3UVNA

Crystal structure of wdr5 in complex with the wdr5-interacting motif of set1a
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
304
structure length
304
Chain Sequence
VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords WD repeat-containing protein 5
publication title The plasticity of WDR5 peptide-binding cleft enables the binding of the SET1 family of histone methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
total genus 100
structure length 304
sequence length 304
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3uvnA00
2I0SA 3JZGA 1B9XA 3C99A 4J0XA 5HYNB 4CZVA 3SN6B 2YNPA 3A0FA 4FA9D 3SXTD 3UVOA 3PSLA 5CXCA 3V5WB 2H6KA 2H9PA 3F3PA 3EU7A 2HKMA 3I7PA 2H14A 5EMLB 3MXXA 2Z2PA 3SVWD 1NR0A 2HJBA 2YB8B 2BBKH 4A0AB 5IJ8E 2HJ4A 2OK4A 3PVWB 2IAAA 3N0DA 4CY5A 3GFCA 4YVDA 5EAMA 2B5MA 3B7FA 3UKRC 3AL8B 4D0KA 5I5MA 2PBIB 3NVQA 3AL9A 3E0CA 2CN3A 3OTTA 2PM9B 1B9YA 1OLZA 2Q7QA 1YFQA 2J55H 4CY3A 4A7JA 4FAVD 1TBGA 1VYHC 3K27A 5EALA 4L3GD 5FKSA 3RFGA 4JSPC 5AMSA 2XL3A 3DXMC 2GNQA 2H9MA 3I7KA 2HKRA 2I3TA 3I7HA 2CNXA 4OWRA 2H47A 5B4WA 4PSWB 4ZOVA 3OKTA 3UVNA 4PC0A 3EWEA 3DXKC 4LG8A 3DSMA 4H5JA 5TEFA 3U4YA 2AH1A 3V9FA 2YMUA 2B5NA 1N6DA 5GSAA 3EMHA 4CI1A 4FB1D 5GXIA 2XYIA 2AGLA 4L1QD 2OVQB 5JWZA 2PM6B 2H6NA 3UKUC 3RSEC 2CO0C 4J77A 3OL2B 4X60B 4XYIA 5HQGA 4GMBA 3RFHA 3RLMD 4QQEA 4CY1A 3KRWB 4A11A 4I79A 3VGZA 3DWLC 4LGNA 3I8EA 2IUVA 5C9ZB 5C2VB 3I7LA 2YBAA 3SLED 2H3XA 4CY2A 3SFZA 5GMKn 4H5IA 1L0QA 4J86A 5EMJB 3UVKA 3FM0A 5HE3B 1XKSA 2J56H 3ZWLB 4ERYA 5TEEA 4GM8A 3MKSB 4ERQA 2AGXA 3I8CA 3ORVD 1P22A 4L3HD 5FLXg 2OVPB 1GOTB 1MDAH 4J79A 5C2WB 5IJ7E 4PBZA 1PI6A 3I2NA 4GGAA 2J57G 3PXSD 3SBQA 5FKRA 2H13A 2IURA 2Z2OA 3BG1A 5HE2B 3PSCB 4IMMA 4A11B 2OVRB 3HFQA 3C9CA 3I7OA 2CO0A 4Y7RA 4J78A 4GM3A 2B4EA 3IJ1A 3C75H 3SWSD 1N6FA 3J80g 2Z2NA 3JPXA 3UR4A 2QXVA 2YNOA 3I89A 4J81A 4LG9A 4OZUA 3PE7A 3N0EA 3EI1B 2IWFA 3MKQA 4J0WA 4XYHA 3CIKB 3VA6A 2OIZA 4N14A 1Q47A 4PXWA 3OL2A 3I7NA 4QL1A 3GREA 3CFSB 5FKTA 4PBYA 3DM0A 4ZOYA 4U7AA 2G99A 5H14A 4GGCA 3SBRA 4G56B 5H1MA 5IGOA 2CE8A 3JB9L 2AQ5A 4JSVC 4ZOXA 4A2MA 5IGQA 2P9NC 5EARA 4Y5RD 5SXMA 4O1QD 3CFVA 3F3GA 3EG6A 4ES0A 4GQ1A 4IA9A 5H17A 4O3TB 2H68A 4A09A 2I0RA 2UZXB 5IT9g 4JSXC 4XEIC 4CI8A 4JT6C 4JSNC 3PVUB 5CXBB 2GC7A 4R7AB 5EMMB 2XL2A 1S4UX 1XIPA 3OKYB 2AGZA 2P9KC 5EAPA 3JROA 3MMYA 2EBSA 4QT8A 2CN2A 1NEXB 4PNKB 2B5LA 5EMKB 2HXCA 4K3ID 4ZOZA 5THAA 2HESX 3K26A 4MK0B 3V7DB 4GZ8A 4U1EI 3MZLA 2O9KA 4JD2C 1SQJA 4A0BA 4GQ2P 3EI1A 1A0RB 3VH0A 4PSXB 1K32A 4FWWA 1PGUA 2AH0A 4A09B 2P9LC 4J8GA 3J81g 3F3FA 4Z8LA 4BUJC 1ERJA 3BG0A 2CE9A 2H9NA 2QC5A 5CYKA 4E54B 1K8KC 3JZNA 1SHYB 3JRPA 4J73A 5K19A 4GGDA 1N6EA 2OJYA 2H9LA 4O9DA 5KDOB 3IIYA 3RN1D 4K3JB 4O45A 3UVLA 1GG2B 2PM7B 4J84A 5I5JA 3OW8A 4X63B 4A08A 2HYEA 5TDHB 4FHLA 2P9UC 4HDJA 2YNNA 4A0BB 3L4OD 4O3UB 4ERZA 3KRXB 1U4CA 3EI2B 5CXBA 3ULEC 1JMZB 3W15A 3EI4B 4CZXA 4J8BA 3P4FA 1JOFA 4FA1D 3OKYA 4GM9A 2H6QA 5EM2A 5CYKB 3SMRA 2P9SC 5TF2A 1PEVA 3MZKA 2IUQA 1GP2B 4CC9A 3IJ0A 4CZYA 3FRXA 3EI3A 4L9OA 3OKWA 5FQDA 4E5ZA 5HE0B 4ESGA 2TRCB 5HE1B 3NVNA 3IJCA 4FA5D 2I3SA 3SHFA 2G9AA 4ZN4A 3JAMg 2XU7A 4X3EA 4CI3A 1JJUB 4JT5C 3UVMA 4GQBB 4D6VA 5CXCB 4A08B 1OMWB 3IKOA 4AOWA 2MTAH 1GXRA 3RN0D 3IIWA 4CI2A 4BH6A 1QNIA 4TZ4A 4X61B 4A2LA 5A2Qg 5I5IA 4E54A 2OK6A 4J87A 2IWKA 5FKQA 4BL0A 5EM2B 1SQ9A 3JZHA 3AH8B 3PXTD 3NVXA 2GC4A 1U2VC 5K1CC 1FWXA 3EI3B 4KFMB 4E5ZB 2BCJB 2I0TA 3SBPA 2AGYA 1PBYB 3AFCA 2AGWA 4NSXA 4AEZA 1TYQC 5AFU3 5AJAA 3C5MA 5FA5B 2IUPA 4FA4D 3RRMC 2P9IC 4UI9R 2UZYB 1JMXB 4A0AA 3EI2A 4JXMA 3FGBA 1XHMA 3PXWD 3EI4A 3L4MD 3BWSA 1MG2A 5FXYA 3AL8A 4FAND 5IC7A 3RMZD 2P9PC 3SCYA 2PM9A 4EWRA 3SJLD 4QRJA 5GXHA 1MG3A 1R5MA 3ODTA 2W18A 4J82A 1RI6A
