2B4EA

Crystal structure of murine coronin-1: monoclinic form
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
386
structure length
386
Chain Sequence
SKFRHVFGQPAKADQCYEDVRVSQTTWDSGFCAVNPKFMALICEASGGGAFLVLPLGKTGRVDKNVPLVCGHTAPVLDIAWCPHNDNVIASGSEDCTVMVWEIPDGGLVLPLREPVITLEGHTKRVGIVAWHPTAQNVLLSAGCDNVILVWDVGTGAAVLTLGPDVHPDTIYSVDWSRDGALICTSCRDKRVRVIEPRKGTVVAEKDRPHEGTRPVHAVFVSEGKILTTGFSRMSERQVALWDTKHLEEPLSLQELDTSSGVLLPFFDPDTNIVYLCGKGDSSIRYFEITSEAPFLHYLSMFSSKESQRGMGYMPKRGLEVNKCEIARFYKLHERKCEPIAMTVPRKSDLFQEDLYPPTAGPDPALTAEEWLGGRDAGPLLISLKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of murine coronin-1: a regulator of actin cytoskeletal dynamics in lymphocytes
pubmed doi rcsb
source organism Mus musculus
molecule tags Structural protein
molecule keywords Coronin-1A
total genus 95
structure length 386
sequence length 386
ec nomenclature
pdb deposition date 2005-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
A PF08953 DUF1899 Domain of unknown function (DUF1899)
A PF16300 WD40_4 Type of WD40 repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2b4eA01
4O3UB 3MZKA 3JB9L 3OKYA 4U7AA 4CI2A 4BUJC 1RI6A 1TYQC 2OIZA 3EI3A 4J81A 2CO0C 4FAND 2Q7QA 4JSPC 4AEZA 5EM2B 3SCYA 3I8CA 5TDHB 3B7FA 5TEEA 3V9FA 2IUPA 2EBSA 4GQBB 5C2VB 5FXYA 3PXTD 5IGOA 4A09B 2H6QA 3JZGA 4Z8LA 2B5LA 4GM8A 3JAMg 3RN1D 1U4CA 4I79A 5JWZA 3SFZA 2Z2NA 4ZN4A 4ZOXA 4K3JB 3J80g 3FM0A 4GMBA 4J84A 5FKSA 4L1QD 1L0QA 3RSEC 2AGYA 3SBRA 2AGXA 3PXSD 4A08A 2J57G 2H9PA 2YNNA 2MTAH 3MKSB 5K1CC 2H3XA 3EI4B 5H1MA 4JSNC 2AGZA 4FAVD 5EARA 3J81g 4PBYA 3UR4A 5I5IA 3IJCA 4FHLA 1U2VC 4GZ8A 4O3TB 3OKWA 3ULEC 3MXXA 2G99A 4J79A 2YBAA 4NSXA 5EMKB 4BL0A 5EAMA 3N0EA 4KFMB 4E5ZB 3K26A 2I0SA 2P9LC 3I8EA 1NEXB 2OK4A 1JOFA 4PSWB 5IT9g 1JMXB 3DXMC 3PXWD 5K19A 3V5WB 4J78A 1XHMA 2H68A 3I7OA 5FKTA 2QXVA 5GSAA 3I7NA 4L3HD 2IURA 1PEVA 3IIYA 1SQ9A 2HJ4A 2IAAA 2P9NC 3UVNA 5KDOB 1A0RB 4X61B 3SN6B 3JRPA 4XYHA 3KRWB 2AGWA 3I7LA 4X60B 2P9UC 1QNIA 2AH1A 4HDJA 3AH8B 4A0BA 2OVQB 4CZXA 5C2WB 3NVXA 3SVWD 3AL8B 5FLXg 4E54B 1JJUB 4CY2A 3VH0A 