4FA5D

Crystal structure of wt maug in complex with pre-methylamine dehydrogenase aged 20 days
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
376
structure length
376
Chain Sequence
QETQGQAAARAAAADLAAGQDDEPRILEAPAPDARRVYVNDPAHFAAVTQQFVIDGEAGRVIGMIDGGFLPNPVVADDGSFIAHASTVFSRIARGERTDYVEVFDPVTLLPTADIELPDAPRFLVGTYPWMTSLTPDGKTLLFYQFSPAPAVGVVDLEGKAFKRMLDVPDCYHIFPTAPDTFFMHCRDGSLAKVAFGTEGTPEITHTEVFHPEDEFLINHPAYSQKAGRLVWPTYTGKIHQIDLSSGDAKFLPAVEALTEAERADGWRPGGWQQVAYHRALDRIYLLVDQRDEWRHKTASRFVVVLDAKTGERLAKFEMGHEIDSINVSQDEKPLLYALSTGDKTLYIHDAESGEELRSVNQLGHGPQVITTADMG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylamine utilization protein MauG
publication title Diradical intermediate within the context of tryptophan tryptophylquinone biosynthesis.
pubmed doi rcsb
source organism Paracoccus denitrificans
molecule tags Oxidoreductase/electron transport
total genus 96
structure length 376
sequence length 376
chains with identical sequence F
ec nomenclature
pdb deposition date 2012-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4fa5D00
5CXBA 3I7HA 4CI3A 5AFU3 2MTAH 3OW8A 3VGZA 5GXHA 5CXBB 3JPXA 1SQJA 1VYHC 3I8EA 4J0XA 3SXTD 4ZOYA 1GOTB 4R7AB 4ZOVA 4GGDA 4EWRA 2TRCB 3KRWB 5H1MA 1JMZB 3AL9A 3JZHA 3EI1A 4XYIA 4AOWA 3V5WB 3PVWB 2G99A 1MG2A 1R5MA 4J86A 2IWKA 4JT5C 3EI1B 4CC9A 2IWFA 1JMXB 3PXWD 5CXCA 3SBRA 4FA1D 5EMMB 4J73A 1NEXB 2OJYA 5AMSA 2H6NA 2H14A 5CXCB 3I7KA 3PXTD 5THAA 2YMUA 2AH0A 2EBSA 3UKRC 4JSXC 2H9MA 1PI6A 2YB8B 3SLED 3V7DB 2G9AA 3ODTA 5FKQA 3MKSB 3SBQA 3I2NA 2P9PC 3JROA 2I3TA 3OKTA 3F3GA 2AGZA 2OVQB 2CNXA 4Y5RD 2OK4A 3FM0A 5HE1B 4J84A 3A0FA 5HYNB 1K32A 3SHFA 3E0CA 2CN2A 3K26A 2PM7B 5EARA 3UVMA 4J79A 4CZXA 1NR0A 3DXKC 4O45A 4PSWB 3JZNA 4IA9A 3JAMg 3SVWD 4XEIC 3MZLA 1U2VC 2AGXA 3SJLD 3ZWLB 1B9YA 5H14A 4K3ID 4GQ2P 4J87A 4PNKB 4YVDA 2J57G 2YBAA 5A2Qg 2J55H 2PM6B 3EU7A 4GZ8A 2W18A 2Z2NA 3OKYA 1P22A 4FA9D 4J78A 2XYIA 3EI3A 5B4WA 4O9DA 3OKYB 5CYKA 2AH1A 2H13A 4L3GD 3EI3B 2P9IC 3PVUB 5TEFA 4J8BA 4OZUA 5IC7A 5CYKB 5EM2A 3L4MD 4J8GA 3UVKA 3BG0A 3MKQA 5I5JA 1YFQA 4ERYA 4GMBA 4JD2C 5KDOB 3GFCA 4GQBB 4J0WA 4TZ4A 1OMWB 3DXMC 3F3FA 1MG3A 3K27A 5EM2B 3N0EA 3PSCB 2P9LC 4ZN4A 5FKSA 2I0TA 2B5MA 1OLZA 3DWLC 3RLMD 4A09A 2CO0C 2I0RA 3EMHA 2QC5A 2I0SA 3IJ0A 2UZXB 2BBKH 4JSNC 4LG9A 4FAND 5EAMA 3IIWA 2HKRA 4A09B 2IURA 4J81A 4CY5A 4O3TB 5I5MA 5EMLB 2AGWA 1GP2B 5TDHB 1SHYB 5FKTA 1JOFA 3W15A 1ERJA 3SCYA 2H47A 2H6QA 4FB1D 2IUQA 3MZKA 2HESX 2GNQA 2P9KC 3RRMC 3EG6A 4A7JA 5H17A 3C99A 3JB9L 4ZOXA 4IMMA 1JJUB 2XU7A 3PSLA 2GC7A 3CFVA 2QXVA 3B7FA 3AL8A 3SWSD 4FAVD 2Z2PA 2PM9A 3ORVD 4JSVC 4A2LA 1XKSA 4OWRA 3AL8B 3V9FA 4CI8A 3I7OA 1XHMA 4L1QD 4ERZA 2PM9B 5IJ7E 5C2WB 3JRPA 5HE3B 4A0BA 3UR4A 2OK6A 4PBZA 3EI4A 4X3EA 4LGNA 3DM0A 1A0RB 3UVLA 4H5JA 4QQEA 4O1QD 3EI4B 3PE7A 2AGLA 5HE0B 4PXWA 1MDAH 5K19A 4D0KA 4CI2A 4Y7RA 2IAAA 4L9OA 2PBIB 3FGBA 2P9SC 3OKWA 5GSAA 2B5NA 4UI9R 4J82A 5TF2A 2UZYB 2CO0A 5K1CC 3I8CA 5C2VB 4PC0A 3UVOA 4FA4D 2Z2OA 3C5MA 5EALA 3RFGA 3L4OD 2H9PA 3ULEC 3U4YA 4XYHA 4GQ1A 2HJBA 2O9KA 1L0QA 4H5IA 3IJ1A 4HDJA 3DSMA 5FQDA 3AFCA 4ES0A 3C75H 4AEZA 3RN0D 2B4EA 2AGYA 5HE2B 4A0AA 4BL0A 5FLXg 1S4UX 3KRXB 2XL3A 2HXCA 2H3XA 2P9NC 4ZOZA 4CY2A 4CZVA 4A0AB 2HJ4A 2P9UC 1PBYB 4PBYA 4BUJC 5AJAA 4N14A 3MXXA 3CIKB 3GREA 4QT8A 3J81g 1N6EA 2Q7QA 2BCJB 3J80g 4ESGA 4X60B 5EMKB 5FA5B 4A11A 1RI6A 3IJCA 4CI1A 2H9LA 1GG2B 2AQ5A 5EAPA 4JXMA 4KFMB 4A11B 5I5IA 1N6FA 4FA5D 3SMRA 3MMYA 