chains in the Genus database with same CATH superfamily
2I0SA 3JZGA 1B9XA 3C99A 2EICA 4J0XA 3ZE2A 3O4JA 5HYNB 4CZVA 2BKLA 3NIGA 3SN6B 2YNPA 3A0FA 4FA9D 1O6GA 3FCSA 5M5SA 3SXTD 3UVOA 4IRZA 3PSLA 5CXCA 3V5WB 3K6SA 2H6KA 2H9PA 3F3PA 3EU7A 2HKMA 3ZDZA 3I7PA 2H14A 5EMLB 3MXXA 2Z2PA 3SVWD 2VDNA 2WQ8A 1NR0A 2HJBA 2YB8B 2BBKH 4A0AB 5IJ8E 2HJ4A 2OK4A 3PVWB 2IAAA 3N0DA 4CY5A 4UM8A 2QZPA 3GFCA 5HDBA 4YVDA 5EAMA 2B5MA 3B7FA 3UKRC 3EQ9A 3AL8B 4D0KA 5I5MA 2PBIB 4L1MA 3NVQA 3AL9A 3E0CA 3O4IA 4Z7OA 2CN3A 3OTTA 2PM9B 1B9YA 1OLZA 2Q7QA 1YFQA 2J55H 4CY3A 4A7JA 4FAVD 1C9LA 1TBGA 1VYHC 3K27A 5EALA 4L3GD 5FKSA 3RFGA 4JSPC 2EIEA 5AMSA 2XL3A 3DXMC 2GNQA 2H9MA 4O2WA 3I7KA 2HKRA 2I3TA 3I7HA 3IULA 3ZE0A 2CNXA 3EQ7A 4OWRA 2H47A 5B4WA 4PSWB 4ZOVA 3OKTA 3UVNA 3IUQA 4PC0A 3EWEA 3DXKC 3IUJA 5FFOA 4NBMA 4LG8A 1K3IA 3DSMA 4H5JA 5TEFA 3U4YA 2AH1A 3V9FA 4BCBA 2YMUA 2B5NA 5M5TA 1JV2A 1N6DA 3O4HA 5M61A 3IURA 5GSAA 3EMHA 1I2MB 4FB1D 4CI1A 5GXIA 2XYIA 2AGLA 1A12A 4L1QD 4WK2A 3O4GA 2OVQB 3EQ8A 5JWZA 2PM6B 2H6NA 3UKUC 1UOOA 3RSEC 2CO0C 4J77A 3OL2B 4X60B 4QAMA 4RE5A 4XYIA 5HQGA 4GMBA 3RFHA 3RLMD 4QQEA 4CY1A 3KRWB 4A11A 4I79A 3VGZA 3DWLC 4LGNA 3I8EA 2IUVA 5C9ZB 5C2VB 4WK0A 3I7LA 3K72A 2YBAA 1GOGA 3SLED 4Z7NA 1E8NA 2H3XA 4CY2A 3SFZA 5GMKn 4H5IA 1L0QA 4J86A 5EMJB 1E8MA 2VDMA 3UVKA 3FM0A 5HE3B 1XKSA 2J56H 3ZWLB 4ERYA 5TEEA 4GM8A 3MKSB 4ERQA 4AN0A 2AGXA 1L5GA 3I8CA 3ORVD 3IUNA 1P22A 4L3HD 5FLXg 2OVPB 1GOTB 1MDAH 3VI3A 4J79A 5C2WB 5IJ7E 4PBZA 1PI6A 3I2NA 4GGAA 3QI0A 1UOPA 4MMZA 2J57G 3PXSD 2VC2A 3SBQA 5FKRA 2H13A 2IURA 1H2XA 2Z2OA 1GOFA 4BP8A 3BG1A 1O6FA 5E6SA 5HE2B 3KCIA 3PSCB 4IMMA 4A11B 2OVRB 3HFQA 3C9CA 2XZGA 3I7OA 4WJKA 2CO0A 4Y7RA 4J78A 4GM3A 2B4EA 3IJ1A 3C75H 3SWSD 1N6FA 3J80g 2Z2NA 3JPXA 4AMZA 3UR4A 2QXVA 2HU8A 2YNOA 3I89A 4J81A 4LG9A 4OZUA 3PE7A 3N0EA 1T2XA 3EI1B 2IWFA 3MKQA 2JKXA 4J0WA 2XDWA 3CIKB 4XYHA 3VA6A 4AN1A 2OIZA 4N14A 3V4VA 1Q47A 4PXWA 4RE6A 3OL2A 3OF7A 3I7NA 4QL1A 3GREA 3K71A 3CFSB 5FKTA 4PBYA 3DM0A 4ZOYA 4U7AA 1UTCA 2G99A 1H2ZA 5H14A 4GGCA 3SBRA 4G56B 5H1MA 5IGOA 2CE8A 4DNWA 2EIBA 3JB9L 2AQ5A 4JSVC 4ZOXA 1TYEA 4A2MA 5IGQA 4BCDA 2P9NC 3NIDA 3ZE1A 5EARA 4Y5RD 5SXMA 4O1QD 3CFVA 3F3GA 1JTDB 3EG6A 4ES0A 4GQ1A 4IA9A 5H17A 4NC4A 4O3TB 2H68A 4A09A 2I0RA 2UZXB 5IT9g 4JSXC 4XEIC 1E5TA 4CI8A 4JT6C 4JSNC 3PVUB 5CXBB 2GC7A 4R7AB 5EMMB 3MUOA 2XL2A 1S4UX 1QFSA 4G55A 4Z7QA 1XIPA 3OKYB 5FFGA 2AGZA 2P9KC 5EAPA 3JROA 3MMYA 2EBSA 4QT8A 2CN2A 1NEXB 4PNKB 2EIDA 2VDLA 2B5LA 3ZDXA 5EMKB 2HXCA 4K3ID 4ZOZA 5THAA 2HESX 3K26A 4MK0B 3V7DB 1VE7A 2VZ3A 4GZ8A 4U1EI 5M5RA 2HU5A 3MZLA 2O9KA 4JD2C 1SQJA 4A0BA 4GQ2P 4JHPC 1A0RB 4NENA 3EI1A 3VH0A 4PSXB 1K32A 4O02A 4FWWA 1PGUA 2AH0A 4A09B 2VDRA 4AX4A 2P9LC 4J8GA 3J81g 3F3FA 4Z8LA 4BUJC 3T3PA 1ERJA 3BG0A 2CE9A 2H9NA 3GC3B 3NIFA 2QC5A 5CYKA 4E54B 1H2YA 1K8KC 4DNVA 3JZNA 1SHYB 3MVDK 3IJEA 3JRPA 4J73A 5K19A 3DDUA 4GGDA 1N6EA 2OJYA 2H9LA 4O9DA 5KDOB 3IIYA 3RN1D 4MMXA 4K3JB 4D9SA 4O45A 3UVLA 4JHNA 1GG2B 2PM7B 1BPOA 4J84A 1M1XA 5I5JA 3OW8A 4X63B 4NAAA 4A08A 2HYEA 5TDHB 