4FA5D

Crystal structure of wt maug in complex with pre-methylamine dehydrogenase aged 20 days
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
376
structure length
376
Chain Sequence
QETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase/electron transport
molecule keywords Methylamine utilization protein MauG
publication title Diradical intermediate within the context of tryptophan tryptophylquinone biosynthesis.
pubmed doi rcsb
source organism Paracoccus denitrificans
total genus 96
structure length 376
sequence length 376
chains with identical sequence F
ec nomenclature
pdb deposition date 2012-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4fa5D00
3MMYA 3RN1D 2I0TA 3PXTD 4JSPC 4JD2C 4GMBA 4Y5RD 4H5JA 3RFGA 4QL1A 5EMKB 3I89A 3CFSB 3EG6A 4A09B 4JT6C 5B4WA 2P9PC 2H13A 2H14A 4ZOXA 1FWXA 3NVNA 2YBAA 3A0FA 4A11A 2HKRA 2IURA 4NSXA 5FKQA 2MTAH 4JSXC 3SBPA 2IAAA 1GG2B 4J8GA 5HQGA 2I3SA 5JWZA 5GMKn 4A08B 4J79A 5EALA 4JSNC 3JZHA 2G9AA 1VYHC 3EI4A 3FRXA 5IJ7E 4GQ2P 4FA9D 3I8EA 2XU7A 4FAND 2CE9A 3UVLA 3IJ0A 3EI2A 4X61B 2IWFA 4IA9A 1SQ9A 4R7AB 5EM2B 1S4UX 1JMXB 2PM9B 4OZUA 3ODTA 3C9CA 4L9OA 4HDJA 3JRPA 5IGQA 4LG8A 3I8CA 3NVXA 2OVRB 3U4YA 4FAVD 5TEFA 5AJAA 3JZGA 3E0CA 2H9LA 4FB1D 3OW8A 4PBYA 3AL8A 5GSAA 4ZOYA 4E5ZA 2IWKA 3PXWD 3OKYA 3SWSD 4PC0A 2YMUA 5HYNB 4O3TB 3SMRA 4A2MA 3KRXB 3PVWB 3L4MD 1XKSA 3EI3B 1B9YA 3BWSA 3V9FA 3EU7A 4CC9A 5THAA 3UVOA 4OWRA 5H17A 3OL2B 2P9KC 4ERYA 3UKRC 1B9XA 2CNXA 4ERZA 5IGOA 3I2NA 3SN6B 3AL9A 4J86A 2B5NA 1XIPA 3KRWB 4E54B 3AH8B 3K26A 2Z2OA 4J0XA 4GQBB 4ES0A 1QNIA 3IKOA 4O9DA 1PI6A 2H9PA 2PBIB 2XYIA 1JMZB 1PGUA 5H14A 5I5MA 3PXSD 2XL2A 4YVDA 5HE2B 4L3GD 3V7DB 4XYIA 5CYKA 3DSMA 1U2VC 3OKTA 4X63B 3CFVA 4U1EI 5FKTA 4A11B 2O9KA 4BUJC 2HJ4A 5HE1B 4A2LA 3EI1A 2BBKH 2GNQA 3IIYA 4O3UB 3SLED 5EARA 2AGZA 4GGAA 3I7HA 1N6FA 3PSCB 5I5JA 5EAMA 2OJYA 2QXVA 2J55H 4X3EA 4J8BA 5CXCA 4N14A 1L0QA 5A2Qg 4G56B 3EI4B 2OK6A 5FXYA 3V5WB 3SXTD 4JT5C 3GFCA 2AGXA 4BL0A 3EWEA 4CZXA 2AGLA 3HFQA 5IC7A 2H3XA 3ULEC 3N0DA 2Q7QA 2I0SA 3J81g 3C5MA 2QC5A 5FKSA 2CE8A 2GC4A 2P9LC 3FM0A 4J0WA 4L1QD 1MDAH 2I3TA 2IUQA 3I7LA 2AH1A 5I5IA 3F3PA 2HYEA 2IUPA 4J84A 5GXIA 2CN2A 3P4FA 4XYHA 5CXBA 4PNKB 1XHMA 4GM3A 1OMWB 5GXHA 2HXCA 2CO0C 4U7AA 5TF2A 4ESGA 2H68A 4AEZA 2H6NA 2H9NA 4O1QD 5HE3B 4A0BA 5KDOB 2G99A 3SBQA 1GOTB 3RRMC 2PM9A 5TDHB 2Z2NA 4CZVA 3C99A 4CI3A 4CI2A 4H5IA 3PSLA 2OK4A 3CIKB 4CY1A 1NR0A 3SFZA 3IIWA 2HJBA 2PM6B 4A0AB 2EBSA 3F3GA 3BG1A 5K1CC 4A7JA 5C9ZB 4GM8A 4GZ8A 4FA5D 1K32A 3L4OD 3EI3A 3DXKC 3JROA 3ORVD 3UVKA 2P9NC 4QT8A 4J78A 2J56H 4JXMA 4XEIC 3F3FA 3MXXA 3SCYA 3OL2A 5IT9g 4FWWA 2W18A 1SHYB 4FA1D 2BCJB 2AGYA 2PM7B 3MZKA 1NEXB 4AOWA 4LGNA 3IJ1A 1P22A 2YNOA 3MZLA 2UZXB 2B5MA 3JB9L 3VA6A 3OKWA 5C2WB 4UI9R 4GGCA 2I0RA 3GREA 3UVMA 3UVNA 3RMZD 5CXCB 2H6QA 4K3JB 5FA5B 4ERQA 2AQ5A 3I7PA 4PBZA 3VH0A 4GM9A 3SVWD 3N0EA 1PEVA 1ERJA 1TBGA 1N6EA 4J82A 2YB8B 4ZN4A 1GXRA 3RSEC 3JZNA 3PE7A 4TZ4A 4Y7RA 5FKRA 4A09A 3OTTA 2UZYB 3AFCA 4I79A 3EI2B 4J73A 5K19A 4JSVC 3MKSB 2B5LA 4CY2A 5TEEA 1N6DA 2HKMA 4FA4D 3DXMC 4ZOVA 2AGWA 1PBYB 4J77A 3PVUB 1OLZA 5AMSA 3I7OA 5CXBB 4QRJA 3BG0A 4ZOZA 3FGBA 4CZYA 2TRCB 3I7KA 1A0RB 4A08A 1GP2B 2H47A 2HESX 2XL3A 3AL8B 5IJ8E 5EAPA 1R5MA 3UKUC 5H1MA 4E5ZB 5C2VB 3OKYB 4FHLA 4CI8A 5AFU3 5EMMB 2OVQB 4PXWA 4A0BB 2B4EA 2P9IC 3DWLC 3C75H 5EMLB 2YNNA 2OVPB 3IJCA 5SXMA 4D6VA 3NVQA 2P9SC 4CI1A 4O45A 5FLXg 1K8KC 1Q47A 4K3ID 2J57G 5EM2A 3B7FA 3JAMg 2CO0A 2P9UC 5EMJB 4MK0B 2AH0A 3MKQA 3DM0A 3K27A 3JPXA 4J87A 3UR4A 4IMMA 1SQJA 4CY3A 4LG9A 4PSWB 4CY5A 3RLMD 4BH6A 5FQDA 1TYQC 4GQ1A 4EWRA 4X60B 2CN3A 3W15A 1JJUB 4KFMB 3SJLD 1MG3A 3SBRA 4J81A 1RI6A 5CYKB 4PSXB 3J80g 1JOFA 4L3HD 2IUVA 3I7NA 3RFHA 2OIZA 4GGDA 3VGZA 2Z2PA 3EI1B 5HE0B 1MG2A 4A0AA 2GC7A 1U4CA 1YFQA 4E54A 3ZWLB 4D0KA 3RN0D 2H9MA 4QQEA 3EMHA 4Z8LA 3SHFA 2YNPA 2H6KA