3I2NA 2YNPA 1Q47A 3N0DA 3OL2B 4R7AB 3UKRC 3BG0A 4CI1A 2PM7B 4A11A 2IWFA 5CXBB 2H14A 4J73A 4FA9D 3RRMC 5FKRA 4A09A 3DM0A 5FA5B 2CO0A 2OVPB 4J0XA 3CIKB 3MZLA 3UVMA 4QQEA 2P9SC 4D6VA 2HJBA 5HE2B 3PSLA 4FB1D 3EI2B 2I3TA 3PE7A 3ZWLB 4L9OA 3HFQA 3AL8A 2PM9B 4Y7RA 1JMZB 2CE8A 4CC9A 3PSCB 4H5JA 3SHFA 3NVQA 4G56B 5CYKA 1GP2B 2CE9A 5GMKn 3PVUB 3C99A 1PI6A 4FWWA 5CXBA 3SMRA 4GM3A 3PVWB 3SBQA 4X63B 2CN2A 3KRXB 4PC0A 1MG3A 3JROA 4ERZA 3U4YA 3JZNA 3EI4A 4L3GD 2P9PC 3SJLD 3EU7A 4XEIC 4JXMA 3GREA 3OL2A 1S4UX 3DSMA 3C9CA 3NVNA 4EWRA 3UVOA 4FA1D 3RFHA 3C5MA 4O45A 3AFCA 2I3SA 2BBKH 2B4EA 3I7HA 1VYHC 4IA9A 2AGLA 2OK6A 3DWLC 2HKMA 3UVLA 3OKTA 3EI1A 2XL2A 2P9KC 3W15A 4ERYA 2P9IC 2H6NA 4QT8A 3MMYA 4QRJA 5EM2A 1GOTB 3EG6A 4ZOZA 5THAA 1PGUA 3CFVA 4A0AB 5HQGA 3FRXA 4J8GA 3IKOA 4CY3A 1MDAH 4CI3A 5HE3B 4ZOYA 3EMHA 5SXMA 4J86A 1TBGA 3UKUC 2XL3A 4PNKB 2J56H 2CN3A 2I0TA 4A0AA 4O9DA 3SLED 2UZXB 4CI8A 1K32A 4PSXB 2CNXA 4J8BA 4CZVA 3IIWA 4ES0A 5GXIA 3OW8A 5FKQA 4JSVC 4MK0B 4JD2C 3MKQA 2I0RA 5HE1B 5HE0B 3F3PA 3EI1B 2YB8B 4A11B 3SXTD 4U1EI 4J0WA 4FA4D 2B5NA 2H6KA 3E0CA 2O9KA 3VA6A 4Y5RD 4UI9R 3OKYB 3I89A 1SHYB 2YNOA 3L4MD 4LGNA 4ERQA 3EI2A 3FGBA 3K27A 3EI3B 5AJAA 5IJ8E 1SQJA 4GQ2P 1GG2B 2GC4A 2HKRA 2BCJB 3ODTA 2QC5A 4E5ZA 1XKSA 2HXCA 4ESGA 2OJYA 3IJ1A 2H47A 3RN0D 1N6FA 2J55H 4IMMA 1OMWB 1ERJA 4OWRA 4A2LA 1FWXA 4CY1A 5EMJB 3EWEA 4LG8A 5IGQA 3V7DB 3OTTA 3SBPA 3JPXA 2W18A 4ZOVA 2IUQA 4GGAA 5CYKB 4XYIA 4QL1A 3ORVD 1GXRA 3GFCA 5CXCB 4H5IA 4OZUA 2HESX 4GGDA 5FQDA 2PM6B 4A0BB 4A08B 5AMSA 1MG2A 3I7KA 1R5MA 5IJ7E 5I5JA 4E54A 4X3EA 1P22A 2Z2PA 4LG9A 4D0KA 2AH0A 3BWSA 1B9YA 4GQ1A 4PBZA 4J82A 5I5MA 1XIPA 4BH6A 4CZYA 5GXHA 4GM9A 3BG1A 5AFU3 3JZHA 2B5MA 3A0FA 1NR0A 5EMLB 3RFGA 5EALA 5EMMB 5C9ZB 3F3GA 2H13A 3SWSD 4A7JA 5TF2A 4CY5A 3L4OD 2XYIA 4JSXC 2Z2OA 3DXKC 4AOWA 3I7PA 2IUVA 4N14A 4A2MA 4YVDA 2HYEA 2YMUA 3CFSB 5CXCA 2AQ5A 2H9LA 2PBIB 4K3ID 1N6EA 1K8KC 4FA5D 2PM9A 2H9MA 2GC7A 5IC7A 1B9XA 3P4FA 2XU7A 2H9NA 5B4WA 3F3FA 5TEFA 5HYNB 1N6DA 2GNQA 4JT5C 4GGCA 4TZ4A 4O1QD 3RMZD 4J77A 4JT6C 2UZYB 2IWKA 2TRCB 4PXWA 3RLMD 1OLZA 5H14A 4J87A 5H17A 3IJ0A 2G9AA 1PBYB 3AL9A 1YFQA 3UVKA 3VGZA 5A2Qg 2OVRB 5EAPA 3C75H