4FHLA 2P9UC 4HDJA 2YNNA 4A0BB 1YR2A 3T3MA 3L4OD 5E6RA 4O3UB 2QR5A 3KRXB 4ERZA 1U4CA 3EI2B 5M5UA 5C92A 5CXBA 3IUMA 3ULEC 1JMZB 5C86A 3W15A 2VDQA 3EI4B 4CZXA 4J8BA 1VZ2A 4G1MA 3P4FA 1JOFA 4FA1D 3QHYB 3OKYA 4GM9A 2H6QA 5EM2A 5CYKB 3SMRA 2P9SC 5TF2A 1PEVA 3MZKA 2IUQA 5E6UA 1GP2B 3V4PA 4CC9A 3IJ0A 4CZYA 3FRXA 3EI3A 4L9OA 3OKWA 5FQDA 4E5ZA 5HE0B 4MMYA 4ESGA 3FCUA 2TRCB 5HE1B 3NVNA 4BP9A 1VZ3A 3IJCA 4FA5D 2I3SA 3SHFA 2G9AA 4ZN4A 3GD1I 1GOHA 3JAMg 2XU7A 4X3EA 4CI3A 1JJUB 4JT5C 3UVMA 4GQBB 4D6VA 5CXCB 4A08B 1OMWB 3IKOA 4AOWA 2MTAH 4DNUA 1GXRA 3RN0D 1H2WA 3IIWA 2VZ1A 4CI2A 4BH6A 1QNIA 4TZ4A 4X61B 2VDOA 4A2LA 3ZDYA 5A2Qg 5I5IA 4E54A 2OK6A 4J87A 2IWKA 5M5VA 5FKQA 3VI4A 1UOQA 4BL0A 2VDPA 5EM2B 1SQ9A 3JZHA 3AH8B 3PXTD 3NVXA 2GC4A 1U2VC 5K1CC 1FWXA 3EI3B 4KFMB 4E5ZB 2BCJB 4UM9A 2I0TA 2XE4A 3SBPA 2AGYA 1PBYB 3AFCA 2AGWA 4NSXA 1QFMA 4AEZA 1TYQC 5AFU3 3MUNA 4BCCA 5AJAA 3C5MA 5FA5B 2IUPA 4FA4D 3RRMC 2P9IC 3IVMA 4UI9R 4WK4A 2UZYB 1JMXB 4A0AA 3EI2A 4JXMA 3FGBA 1XHMA 3PXWD 3EI4A 3L4MD 3BWSA 4G1EA 1MG2A 5FXYA 3AL8A 4FAND 5IC7A 3RMZD 2P9PC 3SCYA 2PM9A 2VDKA 4EWRA 2HU7A 1VE6A 3SJLD 4QRJA 1C9IA 5GXHA 1MG3A 1U8CA 1R5MA 3ODTA 2W18A 4AMYA 4J82A 1RI6A
chains in the Genus database with same CATH topology
2I0SA 3JZGA 1B9XA 3C99A 4J0XA 5HYNB 4CZVA 3SN6B 2YNPA 3A0FA 4FA9D 3SXTD 3UVOA 3PSLA 5CXCA 3V5WB 2H6KA 2H9PA 3F3PA 3EU7A 2HKMA 3I7PA 2H14A 5EMLB 3MXXA 2Z2PA 3SVWD 1NR0A 2HJBA 2YB8B 2BBKH 4A0AB 5IJ8E 2HJ4A 2OK4A 3PVWB 2IAAA 3N0DA 4CY5A 3GFCA 4YVDA 5EAMA 2B5MA 3B7FA 3UKRC 3AL8B 4D0KA 5I5MA 2PBIB 3NVQA 3AL9A 3E0CA 2CN3A 3OTTA 2PM9B 1B9YA 1OLZA 2Q7QA 1YFQA 2J55H 4CY3A 4A7JA 4FAVD 1TBGA 1VYHC 3K27A 5EALA 4L3GD 5FKSA 3RFGA 4JSPC 5AMSA 2XL3A 3DXMC 2GNQA 2H9MA 3I7KA 2HKRA 2I3TA 3I7HA 2CNXA 4OWRA 2H47A 5B4WA 4PSWB 4ZOVA 3OKTA 3UVNA 4PC0A 3EWEA 3DXKC 4LG8A 3DSMA 4H5JA 5TEFA 3U4YA 2AH1A 3V9FA 2YMUA 2B5NA 1N6DA 5GSAA 3EMHA 4CI1A 4FB1D 5GXIA 2XYIA 2AGLA 4L1QD 2OVQB 5JWZA 2PM6B 2H6NA 3UKUC 3RSEC 2CO0C 4J77A 3OL2B 4X60B 4XYIA 5HQGA 4GMBA 3RFHA 3RLMD 4QQEA 4CY1A 3KRWB 4A11A 4I79A 3VGZA 3DWLC 4LGNA 3I8EA 2IUVA 5C9ZB 5C2VB 3I7LA 2YBAA 3SLED 2H3XA 4CY2A 3SFZA 5GMKn 4H5IA 1L0QA 4J86A 5EMJB 3UVKA 3FM0A 5HE3B 1XKSA 2J56H 3ZWLB 4ERYA 5TEEA 4GM8A 3MKSB 4ERQA 2AGXA 3I8CA 3ORVD 1P22A 4L3HD 5FLXg 2OVPB 1GOTB 1MDAH 4J79A 5C2WB 5IJ7E 4PBZA 1PI6A 3I2NA 4GGAA 2J57G 3PXSD 3SBQA 5FKRA 2H13A 2IURA 2Z2OA 3BG1A 5HE2B 3PSCB 4IMMA 4A11B 2OVRB 3HFQA 3C9CA 3I7OA 2CO0A 4Y7RA 4J78A 4GM3A 2B4EA 3IJ1A 3C75H 3SWSD 1N6FA 3J80g 2Z2NA 3JPXA 3UR4A 2QXVA 2YNOA 3I89A 4J81A 4LG9A 4OZUA 3PE7A 3N0EA 3EI1B 2IWFA 3MKQA 4J0WA 4XYHA 3CIKB 3VA6A 2OIZA 4N14A 1Q47A 4PXWA 3OL2A 3I7NA 4QL1A 3GREA 3CFSB 5FKTA 4PBYA 3DM0A 4ZOYA 4U7AA 2G99A 5H14A 4GGCA 3SBRA 4G56B 5H1MA 5IGOA 2CE8A 3JB9L 2AQ5A 4JSVC 4ZOXA 4A2MA 5IGQA 2P9NC 5EARA 4Y5RD 5SXMA 4O1QD 3CFVA 3F3GA 3EG6A 4ES0A 4GQ1A 4IA9A 5H17A 4O3TB 2H68A 4A09A 2I0RA 2UZXB 5IT9g 4JSXC 4XEIC 4CI8A 4JT6C 4JSNC 3PVUB 5CXBB 2GC7A 4R7AB 5EMMB 2XL2A 1S4UX 1XIPA 3OKYB 2AGZA 2P9KC 5EAPA 3JROA 3MMYA 2EBSA 4QT8A 2CN2A 1NEXB 4PNKB 2B5LA 5EMKB 2HXCA 4K3ID 4ZOZA 5THAA 2HESX 3K26A 4MK0B 3V7DB 4GZ8A 4U1EI 3MZLA 2O9KA 4JD2C 1SQJA 4A0BA 4GQ2P 3EI1A 1A0RB 3VH0A 4PSXB 1K32A 4FWWA 1PGUA 2AH0A 4A09B 2P9LC 4J8GA 3J81g 3F3FA 4Z8LA 4BUJC 1ERJA 3BG0A 2CE9A 2H9NA 2QC5A 5CYKA 4E54B 1K8KC 3JZNA 1SHYB 3JRPA 4J73A 5K19A 4GGDA 1N6EA 2OJYA 2H9LA 4O9DA 5KDOB 3IIYA 