chains in the Genus database with same CATH superfamily
3MMYA 3RN1D 2I0TA 4AN0A 2EIBA 3PXTD 4JSPC 4JD2C 4GMBA 4Y5RD 4H5JA 2EICA 3RFGA 4MMZA 4QL1A 3FCSA 5EMKB 5M61A 3I89A 3CFSB 3EG6A 4A09B 4JT6C 5B4WA 2P9PC 2H13A 2H14A 2VC2A 5M5RA 4ZOXA 1H2WA 1FWXA 3NVNA 2XE4A 2YBAA 3A0FA 4A11A 2HKRA 2IURA 4NSXA 5FKQA 2MTAH 3DDUA 4JSXC 4Z7QA 3SBPA 2IAAA 1GG2B 4J8GA 5HQGA 2I3SA 5JWZA 5GMKn 3GC3B 4A08B 3ZDXA 4J79A 5C92A 5EALA 4JSNC 3V4VA 3JZHA 4NBMA 2G9AA 4L1MA 1VYHC 1C9LA 3EI4A 3FRXA 4GQ2P 5IJ7E 4FA9D 3EQ9A 1UOOA 3I8EA 2XU7A 4FAND 3MVDK 2CE9A 3UVLA 5E6UA 3IJ0A 3EI2A 4DNUA 2HU5A 4X61B 2IWFA 4IA9A 1SQ9A 5C86A 4JHPC 4G1MA 4R7AB 4RE6A 5EM2B 1S4UX 1JMXB 2PM9B 4OZUA 3ODTA 3C9CA 1QFMA 4L9OA 4HDJA 1O6FA 3JRPA 5IGQA 4LG8A 3I8CA 3IULA 4WJKA 3NVXA 2OVRB 5FFGA 3U4YA 3O4IA 4FAVD 5TEFA 5AJAA 3JZGA 3E0CA 2H9LA 4FB1D 3OW8A 4PBYA 1K3IA 3AL8A 5GSAA 4WK4A 4ZOYA 1H2ZA 4E5ZA 4DNWA 2IWKA 3PXWD 3OKYA 3SWSD 3IURA 4PC0A 2YMUA 5HYNB 4O3TB 3SMRA 4A2MA 3KRXB 3PVWB 3L4MD 1XKSA 3EI3B 1E5TA 1B9YA 3BWSA 1BPOA 3V9FA 3EU7A 1VZ2A 4CC9A 4D9SA 3ZDYA 5THAA 3UVOA 4OWRA 4BCCA 5H17A 3OL2B 2P9KC 3IUNA 4ERYA 3UKRC 1B9XA 2VDMA 2CNXA 4G1EA 5IGOA 3I2NA 4ERZA 3SN6B 3AL9A 4J86A 2B5NA 1XIPA 3KRWB 4E54B 3AH8B 3K26A 2Z2OA 4J0XA 4GQBB 4ES0A 1QNIA 3IKOA 4O9DA 1TYEA 1PI6A 2H9PA 2PBIB 2XYIA 1JMZB 1PGUA 5H14A 5I5MA 3IJEA 3PXSD 2XL2A 4YVDA 5HE2B 4Z7OA 4L3GD 3V7DB 4XYIA 5CYKA 2VZ1A 1U2VC 3DSMA 4Z7NA 3OKTA 4X63B 3CFVA 4U1EI 1E8MA 2VZ3A 5FKTA 4A11B 2O9KA 4BUJC 2HJ4A 5HE1B 4A2LA 3EI1A 2BBKH 4WK0A 2GNQA 3IIYA 1UTCA 2HU8A 1O6GA 4JHNA 4UM9A 4O3UB 4QAMA 3SLED 5EARA 2AGZA 4GGAA 3I7HA 1N6FA 4BP9A 3PSCB 5I5JA 5EAMA 2OJYA 2QXVA 2J55H 4X3EA 1A12A 3MUNA 4J8BA 5CXCA 4N14A 1L0QA 5A2Qg 4G56B 3EI4B 2OK6A 5FXYA 3O4JA 3V5WB 3OF7A 3SXTD 4JT5C 3GFCA 2AGXA 4O02A 4BCDA 4BL0A 3EWEA 4CZXA 2AGLA 3HFQA 4UM8A 2H3XA 5IC7A 3ULEC 2QZPA 3N0DA 3NIFA 1H2XA 2Q7QA 2I0SA 3J81g 2HU7A 3C5MA 4MMYA 1UOQA 2VDNA 2QC5A 5FKSA 2XDWA 2CE8A 2GC4A 2P9LC 3FM0A 5E6RA 4J0WA 2IUQA 1MDAH 2I3TA 3I7LA 4L1QD 2AH1A 5I5IA 3F3PA 4AMYA 2HYEA 2VDOA 2IUPA 3NIDA 1T2XA 3IUMA 4J84A 5GXIA 2CN2A 3P4FA 3O4GA 4WK2A 4XYHA 5CXBA 5HDBA 4AN1A 4PNKB 1XHMA 4GM3A 1OMWB 5GXHA 2HXCA 2CO0C 3K72A 4U7AA 5TF2A 4NC4A 4ESGA 2H68A 4AEZA 1U8CA 2H6NA 2H9NA 4O1QD 5HE3B 4A0BA 5KDOB 2G99A 3SBQA 3V4PA 1GOTB 3RRMC 2PM9A 5TDHB 2Z2NA 4CZVA 3C99A 4CI3A 4CI2A 3KCIA 4H5IA 3PSLA 2OK4A 3CIKB 4CY1A 1NR0A 3SFZA 3QI0A 3IIWA 3T3MA 4G55A 2HJBA 2PM6B 4O2WA 4A0AB 2EBSA 3F3GA 3BG1A 5K1CC 3K71A 4A7JA 5C9ZB 3QHYB 4GM8A 4GZ8A 4FA5D 1K32A 4BCBA 3L4OD 3EI3A 3DXKC 1JV2A 3JROA 3ORVD 3UVKA 2P9NC 3IUJA 5FFOA 4QT8A 4J78A 3K6SA 2J56H 3IVMA 4JXMA 3F3FA 3MXXA 4XEIC 3SCYA 3OL2A 3ZE0A 5IT9g 1M1XA 4FWWA 2W18A 1SHYB 4FA1D 2BCJB 2AGYA 2PM7B 3MZKA 1NEXB 4AOWA 3VI4A 4LGNA 1QFSA 1UOPA 3IJ1A 2XZGA 1I2MB 1P22A 2YNOA 3MZLA 5M5SA 3EQ7A 2UZXB 2B5MA 4RE5A 4BP8A 3JB9L 3VA6A 2BKLA 3OKWA 5C2WB 4UI9R 2EIDA 2VDQA 4AX4A 4DNVA 4GGCA 2I0RA 3GREA 3UVMA 3UVNA 3RMZD 5CXCB 2H6QA 4K3JB 