chains in the Genus database with same CATH superfamily
4O3UB 3MZKA 3JB9L 3OKYA 4U7AA 4CI2A 4BCDA 4BUJC 1RI6A 1TYQC 2OIZA 3EI3A 4J81A 2CO0C 1O6FA 4FAND 2Q7QA 5M5VA 4JSPC 4AEZA 5EM2B 4JHPC 2JKXA 1K3IA 3SCYA 3I8CA 5TDHB 3B7FA 5TEEA 3V9FA 2IUPA 2VC2A 2EBSA 4GQBB 1VZ3A 3IULA 5C2VB 5FXYA 2VDPA 3PXTD 5IGOA 4A09B 2H6QA 3JZGA 4Z8LA 3GC3B 2B5LA 4GM8A 3JAMg 3RN1D 1U4CA 4I79A 5JWZA 3SFZA 2Z2NA 4NBMA 4ZN4A 4ZOXA 4K3JB 3J80g 3FM0A 3NIGA 4GMBA 4J84A 5FKSA 4L1QD 1L0QA 3RSEC 3ZDYA 2AGYA 3SBRA 2AGXA 3PXSD 4A08A 2J57G 2H9PA 2YNNA 2MTAH 3IUNA 4AN1A 3MKSB 1GOFA 3K72A 5K1CC 2H3XA 3EI4B 5H1MA 2XE4A 4JSNC 2AGZA 4FAVD 5EARA 1QFSA 4PBYA 3J81g 3UR4A 5I5IA 3IJCA 4FHLA 1U2VC 4GZ8A 4O3TB 3OKWA 3ULEC 3MXXA 2G99A 4J79A 3OF7A 1L5GA 4AX4A 2YBAA 4NSXA 4MMYA 5EMKB 4BL0A 5EAMA 3N0EA 3K71A 2HU8A 4KFMB 4E5ZB 3K26A 2I0SA 2P9LC 3I8EA 1NEXB 2OK4A 1JOFA 4PSWB 4QAMA 4UM9A 5IT9g 1C9LA 1JMXB 3DXMC 3EQ9A 3PXWD 5K19A 4NC4A 3V5WB 2EIEA 4J78A 1XHMA 2H68A 3K6SA 3I7OA 5FKTA 2QXVA 5GSAA 3V4PA 2EIDA 3I7NA 2VDOA 4L3HD 2IURA 4NAAA 1PEVA 3IIYA 1SQ9A 2HJ4A 2IAAA 2P9NC 3UVNA 5KDOB 1GOGA 1A0RB 4X61B 3SN6B 3JRPA 4XYHA 3KRWB 2AGWA 3I7LA 4X60B 3FCUA 2P9UC 1QNIA 2AH1A 4HDJA 3AH8B 3IVMA 4A0BA 2OVQB 4CZXA 5C2WB 3NVXA 4RE5A 3SVWD 3AL8B 5FLXg 4E54B 4G1EA 5M61A 3V4VA 1JJUB 4AMYA 1BPOA 4CY2A 3I2NA 2YNPA 3VH0A 1Q47A 3N0DA 3OL2B 4R7AB 2VDMA 3UKRC 3BG0A 4CI1A 2PM7B 3QHYB 4A11A 1JTDB 2IWFA 5CXBB 2H14A 4J73A 2HU7A 4FA9D 4Z7QA 4DNWA 3RRMC 5FFGA 5FKRA 4A09A 3DM0A 5FA5B 3ZE0A 2CO0A 2OVPB 4J0XA 3CIKB 3MZLA 3UVMA 3MVDK 4QQEA 2P9SC 4D6VA 2HJBA 3IUQA 5HE2B 1JV2A 3PSLA 3T3MA 4FB1D 4IRZA 1T2XA 3EI2B 2I3TA 5E6SA 3PE7A 3ZWLB 4L9OA 3HFQA 3AL8A 2PM9B 4Y7RA 1JMZB 2CE8A 4CC9A 3PSCB 4H5JA 3SHFA 3NVQA 3O4HA 4G56B 5CYKA 1GP2B 2CE9A 5GMKn 3PVUB 3C99A 1PI6A 4FWWA 5CXBA 4BP8A 3SMRA 4GM3A 3PVWB 3SBQA 4X63B 2CN2A 3KRXB 4PC0A 1MG3A 1VE6A 3JROA 1C9IA 4ERZA 3U4YA 3JZNA 3EI4A 4L3GD 2P9PC 3SJLD 3EU7A 4XEIC 4JXMA 3GREA 3OL2A 4G55A 1S4UX 3DSMA 3C9CA 3NVNA 3ZDXA 3ZE2A 3UVOA 