3RN1D 4K3JB 4O45A 3UVLA 1GG2B 2PM7B 4J84A 5I5JA 3OW8A 4X63B 4A08A 2HYEA 5TDHB 4FHLA 2P9UC 4HDJA 2YNNA 4A0BB 3L4OD 4O3UB 4ERZA 3KRXB 1U4CA 3EI2B 5CXBA 3ULEC 1JMZB 3W15A 3EI4B 4CZXA 4J8BA 3P4FA 1JOFA 4FA1D 3OKYA 4GM9A 2H6QA 5EM2A 5CYKB 3SMRA 2P9SC 5TF2A 1PEVA 3MZKA 2IUQA 1GP2B 4CC9A 3IJ0A 4CZYA 3FRXA 3EI3A 4L9OA 3OKWA 5FQDA 4E5ZA 5HE0B 4ESGA 2TRCB 5HE1B 3NVNA 3IJCA 4FA5D 2I3SA 3SHFA 2G9AA 4ZN4A 3JAMg 2XU7A 4X3EA 4CI3A 1JJUB 4JT5C 3UVMA 4GQBB 4D6VA 5CXCB 4A08B 1OMWB 3IKOA 4AOWA 2MTAH 1GXRA 3RN0D 3IIWA 4CI2A 4BH6A 1QNIA 4TZ4A 4X61B 4A2LA 5A2Qg 5I5IA 4E54A 2OK6A 4J87A 2IWKA 5FKQA 4BL0A 5EM2B 1SQ9A 3JZHA 3AH8B 3PXTD 3NVXA 2GC4A 1U2VC 5K1CC 1FWXA 3EI3B 4KFMB 4E5ZB 2BCJB 2I0TA 3SBPA 2AGYA 1PBYB 3AFCA 2AGWA 4NSXA 4AEZA 1TYQC 5AFU3 5AJAA 3C5MA 5FA5B 2IUPA 4FA4D 3RRMC 2P9IC 4UI9R 2UZYB 1JMXB 4A0AA 3EI2A 4JXMA 3FGBA 1XHMA 3PXWD 3EI4A 3L4MD 3BWSA 1MG2A 5FXYA 3AL8A 4FAND 5IC7A 3RMZD 2P9PC 3SCYA 2PM9A 4EWRA 3SJLD 4QRJA 5GXHA 1MG3A 1R5MA 3ODTA 2W18A 4J82A 1RI6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I0S A;  3JZG A;  1B9X A;  3C99 A;  4J0X A;  5HYN B;  4CZV A;  3SN6 B;  2YNP A;  3A0F A;  4FA9 D;  3SXT D;  3UVO A;  3PSL A;  5CXC A;  3V5W B;  2H6K A;  2H9P A;  3F3P A;  3EU7 A;  2HKM A;  3I7P A;  2H14 A;  5EML B;  3MXX A;  2Z2P A;  3SVW D;  1NR0 A;  2HJB A;  2YB8 B;  2BBK H;  4A0A B;  5IJ8 E;  2HJ4 A;  2OK4 A;  3PVW B;  2IAA A;  3N0D A;  4CY5 A;  3GFC A;  4YVD A;  5EAM A;  2B5M A;  3B7F A;  3UKR C;  3AL8 B;  4D0K A;  5I5M A;  2PBI B;  3NVQ A;  3AL9 A;  3E0C A;  2CN3 A;  3OTT A;  2PM9 B;  1B9Y A;  1OLZ A;  2Q7Q A;  1YFQ A;  2J55 H;  4CY3 A;  4A7J A;  4FAV D;  1TBG A;  1VYH C;  3K27 A;  5EAL A;  4L3G D;  5FKS A;  3RFG A;  4JSP C;  5AMS A;  2XL3 A;  3DXM C;  2GNQ A;  2H9M A;  3I7K A;  2HKR A;  2I3T A;  3I7H A;  2CNX A;  4OWR A;  2H47 A;  5B4W A;  4PSW B;  4ZOV A;  3OKT A;  3UVN A;  4PC0 A;  3EWE A;  3DXK C;  4LG8 A;  3DSM A;  4H5J A;  5TEF A;  3U4Y A;  2AH1 A;  3V9F A;  2YMU A;  2B5N A;  1N6D A;  5GSA A;  3EMH A;  4CI1 A;  4FB1 D;  5GXI A;  2XYI A;  2AGL A;  4L1Q D;  2OVQ B;  5JWZ A;  2PM6 B;  2H6N A;  3UKU C;  3RSE C;  2CO0 C;  4J77 A;  3OL2 B;  4X60 B;  4XYI A;  5HQG A;  4GMB A;  3RFH A;  3RLM D;  4QQE A;  4CY1 A;  3KRW B;  4A11 A;  4I79 A;  3VGZ A;  3DWL C;  4LGN A;  3I8E A;  2IUV A;  5C9Z B;  5C2V B;  3I7L A;  2YBA A;  3SLE D;  2H3X A;  4CY2 A;  3SFZ A;  5GMK n;  4H5I A;  1L0Q A;  4J86 A;  5EMJ B;  3UVK A;  3FM0 A;  5HE3 B;  1XKS A;  2J56 H;  3ZWL B;  4ERY A;  5TEE A;  4GM8 A;  3MKS B;  4ERQ A;  2AGX A;  3I8C A;  3ORV D;  1P22 A;  4L3H D;  5FLX g;  2OVP B;  1GOT B;  1MDA H;  4J79 A;  5C2W B;  5IJ7 E;  4PBZ A;  1PI6 A;  3I2N A;  4GGA A;  2J57 G;  3PXS D;  3SBQ A;  5FKR A;  2H13 A;  2IUR A;  2Z2O A;  3BG1 A;  5HE2 B;  3PSC B;  4IMM A;  4A11 B;  2OVR B;  3HFQ A;  3C9C A;  3I7O A;  2CO0 A;  4Y7R A;  4J78 A;  4GM3 A;  2B4E A;  3IJ1 A;  3C75 H;  3SWS D;  1N6F A;  3J80 g;  2Z2N A;  3JPX A;  3UR4 A;  2QXV A;  2YNO A;  3I89 A;  4J81 A;  4LG9 A;  4OZU A;  3PE7 A;  3N0E A;  3EI1 B;  2IWF A;  3MKQ A;  4J0W A;  4XYH A;  3CIK B;  3VA6 A;  2OIZ A;  4N14 A;  1Q47 A;  4PXW A;  3OL2 A;  3I7N A;  4QL1 A;  3GRE A;  3CFS B;  5FKT A;  4PBY A;  3DM0 A;  4ZOY A;  4U7A A;  2G99 A;  5H14 A;  4GGC A;  3SBR A;  4G56 B;  5H1M A;  5IGO A;  2CE8 A;  3JB9 L;  2AQ5 A;  4JSV C;  4ZOX A;  4A2M A;  5IGQ A;  2P9N