5FA5B 4ERQA 2AQ5A 3I7PA 5M5TA 4PBZA 3ZE1A 3VH0A 4GM9A 3SVWD 3N0EA 1PEVA 3T3PA 1ERJA 4AMZA 1TBGA 1N6EA 4J82A 2YB8B 4ZN4A 1GXRA 1H2YA 1JTDB 3RSEC 3MUOA 3JZNA 3PE7A 4TZ4A 4Y7RA 5FKRA 4A09A 3OTTA 2UZYB 3AFCA 4I79A 3EI2B 3FCUA 4J73A 5K19A 4JSVC 3MKSB 1GOHA 2B5LA 5TEEA 4CY2A 1N6DA 2HKMA 3IUQA 4FA4D 3DXMC 4ZOVA 2AGWA 1PBYB 4J77A 3O4HA 3PVUB 4IRZA 1OLZA 1VE7A 5AMSA 5M5UA 3I7OA 5CXBB 4QRJA 3BG0A 4ZOZA 3FGBA 4CZYA 2TRCB 3I7KA 1A0RB 4A08A 1GP2B 2H47A 2HESX 2XL3A 3AL8B 5IJ8E 5EAPA 1R5MA 3UKUC 5H1MA 4E5ZB 2VDLA 5C2VB 1GOGA 3ZE2A 3OKYB 4FHLA 4CI8A 5AFU3 5EMMB 2OVQB 3GD1I 4PXWA 5M5VA 4A0BB 4NENA 2B4EA 2P9IC 3DWLC 2VDKA 3C75H 5EMLB 2YNNA 3EQ8A 1L5GA 2OVPB 3IJCA 5SXMA 4D6VA 3NVQA 2P9SC 4CI1A 4O45A 5FLXg 1K8KC 1Q47A 4K3ID 2VDRA 2J57G 5EM2A 2JKXA 3B7FA 3JAMg 1GOFA 2CO0A 2P9UC 5EMJB 4MK0B 2AH0A 3MKQA 3DM0A 5E6SA 3K27A 3JPXA 4MMXA 4J87A 3UR4A 4IMMA 1SQJA 2WQ8A 4CY3A 4LG9A 4PSWB 4CY5A 3RLMD 4BH6A 5FQDA 1TYQC 4GQ1A 4EWRA 4X60B 2CN3A 3W15A 1JJUB 2VDPA 4KFMB 1VZ3A 3SJLD 1E8NA 1MG3A 3SBRA 4J81A 3NIGA 1RI6A 5CYKB 4PSXB 3J80g 2EIEA 1JOFA 4L3HD 2IUVA 3I7NA 3RFHA 2OIZA 4GGDA 3VGZA 2Z2PA 3EI1B 2QR5A 3ZDZA 5HE0B 1MG2A 4A0AA 2GC7A 1U4CA 1YFQA 4E54A 1C9IA 4NAAA 3VI3A 3ZWLB 4D0KA 3RN0D 1YR2A 2H9MA 4QQEA 3EMHA 4Z8LA 3SHFA 1VE6A 2YNPA 2H6KA
chains in the Genus database with same CATH topology
3MMYA 3RN1D 2I0TA 3PXTD 4JSPC 4JD2C 4GMBA 4Y5RD 4H5JA 3RFGA 4QL1A 5EMKB 3I89A 3CFSB 3EG6A 4A09B 4JT6C 5B4WA 2P9PC 2H13A 2H14A 4ZOXA 1FWXA 3NVNA 2YBAA 3A0FA 4A11A 2HKRA 2IURA 4NSXA 5FKQA 2MTAH 4JSXC 3SBPA 2IAAA 1GG2B 4J8GA 5HQGA 2I3SA 5JWZA 5GMKn 4A08B 4J79A 5EALA 4JSNC 3JZHA 2G9AA 1VYHC 3EI4A 3FRXA 5IJ7E 4GQ2P 4FA9D 3I8EA 2XU7A 4FAND 2CE9A 3UVLA 3IJ0A 3EI2A 4X61B 2IWFA 4IA9A 1SQ9A 4R7AB 5EM2B 1S4UX 1JMXB 2PM9B 4OZUA 3ODTA 3C9CA 4L9OA 4HDJA 3JRPA 5IGQA 4LG8A 3I8CA 3NVXA 2OVRB 3U4YA 4FAVD 5TEFA 5AJAA 3JZGA 3E0CA 2H9LA 4FB1D 3OW8A 4PBYA 3AL8A 5GSAA 4ZOYA 4E5ZA 2IWKA 3PXWD 3OKYA 3SWSD 4PC0A 2YMUA 5HYNB 4O3TB 3SMRA 4A2MA 3KRXB 3PVWB 3L4MD 1XKSA 3EI3B 1B9YA 3BWSA 3V9FA 3EU7A 4CC9A 5THAA 3UVOA 4OWRA 5H17A 3OL2B 2P9KC 4ERYA 3UKRC 1B9XA 2CNXA 4ERZA 5IGOA 3I2NA 3SN6B 3AL9A 4J86A 2B5NA 1XIPA 3KRWB 4E54B 3AH8B 3K26A 2Z2OA 4J0XA 4GQBB 4ES0A 1QNIA 3IKOA 4O9DA 1PI6A 2H9PA 2PBIB 2XYIA 1JMZB 1PGUA 5H14A 5I5MA 3PXSD 2XL2A 4YVDA 5HE2B 4L3GD 3V7DB 4XYIA 5CYKA 3DSMA 1U2VC 3OKTA 4X63B 3CFVA 4U1EI 5FKTA 4A11B 2O9KA 4BUJC 2HJ4A 5HE1B 4A2LA 3EI1A 2BBKH 2GNQA 3IIYA 4O3UB 3SLED 5EARA 2AGZA 4GGAA 3I7HA 1N6FA 3PSCB 5I5JA 5EAMA 2OJYA 2QXVA 2J55H 4X3EA 4J8BA 5CXCA 4N14A 1L0QA 5A2Qg 4G56B 3EI4B 2OK6A 5FXYA 3V5WB 3SXTD 4JT5C 3GFCA 2AGXA 4BL0A 3EWEA 4CZXA 2AGLA 3HFQA 5IC7A 2H3XA 3ULEC 3N0DA 2Q7QA 2I0SA 3J81g 3C5MA 2QC5A 5FKSA 2CE8A 2GC4A 2P9LC 3FM0A 4J0WA 4L1QD 1MDAH 2I3TA 2IUQA 3I7LA 2AH1A 5I5IA 3F3PA 2HYEA 2IUPA 4J84A 5GXIA 2CN2A 3P4FA 4XYHA 5CXBA 4PNKB 1XHMA 4GM3A 1OMWB 5GXHA 2HXCA 2CO0C 4U7AA 5TF2A 4ESGA 2H68A 4AEZA 2H6NA 2H9NA 4O1QD 5HE3B 4A0BA 5KDOB 2G99A 3SBQA 1GOTB 3RRMC 2PM9A 5TDHB 2Z2NA 4CZVA 3C99A 4CI3A 4CI2A 4H5IA 3PSLA 2OK4A 3CIKB 4CY1A 1NR0A 3SFZA 3IIWA 2HJBA 2PM6B 4A0AB 2EBSA 3F3GA 3BG1A 5K1CC 4A7JA 5C9ZB 4GM8A 4GZ8A 4FA5D 1K32A 3L4OD 3EI3A 3DXKC 3JROA 3ORVD 3UVKA 2P9NC 4QT8A 4J78A 2J56H 4JXMA 4XEIC 3F3FA 3MXXA 3SCYA 3OL2A 5IT9g 4FWWA 2W18A 1SHYB 4FA1D 2BCJB 2AGYA 2PM7B 3MZKA 1NEXB 4AOWA 4LGNA 3IJ1A 1P22A 2YNOA 3MZLA 2UZXB 2B5MA 3JB9L 3VA6A 3OKWA 5C2WB 