4EWRA 3O4JA 4FA1D 3RFHA 3C5MA 4O45A 3AFCA 2I3SA 2BBKH 1I2MB 2B4EA 3I7HA 3T3PA 1VYHC 4IA9A 1UOPA 2AGLA 2OK6A 3DWLC 2HKMA 3UVLA 3OKTA 3EI1A 2XL2A 1TYEA 2P9KC 2VZ3A 3W15A 4ERYA 2P9IC 2H6NA 3IURA 2QZPA 4QT8A 3MMYA 4QRJA 5EM2A 1GOTB 3EG6A 4ZOZA 3KCIA 5THAA 1PGUA 3CFVA 4A0AB 5HQGA 3FRXA 4Z7OA 4NENA 5E6RA 4J8GA 1UOQA 2VDQA 1E5TA 3IKOA 4CY3A 1MDAH 4CI3A 5HE3B 2EIBA 4ZOYA 3EMHA 5SXMA 4J86A 1TBGA 3UKUC 2XL3A 4PNKB 3ZDZA 4O02A 2J56H 2CN3A 2I0TA 4A0AA 1VZ2A 4O9DA 1UOOA 3SLED 2UZXB 4WJKA 1U8CA 2EICA 4CI8A 1K32A 4PSXB 2CNXA 4J8BA 3DDUA 4CZVA 3IIWA 4ES0A 5GXIA 3OW8A 5FKQA 4JSVC 4MK0B 4RE6A 4JD2C 3MKQA 2I0RA 5FFOA 5HE1B 5HE0B 3F3PA 3EI1B 5C86A 2YB8B 4A11B 3SXTD 5HDBA 4U1EI 2QR5A 4J0WA 4FA4D 2B5NA 2H6KA 3E0CA 2O9KA 3VA6A 4Y5RD 4UI9R 3OKYB 3I89A 1SHYB 2YNOA 3L4MD 4LGNA 4ERQA 3EI2A 3FGBA 3K27A 3EI3B 5AJAA 5IJ8E 1SQJA 4GQ2P 1GG2B 2GC4A 2HKRA 2BCJB 3ODTA 2QC5A 4E5ZA 1XKSA 2HXCA 4DNUA 5M5UA 4ESGA 2OJYA 3IJ1A 2H47A 3RN0D 1N6FA 2J55H 4IMMA 1OMWB 1ERJA 4OWRA 4UM8A 4A2LA 1FWXA 4G1MA 4CY1A 5EMJB 3EWEA 4LG8A 5IGQA 3V7DB 2XZGA 3OTTA 3SBPA 3JPXA 2W18A 4ZOVA 2IUQA 4GGAA 4L1MA 5CYKB 1M1XA 4XYIA 4QL1A 3ORVD 3MUOA 1GXRA 5C92A 3GFCA 3VI3A 4Z7NA 5CXCB 4H5IA 4OZUA 2HESX 4GGDA 5FQDA 2PM6B 4A0BB 4A08B 1QFMA 5AMSA 1MG2A 3I7KA 1R5MA 5IJ7E 5I5JA 4E54A 4X3EA 1P22A 2Z2PA 4LG9A 5M5SA 4WK4A 1H2YA 2VDNA 2VZ1A 3VI4A 2AH0A 3BWSA 4D0KA 1B9YA 4MMZA 4GQ1A 4AMZA 3IJEA 4PBZA 3ZE1A 4J82A 1H2ZA 5I5MA 1E8MA 1XIPA 4BH6A 4CZYA 5GXHA 4GM9A 3BG1A 5AFU3 3JZHA 3EQ7A 2B5MA 3A0FA 1NR0A 5EMLB 1E8NA 1VE7A 3RFGA 5EALA 1UTCA 4O2WA 2WQ8A 5EMMB 3IUMA 3IUJA 1A12A 3O4GA 4WK0A 5C9ZB 3F3GA 2H13A 3SWSD 4A7JA 5TF2A 4CY5A 3L4OD 2XYIA 4JSXC 2Z2OA 4BCBA 1GOHA 3QI0A 4AN0A 3DXKC 4AOWA 3I7PA 2IUVA 4N14A 2VDRA 4A2MA 4YVDA 5M5RA 2HYEA 2YMUA 3CFSB 3MUNA 5CXCA 4MMXA 2AQ5A 2VDKA 2H9LA 2PBIB 2HU5A 4K3ID 1O6GA 1N6EA 1K8KC 4FA5D 2PM9A 2H9MA 2GC7A 4DNVA 5IC7A 1B9XA 4JHNA 3P4FA 2XU7A 2H9NA 1YR2A 3F3FA 5B4WA 5TEFA 5HYNB 1N6DA 4BCCA 2GNQA 2XDWA 4JT5C 4WK2A 1H2WA 4GGCA 4BP9A 4TZ4A 4O1QD 3RMZD 5M5TA 4J77A 4JT6C 2UZYB 2VDLA 2IWKA 5E6UA 2TRCB 4PXWA 3RLMD 1OLZA 2BKLA 3NIFA 4J87A 5H17A 5H14A 3IJ0A 3NIDA 4D9SA 2G9AA 3EQ8A 1PBYB 3AL9A 1YFQA 3O4IA 1H2XA 3GD1I 3UVKA 3VGZA 2OVRB 3FCSA 5A2Qg 5EAPA 3C75H
