;  4CI8 A;  3SHF A;  3F3P A;  5GSA A;  4J86 A;  4LGN A;  3J81 g;  5AFU 3;  3F3G A;  4JSN C;  2OJY A;  5IJ7 E;  1RI6 A;  4FA4 D;  1QNI A;  4CY5 A;  5TDH B;  5HE1 B;  4CY3 A;  4N14 A;  4Y7R A;  3BG0 A;  3NVQ A;  3IJ0 A;  4FAN D;  5SXM A;  2H9P A;  5EAL A;  3SLE D;  4K3I D;  4L3H D;  4J82 A;  3VGZ A;  2P9I C;  3EI4 A;  1SQJ A;  2UZX B;  2CO0 C;  3DSM A;  1XIP A;  3KRX B;  3UR4 A;  4BL0 A;  3I7N A;  2BBK H;  2B5M A;  4CY2 A;  4GGA A;  5AMS A;  2J55 H;  5EML B;  3RSE C;  2YNO A;  5JWZ A;  1PGU A;  3FRX A;  3SCY A;  2H68 A;  4ZOV A;  2XYI A;  2I3S A;  3SFZ A;  3ZWL B;  4CI1 A;  2P9S C;  3DM0 A;  3OKT A;  2PM7 B;  2HES X;  4GQ1 A;  4X63 B;  2J56 H;  3PXS D;  2IUP A;  5FLX g;  1N6E A;  3B7F A;  2H6N A;  2PM9 A;  5CXB A;  4XYI A;  1XHM A;  4PC0 A;  5IJ8 E;  3SBP A;  2XL2 A;  3MZK A;  2H6K A;  4TZ4 A;  4FA9 D;  3ORV D;  2AQ5 A;  3PVU B;  3OKY A;  2IUV A;  3RN1 D;  5IT9 g;  2H9M A;  3EG6 A;  5C9Z B;  3V9F A;  3RFH A;  2IWF A;  5THA A;  3EU7 A;  3N0E A;  4U7A A;  5EMK B;  5HE2 B;  3MZL A;  4JSP C;  5H17 A;  3IJC A;  3V5W B;  4YVD A;  5FKT A;  5TEE A;  3OKW A;  4O1Q D;  5FKQ A;  5EAR A;  4EWR A;  3EI1 A;  5I5I A;  2XU7 A;  1PBY B;  3NVN A;  2Q7Q A;  3I7K A;  3JZN A;  4FWW A;  2H6Q A;  5IGO A;  3JRO A;  5FXY A;  1Q47 A;  3UVN A;  1B9Y A;  4J78 A;  3SWS D;  2H9L A;  2PM6 B;  5TF2 A;  4IA9 A;  3W15 A;  4J77 A;  2AH1 A;  1OMW B;  3F3F A;  3C5M A;  1YFQ A;  4H5I A;  4KFM B;  4ZOY A;  3J80 g;  4PSX B;  3I7H A;  2YB8 B;  1JMX B;  3EI3 B;  5CYK A;  4CI2 A;  1SQ9 A;  1N6D A;  3GRE A;  5I5J A;  5TEF A;  4CC9 A;  3EI2 B;  2OVR B;  3I89 A;  4XYH A;  2P9P C;  4E54 B;  2MTA H;  4GQ2 P;  4PNK B;  2G99 A;  3I7O A;  4ERZ A;  4J81 A;  1GXR A;  4A09 A;  3IIW A;  4Y5R D;  3FM0 A;  3JZH A;  4AEZ A;  2HXC A;  2UZY B;  1NEX B;  1P22 A;  4A2M A;  1JMZ B;  4PSW B;  4Z8L A;  2HYE A;  5EAM A;  2GC7 A;  3MKQ A;  2OVQ B;  5EM2 B;  2B5L A;  4GZ8 A;  4QL1 A;  4A0B B;  2CNX A;  2BCJ B;  4LG9 A;  3SN6 B;  4LG8 A;  3UKU C;  2H3X A;  3U4Y A;  4E54 A;  4I79 A;  4A08 B;  3RMZ D;  4PBY A;  3UKR C;  2YMU A;  3SJL D;  3HFQ A;  3AFC A;  4GM9 A;  4GM3 A;  4GGC A;  3JZG A;  3ODT A;  2I0T A;  2GNQ A;  3OL2 B;  1JJU B;  3AL8 B;  4UI9 R;  3VA6 A;  4J79 A;  4OZU A;  1MG3 A;  3IIY A;  5C2V B;  2CE8 A;  4ERQ A;  4CI3 A;  1FWX A;  