4UI9R 4GGCA 2I0RA 3GREA 3UVMA 3UVNA 3RMZD 5CXCB 2H6QA 4K3JB 5FA5B 4ERQA 2AQ5A 3I7PA 4PBZA 3VH0A 4GM9A 3SVWD 3N0EA 1PEVA 1ERJA 1TBGA 1N6EA 4J82A 2YB8B 4ZN4A 1GXRA 3RSEC 3JZNA 3PE7A 4TZ4A 4Y7RA 5FKRA 4A09A 3OTTA 2UZYB 3AFCA 4I79A 3EI2B 4J73A 5K19A 4JSVC 3MKSB 2B5LA 4CY2A 5TEEA 1N6DA 2HKMA 4FA4D 3DXMC 4ZOVA 2AGWA 1PBYB 4J77A 3PVUB 1OLZA 5AMSA 3I7OA 5CXBB 4QRJA 3BG0A 4ZOZA 3FGBA 4CZYA 2TRCB 3I7KA 1A0RB 4A08A 1GP2B 2H47A 2HESX 2XL3A 3AL8B 5IJ8E 5EAPA 1R5MA 3UKUC 5H1MA 4E5ZB 5C2VB 3OKYB 4FHLA 4CI8A 5AFU3 5EMMB 2OVQB 4PXWA 4A0BB 2B4EA 2P9IC 3DWLC 3C75H 5EMLB 2YNNA 2OVPB 3IJCA 5SXMA 4D6VA 3NVQA 2P9SC 4CI1A 4O45A 5FLXg 1K8KC 1Q47A 4K3ID 2J57G 5EM2A 3B7FA 3JAMg 2CO0A 2P9UC 5EMJB 4MK0B 2AH0A 3MKQA 3DM0A 3K27A 3JPXA 4J87A 3UR4A 4IMMA 1SQJA 4CY3A 4LG9A 4PSWB 4CY5A 3RLMD 4BH6A 5FQDA 1TYQC 4GQ1A 4EWRA 4X60B 2CN3A 3W15A 1JJUB 4KFMB 3SJLD 1MG3A 3SBRA 4J81A 1RI6A 5CYKB 4PSXB 3J80g 1JOFA 4L3HD 2IUVA 3I7NA 3RFHA 2OIZA 4GGDA 3VGZA 2Z2PA 3EI1B 5HE0B 1MG2A 4A0AA 2GC7A 1U4CA 1YFQA 4E54A 3ZWLB 4D0KA 3RN0D 2H9MA 4QQEA 3EMHA 4Z8LA 3SHFA 2YNPA 2H6KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MMY A;  3RN1 D;  2I0T A;  3PXT D;  4JSP C;  4JD2 C;  4GMB A;  4Y5R D;  4H5J A;  3RFG A;  4QL1 A;  5EMK B;  3I89 A;  3CFS B;  3EG6 A;  4A09 B;  4JT6 C;  5B4W A;  2P9P C;  2H13 A;  2H14 A;  4ZOX A;  1FWX A;  3NVN A;  2YBA A;  3A0F A;  4A11 A;  2HKR A;  2IUR A;  4NSX A;  5FKQ A;  2MTA H;  4JSX C;  3SBP A;  2IAA A;  1GG2 B;  4J8G A;  5HQG A;  2I3S A;  5JWZ A;  5GMK n;  4A08 B;  4J79 A;  5EAL A;  4JSN C;  3JZH A;  2G9A A;  1VYH C;  3EI4 A;  3FRX A;  5IJ7 E;  4GQ2 P;  4FA9 D;  3I8E A;  2XU7 A;  4FAN D;  2CE9 A;  3UVL A;  3IJ0 A;  3EI2 A;  4X61 B;  2IWF A;  4IA9 A;  1SQ9 A;  4R7A B;  5EM2 B;  1S4U X;  1JMX B;  2PM9 B;  4OZU A;  3ODT A;  3C9C A;  4L9O A;  4HDJ A;  3JRP A;  5IGQ A;  4LG8 A;  3I8C A;  3NVX A;  2OVR B;  3U4Y A;  4FAV D;  5TEF A;  5AJA A;  3JZG A;  3E0C A;  2H9L A;  4FB1 D;  3OW8 A;  4PBY A;  3AL8 A;  5GSA A;  4ZOY A;  4E5Z A;  2IWK A;  3PXW D;  3OKY A;  3SWS D;  4PC0 A;  2YMU A;  5HYN B;  4O3T B;  3SMR A;  4A2M A;  3KRX B;  3PVW B;  3L4M D;  1XKS A;  3EI3 B;  1B9Y A;  3BWS A;  3V9F A;  3EU7 A;  4CC9 A;  5THA A;  3UVO A;  4OWR A;  5H17 A;  3OL2 B;  2P9K C;  4ERY A;  3UKR C;  1B9X A;  2CNX A;  4ERZ A;  5IGO A;  3I2N A;  3SN6 B;  3AL9 A;  4J86 A;  2B5N A;  1XIP A;  3KRW B;  4E54 B;  3AH8 B;  3K26 A;  2Z2O A;  4J0X A;  4GQB B;  4ES0 A;  1QNI A;  3IKO A;  4O9D A;  1PI6 A;  2H9P A;  2PBI B;  2XYI A;  1JMZ B;  1PGU A;  5H14 A;  5I5M A;  3PXS D;  2XL2 A;  4YVD A;  5HE2 B;  4L3G D;  3V7D B;  4XYI A;  5CYK A;  3DSM A;  1U2V C;  3OKT A;  4X63 B;  3CFV A;  4U1E I;  5FKT A;  4A11 B;  2O9K A;  4BUJ C;  2HJ4 A;  5HE1 B;  4A2L A;  3EI1 A;  2BBK H;  2GNQ A;  3IIY A;  4O3U B;  3SLE D;  5EAR A;  2AGZ A;  4GGA A;  3I7H A;  1N6F A;  3PSC B;  5I5J A;  5EAM A;  2OJY A;  2QXV A;  2J55 H;  4X3E A;  4J8B A;  5CXC A;  4N14 A;  1L0Q A;  5A2Q g;  4G56 B;  3EI4 B;  2OK6 A;  5FXY A;  3V5W B;  3SXT D;  4JT5 C;  3GFC A;  2AGX A;  4BL0 A;  3EWE A;  4CZX A;  2AGL A;  3HFQ A;  5IC7 A;  2H3X A;  3ULE C;  3N0D A;  2Q7Q A;  2I0S A;  3J81 g;  3C5M A;  2QC5 A;  5FKS A;  2CE8 A;  2GC4 A;  2P9L C;  3FM0 A;  4J0W A;  4L1Q D;  1MDA H;  2I3T A;  2IUQ A;  3I7L A;  2AH1 A;  5I5I A;  3F3P A;  2HYE A;  2IUP A;  4J84 A;  5GXI A;  2CN2 A;  3P4F A;  4XYH A;  5CXB A;  