C;  5EAR A;  4Y5R D;  5SXM A;  4O1Q D;  3CFV A;  3F3G A;  3EG6 A;  4ES0 A;  4GQ1 A;  4IA9 A;  5H17 A;  4O3T B;  2H68 A;  4A09 A;  2I0R A;  2UZX B;  5IT9 g;  4JSX C;  4XEI C;  4CI8 A;  4JT6 C;  4JSN C;  3PVU B;  5CXB B;  2GC7 A;  4R7A B;  5EMM B;  2XL2 A;  1S4U X;  1XIP A;  3OKY B;  2AGZ A;  2P9K C;  5EAP A;  3JRO A;  3MMY A;  2EBS A;  4QT8 A;  2CN2 A;  1NEX B;  4PNK B;  2B5L A;  5EMK B;  2HXC A;  4K3I D;  4ZOZ A;  5THA A;  2HES X;  3K26 A;  4MK0 B;  3V7D B;  4GZ8 A;  4U1E I;  3MZL A;  2O9K A;  4JD2 C;  1SQJ A;  4A0B A;  4GQ2 P;  3EI1 A;  1A0R B;  3VH0 A;  4PSX B;  1K32 A;  4FWW A;  1PGU A;  2AH0 A;  4A09 B;  2P9L C;  4J8G A;  3J81 g;  3F3F A;  4Z8L A;  4BUJ C;  1ERJ A;  3BG0 A;  2CE9 A;  2H9N A;  2QC5 A;  5CYK A;  4E54 B;  1K8K C;  3JZN A;  1SHY B;  3JRP A;  4J73 A;  5K19 A;  4GGD A;  1N6E A;  2OJY A;  2H9L A;  4O9D A;  5KDO B;  3IIY A;  3RN1 D;  4K3J B;  4O45 A;  3UVL A;  1GG2 B;  2PM7 B;  4J84 A;  5I5J A;  3OW8 A;  4X63 B;  4A08 A;  2HYE A;  5TDH B;  4FHL A;  2P9U C;  4HDJ A;  2YNN A;  4A0B B;  3L4O D;  4O3U B;  4ERZ A;  3KRX B;  1U4C A;  3EI2 B;  5CXB A;  3ULE C;  1JMZ B;  3W15 A;  3EI4 B;  4CZX A;  4J8B A;  3P4F A;  1JOF A;  4FA1 D;  3OKY A;  4GM9 A;  2H6Q A;  5EM2 A;  5CYK B;  3SMR A;  2P9S C;  5TF2 A;  1PEV A;  3MZK A;  2IUQ A;  1GP2 B;  4CC9 A;  3IJ0 A;  4CZY A;  3FRX A;  3EI3 A;  4L9O A;  3OKW A;  5FQD A;  4E5Z A;  5HE0 B;  4ESG A;  2TRC B;  5HE1 B;  3NVN A;  3IJC A;  4FA5 D;  2I3S A;  3SHF A;  2G9A A;  4ZN4 A;  3JAM g;  2XU7 A;  4X3E A;  4CI3 A;  1JJU B;  4JT5 C;  3UVM A;  4GQB B;  4D6V A;  5CXC B;  4A08 B;  1OMW B;  3IKO A;  4AOW A;  2MTA H;  1GXR A;  3RN0 D;  3IIW A;  4CI2 A;  4BH6 A;  1QNI A;  4TZ4 A;  4X61 B;  4A2L A;  5A2Q g;  5I5I A;  4E54 A;  2OK6 A;  4J87 A;  2IWK A;  5FKQ A;  4BL0 A;  5EM2 B;  1SQ9 A;  3JZH A;  3AH8 B;  3PXT D;  3NVX A;  2GC4 A;  1U2V C;  5K1C C;  1FWX A;  3EI3 B;  4KFM B;  4E5Z B;  2BCJ B;  2I0T A;  3SBP A;  2AGY A;  1PBY B;  3AFC A;  2AGW A;  4NSX A;  4AEZ A;  1TYQ C;  5AFU 3;  5AJA A;  3C5M A;  5FA5 B;  2IUP A;  4FA4 D;  3RRM C;  2P9I C;  4UI9 R;  2UZY B;  1JMX B;  4A0A A;  3EI2 A;  4JXM A;  3FGB A;  1XHM A;  3PXW D;  3EI4 A;  3L4M D;  3BWS A;  1MG2 A;  5FXY A;  3AL8 A;  4FAN D;  5IC7 A;  3RMZ D;  2P9P C;  3SCY A;  2PM9 A;  4EWR A;  3SJL D;  4QRJ A;  5GXH A;  1MG3 A;  1R5M A;  3ODT A;  2W18 A;  4J82 A;  1RI6 A; 
#chains in the Genus database with same CATH topology
 2I0S A;  3JZG A;  1B9X A;  3C99 A;  2EIC A;  4J0X A;  3ZE2 A;  3O4J A;  5HYN B;  4CZV A;  2BKL A;  3NIG A;  3SN6 B;  2YNP A;  3A0F A;  4FA9 D;  1O6G A;  3FCS A;  5M5S A;  3SXT D;  3UVO A;  4IRZ A;  3PSL A;  5CXC A;  3V5W B;  3K6S A;  2H6K A;  2H9P A;  3F3P A;  3EU7 A;  2HKM A;  3ZDZ A;  3I7P A;  2H14 A;  5EML B;  3MXX A;  2Z2P A;  3SVW D;  2VDN A;  2WQ8 A;  1NR0 A;  2HJB A;  2YB8 B;  2BBK H;  4A0A B;  5IJ8 E;  2HJ4 A;  2OK4 A;  3PVW B;  2IAA A;  3N0D A;  4CY5 A;  4UM8 A;  2QZP A;  3GFC A;  5HDB A;  4YVD A;  5EAM A;  2B5M A;  3B7F A;  3UKR C;  3EQ9 A;  3AL8 B;  4D0K A;  5I5M A;  2PBI B;  4L1M A;  3NVQ A;  3AL9 A;  3E0C A;  3O4I A;  4Z7O A;  2CN3 A;  3OTT A;  2PM9 B;  1B9Y A;  1OLZ A;  2Q7Q A;  1YFQ A;  2J55 H;  4CY3 A;  4A7J A;  4FAV D;  1C9L A;  1TBG A;  1VYH C;  3K27 A;  5EAL A;  4L3G D;  5FKS A;  3RFG A;  4JSP C;  2EIE A;  5AMS A;  2XL3 A;  3DXM C;  2GNQ A;  2H9M A;  4O2W A;  