1GOT B;  4ESG A;  5HYN B;  4A0A B;  1GP2 B;  2YNN A;  2H14 A;  1N6F A;  2OK4 A;  2YNP A;  2J57 G;  2CN2 A;  4ZN4 A;  4J87 A;  5B4W A;  4A7J A;  4O9D A;  1S4U X;  4GQB B;  2AGW A;  3KRW B;  4FA5 D;  4E5Z B;  3OTT A;  2HJ4 A;  5FKR A;  4FHL A;  3OL2 A;  3SBQ A;  3UVO A;  4J0W A;  1U2V C;  3NVX A;  4A11 B;  3PVW B;  3EMH A;  4FA1 D;  5HE3 B;  1B9X A;  2Z2O A;  4A0A A;  4O45 A;  1GG2 B; 
#chains in the Genus database with same CATH topology
 4L1Q D;  3PE7 A;  4PXW A;  3PSL A;  1A0R B;  3K72 A;  2O9K A;  2XDW A;  3RRM C;  2HU8 A;  5GXI A;  3K71 A;  5HE0 B;  3I2N A;  5EMJ B;  4J8B A;  4JSV C;  5C86 A;  1SHY B;  2EIE A;  1JOF A;  4JHN A;  5AJA A;  4MK0 B;  1O6G A;  3I8C A;  4UM9 A;  4GM8 A;  5K19 A;  3JPX A;  5H1M A;  4ES0 A;  5FQD A;  2G9A A;  5EAP A;  1GOH A;  3I7P A;  3IUM A;  3UVM A;  2B5N A;  4MMY A;  4BP9 A;  3MXX A;  4CZX A;  2B4E A;  4PBZ A;  3FGB A;  3K27 A;  3CFV A;  2P9N C;  3O4G A;  2PBI B;  3I7L A;  5C2W B;  4O3T B;  4ZOX A;  3VH0 A;  3A0F A;  4HDJ A;  2VZ3 A;  2AGY A;  3SMR A;  5IC7 A;  5CXC B;  3EI3 A;  3UVL A;  5FA5 B;  4JSX C;  3L4M D;  2XZG A;  2I0S A;  3EWE A;  5IGQ A;  3EI2 A;  5FFO A;  4QQE A;  3K6S A;  1JV2 A;  2AGZ A;  3BG1 A;  4JT6 C;  2WQ8 A;  2EBS A;  3ZE2 A;  3IUN A;  3EQ9 A;  3AL9 A;  4BUJ C;  2QXV A;  2IAA A;  4IMM A;  1H2W A;  1ERJ A;  2TRC B;  2OVP B;  4BCC A;  4OWR A;  4J0X A;  1TYQ C;  3ZDZ A;  2QC5 A;  2GC4 A;  4CZY A;  2PM9 B;  4AN1 A;  1MDA H;  5CXB B;  2P9L C;  4G56 B;  5K1C C;  5GMK n;  5GXH A;  1L0Q A;  3ULE C;  3ZE1 A;  4CZV A;  4GGD A;  4JD2 C;  4JT5 C;  2VDP A;  4D6V A;  3C9C A;  1VYH C;  3RN0 D;  2OIZ A;  3IKO A;  3OKY B;  1XKS A;  5A2Q g;  3EQ7 A;  2IWK A;  3I8E A;  4XEI C;  5CXC A;  1PI6 A;  1K32 A;  1PEV A;  4J84 A;  4G55 A;  5EM2 A;  3RFG A;  3JRP A;  2XL3 A;  4A0B A;  4D0K A;  5M5T A;  3SBR A;  3SXT D;  4QT8 A;  2I0R A;  1R5M A;  3IUQ A;  3OW8 A;  5HQG A;  3E0C A;  4CY1 A;  2QZP A;  4A08 A;  2P9K C;  3V4P A;  3MKS B;  5M61 A;  5I5M A;  3EI1 B;  4O2W A;  3PXT D;  2IUR A;  5KDO B;  4K3J B;  3SVW D;  4ERY A;  1GOF A;  3IJ1 A;  2HKR A;  3C99 A;  2QR5 A;  4J8G A;  2HKM A;  4ZOZ A;  1A12 A;  1E5T A;  3CFS B;  3CIK B;  4AOW A;  3GFC A;  4X61 B;  3RLM D;  4FAV D;  2H47 A;  3O4H A;  3IVM A;  2AGX A;  2BKL A;  3AL8 A;  4A2L A;  1U4C A;  