4PNK B;  1XHM A;  4GM3 A;  1OMW B;  5GXH A;  2HXC A;  2CO0 C;  4U7A A;  5TF2 A;  4ESG A;  2H68 A;  4AEZ A;  2H6N A;  2H9N A;  4O1Q D;  5HE3 B;  4A0B A;  5KDO B;  2G99 A;  3SBQ A;  1GOT B;  3RRM C;  2PM9 A;  5TDH B;  2Z2N A;  4CZV A;  3C99 A;  4CI3 A;  4CI2 A;  4H5I A;  3PSL A;  2OK4 A;  3CIK B;  4CY1 A;  1NR0 A;  3SFZ A;  3IIW A;  2HJB A;  2PM6 B;  4A0A B;  2EBS A;  3F3G A;  3BG1 A;  5K1C C;  4A7J A;  5C9Z B;  4GM8 A;  4GZ8 A;  4FA5 D;  1K32 A;  3L4O D;  3EI3 A;  3DXK C;  3JRO A;  3ORV D;  3UVK A;  2P9N C;  4QT8 A;  4J78 A;  2J56 H;  4JXM A;  4XEI C;  3F3F A;  3MXX A;  3SCY A;  3OL2 A;  5IT9 g;  4FWW A;  2W18 A;  1SHY B;  4FA1 D;  2BCJ B;  2AGY A;  2PM7 B;  3MZK A;  1NEX B;  4AOW A;  4LGN A;  3IJ1 A;  1P22 A;  2YNO A;  3MZL A;  2UZX B;  2B5M A;  3JB9 L;  3VA6 A;  3OKW A;  5C2W B;  4UI9 R;  4GGC A;  2I0R A;  3GRE A;  3UVM A;  3UVN A;  3RMZ D;  5CXC B;  2H6Q A;  4K3J B;  5FA5 B;  4ERQ A;  2AQ5 A;  3I7P A;  4PBZ A;  3VH0 A;  4GM9 A;  3SVW D;  3N0E A;  1PEV A;  1ERJ A;  1TBG A;  1N6E A;  4J82 A;  2YB8 B;  4ZN4 A;  1GXR A;  3RSE C;  3JZN A;  3PE7 A;  4TZ4 A;  4Y7R A;  5FKR A;  4A09 A;  3OTT A;  2UZY B;  3AFC A;  4I79 A;  3EI2 B;  4J73 A;  5K19 A;  4JSV C;  3MKS B;  2B5L A;  4CY2 A;  5TEE A;  1N6D A;  2HKM A;  4FA4 D;  3DXM C;  4ZOV A;  2AGW A;  1PBY B;  4J77 A;  3PVU B;  1OLZ A;  5AMS A;  3I7O A;  5CXB B;  4QRJ A;  3BG0 A;  4ZOZ A;  3FGB A;  4CZY A;  2TRC B;  3I7K A;  1A0R B;  4A08 A;  1GP2 B;  2H47 A;  2HES X;  2XL3 A;  3AL8 B;  5IJ8 E;  5EAP A;  1R5M A;  3UKU C;  5H1M A;  4E5Z B;  5C2V B;  3OKY B;  4FHL A;  4CI8 A;  5AFU 3;  5EMM B;  2OVQ B;  4PXW A;  4A0B B;  2B4E A;  2P9I C;  3DWL C;  3C75 H;  5EML B;  2YNN A;  2OVP B;  3IJC A;  5SXM A;  4D6V A;  3NVQ A;  2P9S C;  4CI1 A;  4O45 A;  5FLX g;  1K8K C;  1Q47 A;  4K3I D;  2J57 G;  5EM2 A;  3B7F A;  3JAM g;  2CO0 A;  2P9U C;  5EMJ B;  4MK0 B;  2AH0 A;  3MKQ A;  3DM0 A;  3K27 A;  3JPX A;  4J87 A;  3UR4 A;  4IMM A;  1SQJ A;  4CY3 A;  4LG9 A;  4PSW B;  4CY5 A;  3RLM D;  4BH6 A;  5FQD A;  1TYQ C;  4GQ1 A;  4EWR A;  4X60 B;  2CN3 A;  3W15 A;  1JJU B;  4KFM B;  3SJL D;  1MG3 A;  3SBR A;  4J81 A;  1RI6 A;  5CYK B;  4PSX B;  3J80 g;  1JOF A;  4L3H D;  2IUV A;  3I7N A;  3RFH A;  2OIZ A;  4GGD A;  3VGZ A;  2Z2P A;  3EI1 B;  5HE0 B;  1MG2 A;  4A0A A;  2GC7 A;  1U4C A;  1YFQ A;  4E54 A;  3ZWL B;  4D0K A;  3RN0 D;  2H9M A;  4QQE A;  3EMH A;  4Z8L A;  3SHF A;  2YNP A;  2H6K A; 
#chains in the Genus database with same CATH topology
 3MMY A;  3RN1 D;  2I0T A;  4AN0 A;  2EIB A;  3PXT D;  4JSP C;  4JD2 C;  4GMB A;  4Y5R D;  4H5J A;  2EIC A;  3RFG A;  4MMZ A;  4QL1 A;  3FCS A;  5EMK B;  5M61 A;  3I89 A;  3CFS B;  3EG6 A;  4A09 B;  4JT6 C;  5B4W A;  2P9P C;  2H13 A;  2H14 A;  2VC2 A;  5M5R A;  4ZOX A;  1H2W A;  1FWX A;  3NVN A;  2XE4 A;  2YBA A;  3A0F A;  4A11 A;  2HKR A;  2IUR A;  4NSX A;  5FKQ A;  2MTA H;  3DDU A;  4JSX C;  4Z7Q A;  3SBP A;  2IAA A;  1GG2 B;  4J8G A;  5HQG A;  2I3S A;  5JWZ A;  5GMK n;  3GC3 B;  4A08 B;  3ZDX A;  4J79 A;  5C92 A;  5EAL A;  4JSN C;  3V4V A;  3JZH A;  4NBM A;  2G9A A;  4L1M A;  1VYH C;  1C9L A;  3EI4 A;  3FRX A;  4GQ2 P;  5IJ7 E;  4FA9 D;  3EQ9 A;  1UOO A;  3I8E A;  2XU7 A;  4FAN D;  3MVD K;  2CE9 A;  3UVL A;  5E6U A;  3IJ0 A;  3EI2 A;  4DNU A;  2HU5 A;  4X61 B;  2IWF A;  4IA9 A;  1SQ9 A;  5C86 A;  4JHP C;  4G1M A;  4R7A B;  4RE6 A;  