5FXYA 4BH6A 4GM3A 4MK0B 4QRJA 3RN1D 1TYQC 1U4CA 4GGAA 5IJ8E 4X63B 3OL2A 3JZGA 3N0DA 1SQ9A 4O3UB 3F3PA 3IIYA 1N6DA 4U7AA 5JWZA 1FWXA 1GXRA 3OL2B 4CZYA 2J56H 5GMKn 3P4FA 4GGCA 4K3JB 5TEEA 4L3HD 4Z8LA 1B9XA 5EMJB 5HQGA 2YNPA 3AH8B 2GC4A 3VH0A 3I7NA 3UKUC 5SXMA 4A0BB 3RMZD 5GXIA 1TBGA 5FKRA 5C9ZB 4FHLA 2B5LA 3HFQA 3BG1A 2H9NA 4GM9A 3EI2A 2H6KA 4J77A 4JSPC 4E54A 3SN6B 2I3SA 3EWEA 2YNOA 2HKMA 3NVQA 4A08A 3EI2B 4QL1A 2OVRB 4E54B 4D6VA 1PEVA 4E5ZA 2OVPB 5IT9g 4X61B 1K8KC 4A08B 3UVNA 5IGQA 1PGUA 4PSXB 1XIPA 3I7PA 4E5ZB 2CE8A 3NVXA 4A2MA 3SFZA 3OTTA 4I79A 2YNNA 2XL2A 4GM8A 4CY1A 1Q47A 2IUVA 4NSXA 4CY3A 3I7LA 3I89A 3C9CA 3CFSB 4G56B 3RSEC 4FWWA 3FRXA 3IKOA 3SBPA 2CE9A 4ERQA 4JT6C 2H68A 2CN3A 3BWSA 4LG8A 4U1EI 2OIZA 2HYEA 3NVNA 1QNIA 2IUPA 3VA6A 5IGOA 3PXSD 3RFHA
chains in the Genus database with same CATH superfamily
4G55A 5HDBA 2VDRA 1H2ZA 5CXBA 5M5RA 1JTDB 3I7HA 3O4JA 4CI3A 5AFU3 2VDMA 2MTAH 3OW8A 1UTCA 3VGZA 5GXHA 1GOGA 5CXBB 3JPXA 1SQJA 1VYHC 4DNVA 2EIDA 3I8EA 4J0XA 3SXTD 3VI3A 2JKXA 1U8CA 2XDWA 4ZOYA 3FCUA 4Z7OA 1GOTB 4R7AB 4ZOVA 2EIBA 4GGDA 4EWRA 2TRCB 3KRWB 5H1MA 4BCDA 1JMZB 3AL9A 4DNWA 3JZHA 3EI1A 4XYIA 4AOWA 1H2YA 3V5WB 3PVWB 2G99A 1MG2A 3ZDXA 1R5MA 1VE7A 4J86A 3NIGA 1GOHA 2IWKA 4JT5C 3EI1B 4CC9A 2IWFA 1JMXB 3PXWD 3IUJA 5CXCA 3IUNA 4O2WA 2BKLA 3SBRA 4D9SA 4FA1D 5EMMB 4J73A 1NEXB 2OJYA 5AMSA 2H6NA 2H14A 2WQ8A 1BPOA 5CXCB 3I7KA 3PXTD 3ZE2A 5THAA 2YMUA 2AH0A 2EBSA 3EQ8A 3UKRC 4JSXC 2H9MA 1PI6A 2YB8B 1JV2A 3SLED 5C86A 3MUNA 3V7DB 2G9AA 3ODTA 5FKQA 3MKSB 3SBQA 3I2NA 3K72A 2P9PC 3JROA 2I3TA 3OKTA 3F3GA 2AGZA 2OVQB 1T2XA 2QR5A 2CNXA 4O02A 4Y5RD 2OK4A 3FM0A 5HE1B 4J84A 3A0FA 5HYNB 1K32A 3SHFA 3E0CA 3FCSA 2CN2A 3K26A 2PM7B 5EARA 3UVMA 2XE4A 4J79A 4CZXA 1NR0A 3DXKC 4O45A 4PSWB 3JZNA 3KCIA 4IA9A 4UM9A 3JAMg 3SVWD 4XEIC 3MZLA 1U2VC 3O4IA 2AGXA 3SJLD 3ZWLB 1B9YA 5H14A 4K3ID 4GQ2P 4BCCA 4NC4A 4JHPC 4G1EA 4J87A 2HU8A 4PNKB 4YVDA 2J57G 3DDUA 2YBAA 5A2Qg 2J55H 2PM6B 3EU7A 4GZ8A 2W18A 2Z2NA 3OKYA 3QI0A 1P22A 4FA9D 4J78A 3K71A 2XYIA 3EI3A 4BP8A 5B4WA 5M61A 4O9DA 4NAAA 3OKYB 5CYKA 2AH1A 1QFMA 2H13A 4QAMA 4AN0A 4L3GD 3EI3B 2P9IC 3PVUB 5TEFA 4WK4A 4J8BA 4OZUA 5IC7A 5CYKB 5EM2A 3L4MD 3OF7A 4J8GA 3UVKA 3BG0A 3MKQA 5I5JA 1YFQA 4ERYA 4GMBA 4JD2C 5KDOB 3GFCA 4UM8A 1L5GA 4GQBB 4J0WA 4TZ4A 1OMWB 3DXMC 3F3FA 1MG3A 3K27A 5EM2B 3N0EA 3PSCB 4L1MA 2P9LC 4ZN4A 5FKSA 2I0TA 2B5MA 1E5TA 1OLZA 3DWLC 3RLMD 3K6SA 4A09A 5M5TA 2CO0C 2I0RA 3EMHA 2QC5A 2I0SA 1O6FA 3IJ0A 2UZXB 3V4VA 2BBKH 5M5SA 4JSNC 4LG9A 4FAND 2VZ1A 5EAMA 3IIWA 2HKRA 4A09B 2IURA 4J81A 1E8NA 4O3TB 4CY5A 5I5MA 5EMLB 2AGWA 1GP2B 5TDHB 1SHYB 5FKTA 1JOFA 4MMYA 3W15A 3IURA 1ERJA 3EQ9A 3SCYA 2H47A 2H6QA 4FB1D 2IUQA 3MZKA 1UOPA 2HESX 4JHNA 2GNQA 2P9KC 3RRMC 4NENA 3IUQA 3EG6A 4A7JA 5H17A 3C99A 3JB9L 4ZOXA 4IMMA 1JJUB 2XU7A 3PSLA 2GC7A 3CFVA 2QXVA 3B7FA 3AL8A 3SWSD 4FAVD 3MUOA 2Z2PA 2PM9A 3ORVD 4JSVC 4A2LA 4AN1A 1XKSA 2VC2A 4OWRA 3AL8B 3V9FA 4CI8A 3I7OA 1H2WA 1XHMA 2VZ3A 4L1QD 2PM9B 4ERZA 5IJ7E 5C2WB 1VE6A 3JRPA 5HE3B 4A0BA 3UR4A 2OK6A 4PBZA 3EI4A 4RE5A 4X3EA 3IVMA 4LGNA 3DM0A 1A0RB 3NIFA 3UVLA 3GC3B 4H5JA 4QQEA 4O1QD 3EI4B 3PE7A 2AGLA 5HE0B 4PXWA 1K3IA 1MDAH 5K19A 4D0KA 4CI2A 4Y7RA 1UOOA 2IAAA 4L9OA 2PBIB 3FGBA 2P9SC 3OKWA 4WK0A 3T3PA 2B5NA 1UOQA 4UI9R 5GSAA 3V4PA 4J82A 4RE6A 5TF2A 1C9IA 2UZYB 5M5VA 2CO0A 5K1CC 3I8CA 5C2VB 4PC0A 3UVOA 4FA4D 3MVDK 2Z2OA 3C5MA 5EALA 3RFGA 3L4OD 2H9PA 3ULEC 3U4YA 4WK2A 4XYHA 4GQ1A 2HJBA 1H2XA 