chains in the Genus database with same CATH topology
4O3UB 3MZKA 3JB9L 3OKYA 4U7AA 4CI2A 4BUJC 1RI6A 1TYQC 2OIZA 3EI3A 4J81A 2CO0C 4FAND 2Q7QA 4JSPC 4AEZA 5EM2B 3SCYA 3I8CA 5TDHB 3B7FA 5TEEA 3V9FA 2IUPA 2EBSA 4GQBB 5C2VB 5FXYA 3PXTD 5IGOA 4A09B 2H6QA 3JZGA 4Z8LA 2B5LA 4GM8A 3JAMg 3RN1D 1U4CA 4I79A 5JWZA 3SFZA 2Z2NA 4ZN4A 4ZOXA 4K3JB 3J80g 3FM0A 4GMBA 4J84A 5FKSA 4L1QD 1L0QA 3RSEC 2AGYA 3SBRA 2AGXA 3PXSD 4A08A 2J57G 2H9PA 2YNNA 2MTAH 3MKSB 5K1CC 2H3XA 3EI4B 5H1MA 4JSNC 2AGZA 4FAVD 5EARA 3J81g 4PBYA 3UR4A 5I5IA 3IJCA 4FHLA 1U2VC 4GZ8A 4O3TB 3OKWA 3ULEC 3MXXA 2G99A 4J79A 2YBAA 4NSXA 5EMKB 4BL0A 5EAMA 3N0EA 4KFMB 4E5ZB 3K26A 2I0SA 2P9LC 3I8EA 1NEXB 2OK4A 1JOFA 4PSWB 5IT9g 1JMXB 3DXMC 3PXWD 5K19A 3V5WB 4J78A 1XHMA 2H68A 3I7OA 5FKTA 2QXVA 5GSAA 3I7NA 4L3HD 2IURA 1PEVA 3IIYA 1SQ9A 2HJ4A 2IAAA 2P9NC 3UVNA 5KDOB 1A0RB 4X61B 3SN6B 3JRPA 4XYHA 3KRWB 2AGWA 3I7LA 4X60B 2P9UC 1QNIA 2AH1A 4HDJA 3AH8B 4A0BA 2OVQB 4CZXA 5C2WB 3NVXA 3SVWD 3AL8B 5FLXg 4E54B 1JJUB 4CY2A 3VH0A 3I2NA 2YNPA 1Q47A 3N0DA 3OL2B 4R7AB 3UKRC 3BG0A 4CI1A 2PM7B 4A11A 2IWFA 5CXBB 2H14A 4J73A 4FA9D 3RRMC 5FKRA 4A09A 3DM0A 5FA5B 2CO0A 2OVPB 4J0XA 3CIKB 3MZLA 3UVMA 4QQEA 2P9SC 4D6VA 2HJBA 5HE2B 3PSLA 4FB1D 3EI2B 2I3TA 3PE7A 3ZWLB 4L9OA 3HFQA 3AL8A 2PM9B 4Y7RA 1JMZB 2CE8A 4CC9A 3PSCB 4H5JA 3SHFA 3NVQA 4G56B 5CYKA 1GP2B 2CE9A 5GMKn 3PVUB 3C99A 1PI6A 4FWWA 5CXBA 3SMRA 4GM3A 3PVWB 3SBQA 4X63B 2CN2A 3KRXB 4PC0A 1MG3A 3JROA 4ERZA 3U4YA 3JZNA 3EI4A 4L3GD 2P9PC 3SJLD 3EU7A 4XEIC 4JXMA 3GREA 3OL2A 1S4UX 3DSMA 3C9CA 3NVNA 4EWRA 3UVOA 4FA1D 3RFHA 3C5MA 4O45A 3AFCA 2I3SA 2BBKH 2B4EA 3I7HA 1VYHC 4IA9A 2AGLA 2OK6A 3DWLC 2HKMA 3UVLA 3OKTA 3EI1A 2XL2A 2P9KC 3W15A 4ERYA 2P9IC 2H6NA 4QT8A 3MMYA 4QRJA 5EM2A 1GOTB 3EG6A 4ZOZA 5THAA 1PGUA 3CFVA 4A0AB 5HQGA 3FRXA 4J8GA 3IKOA 4CY3A 1MDAH 4CI3A 5HE3B 4ZOYA 3EMHA 5SXMA 4J86A 1TBGA 3UKUC 2XL3A 4PNKB 2J56H 2CN3A 2I0TA 4A0AA 4O9DA 3SLED 2UZXB 4CI8A 