5EM2 B;  1S4U X;  1JMX B;  2PM9 B;  4OZU A;  3ODT A;  3C9C A;  1QFM A;  4L9O A;  4HDJ A;  1O6F A;  3JRP A;  5IGQ A;  4LG8 A;  3I8C A;  3IUL A;  4WJK A;  3NVX A;  2OVR B;  5FFG A;  3U4Y A;  3O4I A;  4FAV D;  5TEF A;  5AJA A;  3JZG A;  3E0C A;  2H9L A;  4FB1 D;  3OW8 A;  4PBY A;  1K3I A;  3AL8 A;  5GSA A;  4WK4 A;  4ZOY A;  1H2Z A;  4E5Z A;  4DNW A;  2IWK A;  3PXW D;  3OKY A;  3SWS D;  3IUR A;  4PC0 A;  2YMU A;  5HYN B;  4O3T B;  3SMR A;  4A2M A;  3KRX B;  3PVW B;  3L4M D;  1XKS A;  3EI3 B;  1E5T A;  1B9Y A;  3BWS A;  1BPO A;  3V9F A;  3EU7 A;  1VZ2 A;  4CC9 A;  4D9S A;  3ZDY A;  5THA A;  3UVO A;  4OWR A;  4BCC A;  5H17 A;  3OL2 B;  2P9K C;  3IUN A;  4ERY A;  3UKR C;  1B9X A;  2VDM A;  2CNX A;  4G1E A;  5IGO A;  3I2N A;  4ERZ A;  3SN6 B;  3AL9 A;  4J86 A;  2B5N A;  1XIP A;  3KRW B;  4E54 B;  3AH8 B;  3K26 A;  2Z2O A;  4J0X A;  4GQB B;  4ES0 A;  1QNI A;  3IKO A;  4O9D A;  1TYE A;  1PI6 A;  2H9P A;  2PBI B;  2XYI A;  1JMZ B;  1PGU A;  5H14 A;  5I5M A;  3IJE A;  3PXS D;  2XL2 A;  4YVD A;  5HE2 B;  4Z7O A;  4L3G D;  3V7D B;  4XYI A;  5CYK A;  2VZ1 A;  1U2V C;  3DSM A;  4Z7N A;  3OKT A;  4X63 B;  3CFV A;  4U1E I;  1E8M A;  2VZ3 A;  5FKT A;  4A11 B;  2O9K A;  4BUJ C;  2HJ4 A;  5HE1 B;  4A2L A;  3EI1 A;  2BBK H;  4WK0 A;  2GNQ A;  3IIY A;  1UTC A;  2HU8 A;  1O6G A;  4JHN A;  4UM9 A;  4O3U B;  4QAM A;  3SLE D;  5EAR A;  2AGZ A;  4GGA A;  3I7H A;  1N6F A;  4BP9 A;  3PSC B;  5I5J A;  5EAM A;  2OJY A;  2QXV A;  2J55 H;  4X3E A;  1A12 A;  3MUN A;  4J8B A;  5CXC A;  4N14 A;  1L0Q A;  5A2Q g;  4G56 B;  3EI4 B;  2OK6 A;  5FXY A;  3O4J A;  3V5W B;  3OF7 A;  3SXT D;  4JT5 C;  3GFC A;  2AGX A;  4O02 A;  4BCD A;  4BL0 A;  3EWE A;  4CZX A;  2AGL A;  3HFQ A;  4UM8 A;  2H3X A;  5IC7 A;  3ULE C;  2QZP A;  3N0D A;  3NIF A;  1H2X A;  2Q7Q A;  2I0S A;  3J81 g;  2HU7 A;  3C5M A;  4MMY A;  1UOQ A;  2VDN A;  2QC5 A;  5FKS A;  2XDW A;  2CE8 A;  2GC4 A;  2P9L C;  3FM0 A;  5E6R A;  4J0W A;  2IUQ A;  1MDA H;  2I3T A;  3I7L A;  4L1Q D;  2AH1 A;  5I5I A;  3F3P A;  4AMY A;  2HYE A;  2VDO A;  2IUP A;  3NID A;  1T2X A;  3IUM A;  4J84 A;  5GXI A;  2CN2 A;  3P4F A;  3O4G A;  4WK2 A;  4XYH A;  5CXB A;  5HDB A;  4AN1 A;  4PNK B;  1XHM A;  4GM3 A;  1OMW B;  5GXH A;  2HXC A;  2CO0 C;  3K72 A;  4U7A A;  5TF2 A;  4NC4 A;  4ESG A;  2H68 A;  4AEZ A;  1U8C A;  2H6N A;  2H9N A;  4O1Q D;  5HE3 B;  4A0B A;  5KDO B;  2G99 A;  3SBQ A;  3V4P A;  1GOT B;  3RRM C;  2PM9 A;  5TDH B;  2Z2N A;  4CZV A;  3C99 A;  4CI3 A;  4CI2 A;  3KCI A;  4H5I A;  3PSL A;  2OK4 A;  3CIK B;  4CY1 A;  1NR0 A;  3SFZ A;  3QI0 A;  3IIW A;  3T3M A;  4G55 A;  2HJB A;  2PM6 B;  4O2W A;  4A0A B;  2EBS A;  3F3G A;  3BG1 A;  5K1C C;  3K71 A;  4A7J A;  5C9Z B;  3QHY B;  4GM8 A;  4GZ8 A;  4FA5 D;  1K32 A;  4BCB A;  3L4O D;  3EI3 A;  3DXK C;  1JV2 A;  3JRO A;  3ORV D;  3UVK A;  2P9N C;  3IUJ A;  5FFO A;  4QT8 A;  4J78 A;  3K6S A;  2J56 H;  3IVM A;  4JXM A;  3F3F A;  3MXX A;  4XEI C;  3SCY A;  3OL2 A;  3ZE0 A;  5IT9 g;  1M1X A;  4FWW A;  2W18 A;  1SHY B;  4FA1 D;  2BCJ B;  2AGY A;  2PM7 B;  3MZK A;  1NEX B;  4AOW A;  3VI4 A;  4LGN A;  1QFS A;  1UOP A;  3IJ1 A;  2XZG A;  1I2M B;  1P22 A;  2YNO A;  3MZL A;  5M5S A;  3EQ7 A;  2UZX B;  2B5M A;  4RE5 A;  4BP8 A;  3JB9 L;  3VA6 A;  2BKL A;  3OKW A;  5C2W B;  4UI9 R;  2EID A;  2VDQ A;  4AX4 A;  4DNV A;  4GGC A;  2I0R A;  3GRE A;  3UVM A;  