3I7K A;  2HKR A;  2I3T A;  3I7H A;  3IUL A;  3ZE0 A;  2CNX A;  3EQ7 A;  4OWR A;  2H47 A;  5B4W A;  4PSW B;  4ZOV A;  3OKT A;  3UVN A;  3IUQ A;  4PC0 A;  3EWE A;  3DXK C;  3IUJ A;  5FFO A;  4NBM A;  4LG8 A;  1K3I A;  3DSM A;  4H5J A;  5TEF A;  3U4Y A;  2AH1 A;  3V9F A;  4BCB A;  2YMU A;  2B5N A;  5M5T A;  1JV2 A;  1N6D A;  3O4H A;  5M61 A;  3IUR A;  5GSA A;  3EMH A;  1I2M B;  4FB1 D;  4CI1 A;  5GXI A;  2XYI A;  2AGL A;  1A12 A;  4L1Q D;  4WK2 A;  3O4G A;  2OVQ B;  3EQ8 A;  5JWZ A;  2PM6 B;  2H6N A;  3UKU C;  1UOO A;  3RSE C;  2CO0 C;  4J77 A;  3OL2 B;  4X60 B;  4QAM A;  4RE5 A;  4XYI A;  5HQG A;  4GMB A;  3RFH A;  3RLM D;  4QQE A;  4CY1 A;  3KRW B;  4A11 A;  4I79 A;  3VGZ A;  3DWL C;  4LGN A;  3I8E A;  2IUV A;  5C9Z B;  5C2V B;  4WK0 A;  3I7L A;  3K72 A;  2YBA A;  1GOG A;  3SLE D;  4Z7N A;  1E8N A;  2H3X A;  4CY2 A;  3SFZ A;  5GMK n;  4H5I A;  1L0Q A;  4J86 A;  5EMJ B;  1E8M A;  2VDM A;  3UVK A;  3FM0 A;  5HE3 B;  1XKS A;  2J56 H;  3ZWL B;  4ERY A;  5TEE A;  4GM8 A;  3MKS B;  4ERQ A;  4AN0 A;  2AGX A;  1L5G A;  3I8C A;  3ORV D;  3IUN A;  1P22 A;  4L3H D;  5FLX g;  2OVP B;  1GOT B;  1MDA H;  3VI3 A;  4J79 A;  5C2W B;  5IJ7 E;  4PBZ A;  1PI6 A;  3I2N A;  4GGA A;  3QI0 A;  1UOP A;  4MMZ A;  2J57 G;  3PXS D;  2VC2 A;  3SBQ A;  5FKR A;  2H13 A;  2IUR A;  1H2X A;  2Z2O A;  1GOF A;  4BP8 A;  3BG1 A;  1O6F A;  5E6S A;  5HE2 B;  3KCI A;  3PSC B;  4IMM A;  4A11 B;  2OVR B;  3HFQ A;  3C9C A;  2XZG A;  3I7O A;  4WJK A;  2CO0 A;  4Y7R A;  4J78 A;  4GM3 A;  2B4E A;  3IJ1 A;  3C75 H;  3SWS D;  1N6F A;  3J80 g;  2Z2N A;  3JPX A;  4AMZ A;  3UR4 A;  2QXV A;  2HU8 A;  2YNO A;  3I89 A;  4J81 A;  4LG9 A;  4OZU A;  3PE7 A;  3N0E A;  1T2X A;  3EI1 B;  2IWF A;  3MKQ A;  2JKX A;  4J0W A;  2XDW A;  3CIK B;  4XYH A;  3VA6 A;  4AN1 A;  2OIZ A;  4N14 A;  3V4V A;  1Q47 A;  4PXW A;  4RE6 A;  3OL2 A;  3OF7 A;  3I7N A;  4QL1 A;  3GRE A;  3K71 A;  3CFS B;  5FKT A;  4PBY A;  3DM0 A;  4ZOY A;  4U7A A;  1UTC A;  2G99 A;  1H2Z A;  5H14 A;  4GGC A;  3SBR A;  4G56 B;  5H1M A;  5IGO A;  2CE8 A;  4DNW A;  2EIB A;  3JB9 L;  2AQ5 A;  4JSV C;  4ZOX A;  1TYE A;  4A2M A;  5IGQ A;  4BCD A;  2P9N C;  3NID A;  3ZE1 A;  5EAR A;  4Y5R D;  5SXM A;  4O1Q D;  3CFV A;  3F3G A;  1JTD B;  3EG6 A;  4ES0 A;  4GQ1 A;  4IA9 A;  5H17 A;  4NC4 A;  4O3T B;  2H68 A;  4A09 A;  2I0R A;  2UZX B;  5IT9 g;  4JSX C;  4XEI C;  1E5T A;  4CI8 A;  4JT6 C;  4JSN C;  3PVU B;  5CXB B;  2GC7 A;  4R7A B;  5EMM B;  3MUO A;  2XL2 A;  1S4U X;  1QFS A;  4G55 A;  4Z7Q A;  1XIP A;  3OKY B;  5FFG A;  2AGZ A;  2P9K C;  5EAP A;  3JRO A;  3MMY A;  2EBS A;  4QT8 A;  2CN2 A;  1NEX B;  4PNK B;  2EID A;  2VDL A;  2B5L A;  3ZDX A;  5EMK B;  2HXC A;  4K3I D;  4ZOZ A;  5THA A;  2HES X;  3K26 A;  4MK0 B;  3V7D B;  1VE7 A;  2VZ3 A;  4GZ8 A;  4U1E I;  5M5R A;  2HU5 A;  3MZL A;  2O9K A;  4JD2 C;  1SQJ A;  4A0B A;  4GQ2 P;  4JHP C;  1A0R B;  4NEN A;  3EI1 A;  3VH0 A;  4PSX B;  1K32 A;  4O02 A;  4FWW A;  1PGU A;  2AH0 A;  4A09 B;  2VDR A;  4AX4 A;  2P9L C;  4J8G A;  3J81 g;  3F3F A;  4Z8L A;  4BUJ C;  3T3P A;  1ERJ A;  3BG0 A;  2CE9 A;  2H9N A;  3GC3 B;  3NIF A;  2QC5 A;  5CYK A;  4E54 B;  1H2Y A;  1K8K C;  4DNV A;  3JZN A;  1SHY B;  3MVD K;  3IJE A;  3JRP A;  4J73 A;  5K19 A;  3DDU A;  4GGD A;  1N6E A;  2OJY A;  2H9L A;  4O9D A;  5KDO B;  3IIY A;  3RN1 D;  4MMX A;  4K3J B;  