1K32A 4PSXB 2CNXA 4J8BA 4CZVA 3IIWA 4ES0A 5GXIA 3OW8A 5FKQA 4JSVC 4MK0B 4JD2C 3MKQA 2I0RA 5HE1B 5HE0B 3F3PA 3EI1B 2YB8B 4A11B 3SXTD 4U1EI 4J0WA 4FA4D 2B5NA 2H6KA 3E0CA 2O9KA 3VA6A 4Y5RD 4UI9R 3OKYB 3I89A 1SHYB 2YNOA 3L4MD 4LGNA 4ERQA 3EI2A 3FGBA 3K27A 3EI3B 5AJAA 5IJ8E 1SQJA 4GQ2P 1GG2B 2GC4A 2HKRA 2BCJB 3ODTA 2QC5A 4E5ZA 1XKSA 2HXCA 4ESGA 2OJYA 3IJ1A 2H47A 3RN0D 1N6FA 2J55H 4IMMA 1OMWB 1ERJA 4OWRA 4A2LA 1FWXA 4CY1A 5EMJB 3EWEA 4LG8A 5IGQA 3V7DB 3OTTA 3SBPA 3JPXA 2W18A 4ZOVA 2IUQA 4GGAA 5CYKB 4XYIA 4QL1A 3ORVD 1GXRA 3GFCA 5CXCB 4H5IA 4OZUA 2HESX 4GGDA 5FQDA 2PM6B 4A0BB 4A08B 5AMSA 1MG2A 3I7KA 1R5MA 5IJ7E 5I5JA 4E54A 4X3EA 1P22A 2Z2PA 4LG9A 4D0KA 2AH0A 3BWSA 1B9YA 4GQ1A 4PBZA 4J82A 5I5MA 1XIPA 4BH6A 4CZYA 5GXHA 4GM9A 3BG1A 5AFU3 3JZHA 2B5MA 3A0FA 1NR0A 5EMLB 3RFGA 5EALA 5EMMB 5C9ZB 3F3GA 2H13A 3SWSD 4A7JA 5TF2A 4CY5A 3L4OD 2XYIA 4JSXC 2Z2OA 3DXKC 4AOWA 3I7PA 2IUVA 4N14A 4A2MA 4YVDA 2HYEA 2YMUA 3CFSB 5CXCA 2AQ5A 2H9LA 2PBIB 4K3ID 1N6EA 1K8KC 4FA5D 2PM9A 2H9MA 2GC7A 5IC7A 1B9XA 3P4FA 2XU7A 2H9NA 5B4WA 3F3FA 5TEFA 5HYNB 1N6DA 2GNQA 4JT5C 4GGCA 4TZ4A 4O1QD 3RMZD 4J77A 4JT6C 2UZYB 2IWKA 2TRCB 4PXWA 3RLMD 1OLZA 5H14A 4J87A 5H17A 3IJ0A 2G9AA 1PBYB 3AL9A 1YFQA 3UVKA 3VGZA 5A2Qg 2OVRB 5EAPA 3C75H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4O3U B;  3MZK A;  3JB9 L;  3OKY A;  4U7A A;  4CI2 A;  4BUJ C;  1RI6 A;  1TYQ C;  2OIZ A;  3EI3 A;  4J81 A;  2CO0 C;  4FAN D;  2Q7Q A;  4JSP C;  4AEZ A;  5EM2 B;  3SCY A;  3I8C A;  5TDH B;  3B7F A;  5TEE A;  3V9F A;  2IUP A;  2EBS A;  4GQB B;  5C2V B;  5FXY A;  3PXT D;  5IGO A;  4A09 B;  2H6Q A;  3JZG A;  4Z8L A;  2B5L A;  4GM8 A;  3JAM g;  3RN1 D;  1U4C A;  4I79 A;  5JWZ A;  3SFZ A;  2Z2N A;  4ZN4 A;  4ZOX A;  4K3J B;  3J80 g;  3FM0 A;  4GMB A;  4J84 A;  5FKS A;  4L1Q D;  1L0Q A;  3RSE C;  2AGY A;  3SBR A;  2AGX A;  3PXS D;  4A08 A;  2J57 G;  2H9P A;  2YNN A;  2MTA H;  3MKS B;  5K1C C;  2H3X A;  3EI4 B;  5H1M A;  4JSN C;  2AGZ A;  4FAV D;  5EAR A;  3J81 g;  4PBY A;  3UR4 A;  5I5I A;  3IJC A;  4FHL A;  1U2V C;  4GZ8 A;  4O3T B;  