3MMY A;  4R7A B;  4X60 B;  3V7D B;  3AH8 B;  4JHP C;  1NR0 A;  3JB9 L;  2CN3 A;  1QFM A;  5E6R A;  5H14 A;  5EMM B;  5FKS A;  1K3I A;  4NSX A;  3DXK C;  3VI3 A;  3ZE0 A;  3KCI A;  3JAM g;  4U1E I;  4JXM A;  3MVD K;  3MUN A;  4L3G D;  1K8K C;  1TBG A;  2AGL A;  4QRJ A;  2IUQ A;  2I3T A;  4G1E A;  2HJB A;  4NC4 A;  5CYK B;  2VDM A;  2YBA A;  2H13 A;  4QAM A;  4AMZ A;  2CO0 A;  3IUJ A;  2P9U C;  4H5J A;  3OF7 A;  3QI0 A;  3C75 H;  1M1X A;  2Z2P A;  4E5Z A;  3P4F A;  2Z2N A;  4GMB A;  4X3E A;  1UOP A;  2EID A;  4J73 A;  3PSC B;  4O3U B;  3DWL C;  2W18 A;  3DXM C;  4BCB A;  2OK6 A;  3L4O D;  4A11 A;  1C9L A;  4FB1 D;  1OLZ A;  2AH0 A;  4A09 B;  3UVK A;  2CE9 A;  3N0D A;  4L9O A;  3PXW D;  2HU5 A;  3EI4 B;  3K26 A;  1MG2 A;  5HDB A;  3BWS A;  2H9N A;  4BH6 A;  4CI8 A;  3SHF A;  1C9I A;  3F3P A;  5GSA A;  4J86 A;  4LGN A;  3J81 g;  5AFU 3;  3F3G A;  4JSN C;  2OJY A;  5IJ7 E;  1VE6 A;  1RI6 A;  4FA4 D;  1QNI A;  4CY5 A;  5TDH B;  5HE1 B;  3ZDX A;  4CY3 A;  4DNW A;  4N14 A;  4Y7R A;  1T2X A;  3BG0 A;  4MMZ A;  5C92 A;  3NVQ A;  3IJ0 A;  4FAN D;  5SXM A;  2H9P A;  5EAL A;  3GD1 I;  3SLE D;  3T3M A;  4K3I D;  4L3H D;  4J82 A;  3QHY B;  1H2Z A;  3VGZ A;  2P9I C;  1BPO A;  3EI4 A;  1SQJ A;  2UZX B;  2CO0 C;  3DSM A;  1XIP A;  2HU7 A;  3KRX B;  3UR4 A;  4BL0 A;  3I7N A;  3IUR A;  3ZDY A;  4DNV A;  2BBK H;  2B5M A;  4CY2 A;  4GGA A;  4AX4 A;  5AMS A;  2J55 H;  4BP8 A;  5EML B;  5FFG A;  3EQ8 A;  5E6U A;  4MMX A;  4Z7N A;  4IRZ A;  3RSE C;  2YNO A;  4DNU A;  1PGU A;  3FRX A;  3SCY A;  5JWZ A;  2H68 A;  1L5G A;  4ZOV A;  2XYI A;  2I3S A;  3SFZ A;  3ZWL B;  4CI1 A;  2P9S C;  3DM0 A;  3OKT A;  2PM7 B;  2HES X;  4GQ1 A;  4X63 B;  2J56 H;  3PXS D;  1O6F A;  3IUL A;  2IUP A;  5FLX g;  3NIF A;  1N6E A;  3B7F A;  4NAA A;  2H6N A;  2PM9 A;  2VDK A;  5CXB A;  5M5V A;  4Z7O A;  4NBM A;  4XYI A;  1XHM A;  4PC0 A;  5IJ8 E;  3SBP A;  1I2M B;  2XL2 A;  2XE4 A;  3MZK A;  2H6K A;  4TZ4 A;  4FA9 D;  3ORV D;  2AQ5 A;  3PVU B;  3OKY A;  1UOO A;  2IUV A;  3RN1 D;  5M5R A;  5IT9 g;  2H9M A;  3EG6 A;  3MUO A;  5C9Z B;  3IJE A;  1VZ2 A;  3RFH A;  3V9F A;  2IWF A;  5THA A;  4NEN A;  3EU7 A;  3GC3 B;  3N0E A;  4U7A A;  5EMK B;  5HE2 B;  3MZL A;  4JSP C;  1VE7 A;  5H17 A;  3IJC A;  3V5W B;  4YVD A;  5FKT A;  