3UVN A;  3RMZ D;  5CXC B;  2H6Q A;  4K3J B;  5FA5 B;  4ERQ A;  2AQ5 A;  3I7P A;  5M5T A;  4PBZ A;  3ZE1 A;  3VH0 A;  4GM9 A;  3SVW D;  3N0E A;  1PEV A;  3T3P A;  1ERJ A;  4AMZ A;  1TBG A;  1N6E A;  4J82 A;  2YB8 B;  4ZN4 A;  1GXR A;  1H2Y A;  1JTD B;  3RSE C;  3MUO A;  3JZN A;  3PE7 A;  4TZ4 A;  4Y7R A;  5FKR A;  4A09 A;  3OTT A;  2UZY B;  3AFC A;  4I79 A;  3EI2 B;  3FCU A;  4J73 A;  5K19 A;  4JSV C;  3MKS B;  1GOH A;  2B5L A;  5TEE A;  4CY2 A;  1N6D A;  2HKM A;  3IUQ A;  4FA4 D;  3DXM C;  4ZOV A;  2AGW A;  1PBY B;  4J77 A;  3O4H A;  3PVU B;  4IRZ A;  1OLZ A;  1VE7 A;  5AMS A;  5M5U A;  3I7O A;  5CXB B;  4QRJ A;  3BG0 A;  4ZOZ A;  3FGB A;  4CZY A;  2TRC B;  3I7K A;  1A0R B;  4A08 A;  1GP2 B;  2H47 A;  2HES X;  2XL3 A;  3AL8 B;  5IJ8 E;  5EAP A;  1R5M A;  3UKU C;  5H1M A;  4E5Z B;  2VDL A;  5C2V B;  1GOG A;  3ZE2 A;  3OKY B;  4FHL A;  4CI8 A;  5AFU 3;  5EMM B;  2OVQ B;  3GD1 I;  4PXW A;  5M5V A;  4A0B B;  4NEN A;  2B4E A;  2P9I C;  3DWL C;  2VDK A;  3C75 H;  5EML B;  2YNN A;  3EQ8 A;  1L5G A;  2OVP B;  3IJC A;  5SXM A;  4D6V A;  3NVQ A;  2P9S C;  4CI1 A;  4O45 A;  5FLX g;  1K8K C;  1Q47 A;  4K3I D;  2VDR A;  2J57 G;  5EM2 A;  2JKX A;  3B7F A;  3JAM g;  1GOF A;  2CO0 A;  2P9U C;  5EMJ B;  4MK0 B;  2AH0 A;  3MKQ A;  3DM0 A;  5E6S A;  3K27 A;  3JPX A;  4MMX A;  4J87 A;  3UR4 A;  4IMM A;  1SQJ A;  2WQ8 A;  4CY3 A;  4LG9 A;  4PSW B;  4CY5 A;  3RLM D;  4BH6 A;  5FQD A;  1TYQ C;  4GQ1 A;  4EWR A;  4X60 B;  2CN3 A;  3W15 A;  1JJU B;  2VDP A;  4KFM B;  1VZ3 A;  3SJL D;  1E8N A;  1MG3 A;  3SBR A;  4J81 A;  3NIG A;  1RI6 A;  5CYK B;  4PSX B;  3J80 g;  2EIE A;  1JOF A;  4L3H D;  2IUV A;  3I7N A;  3RFH A;  2OIZ A;  4GGD A;  3VGZ A;  2Z2P A;  3EI1 B;  2QR5 A;  3ZDZ A;  5HE0 B;  1MG2 A;  4A0A A;  2GC7 A;  1U4C A;  1YFQ A;  4E54 A;  1C9I A;  4NAA A;  3VI3 A;  3ZWL B;  4D0K A;  3RN0 D;  1YR2 A;  2H9M A;  4QQE A;  3EMH A;  4Z8L A;  3SHF A;  1VE6 A;  2YNP A;  2H6K A; 
#chains in the Genus database with same CATH homology
 3MMY A;  3RN1 D;  2I0T A;  3PXT D;  4JSP C;  4JD2 C;  4GMB A;  4Y5R D;  4H5J A;  3RFG A;  4QL1 A;  5EMK B;  3I89 A;  3CFS B;  3EG6 A;  4A09 B;  4JT6 C;  5B4W A;  2P9P C;  2H13 A;  2H14 A;  4ZOX A;  1FWX A;  3NVN A;  2YBA A;  3A0F A;  4A11 A;  2HKR A;  2IUR A;  4NSX A;  5FKQ A;  2MTA H;  4JSX C;  3SBP A;  2IAA A;  1GG2 B;  4J8G A;  5HQG A;  2I3S A;  5JWZ A;  5GMK n;  4A08 B;  4J79 A;  5EAL A;  4JSN C;  3JZH A;  2G9A A;  1VYH C;  3EI4 A;  3FRX A;  5IJ7 E;  4GQ2 P;  4FA9 D;  3I8E A;  2XU7 A;  4FAN D;  2CE9 A;  3UVL A;  3IJ0 A;  3EI2 A;  4X61 B;  2IWF A;  4IA9 A;  1SQ9 A;  4R7A B;  5EM2 B;  1S4U X;  1JMX B;  2PM9 B;  4OZU A;  3ODT A;  3C9C A;  4L9O A;  4HDJ A;  3JRP A;  5IGQ A;  4LG8 A;  3I8C A;  3NVX A;  2OVR B;  3U4Y A;  4FAV D;  5TEF A;  5AJA A;  3JZG A;  3E0C A;  2H9L A;  4FB1 D;  3OW8 A;  4PBY A;  3AL8 A;  5GSA A;  4ZOY A;  4E5Z A;  2IWK A;  3PXW D;  3OKY A;  3SWS D;  4PC0 A;  2YMU A;  5HYN B;  4O3T B;  3SMR A;  4A2M A;  3KRX B;  3PVW B;  3L4M D;  1XKS A;  3EI3 B;  1B9Y A;  3BWS A;  3V9F A;  3EU7 A;  4CC9 A;  5THA A;  3UVO A;  4OWR A;  5H17 A;  3OL2 B;  2P9K C;  4ERY A;  3UKR C;  1B9X A;  2CNX A;  4ERZ A;  5IGO A;  3I2N A;  3SN6 B;  3AL9 A;  4J86 A;  2B5N A;  1XIP A;  3KRW B;  4E54 B;  3AH8 B;  3K26 A;  2Z2O A;  4J0X A;  4GQB B;  4ES0 A;  1QNI A;  3IKO A;  4O9D A;  1PI6 A;  2H9P A;  2PBI