3OKW A;  3ULE C;  3MXX A;  2G99 A;  4J79 A;  2YBA A;  4NSX A;  5EMK B;  4BL0 A;  5EAM A;  3N0E A;  4KFM B;  4E5Z B;  3K26 A;  2I0S A;  2P9L C;  3I8E A;  1NEX B;  2OK4 A;  1JOF A;  4PSW B;  5IT9 g;  1JMX B;  3DXM C;  3PXW D;  5K19 A;  3V5W B;  4J78 A;  1XHM A;  2H68 A;  3I7O A;  5FKT A;  2QXV A;  5GSA A;  3I7N A;  4L3H D;  2IUR A;  1PEV A;  3IIY A;  1SQ9 A;  2HJ4 A;  2IAA A;  2P9N C;  3UVN A;  5KDO B;  1A0R B;  4X61 B;  3SN6 B;  3JRP A;  4XYH A;  3KRW B;  2AGW A;  3I7L A;  4X60 B;  2P9U C;  1QNI A;  2AH1 A;  4HDJ A;  3AH8 B;  4A0B A;  2OVQ B;  4CZX A;  5C2W B;  3NVX A;  3SVW D;  3AL8 B;  5FLX g;  4E54 B;  1JJU B;  4CY2 A;  3VH0 A;  3I2N A;  2YNP A;  1Q47 A;  3N0D A;  3OL2 B;  4R7A B;  3UKR C;  3BG0 A;  4CI1 A;  2PM7 B;  4A11 A;  2IWF A;  5CXB B;  2H14 A;  4J73 A;  4FA9 D;  3RRM C;  5FKR A;  4A09 A;  3DM0 A;  5FA5 B;  2CO0 A;  2OVP B;  4J0X A;  3CIK B;  3MZL A;  3UVM A;  4QQE A;  2P9S C;  4D6V A;  2HJB A;  5HE2 B;  3PSL A;  4FB1 D;  3EI2 B;  2I3T A;  3PE7 A;  3ZWL B;  4L9O A;  3HFQ A;  3AL8 A;  2PM9 B;  4Y7R A;  1JMZ B;  2CE8 A;  4CC9 A;  3PSC B;  4H5J A;  3SHF A;  3NVQ A;  4G56 B;  5CYK A;  1GP2 B;  2CE9 A;  5GMK n;  3PVU B;  3C99 A;  1PI6 A;  4FWW A;  5CXB A;  3SMR A;  4GM3 A;  3PVW B;  3SBQ A;  4X63 B;  2CN2 A;  3KRX B;  4PC0 A;  1MG3 A;  3JRO A;  4ERZ A;  3U4Y A;  3JZN A;  3EI4 A;  4L3G D;  2P9P C;  3SJL D;  3EU7 A;  4XEI C;  4JXM A;  3GRE A;  3OL2 A;  1S4U X;  3DSM A;  3C9C A;  3NVN A;  4EWR A;  3UVO A;  4FA1 D;  3RFH A;  3C5M A;  4O45 A;  3AFC A;  2I3S A;  2BBK H;  2B4E A;  3I7H A;  1VYH C;  4IA9 A;  2AGL A;  2OK6 A;  3DWL C;  2HKM A;  3UVL A;  3OKT A;  3EI1 A;  2XL2 A;  2P9K C;  3W15 A;  4ERY A;  2P9I C;  2H6N A;  4QT8 A;  3MMY A;  4QRJ A;  5EM2 A;  1GOT B;  3EG6 A;  4ZOZ A;  5THA A;  1PGU A;  3CFV A;  4A0A B;  5HQG A;  3FRX A;  4J8G A;  3IKO A;  4CY3 A;  1MDA H;  4CI3 A;  5HE3 B;  4ZOY A;  3EMH A;  5SXM A;  4J86 A;  1TBG A;  3UKU C;  2XL3 A;  4PNK B;  2J56 H;  2CN3 A;  2I0T A;  4A0A A;  4O9D A;  3SLE D;  2UZX B;  4CI8 A;  1K32 A;  4PSX B;  2CNX A;  4J8B A;  