5TEE A;  3OKW A;  4O1Q D;  5FKQ A;  5EAR A;  4EWR A;  3EI1 A;  5I5I A;  2XU7 A;  1PBY B;  4AMY A;  3NVN A;  2Q7Q A;  3I7K A;  3JZN A;  4FWW A;  2H6Q A;  5IGO A;  3JRO A;  5FXY A;  1Q47 A;  3UVN A;  1B9Y A;  4J78 A;  3SWS D;  2VDR A;  2H9L A;  2PM6 B;  5TF2 A;  3FCS A;  2JKX A;  4IA9 A;  4WK4 A;  3W15 A;  4J77 A;  2AH1 A;  5M5S A;  1OMW B;  3F3F A;  3C5M A;  1GOG A;  1YFQ A;  5E6S A;  4H5I A;  4KFM B;  4ZOY A;  3J80 g;  4PSX B;  3I7H A;  2YB8 B;  1JMX B;  3EI3 B;  5CYK A;  2EIB A;  4CI2 A;  1SQ9 A;  1N6D A;  2VZ1 A;  3GRE A;  5I5J A;  5TEF A;  4CC9 A;  3EI2 B;  2OVR B;  3O4J A;  3I89 A;  1UOQ A;  4XYH A;  2P9P C;  4E54 B;  2MTA H;  1VZ3 A;  4GQ2 P;  2VDQ A;  4PNK B;  2G99 A;  4UM8 A;  3I7O A;  4ERZ A;  4WK0 A;  4RE6 A;  4J81 A;  1QFS A;  1GXR A;  4A09 A;  3IIW A;  4Y5R D;  2VC2 A;  3FM0 A;  3JZH A;  4AEZ A;  3FCU A;  4WK2 A;  3NIG A;  2HXC A;  2UZY B;  1NEX B;  1P22 A;  4A2M A;  1JMZ B;  4PSW B;  4Z8L A;  2HYE A;  5EAM A;  4WJK A;  2GC7 A;  3MKQ A;  4O02 A;  2OVQ B;  5EM2 B;  2B5L A;  1JTD B;  4GZ8 A;  4QL1 A;  4A0B B;  2CNX A;  3VI4 A;  2BCJ B;  4LG9 A;  3SN6 B;  4LG8 A;  3UKU C;  2H3X A;  4D9S A;  3U4Y A;  4G1M A;  4E54 A;  4I79 A;  4A08 B;  5M5U A;  3RMZ D;  4PBY A;  3UKR C;  2YMU A;  3SJL D;  3HFQ A;  3AFC A;  4GM9 A;  1E8M A;  4RE5 A;  4GM3 A;  2EIC A;  4GGC A;  3JZG A;  3ODT A;  1U8C A;  2I0T A;  2GNQ A;  3OL2 B;  3O4I A;  1JJU B;  3AL8 B;  4UI9 R;  3VA6 A;  4J79 A;  4OZU A;  1E8N A;  1MG3 A;  2VDL A;  3IIY A;  5C2V B;  2CE8 A;  4BCD A;  4ERQ A;  4CI3 A;  1FWX A;  1GOT B;  4ESG A;  5HYN B;  4A0A B;  2VDO A;  1GP2 B;  3V4V A;  2YNN A;  2H14 A;  1N6F A;  3NID A;  4AN0 A;  2OK4 A;  2YNP A;  2J57 G;  2CN2 A;  4ZN4 A;  4Z7Q A;  4J87 A;  5B4W A;  4A7J A;  4O9D A;  4L1M A;  1S4U X;  1YR2 A;  4GQB B;  2AGW A;  1H2Y A;  3KRW B;  4FA5 D;  1UTC A;  3T3P A;  4E5Z B;  3OTT A;  2HJ4 A;  5FKR A;  4FHL A;  2VDN A;  3OL2 A;  3SBQ A;  3UVO A;  4J0W A;  1U2V C;  1TYE A;  3NVX A;  4A11 B;  3PVW B;  3EMH A;  1H2X A;  4FA1 D;  5HE3 B;  1B9X A;  2Z2O A;  4A0A A;  4O45 A;  3DDU A;  1GG2 B; 
#chains in the Genus database with same CATH homology