2O9KA 5E6UA 5E6SA 3ZE0A 1L0QA 4H5IA 3IJ1A 3QHYB 4HDJA 3DSMA 5FQDA 4DNUA 3AFCA 2HU5A 1VZ2A 1QFSA 4ES0A 3C75H 4AEZA 3RN0D 3ZDYA 4Z7NA 2B4EA 3GD1I 2AGYA 1E8MA 5HE2B 4BP9A 4A0AA 1C9LA 4BL0A 5FLXg 1S4UX 3KRXB 2XL3A 2HXCA 2H3XA 2P9NC 4ZOZA 4CY2A 4CZVA 4A0AB 2HJ4A 2P9UC 2QZPA 3NIDA 1O6GA 1PBYB 4AMYA 4PBYA 4BUJC 5AJAA 2VDOA 4N14A 3MXXA 3CIKB 3GREA 4QT8A 3J81g 1N6EA 2Q7QA 2VDKA 2BCJB 4NBMA 1TYEA 4MMXA 3J80g 4ESGA 4X60B 5EMKB 5FA5B 4A11A 1RI6A 3ZE1A 3IJCA 4CI1A 2H9LA 1GG2B 2AQ5A 5EAPA 4JXMA 4KFMB 4A11B 5I5IA 1N6FA 2HU7A 4FA5D 3SMRA 3MMYA 5FXYA 4BH6A 4GM3A 4MK0B 4QRJA 3RN1D 1TYQC 1U4CA 4GGAA 1M1XA 2EIEA 5IJ8E 4X63B 3OL2A 3JZGA 3N0DA 1SQ9A 4O3UB 3F3PA 4AX4A 3IIYA 1N6DA 3EQ7A 4U7AA 5JWZA 1FWXA 1GXRA 3OL2B 4CZYA 4WJKA 3ZDZA 2J56H 5GMKn 2XZGA 3P4FA 4GGCA 4IRZA 2EICA 4K3JB 2VDQA 4L3HD 5TEEA 3IJEA 1A12A 4Z8LA 1B9XA 5EMJB 5HQGA 2YNPA 3AH8B 2GC4A 3VH0A 3I7NA 3UKUC 5C92A 5SXMA 4A0BB 3RMZD 1GOFA 5GXIA 3VI4A 1TBGA 5FKRA 5C9ZB 4FHLA 2B5LA 3HFQA 4G1MA 3BG1A 3O4HA 2H9NA 4GM9A 3EI2A 4Z7QA 2H6KA 4J77A 4JSPC 4E54A 3SN6B 2I3SA 3EWEA 2YNOA 2HKMA 3NVQA 4A08A 3EI2B 3T3MA 4QL1A 2OVRB 4E54B 4D6VA 1PEVA 4E5ZA 2OVPB 5IT9g 4X61B 1K8KC 5M5UA 4A08B 1I2MB 3UVNA 5IGQA 3IUMA 1PGUA 4PSXB 1XIPA 3O4GA 3I7PA 4E5ZB 4AMZA 2CE8A 3NVXA 4A2MA 3SFZA 2VDPA 3OTTA 4I79A 2YNNA 5E6RA 2XL2A 1VZ3A 2VDLA 4GM8A 2VDNA 5FFGA 3IULA 4CY1A 1Q47A 2IUVA 4NSXA 4CY3A 3I7LA 3I89A 3C9CA 3CFSB 4G56B 3RSEC 4FWWA 3FRXA 3IKOA 3SBPA 2CE9A 4ERQA 4JT6C 2H68A 2CN3A 4BCBA 3BWSA 4LG8A 4U1EI 2OIZA 4MMZA 3NVNA 2HYEA 1QNIA 2IUPA 3VA6A 5IGOA 5FFOA 3PXSD 1YR2A 3RFHA
chains in the Genus database with same CATH topology
5CXBA 3I7HA 4CI3A 5AFU3 2MTAH 3OW8A 3VGZA 5GXHA 5CXBB 3JPXA 1SQJA 1VYHC 3I8EA 4J0XA 3SXTD 4ZOYA 1GOTB 4R7AB 4ZOVA 4GGDA 4EWRA 2TRCB 3KRWB 5H1MA 1JMZB 3AL9A 3JZHA 3EI1A 4XYIA 4AOWA 3V5WB 3PVWB 2G99A 1MG2A 1R5MA 4J86A 2IWKA 4JT5C 3EI1B 4CC9A 2IWFA 1JMXB 3PXWD 5CXCA 3SBRA 4FA1D 5EMMB 4J73A 1NEXB 2OJYA 5AMSA 2H6NA 2H14A 5CXCB 3I7KA 3PXTD 5THAA 2YMUA 2AH0A 2EBSA 3UKRC 4JSXC 2H9MA 1PI6A 2YB8B 3SLED 3V7DB 2G9AA 3ODTA 5FKQA 3MKSB 3SBQA 3I2NA 2P9PC 3JROA 2I3TA 3OKTA 3F3GA 2AGZA 2OVQB 2CNXA 4Y5RD 2OK4A 3FM0A 5HE1B 4J84A 3A0FA 5HYNB 1K32A 3SHFA 3E0CA 2CN2A 3K26A 2PM7B 5EARA 3UVMA 4J79A 4CZXA 1NR0A 3DXKC 4O45A 4PSWB 3JZNA 4IA9A 3JAMg 3SVWD 4XEIC 3MZLA 1U2VC 2AGXA 3SJLD 3ZWLB 1B9YA 5H14A 4K3ID 4GQ2P 4J87A 4PNKB 4YVDA 2J57G 2YBAA 5A2Qg 2J55H 2PM6B 3EU7A 4GZ8A 2W18A 2Z2NA 3OKYA 1P22A 4FA9D 4J78A 2XYIA 3EI3A 5B4WA 4O9DA 3OKYB 5CYKA 2AH1A 2H13A 4L3GD 3EI3B 2P9IC 3PVUB 5TEFA 4J8BA 4OZUA 5IC7A 5CYKB 5EM2A 3L4MD 4J8GA 3UVKA 3BG0A 3MKQA 5I5JA 1YFQA 4ERYA 4GMBA 4JD2C 5KDOB 3GFCA 4GQBB 4J0WA 4TZ4A 1OMWB 3DXMC 3F3FA 1MG3A 3K27A 5EM2B 3N0EA 3PSCB 2P9LC 4ZN4A 5FKSA 2I0TA 2B5MA 1OLZA 3DWLC 3RLMD 4A09A 2CO0C 2I0RA 3EMHA 2QC5A 2I0SA 3IJ0A 2UZXB 2BBKH 4JSNC 4LG9A 4FAND 5EAMA 3IIWA 2HKRA 4A09B 2IURA 4J81A 4CY5A 4O3TB 5I5MA 5EMLB 2AGWA 1GP2B 5TDHB 1SHYB 5FKTA 1JOFA 3W15A 1ERJA 3SCYA 2H47A 2H6QA 4FB1D 2IUQA 3MZKA 2HESX 2GNQA 2P9KC 3RRMC 3EG6A 4A7JA 5H17A 3C99A 3JB9L 4ZOXA 4IMMA 1JJUB 2XU7A 3PSLA 2GC7A 3CFVA 2QXVA 3B7FA 3AL8A 3SWSD 4FAVD 2Z2PA 2PM9A 3ORVD 4JSVC 4A2LA 1XKSA 4OWRA 3AL8B 3V9FA 4CI8A 3I7OA 1XHMA 4L1QD 4ERZA 2PM9B 5IJ7E 5C2WB 3JRPA 5HE3B 4A0BA 3UR4A 2OK6A 4PBZA 3EI4A 4X3EA 4LGNA 3DM0A 1A0RB 3UVLA 4H5JA 4QQEA 4O1QD 3EI4B 3PE7A 2AGLA 5HE0B 4PXWA 1MDAH 5K19A 4D0KA 4CI2A 4Y7RA 2IAAA 4L9OA 2PBIB 3FGBA 2P9SC 3OKWA 5GSAA 2B5NA 4UI9R 