4D9S A;  4O45 A;  3UVL A;  4JHN A;  1GG2 B;  2PM7 B;  1BPO A;  4J84 A;  1M1X A;  5I5J A;  3OW8 A;  4X63 B;  4NAA A;  4A08 A;  2HYE A;  5TDH B;  4FHL A;  2P9U C;  4HDJ A;  2YNN A;  4A0B B;  1YR2 A;  3T3M A;  3L4O D;  5E6R A;  4O3U B;  2QR5 A;  3KRX B;  4ERZ A;  1U4C A;  3EI2 B;  5M5U A;  5C92 A;  5CXB A;  3IUM A;  3ULE C;  1JMZ B;  5C86 A;  3W15 A;  2VDQ A;  3EI4 B;  4CZX A;  4J8B A;  1VZ2 A;  4G1M A;  3P4F A;  1JOF A;  4FA1 D;  3QHY B;  3OKY A;  4GM9 A;  2H6Q A;  5EM2 A;  5CYK B;  3SMR A;  2P9S C;  5TF2 A;  1PEV A;  3MZK A;  2IUQ A;  5E6U A;  1GP2 B;  3V4P A;  4CC9 A;  3IJ0 A;  4CZY A;  3FRX A;  3EI3 A;  4L9O A;  3OKW A;  5FQD A;  4E5Z A;  5HE0 B;  4MMY A;  4ESG A;  3FCU A;  2TRC B;  5HE1 B;  3NVN A;  4BP9 A;  1VZ3 A;  3IJC A;  4FA5 D;  2I3S A;  3SHF A;  2G9A A;  4ZN4 A;  3GD1 I;  1GOH A;  3JAM g;  2XU7 A;  4X3E A;  4CI3 A;  1JJU B;  4JT5 C;  3UVM A;  4GQB B;  4D6V A;  5CXC B;  4A08 B;  1OMW B;  3IKO A;  4AOW A;  2MTA H;  4DNU A;  1GXR A;  3RN0 D;  1H2W A;  3IIW A;  2VZ1 A;  4CI2 A;  4BH6 A;  1QNI A;  4TZ4 A;  4X61 B;  2VDO A;  4A2L A;  3ZDY A;  5A2Q g;  5I5I A;  4E54 A;  2OK6 A;  4J87 A;  2IWK A;  5M5V A;  5FKQ A;  3VI4 A;  1UOQ A;  4BL0 A;  2VDP A;  5EM2 B;  1SQ9 A;  3JZH A;  3AH8 B;  3PXT D;  3NVX A;  2GC4 A;  1U2V C;  5K1C C;  1FWX A;  3EI3 B;  4KFM B;  4E5Z B;  2BCJ B;  4UM9 A;  2I0T A;  2XE4 A;  3SBP A;  2AGY A;  1PBY B;  3AFC A;  2AGW A;  4NSX A;  1QFM A;  4AEZ A;  1TYQ C;  5AFU 3;  3MUN A;  4BCC A;  5AJA A;  3C5M A;  5FA5 B;  2IUP A;  4FA4 D;  3RRM C;  2P9I C;  3IVM A;  4UI9 R;  4WK4 A;  2UZY B;  1JMX B;  4A0A A;  3EI2 A;  4JXM A;  3FGB A;  1XHM A;  3PXW D;  3EI4 A;  3L4M D;  3BWS A;  4G1E A;  1MG2 A;  5FXY A;  3AL8 A;  4FAN D;  5IC7 A;  3RMZ D;  2P9P C;  3SCY A;  2PM9 A;  2VDK A;  4EWR A;  2HU7 A;  1VE6 A;  3SJL D;  4QRJ A;  1C9I A;  5GXH A;  1MG3 A;  1U8C A;  1R5M A;  3ODT A;  2W18 A;  4AMY A;  4J82 A;  1RI6 A; 
#chains in the Genus database with same CATH homology
 2I0S A;  3JZG A;  1B9X A;  3C99 A;  4J0X A;  5HYN B;  4CZV A;  3SN6 B;  2YNP A;  3A0F A;  4FA9 D;  3SXT D;  3UVO A;  3PSL A;  5CXC A;  3V5W B;  2H6K A;  2H9P A;  3F3P A;  3EU7 A;  2HKM A;  3I7P A;  2H14 A;  5EML B;  3MXX A;  2Z2P A;  3SVW D;  1NR0 A;  2HJB A;  2YB8 B;  2BBK H;  4A0A B;  5IJ8 E;  2HJ4 A;  2OK4 A;  3PVW B;  2IAA A;  3N0D A;  4CY5 A;  3GFC A;  4YVD A;  5EAM A;  2B5M A;  3B7F A;  3UKR C;  3AL8 B;  4D0K A;  5I5M A;  2PBI B;  3NVQ A;  3AL9 A;  3E0C A;  2CN3 A;  3OTT A;  2PM9 B;  1B9Y A;  1OLZ A;  2Q7Q A;  1YFQ A;  2J55 H;  4CY3 A;  4A7J A;  4FAV D;  1TBG A;  1VYH C;  3K27 A;  5EAL A;  4L3G D;  5FKS A;  3RFG A;  4JSP C;  5AMS A;  2XL3 A;  3DXM C;  2GNQ A;  2H9M A;  3I7K A;  2HKR A;  2I3T A;  3I7H A;  2CNX A;  4OWR A;  2H47 A;  5B4W A;  4PSW B;  4ZOV A;  3OKT A;  3UVN A;  4PC0 A;  3EWE A;  3DXK C;  4LG8 A;  3DSM A;  4H5J A;  5TEF A;  3U4Y A;  2AH1 A;  3V9F A;  2YMU A;  2B5N A;  1N6D A;  5GSA A;  3EMH A;  4CI1 A;  4FB1 D;  5GXI A;  2XYI A;  2AGL A;  4L1Q D;  2OVQ B;  5JWZ A;  2PM6 B;  2H6N A;  3UKU C;  3RSE C;  2CO0 C;  4J77 A;  3OL2 B;  4X60 B;  4XYI A;  5HQG A;  4GMB A;  3RFH A;  3RLM D;  4QQE A;  4CY1 A;  3KRW B;  4A11 A;  4I79 A;  3VGZ A;  3DWL C;  4LGN A;  3I8E A;  2IUV A;  5C9Z B;  5C2V B;  3I7L A;  2YBA A;  3SLE D;  2H3X A;  4CY2 A;  3SFZ A;  5GMK n;  4H5I A;  1L0Q A;  4J86 A;  5EMJ B;  3UVK