 4L1Q D;  3PE7 A;  4PXW A;  3PSL A;  1A0R B;  2O9K A;  3RRM C;  5GXI A;  5HE0 B;  3I2N A;  5EMJ B;  4J8B A;  4JSV C;  1SHY B;  1JOF A;  5AJA A;  4MK0 B;  3I8C A;  4GM8 A;  5K19 A;  3JPX A;  5H1M A;  4ES0 A;  5FQD A;  2G9A A;  5EAP A;  3I7P A;  3UVM A;  2B5N A;  3MXX A;  4CZX A;  2B4E A;  4PBZ A;  3FGB A;  3K27 A;  3CFV A;  2P9N C;  2PBI B;  3I7L A;  5C2W B;  4O3T B;  4ZOX A;  3VH0 A;  3A0F A;  4HDJ A;  2AGY A;  3SMR A;  5IC7 A;  5CXC B;  3EI3 A;  3UVL A;  5FA5 B;  4JSX C;  3L4M D;  3EWE A;  2I0S A;  5IGQ A;  3EI2 A;  4QQE A;  2AGZ A;  3BG1 A;  4JT6 C;  2EBS A;  3AL9 A;  4BUJ C;  2QXV A;  2IAA A;  4IMM A;  1ERJ A;  2TRC B;  2OVP B;  4OWR A;  4J0X A;  1TYQ C;  2QC5 A;  2GC4 A;  4CZY A;  2PM9 B;  1MDA H;  5CXB B;  2P9L C;  4G56 B;  5K1C C;  5GMK n;  5GXH A;  1L0Q A;  3ULE C;  4CZV A;  4GGD A;  4JD2 C;  4JT5 C;  4D6V A;  3C9C A;  1VYH C;  3RN0 D;  2OIZ A;  3IKO A;  3OKY B;  1XKS A;  5A2Q g;  2IWK A;  3I8E A;  4XEI C;  5CXC A;  1PI6 A;  1K32 A;  1PEV A;  4J84 A;  5EM2 A;  3RFG A;  3JRP A;  2XL3 A;  4A0B A;  4D0K A;  3SBR A;  3SXT D;  4QT8 A;  2I0R A;  1R5M A;  3OW8 A;  5HQG A;  3E0C A;  4CY1 A;  4A08 A;  2P9K C;  3MKS B;  5I5M A;  3EI1 B;  3PXT D;  2IUR A;  5KDO B;  4K3J B;  3SVW D;  4ERY A;  3IJ1 A;  2HKR A;  3C99 A;  4J8G A;  2HKM A;  4ZOZ A;  3CFS B;  3CIK B;  4AOW A;  3GFC A;  4X61 B;  3RLM D;  4FAV D;  2H47 A;  2AGX A;  3AL8 A;  4A2L A;  1U4C A;  3MMY A;  4R7A B;  4X60 B;  3V7D B;  3AH8 B;  1NR0 A;  3JB9 L;  2CN3 A;  5H14 A;  5EMM B;  5FKS A;  4NSX A;  3DXK C;  3JAM g;  4U1E I;  4JXM A;  4L3G D;  1K8K C;  1TBG A;  2AGL A;  4QRJ A;  2IUQ A;  2I3T A;  2HJB A;  5CYK B;  2YBA A;  2H13 A;  2CO0 A;  2P9U C;  4H5J A;  3C75 H;  2Z2P A;  4E5Z A;  3P4F A;  2Z2N A;  4GMB A;  4X3E A;  4J73 A;  3PSC B;  4O3U B;  3DWL C;  2W18 A;  3DXM C;  2OK6 A;  3L4O D;  4A11 A;  4FB1 D;  1OLZ A;  2AH0 A;  4A09 B;  3UVK A;  2CE9 A;  3N0D A;  4L9O A;  3PXW D;  3EI4 B;  3K26 A;  1MG2 A;  3BWS A;  2H9N A;  4BH6 A;  4CI8 A;  3SHF A;  3F3P A;  5GSA A;  4J86 A;  4LGN A;  3J81 g;  5AFU 3;  3F3G A;  4JSN C;  2OJY A;  5IJ7 E;  1RI6 A;  4FA4 D;  1QNI A;  4CY5 A;  5TDH B;  5HE1 B;  4CY3 A;  4N14 A;  4Y7R A;  3BG0 A;  3NVQ A;  3IJ0 A;  4FAN D;  5SXM A;  2H9P A;  5EAL A;  3SLE D;  4K3I D;  4L3H D;  4J82 A;  3VGZ A;  2P9I C;  3EI4 A;  1SQJ A;  2UZX B;  2CO0 C;  3DSM A;  1XIP A;  3KRX B;  3UR4 A;  4BL0 A;  3I7N A;  2BBK H;  2B5M A;  4CY2 A;  4GGA A;  5AMS