4J82A 5TF2A 2UZYB 2CO0A 5K1CC 3I8CA 5C2VB 4PC0A 3UVOA 4FA4D 2Z2OA 3C5MA 5EALA 3RFGA 3L4OD 2H9PA 3ULEC 3U4YA 4XYHA 4GQ1A 2HJBA 2O9KA 1L0QA 4H5IA 3IJ1A 4HDJA 3DSMA 5FQDA 3AFCA 4ES0A 3C75H 4AEZA 3RN0D 2B4EA 2AGYA 5HE2B 4A0AA 4BL0A 5FLXg 1S4UX 3KRXB 2XL3A 2HXCA 2H3XA 2P9NC 4ZOZA 4CY2A 4CZVA 4A0AB 2HJ4A 2P9UC 1PBYB 4PBYA 4BUJC 5AJAA 4N14A 3MXXA 3CIKB 3GREA 4QT8A 3J81g 1N6EA 2Q7QA 2BCJB 3J80g 4ESGA 4X60B 5EMKB 5FA5B 4A11A 1RI6A 3IJCA 4CI1A 2H9LA 1GG2B 2AQ5A 5EAPA 4JXMA 4KFMB 4A11B 5I5IA 1N6FA 4FA5D 3SMRA 3MMYA 5FXYA 4BH6A 4GM3A 4MK0B 4QRJA 3RN1D 1TYQC 1U4CA 4GGAA 5IJ8E 4X63B 3OL2A 3JZGA 3N0DA 1SQ9A 4O3UB 3F3PA 3IIYA 1N6DA 4U7AA 5JWZA 1FWXA 1GXRA 3OL2B 4CZYA 2J56H 5GMKn 3P4FA 4GGCA 4K3JB 5TEEA 4L3HD 4Z8LA 1B9XA 5EMJB 5HQGA 2YNPA 3AH8B 2GC4A 3VH0A 3I7NA 3UKUC 5SXMA 4A0BB 3RMZD 5GXIA 1TBGA 5FKRA 5C9ZB 4FHLA 2B5LA 3HFQA 3BG1A 2H9NA 4GM9A 3EI2A 2H6KA 4J77A 4JSPC 4E54A 3SN6B 2I3SA 3EWEA 2YNOA 2HKMA 3NVQA 4A08A 3EI2B 4QL1A 2OVRB 4E54B 4D6VA 1PEVA 4E5ZA 2OVPB 5IT9g 4X61B 1K8KC 4A08B 3UVNA 5IGQA 1PGUA 4PSXB 1XIPA 3I7PA 4E5ZB 2CE8A 3NVXA 4A2MA 3SFZA 3OTTA 4I79A 2YNNA 2XL2A 4GM8A 4CY1A 1Q47A 2IUVA 4NSXA 4CY3A 3I7LA 3I89A 3C9CA 3CFSB 4G56B 3RSEC 4FWWA 3FRXA 3IKOA 3SBPA 2CE9A 4ERQA 4JT6C 2H68A 2CN3A 3BWSA 4LG8A 4U1EI 2OIZA 2HYEA 3NVNA 1QNIA 2IUPA 3VA6A 5IGOA 3PXSD 3RFHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CXB A;  3I7H A;  4CI3 A;  5AFU 3;  2MTA H;  3OW8 A;  3VGZ A;  5GXH A;  5CXB B;  3JPX A;  1SQJ A;  1VYH C;  3I8E A;  4J0X A;  3SXT D;  4ZOY A;  1GOT B;  4R7A B;  4ZOV A;  4GGD A;  4EWR A;  2TRC B;  3KRW B;  5H1M A;  1JMZ B;  3AL9 A;  3JZH A;  3EI1 A;  4XYI A;  4AOW A;  3V5W B;  3PVW B;  2G99 A;  1MG2 A;  1R5M A;  4J86 A;  2IWK A;  4JT5 C;  3EI1 B;  4CC9 A;  2IWF A;  1JMX B;  3PXW D;  5CXC A;  3SBR A;  4FA1 D;  5EMM B;  4J73 A;  1NEX B;  2OJY A;  5AMS A;  2H6N A;  2H14 A;  5CXC B;  3I7K A;  3PXT D;  5THA A;  2YMU A;  2AH0 A;  2EBS A;  3UKR C;  4JSX C;  2H9M A;  1PI6 A;  2YB8 B;  3SLE D;  3V7D B;  2G9A A;  3ODT A;  5FKQ A;  3MKS B;  3SBQ A;  3I2N A;  2P9P C;  3JRO A;  2I3T A;  3OKT A;  3F3G A;  2AGZ A;  2OVQ B;  2CNX A;  4Y5R D;  2OK4 A;  3FM0 A;  5HE1 B;  4J84 A;  3A0F A;  5HYN B;  1K32 A;  3SHF A;  3E0C A;  2CN2 A;  3K26 A;  2PM7 B;  5EAR A;  3UVM A;  4J79 A;  4CZX A;  1NR0 A;  3DXK C;  4O45 A;  4PSW B;  3JZN A;  4IA9 A;  3JAM g;  3SVW D;  4XEI C;  3MZL A;  1U2V C;  2AGX A;  3SJL D;  3ZWL B;  1B9Y A;  5H14 A;  4K3I D;  4GQ2 P;  4J87 A;  4PNK B;  4YVD A;  2J57 G;  2YBA A;  5A2Q g;  2J55 H;  2PM6 B;  3EU7 A;  4GZ8 A;  2W18 A;  2Z2N A;  3OKY A;  1P22 A;  4FA9 D;  4J78 A;  2XYI A;  3EI3 A;  5B4W A;  4O9D A;  3OKY B;  5CYK A;  2AH1 A;  2H13 A;  4L3G D;  3EI3 B;  2P9I C;  3PVU B;  5TEF A;  4J8B A;  4OZU A;  5IC7 A;  5CYK B;  5EM2 A;  3L4M D;  4J8G A;  3UVK A;  3BG0 A;  3MKQ A;  5I5J A;  1YFQ A;  4ERY A;  4GMB A;  4JD2 C;  5KDO B;  3GFC A;  4GQB B;  4J0W A;  4TZ4 A;  1OMW B;  3DXM C;  3F3F A;  1MG3 A;  3K27 A;  5EM2 B;  3N0E A;  3PSC B;  2P9L C;  4ZN4 A;  5FKS A;  2I0T A;  2B5M A;  1OLZ A;  3DWL C;  3RLM D;  4A09 A;  2CO0 C;  2I0R A;  3EMH A;  2QC5 A;  2I0S A;  3IJ0 A;  2UZX B;  2BBK H;  4JSN C;  4LG9 A;  4FAN D;  5EAM A;  3IIW A;  2HKR A;  4A09 B;  2IUR A;  4J81 A;  4CY5 A;  4O3T B;  5I5M A;  5EML B;  2AGW A;  1GP2 B;  5TDH B;  1SHY B;  5FKT A;  1JOF A;  3W15 A;  1ERJ A;  3SCY A;  2H47 A;  2H6Q A;  4FB1 D;  2IUQ A;  3MZK A;  2HES X;  2GNQ A;  