A;  3FM0 A;  5HE3 B;  1XKS A;  2J56 H;  3ZWL B;  4ERY A;  5TEE A;  4GM8 A;  3MKS B;  4ERQ A;  2AGX A;  3I8C A;  3ORV D;  1P22 A;  4L3H D;  5FLX g;  2OVP B;  1GOT B;  1MDA H;  4J79 A;  5C2W B;  5IJ7 E;  4PBZ A;  1PI6 A;  3I2N A;  4GGA A;  2J57 G;  3PXS D;  3SBQ A;  5FKR A;  2H13 A;  2IUR A;  2Z2O A;  3BG1 A;  5HE2 B;  3PSC B;  4IMM A;  4A11 B;  2OVR B;  3HFQ A;  3C9C A;  3I7O A;  2CO0 A;  4Y7R A;  4J78 A;  4GM3 A;  2B4E A;  3IJ1 A;  3C75 H;  3SWS D;  1N6F A;  3J80 g;  2Z2N A;  3JPX A;  3UR4 A;  2QXV A;  2YNO A;  3I89 A;  4J81 A;  4LG9 A;  4OZU A;  3PE7 A;  3N0E A;  3EI1 B;  2IWF A;  3MKQ A;  4J0W A;  4XYH A;  3CIK B;  3VA6 A;  2OIZ A;  4N14 A;  1Q47 A;  4PXW A;  3OL2 A;  3I7N A;  4QL1 A;  3GRE A;  3CFS B;  5FKT A;  4PBY A;  3DM0 A;  4ZOY A;  4U7A A;  2G99 A;  5H14 A;  4GGC A;  3SBR A;  4G56 B;  5H1M A;  5IGO A;  2CE8 A;  3JB9 L;  2AQ5 A;  4JSV C;  4ZOX A;  4A2M A;  5IGQ A;  2P9N C;  5EAR A;  4Y5R D;  5SXM A;  4O1Q D;  3CFV A;  3F3G A;  3EG6 A;  4ES0 A;  4GQ1 A;  4IA9 A;  5H17 A;  4O3T B;  2H68 A;  4A09 A;  2I0R A;  2UZX B;  5IT9 g;  4JSX C;  4XEI C;  4CI8 A;  4JT6 C;  4JSN C;  3PVU B;  5CXB B;  2GC7 A;  4R7A B;  5EMM B;  2XL2 A;  1S4U X;  1XIP A;  3OKY B;  2AGZ A;  2P9K C;  5EAP A;  3JRO A;  3MMY A;  2EBS A;  4QT8 A;  2CN2 A;  1NEX B;  4PNK B;  2B5L A;  5EMK B;  2HXC A;  4K3I D;  4ZOZ A;  5THA A;  2HES X;  3K26 A;  4MK0 B;  3V7D B;  4GZ8 A;  4U1E I;  3MZL A;  2O9K A;  4JD2 C;  1SQJ A;  4A0B A;  4GQ2 P;  3EI1 A;  1A0R B;  3VH0 A;  4PSX B;  1K32 A;  4FWW A;  1PGU A;  2AH0 A;  4A09 B;  2P9L C;  4J8G A;  3J81 g;  3F3F A;  4Z8L A;  4BUJ C;  1ERJ A;  3BG0 A;  2CE9 A;  2H9N A;  2QC5 A;  5CYK A;  4E54 B;  1K8K C;  3JZN A;  1SHY B;  3JRP A;  4J73 A;  5K19 A;  4GGD A;  1N6E A;  2OJY A;  2H9L A;  4O9D A;  5KDO B;  3IIY A;  3RN1 D;  4K3J B;  4O45 A;  3UVL A;  1GG2 B;  2PM7 B;  4J84 A;  5I5J A;  3OW8 A;  4X63 B;  4A08 A;  2HYE A;  5TDH B;  4FHL A;  2P9U C;  4HDJ A;  2YNN A;  4A0B B;  3L4O D;  4O3U B;  4ERZ A;  3KRX B;  1U4C A;  3EI2 B;  5CXB A;  3ULE C;  1JMZ B;  3W15 A;  3EI4 B;  4CZX A;  4J8B A;  3P4F A;  1JOF A;  4FA1 D;  3OKY A;  4GM9 A;  2H6Q A;  5EM2 A;  5CYK B;  3SMR A;  2P9S C;  5TF2 A;  1PEV A;  3MZK A;  2IUQ A;  1GP2 B;  4CC9 A;  3IJ0 A;  4CZY A;  3FRX A;  3EI3 A;  4L9O A;  3OKW A;  5FQD A;  4E5Z A;  5HE0 B;  4ESG A;  2TRC B;  5HE1 B;  3NVN A;  3IJC A;  4FA5 D;  2I3S A;  3SHF A;  2G9A A;  4ZN4 A;  3JAM g;  2XU7 A;  4X3E A;  4CI3 A;  1JJU B;  4JT5 C;  3UVM A;  4GQB B;  4D6V A;  5CXC B;  4A08 B;  1OMW B;  3IKO A;  4AOW A;  2MTA H;  1GXR A;  3RN0 D;  3IIW A;  4CI2 A;  4BH6 A;  1QNI A;  4TZ4 A;  4X61 B;  4A2L A;  5A2Q g;  5I5I A;  4E54 A;  2OK6 A;  4J87 A;  2IWK A;  5FKQ A;  4BL0 A;  5EM2 B;  1SQ9 A;  3JZH A;  3AH8 B;  3PXT D;  3NVX A;  2GC4 A;  1U2V C;  5K1C C;  1FWX A;  3EI3 B;  4KFM B;  4E5Z B;  2BCJ B;  2I0T A;  3SBP A;  2AGY A;  1PBY B;  3AFC A;  2AGW A;  4NSX A;  4AEZ A;  1TYQ C;  5AFU 3;  5AJA A;  3C5M A;  5FA5 B;  2IUP A;  4FA4 D;  3RRM C;  2P9I C;  4UI9 R;  2UZY B;  1JMX B;  4A0A A;  3EI2 A;  4JXM A;  3FGB A;  1XHM A;  3PXW D;  3EI4 A;  3L4M D;  3BWS A;  1MG2 A;  5FXY A;  3AL8 A;  4FAN D;  5IC7 A;  3RMZ D;  2P9P C;  3SCY A;  2PM9 A;  4EWR A;  3SJL D;  4QRJ A;  5GXH A;  1MG3 A;  1R5M A;  3ODT A;  2W18 A;  4J82 A;  1RI6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...