A;  2J55 H;  5EML B;  3RSE C;  2YNO A;  5JWZ A;  1PGU A;  3FRX A;  3SCY A;  2H68 A;  4ZOV A;  2XYI A;  2I3S A;  3SFZ A;  3ZWL B;  4CI1 A;  2P9S C;  3DM0 A;  3OKT A;  2PM7 B;  2HES X;  4GQ1 A;  4X63 B;  2J56 H;  3PXS D;  2IUP A;  5FLX g;  1N6E A;  3B7F A;  2H6N A;  2PM9 A;  5CXB A;  4XYI A;  1XHM A;  4PC0 A;  5IJ8 E;  3SBP A;  2XL2 A;  3MZK A;  2H6K A;  4TZ4 A;  4FA9 D;  3ORV D;  2AQ5 A;  3PVU B;  3OKY A;  2IUV A;  3RN1 D;  5IT9 g;  2H9M A;  3EG6 A;  5C9Z B;  3V9F A;  3RFH A;  2IWF A;  5THA A;  3EU7 A;  3N0E A;  4U7A A;  5EMK B;  5HE2 B;  3MZL A;  4JSP C;  5H17 A;  3IJC A;  3V5W B;  4YVD A;  5FKT A;  5TEE A;  3OKW A;  4O1Q D;  5FKQ A;  5EAR A;  4EWR A;  3EI1 A;  5I5I A;  2XU7 A;  1PBY B;  3NVN A;  2Q7Q A;  3I7K A;  3JZN A;  4FWW A;  2H6Q A;  5IGO A;  3JRO A;  5FXY A;  1Q47 A;  3UVN A;  1B9Y A;  4J78 A;  3SWS D;  2H9L A;  2PM6 B;  5TF2 A;  4IA9 A;  3W15 A;  4J77 A;  2AH1 A;  1OMW B;  3F3F A;  3C5M A;  1YFQ A;  4H5I A;  4KFM B;  4ZOY A;  3J80 g;  4PSX B;  3I7H A;  2YB8 B;  1JMX B;  3EI3 B;  5CYK A;  4CI2 A;  1SQ9 A;  1N6D A;  3GRE A;  5I5J A;  5TEF A;  4CC9 A;  3EI2 B;  2OVR B;  3I89 A;  4XYH A;  2P9P C;  4E54 B;  2MTA H;  4GQ2 P;  4PNK B;  2G99 A;  3I7O A;  4ERZ A;  4J81 A;  1GXR A;  4A09 A;  3IIW A;  4Y5R D;  3FM0 A;  3JZH A;  4AEZ A;  2HXC A;  2UZY B;  1NEX B;  1P22 A;  4A2M A;  1JMZ B;  4PSW B;  4Z8L A;  2HYE A;  5EAM A;  2GC7 A;  3MKQ A;  2OVQ B;  5EM2 B;  2B5L A;  4GZ8 A;  4QL1 A;  4A0B B;  2CNX A;  2BCJ B;  4LG9 A;  3SN6 B;  4LG8 A;  3UKU C;  2H3X A;  3U4Y A;  4E54 A;  4I79 A;  4A08 B;  3RMZ D;  4PBY A;  3UKR C;  2YMU A;  3SJL D;  3HFQ A;  3AFC A;  4GM9 A;  4GM3 A;  4GGC A;  3JZG A;  3ODT A;  2I0T A;  2GNQ A;  3OL2 B;  1JJU B;  3AL8 B;  4UI9 R;  3VA6 A;  4J79 A;  4OZU A;  1MG3 A;  3IIY A;  5C2V B;  2CE8 A;  4ERQ A;  4CI3 A;  1FWX A;  1GOT B;  4ESG A;  5HYN B;  4A0A B;  1GP2 B;  2YNN A;  2H14 A;  1N6F A;  2OK4 A;  2YNP A;  2J57 G;  2CN2 A;  4ZN4 A;  4J87 A;  5B4W A;  4A7J A;  4O9D A;  1S4U X;  4GQB B;  2AGW A;  3KRW B;  4FA5 D;  4E5Z B;  3OTT A;  2HJ4 A;  5FKR A;  4FHL A;  3OL2 A;  3SBQ A;  3UVO A;  4J0W A;  1U2V C;  3NVX A;  4A11 B;  3PVW B;  3EMH A;  4FA1 D;  5HE3 B;  1B9X A;  2Z2O A;  4A0A A;  4O45 A;  1GG2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...