2P9K C;  3RRM C;  3EG6 A;  4A7J A;  5H17 A;  3C99 A;  3JB9 L;  4ZOX A;  4IMM A;  1JJU B;  2XU7 A;  3PSL A;  2GC7 A;  3CFV A;  2QXV A;  3B7F A;  3AL8 A;  3SWS D;  4FAV D;  2Z2P A;  2PM9 A;  3ORV D;  4JSV C;  4A2L A;  1XKS A;  4OWR A;  3AL8 B;  3V9F A;  4CI8 A;  3I7O A;  1XHM A;  4L1Q D;  4ERZ A;  2PM9 B;  5IJ7 E;  5C2W B;  3JRP A;  5HE3 B;  4A0B A;  3UR4 A;  2OK6 A;  4PBZ A;  3EI4 A;  4X3E A;  4LGN A;  3DM0 A;  1A0R B;  3UVL A;  4H5J A;  4QQE A;  4O1Q D;  3EI4 B;  3PE7 A;  2AGL A;  5HE0 B;  4PXW A;  1MDA H;  5K19 A;  4D0K A;  4CI2 A;  4Y7R A;  2IAA A;  4L9O A;  2PBI B;  3FGB A;  2P9S C;  3OKW A;  5GSA A;  2B5N A;  4UI9 R;  4J82 A;  5TF2 A;  2UZY B;  2CO0 A;  5K1C C;  3I8C A;  5C2V B;  4PC0 A;  3UVO A;  4FA4 D;  2Z2O A;  3C5M A;  5EAL A;  3RFG A;  3L4O D;  2H9P A;  3ULE C;  3U4Y A;  4XYH A;  4GQ1 A;  2HJB A;  2O9K A;  1L0Q A;  4H5I A;  3IJ1 A;  4HDJ A;  3DSM A;  5FQD A;  3AFC A;  4ES0 A;  3C75 H;  4AEZ A;  3RN0 D;  2B4E A;  2AGY A;  5HE2 B;  4A0A A;  4BL0 A;  5FLX g;  1S4U X;  3KRX B;  2XL3 A;  2HXC A;  2H3X A;  2P9N C;  4ZOZ A;  4CY2 A;  4CZV A;  4A0A B;  2HJ4 A;  2P9U C;  1PBY B;  4PBY A;  4BUJ C;  5AJA A;  4N14 A;  3MXX A;  3CIK B;  3GRE A;  4QT8 A;  3J81 g;  1N6E A;  2Q7Q A;  2BCJ B;  3J80 g;  4ESG A;  4X60 B;  5EMK B;  5FA5 B;  4A11 A;  1RI6 A;  3IJC A;  4CI1 A;  2H9L A;  1GG2 B;  2AQ5 A;  5EAP A;  4JXM A;  4KFM B;  4A11 B;  5I5I A;  1N6F A;  4FA5 D;  3SMR A;  3MMY A;  5FXY A;  4BH6 A;  4GM3 A;  4MK0 B;  4QRJ A;  3RN1 D;  1TYQ C;  1U4C A;  4GGA A;  5IJ8 E;  4X63 B;  3OL2 A;  3JZG A;  3N0D A;  1SQ9 A;  4O3U B;  3F3P A;  3IIY A;  1N6D A;  4U7A A;  5JWZ A;  1FWX A;  1GXR A;  3OL2 B;  4CZY A;  2J56 H;  5GMK n;  3P4F A;  4GGC A;  4K3J B;  5TEE A;  4L3H D;  4Z8L A;  1B9X A;  5EMJ B;  5HQG A;  2YNP A;  3AH8 B;  2GC4 A;  3VH0 A;  3I7N A;  3UKU C;  5SXM A;  4A0B B;  3RMZ D;  5GXI A;  1TBG A;  5FKR A;  5C9Z B;  4FHL A;  2B5L A;  3HFQ A;  3BG1 A;  2H9N A;  4GM9 A;  3EI2 A;  2H6K A;  4J77 A;  4JSP C;  4E54 A;  3SN6 B;  2I3S A;  3EWE A;  2YNO A;  2HKM A;  3NVQ A;  4A08 A;  3EI2 B;  4QL1 A;  2OVR B;  4E54 B;  4D6V A;  1PEV A;  4E5Z A;  2OVP B;  5IT9 g;  4X61 B;  1K8K C;  4A08 B;  3UVN A;  5IGQ A;  1PGU A;  4PSX B;  1XIP A;  3I7P A;  4E5Z B;  2CE8 A;  3NVX A;  4A2M A;  3SFZ A;  3OTT A;  4I79 A;  2YNN A;  2XL2 A;  4GM8 A;  4CY1 A;  1Q47 A;  2IUV A;  4NSX A;  4CY3 A;  3I7L A;  3I89 A;  3C9C A;  3CFS B;  4G56 B;  3RSE C;  4FWW A;  3FRX A;  3IKO A;  3SBP A;  2CE9 A;  4ERQ A;  4JT6 C;  2H68 A;  2CN3 A;  3BWS A;  4LG8 A;  4U1E I;  2OIZ A;  2HYE A;  3NVN A;  1QNI A;  2IUP A;  3VA6 A;  5IGO A;  3PXS D;  3RFH A; 
#chains in the Genus database with same CATH topology
 4G55 A;  5HDB A;  2VDR A;  1H2Z A;  5CXB A;  5M5R A;  1JTD B;  3I7H A;  3O4J A;  4CI3 A;  5AFU 3;  2VDM A;  2MTA H;  3OW8 A;  1UTC A;  3VGZ A;  5GXH A;  1GOG A;  5CXB B;  3JPX A;  1SQJ A;  1VYH C;  4DNV A;  2EID A;  3I8E A;  4J0X A;  3SXT D;  3VI3 A;  2JKX A;  1U8C A;  2XDW A;  4ZOY A;  3FCU A;  4Z7O A;  1GOT B;  4R7A B;  4ZOV A;  2EIB A;  4GGD A;  4EWR A;  2TRC B;  3KRW B;  5H1M A;  4BCD A;  1JMZ B;  3AL9 A;  4DNW A;  3JZH A;  3EI1 A;  4XYI A;  4AOW A;  1H2Y A;  3V5W B;  3PVW B;  2G99 A;  1MG2 A;  3ZDX A;  1R5M A;  1VE7 A;  4J86 A;  3NIG A;  1GOH A;  2IWK A;  4JT5 C;  3EI1 B;  4CC9 A;  2IWF A;  1JMX B;  3PXW D;  3IUJ A;  5CXC A;  3IUN A;  4O2W A;  2BKL A;  3SBR A;  4D9S A;  4FA1 D;  5EMM B;  4J73 