B;  2XYI A;  1JMZ B;  1PGU A;  5H14 A;  5I5M A;  3PXS D;  2XL2 A;  4YVD A;  5HE2 B;  4L3G D;  3V7D B;  4XYI A;  5CYK A;  3DSM A;  1U2V C;  3OKT A;  4X63 B;  3CFV A;  4U1E I;  5FKT A;  4A11 B;  2O9K A;  4BUJ C;  2HJ4 A;  5HE1 B;  4A2L A;  3EI1 A;  2BBK H;  2GNQ A;  3IIY A;  4O3U B;  3SLE D;  5EAR A;  2AGZ A;  4GGA A;  3I7H A;  1N6F A;  3PSC B;  5I5J A;  5EAM A;  2OJY A;  2QXV A;  2J55 H;  4X3E A;  4J8B A;  5CXC A;  4N14 A;  1L0Q A;  5A2Q g;  4G56 B;  3EI4 B;  2OK6 A;  5FXY A;  3V5W B;  3SXT D;  4JT5 C;  3GFC A;  2AGX A;  4BL0 A;  3EWE A;  4CZX A;  2AGL A;  3HFQ A;  5IC7 A;  2H3X A;  3ULE C;  3N0D A;  2Q7Q A;  2I0S A;  3J81 g;  3C5M A;  2QC5 A;  5FKS A;  2CE8 A;  2GC4 A;  2P9L C;  3FM0 A;  4J0W A;  4L1Q D;  1MDA H;  2I3T A;  2IUQ A;  3I7L A;  2AH1 A;  5I5I A;  3F3P A;  2HYE A;  2IUP A;  4J84 A;  5GXI A;  2CN2 A;  3P4F A;  4XYH A;  5CXB A;  4PNK B;  1XHM A;  4GM3 A;  1OMW B;  5GXH A;  2HXC A;  2CO0 C;  4U7A A;  5TF2 A;  4ESG A;  2H68 A;  4AEZ A;  2H6N A;  2H9N A;  4O1Q D;  5HE3 B;  4A0B A;  5KDO B;  2G99 A;  3SBQ A;  1GOT B;  3RRM C;  2PM9 A;  5TDH B;  2Z2N A;  4CZV A;  3C99 A;  4CI3 A;  4CI2 A;  4H5I A;  3PSL A;  2OK4 A;  3CIK B;  4CY1 A;  1NR0 A;  3SFZ A;  3IIW A;  2HJB A;  2PM6 B;  4A0A B;  2EBS A;  3F3G A;  3BG1 A;  5K1C C;  4A7J A;  5C9Z B;  4GM8 A;  4GZ8 A;  4FA5 D;  1K32 A;  3L4O D;  3EI3 A;  3DXK C;  3JRO A;  3ORV D;  3UVK A;  2P9N C;  4QT8 A;  4J78 A;  2J56 H;  4JXM A;  4XEI C;  3F3F A;  3MXX A;  3SCY A;  3OL2 A;  5IT9 g;  4FWW A;  2W18 A;  1SHY B;  4FA1 D;  2BCJ B;  2AGY A;  2PM7 B;  3MZK A;  1NEX B;  4AOW A;  4LGN A;  3IJ1 A;  1P22 A;  2YNO A;  3MZL A;  2UZX B;  2B5M A;  3JB9 L;  3VA6 A;  3OKW A;  5C2W B;  4UI9 R;  4GGC A;  2I0R A;  3GRE A;  3UVM A;  3UVN A;  3RMZ D;  5CXC B;  2H6Q A;  4K3J B;  5FA5 B;  4ERQ A;  2AQ5 A;  3I7P A;  4PBZ A;  3VH0 A;  4GM9 A;  3SVW D;  3N0E A;  1PEV A;  1ERJ A;  1TBG A;  1N6E A;  4J82 A;  2YB8 B;  4ZN4 A;  1GXR A;  3RSE C;  3JZN A;  3PE7 A;  4TZ4 A;  4Y7R A;  5FKR A;  4A09 A;  3OTT A;  2UZY B;  3AFC A;  4I79 A;  3EI2 B;  4J73 A;  5K19 A;  4JSV C;  3MKS B;  2B5L A;  4CY2 A;  5TEE A;  1N6D A;  2HKM A;  4FA4 D;  3DXM C;  4ZOV A;  2AGW A;  1PBY B;  4J77 A;  3PVU B;  1OLZ A;  5AMS A;  3I7O A;  5CXB B;  4QRJ A;  3BG0 A;  4ZOZ A;  3FGB A;  4CZY A;  2TRC B;  3I7K A;  1A0R B;  4A08 A;  1GP2 B;  2H47 A;  2HES X;  2XL3 A;  3AL8 B;  5IJ8 E;  5EAP A;  1R5M A;  3UKU C;  5H1M A;  4E5Z B;  5C2V B;  3OKY B;  4FHL A;  4CI8 A;  5AFU 3;  5EMM B;  2OVQ B;  4PXW A;  4A0B B;  2B4E A;  2P9I C;  3DWL C;  3C75 H;  5EML B;  2YNN A;  2OVP B;  3IJC A;  5SXM A;  4D6V A;  3NVQ A;  2P9S C;  4CI1 A;  4O45 A;  5FLX g;  1K8K C;  1Q47 A;  4K3I D;  2J57 G;  5EM2 A;  3B7F A;  3JAM g;  2CO0 A;  2P9U C;  5EMJ B;  4MK0 B;  2AH0 A;  3MKQ A;  3DM0 A;  3K27 A;  3JPX A;  4J87 A;  3UR4 A;  4IMM A;  1SQJ A;  4CY3 A;  4LG9 A;  4PSW B;  4CY5 A;  3RLM D;  4BH6 A;  5FQD A;  1TYQ C;  4GQ1 A;  4EWR A;  4X60 B;  2CN3 A;  3W15 A;  1JJU B;  4KFM B;  3SJL D;  1MG3 A;  3SBR A;  4J81 A;  1RI6 A;  5CYK B;  4PSX B;  3J80 g;  1JOF A;  4L3H D;  2IUV A;  3I7N A;  3RFH A;  2OIZ A;  4GGD A;  3VGZ A;  2Z2P A;  3EI1 B;  5HE0 B;  1MG2 A;  4A0A A;  2GC7 A;  1U4C A;  1YFQ A;  4E54 A;  3ZWL B;  4D0K A;  3RN0 D;  2H9M A;  4QQE A;  3EMH A;  4Z8L A;  3SHF A;  2YNP A;  2H6K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...