A;  1NEX B;  2OJY A;  5AMS A;  2H6N A;  2H14 A;  2WQ8 A;  1BPO A;  5CXC B;  3I7K A;  3PXT D;  3ZE2 A;  5THA A;  2YMU A;  2AH0 A;  2EBS A;  3EQ8 A;  3UKR C;  4JSX C;  2H9M A;  1PI6 A;  2YB8 B;  1JV2 A;  3SLE D;  5C86 A;  3MUN A;  3V7D B;  2G9A A;  3ODT A;  5FKQ A;  3MKS B;  3SBQ A;  3I2N A;  3K72 A;  2P9P C;  3JRO A;  2I3T A;  3OKT A;  3F3G A;  2AGZ A;  2OVQ B;  1T2X A;  2QR5 A;  2CNX A;  4O02 A;  4Y5R D;  2OK4 A;  3FM0 A;  5HE1 B;  4J84 A;  3A0F A;  5HYN B;  1K32 A;  3SHF A;  3E0C A;  3FCS A;  2CN2 A;  3K26 A;  2PM7 B;  5EAR A;  3UVM A;  2XE4 A;  4J79 A;  4CZX A;  1NR0 A;  3DXK C;  4O45 A;  4PSW B;  3JZN A;  3KCI A;  4IA9 A;  4UM9 A;  3JAM g;  3SVW D;  4XEI C;  3MZL A;  1U2V C;  3O4I A;  2AGX A;  3SJL D;  3ZWL B;  1B9Y A;  5H14 A;  4K3I D;  4GQ2 P;  4BCC A;  4NC4 A;  4JHP C;  4G1E A;  4J87 A;  2HU8 A;  4PNK B;  4YVD A;  2J57 G;  3DDU A;  2YBA A;  5A2Q g;  2J55 H;  2PM6 B;  3EU7 A;  4GZ8 A;  2W18 A;  2Z2N A;  3OKY A;  3QI0 A;  1P22 A;  4FA9 D;  4J78 A;  3K71 A;  2XYI A;  3EI3 A;  4BP8 A;  5B4W A;  5M61 A;  4O9D A;  4NAA A;  3OKY B;  5CYK A;  2AH1 A;  1QFM A;  2H13 A;  4QAM A;  4AN0 A;  4L3G D;  3EI3 B;  2P9I C;  3PVU B;  5TEF A;  4WK4 A;  4J8B A;  4OZU A;  5IC7 A;  5CYK B;  5EM2 A;  3L4M D;  3OF7 A;  4J8G A;  3UVK A;  3BG0 A;  3MKQ A;  5I5J A;  1YFQ A;  4ERY A;  4GMB A;  4JD2 C;  5KDO B;  3GFC A;  4UM8 A;  1L5G A;  4GQB B;  4J0W A;  4TZ4 A;  1OMW B;  3DXM C;  3F3F A;  1MG3 A;  3K27 A;  5EM2 B;  3N0E A;  3PSC B;  4L1M A;  2P9L C;  4ZN4 A;  5FKS A;  2I0T A;  2B5M A;  1E5T A;  1OLZ A;  3DWL C;  3RLM D;  3K6S A;  4A09 A;  5M5T A;  2CO0 C;  2I0R A;  3EMH A;  2QC5 A;  2I0S A;  1O6F A;  3IJ0 A;  2UZX B;  3V4V A;  2BBK H;  5M5S A;  4JSN C;  4LG9 A;  4FAN D;  2VZ1 A;  5EAM A;  3IIW A;  2HKR A;  4A09 B;  2IUR A;  4J81 A;  1E8N A;  4O3T B;  4CY5 A;  5I5M A;  5EML B;  2AGW A;  1GP2 B;  5TDH B;  1SHY B;  5FKT A;  1JOF A;  4MMY A;  3W15 A;  3IUR A;  1ERJ A;  3EQ9 A;  3SCY A;  2H47 A;  2H6Q A;  4FB1 D;  2IUQ A;  3MZK A;  1UOP A;  2HES X;  4JHN A;  2GNQ A;  2P9K C;  3RRM C;  4NEN A;  3IUQ A;  3EG6 A;  4A7J A;  5H17 A;  3C99 A;  3JB9 L;  4ZOX A;  4IMM A;  1JJU B;  2XU7 A;  3PSL A;  2GC7 A;  3CFV A;  2QXV A;  3B7F A;  3AL8 A;  3SWS D;  4FAV D;  3MUO A;  2Z2P A;  2PM9 A;  3ORV D;  4JSV C;  4A2L A;  4AN1 A;  1XKS A;  2VC2 A;  4OWR A;  3AL8 B;  3V9F A;  4CI8 A;  3I7O A;  1H2W A;  1XHM A;  2VZ3 A;  4L1Q D;  2PM9 B;  4ERZ A;  5IJ7 E;  5C2W B;  1VE6 A;  3JRP A;  5HE3 B;  4A0B A;  3UR4 A;  2OK6 A;  4PBZ A;  3EI4 A;  4RE5 A;  4X3E A;  3IVM A;  4LGN A;  3DM0 A;  1A0R B;  3NIF A;  3UVL A;  3GC3 B;  4H5J A;  4QQE A;  4O1Q D;  3EI4 B;  3PE7 A;  2AGL A;  5HE0 B;  4PXW A;  1K3I A;  1MDA H;  5K19 A;  4D0K A;  4CI2 A;  4Y7R A;  1UOO A;  2IAA A;  4L9O A;  2PBI B;  3FGB A;  2P9S C;  3OKW A;  4WK0 A;  3T3P A;  2B5N A;  1UOQ A;  4UI9 R;  5GSA A;  3V4P A;  4J82 A;  4RE6 A;  5TF2 A;  1C9I A;  2UZY B;  5M5V A;  2CO0 A;  5K1C C;  3I8C A;  5C2V B;  4PC0 A;  3UVO A;  4FA4 D;  3MVD K;  2Z2O A;  3C5M A;  5EAL A;  3RFG A;  3L4O D;  2H9P A;  3ULE C;  3U4Y A;  4WK2 A;  4XYH A;  4GQ1 A;  2HJB A;  1H2X A;  2O9K A;  5E6U A;  5E6S A;  3ZE0 A;  1L0Q A;  4H5I A;  3IJ1 A;  3QHY B;  4HDJ A;  3DSM A;  5FQD A;  4DNU A;  3AFC A;  2HU5 A;  1VZ2 A;  1QFS A;  4ES0 A;  3C75 H;  4AEZ A;  3RN0 D;  3ZDY A;  4Z7N A;  2B4E A;  3GD1 I;  2AGY A;  1E8M A;  5HE2 B;  4BP9 A;  4A0A A;  1C9L A;  4BL0 A;  5FLX g;  1S4U X;  3KRX B;  2XL3 A;  2HXC A;  2H3X A;  2P9N C;  4ZOZ A;  4CY2 A;  4CZV A;  4A0A B;  2HJ4 A;  2P9U C;  2QZP A;  3NID A;  1O6G A;  1PBY B;  4AMY A;  4PBY A;  4BUJ C;  5AJA A;  2VDO A;  4N14 A;  3MXX A;  3CIK B;  3GRE A;  4QT8 A;  3J81 g;  1N6E A;  2Q7Q A;  2VDK A;  2BCJ B;  4NBM A;  1TYE A;  4MMX A;  3J80 g;  4ESG A;  4X60 B;  5EMK B;  5FA5 B;  4A11 A;  1RI6 A;  3ZE1 A;  3IJC A;  4CI1 A;  2H9L A;  1GG2 B;  2AQ5 A;  5EAP A;  4JXM A;  4KFM B;  4A11 B;  5I5I A;  1N6F A;  2HU7 A;  4FA5 D;  3SMR A;  3MMY A;  5FXY A;  4BH6 A;  4GM3 A;  4MK0 B;  4QRJ A;  3RN1 D;  1TYQ C;  1U4C A;  4GGA A;  1M1X A;  2EIE A;  5IJ8 E;  4X63 B;  3OL2 A;  3JZG A;  3N0D A;  1SQ9 A;  4O3U B;  3F3P A;  4AX4 A;  3IIY A;  1N6D A;  3EQ7 A;  4U7A A;  5JWZ A;  1FWX A;  1GXR A;  3OL2 B;  4CZY A;  4WJK A;  3ZDZ A;  2J56 H;  5GMK n;  2XZG A;  3P4F A;  4GGC A;  4IRZ A;  2EIC A;  4K3J B;  2VDQ A;  4L3H D;  5TEE A;  3IJE A;  1A12 A;  4Z8L A;  1B9X A;  5EMJ B;  5HQG A;  2YNP A;  3AH8 B;  2GC4 A;  3VH0 A;  3I7N A;  3UKU C;  5C92 A;  5SXM A;  4A0B B;  3RMZ D;  1GOF A;  5GXI A;  3VI4 A;  1TBG A;  5FKR A;  5C9Z B;  4FHL A;  2B5L A;  3HFQ A;  4G1M A;  3BG1 A;  3O4H A;  2H9N A;  4GM9 A;  3EI2 A;  4Z7Q A;  2H6K A;  4J77 A;  4JSP C;  4E54 A;  3SN6 B;  2I3S A;  3EWE A;  2YNO A;  2HKM A;  3NVQ A;  4A08 A;  3EI2 B;  3T3M A;  4QL1 A;  2OVR B;  4E54 B;  4D6V A;  1PEV A;  4E5Z A;  2OVP B;  5IT9 g;  4X61 B;  1K8K C;  5M5U A;  4A08 B;  1I2M B;  3UVN A;  5IGQ A;  3IUM A;  1PGU A;  4PSX B;  1XIP A;  3O4G A;  3I7P A;  4E5Z B;  4AMZ A;  2CE8 A;  3NVX A;  4A2M A;  3SFZ A;  2VDP A;  3OTT A;  4I79 A;  2YNN A;  5E6R A;  2XL2 A;  1VZ3 A;  2VDL A;  4GM8 A;  2VDN A;  5FFG A;  3IUL A;  4CY1 A;  1Q47 A;  2IUV A;  4NSX A;  4CY3 A;  3I7L A;  3I89 A;  3C9C A;  3CFS B;  4G56 B;  3RSE C;  4FWW A;  3FRX A;  3IKO A;  3SBP A;  2CE9 A;  4ERQ A;  4JT6 C;  2H68 A;  2CN3 A;  4BCB A;  3BWS A;  4LG8 A;  4U1E I;  2OIZ A;  4MMZ A;  3NVN A;  2HYE A;  1QNI A;  2IUP A;  3VA6 A;  5IGO A;  5FFO A;  3PXS D;  1YR2 A;  3RFH A; 
#chains in the Genus database with same CATH homology
 5CXB A;  3I7H A;  4CI3 A;  5AFU 3;  2MTA H;  3OW8 A;  3VGZ A;  5GXH A;  5CXB B;  3JPX A;  1SQJ A;  1VYH C;  3I8E A;  4J0X A;  3SXT D;  4ZOY A;  1GOT B;  4R7A B;  4ZOV A;  4GGD A;  4EWR A;  2TRC B;  3KRW B;  5H1M A;  1JMZ B;  3AL9 A;  3JZH A;  3EI1 A;  4XYI A;  4AOW A;  3V5W B;  3PVW B;  2G99 A;  1MG2 A;  1R5M A;  4J86 A;  2IWK A;  4JT5 C;  3EI1 B;  4CC9 A;  2IWF A;  1JMX B;  3PXW D;  5CXC A;  3SBR A;  4FA1 D;  5EMM B;  4J73 A;  1NEX B;  2OJY A;  5AMS A;  2H6N A;  2H14 A;  5CXC B;  3I7K A;  3PXT D;  5THA A;  2YMU A;  2AH0 A;  2EBS A;  3UKR C;  4JSX C;  2H9M A;  1PI6 A;  2YB8 B;  3SLE D;  3V7D B;  2G9A A;  3ODT A;  5FKQ A;  3MKS B;  3SBQ A;  3I2N A;  2P9P C;  3JRO A;  2I3T A;  3OKT A;  3F3G A;  2AGZ A;  2OVQ B;  2CNX A;  4Y5R D;  2OK4 A;  3FM0 A;  5HE1 B;  4J84 A;  3A0F A;  5HYN B;  1K32 A;  3SHF A;  3E0C A;  2CN2 A;  3K26 A;  2PM7 B;  5EAR A;  3UVM A;  4J79 A;  4CZX A;  1NR0 A;  3DXK C;  4O45 A;  4PSW B;  3JZN A;  4IA9 A;  3JAM g;  3SVW D;  4XEI C;  3MZL A;  1U2V C;  2AGX A;  3SJL D;  3ZWL B;  1B9Y A;  5H14 A;  4K3I D;  4GQ2 P;  4J87 A;  4PNK B;  4YVD A;  2J57 G;  2YBA A;  5A2Q g;  2J55 H;  2PM6 B;  3EU7 A;  4GZ8 A;  2W18 A;  2Z2N A;  3OKY A;  1P22 A;  4FA9 D;  4J78 A;  2XYI A;  3EI3 A;  5B4W A;  4O9D A;  3OKY B;  5CYK A;  2AH1 A;  2H13 A;  4L3G D;  3EI3 B;  2P9I C;  3PVU B;  5TEF A;  4J8B A;  4OZU A;  5IC7 A;  5CYK B;  5EM2 A;  3L4M D;  4J8G A;  3UVK A;  3BG0 A;  3MKQ A;  5I5J A;  1YFQ A;  4ERY A;  4GMB A;  4JD2 C;  5KDO B;  3GFC A;  4GQB B;  4J0W A;  4TZ4 A;  1OMW B;  3DXM C;  3F3F A;  1MG3 A;  3K27 A;  5EM2 B;  3N0E A;  3PSC B;  2P9L C;  4ZN4 A;  5FKS A;  2I0T A;  2B5M A;  1OLZ A;  3DWL C;  3RLM D;  4A09 A;  2CO0 C;  2I0R A;  3EMH A;  2QC5 A;  2I0S A;  3IJ0 A;  2UZX B;  2BBK H;  4JSN C;  4LG9 A;  4FAN D;  5EAM A;  3IIW A;  2HKR A;  4A09 B;  2IUR A;  4J81 A;  4CY5 A;  4O3T B;  5I5M A;  5EML B;  2AGW A;  1GP2 B;  5TDH B;  1SHY B;  5FKT A;  1JOF A;  3W15 A;  1ERJ A;  3SCY A;  2H47 A;  2H6Q A;  4FB1 D;  2IUQ A;  3MZK A;  2HES X;  2GNQ A;  2P9K C;  3RRM C;  3EG6 A;  4A7J A;  5H17 A;  3C99 A;  3JB9 L;  4ZOX A;  4IMM A;  1JJU B;  2XU7 A;  3PSL A;  2GC7 A;  3CFV A;  2QXV A;  3B7F A;  3AL8 A;  3SWS D;  4FAV D;  2Z2P A;  2PM9 A;  3ORV D;  4JSV C;  4A2L A;  1XKS A;  4OWR A;  3AL8 B;  3V9F A;  4CI8 A;  3I7O A;  1XHM A;  4L1Q D;  4ERZ A;  2PM9 B;  5IJ7 E;  5C2W B;  3JRP A;  5HE3 B;  4A0B A;  3UR4 A;  2OK6 A;  4PBZ A;  3EI4 A;  4X3E A;  4LGN A;  3DM0 A;  1A0R B;  3UVL A;  4H5J A;  4QQE A;  4O1Q D;  3EI4 B;  3PE7 A;  2AGL A;  5HE0 B;  4PXW A;  1MDA H;  5K19 A;  4D0K A;  4CI2 A;  4Y7R A;  2IAA A;  4L9O A;  2PBI B;  3FGB A;  2P9S C;  3OKW A;  5GSA A;  2B5N A;  4UI9 R;  4J82 A;  5TF2 A;  2UZY B;  2CO0 A;  5K1C C;  3I8C A;  5C2V B;  4PC0 A;  3UVO A;  4FA4 D;  2Z2O A;  3C5M A;  5EAL A;  3RFG A;  3L4O D;  2H9P A;  3ULE C;  3U4Y A;  4XYH A;  4GQ1 A;  2HJB A;  2O9K A;  1L0Q A;  4H5I A;  3IJ1 A;  4HDJ A;  3DSM A;  5FQD A;  3AFC A;  4ES0 A;  3C75 H;  4AEZ A;  3RN0 D;  2B4E A;  2AGY A;  5HE2 B;  4A0A A;  4BL0 A;  5FLX g;  1S4U X;  3KRX B;  2XL3 A;  2HXC A;  2H3X A;  2P9N C;  4ZOZ A;  4CY2 A;  4CZV A;  4A0A B;  2HJ4 A;  2P9U C;  1PBY B;  4PBY A;  4BUJ C;  5AJA A;  4N14 A;  3MXX A;  3CIK B;  3GRE A;  4QT8 A;  3J81 g;  1N6E A;  2Q7Q A;  2BCJ B;  3J80 g;  4ESG A;  4X60 B;  5EMK B;  5FA5 B;  4A11 A;  1RI6 A;  3IJC A;  4CI1 A;  2H9L A;  1GG2 B;  2AQ5 A;  5EAP A;  4JXM A;  4KFM B;  4A11 B;  5I5I A;  1N6F A;  4FA5 D;  3SMR A;  3MMY A;  5FXY A;  4BH6 A;  4GM3 A;  4MK0 B;  4QRJ A;  3RN1 D;  1TYQ C;  1U4C A;  4GGA A;  5IJ8 E;  4X63 B;  3OL2 A;  3JZG A;  3N0D A;  1SQ9 A;  4O3U B;  3F3P A;  3IIY A;  1N6D A;  4U7A A;  5JWZ A;  1FWX A;  1GXR A;  3OL2 B;  4CZY A;  2J56 H;  5GMK n;  3P4F A;  4GGC A;  4K3J B;  5TEE A;  4L3H D;  4Z8L A;  1B9X A;  5EMJ B;  5HQG A;  2YNP A;  3AH8 B;  2GC4 A;  3VH0 A;  3I7N A;  3UKU C;  5SXM A;  4A0B B;  3RMZ D;  5GXI A;  1TBG A;  5FKR A;  5C9Z B;  4FHL A;  2B5L A;  3HFQ A;  3BG1 A;  2H9N A;  4GM9 A;  3EI2 A;  2H6K A;  4J77 A;  4JSP C;  4E54 A;  3SN6 B;  2I3S A;  3EWE A;  2YNO A;  2HKM A;  3NVQ A;  4A08 A;  3EI2 B;  4QL1 A;  2OVR B;  4E54 B;  4D6V A;  1PEV A;  4E5Z A;  2OVP B;  5IT9 g;  4X61 B;  1K8K C;  4A08 B;  3UVN A;  5IGQ A;  1PGU A;  4PSX B;  1XIP A;  3I7P A;  4E5Z B;  2CE8 A;  3NVX A;  4A2M A;  3SFZ A;  3OTT A;  4I79 A;  2YNN A;  2XL2 A;  4GM8 A;  4CY1 A;  1Q47 A;  2IUV A;  4NSX A;  4CY3 A;  3I7L A;  3I89 A;  3C9C A;  3CFS B;  4G56 B;  3RSE C;  4FWW A;  3FRX A;  3IKO A;  3SBP A;  2CE9 A;  4ERQ A;  4JT6 C;  2H68 A;  2CN3 A;  3BWS A;  4LG8 A;  4U1E I;  2OIZ A;  2HYE A;  3NVN A;  1QNI A;  2IUP A;  3VA6 A;  5IGO A;  3PXS D;  3RFH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...