4CZV A;  3IIW A;  4ES0 A;  5GXI A;  3OW8 A;  5FKQ A;  4JSV C;  4MK0 B;  4JD2 C;  3MKQ A;  2I0R A;  5HE1 B;  5HE0 B;  3F3P A;  3EI1 B;  2YB8 B;  4A11 B;  3SXT D;  4U1E I;  4J0W A;  4FA4 D;  2B5N A;  2H6K A;  3E0C A;  2O9K A;  3VA6 A;  4Y5R D;  4UI9 R;  3OKY B;  3I89 A;  1SHY B;  2YNO A;  3L4M D;  4LGN A;  4ERQ A;  3EI2 A;  3FGB A;  3K27 A;  3EI3 B;  5AJA A;  5IJ8 E;  1SQJ A;  4GQ2 P;  1GG2 B;  2GC4 A;  2HKR A;  2BCJ B;  3ODT A;  2QC5 A;  4E5Z A;  1XKS A;  2HXC A;  4ESG A;  2OJY A;  3IJ1 A;  2H47 A;  3RN0 D;  1N6F A;  2J55 H;  4IMM A;  1OMW B;  1ERJ A;  4OWR A;  4A2L A;  1FWX A;  4CY1 A;  5EMJ B;  3EWE A;  4LG8 A;  5IGQ A;  3V7D B;  3OTT A;  3SBP A;  3JPX A;  2W18 A;  4ZOV A;  2IUQ A;  4GGA A;  5CYK B;  4XYI A;  4QL1 A;  3ORV D;  1GXR A;  3GFC A;  5CXC B;  4H5I A;  4OZU A;  2HES X;  4GGD A;  5FQD A;  2PM6 B;  4A0B B;  4A08 B;  5AMS A;  1MG2 A;  3I7K A;  1R5M A;  5IJ7 E;  5I5J A;  4E54 A;  4X3E A;  1P22 A;  2Z2P A;  4LG9 A;  4D0K A;  2AH0 A;  3BWS A;  1B9Y A;  4GQ1 A;  4PBZ A;  4J82 A;  5I5M A;  1XIP A;  4BH6 A;  4CZY A;  5GXH A;  4GM9 A;  3BG1 A;  5AFU 3;  3JZH A;  2B5M A;  3A0F A;  1NR0 A;  5EML B;  3RFG A;  5EAL A;  5EMM B;  5C9Z B;  3F3G A;  2H13 A;  3SWS D;  4A7J A;  5TF2 A;  4CY5 A;  3L4O D;  2XYI A;  4JSX C;  2Z2O A;  3DXK C;  4AOW A;  3I7P A;  2IUV A;  4N14 A;  4A2M A;  4YVD A;  2HYE A;  2YMU A;  3CFS B;  5CXC A;  2AQ5 A;  2H9L A;  2PBI B;  4K3I D;  1N6E A;  1K8K C;  4FA5 D;  2PM9 A;  2H9M A;  2GC7 A;  5IC7 A;  1B9X A;  3P4F A;  2XU7 A;  2H9N A;  5B4W A;  3F3F A;  5TEF A;  5HYN B;  1N6D A;  2GNQ A;  4JT5 C;  4GGC A;  4TZ4 A;  4O1Q D;  3RMZ D;  4J77 A;  4JT6 C;  2UZY B;  2IWK A;  2TRC B;  4PXW A;  3RLM D;  1OLZ A;  5H14 A;  4J87 A;  5H17 A;  3IJ0 A;  2G9A A;  1PBY B;  3AL9 A;  1YFQ A;  3UVK A;  3VGZ A;  5A2Q g;  2OVR B;  5EAP A;  3C75 H; 
#chains in the Genus database with same CATH topology
 4O3U B;  3MZK A;  3JB9 L;  3OKY A;  4U7A A;  4CI2 A;  4BCD A;  4BUJ C;  1RI6 A;  1TYQ C;  2OIZ A;  3EI3 A;  4J81 A;  2CO0 C;  1O6F A;  4FAN D;  2Q7Q A;  5M5V A;  4JSP C;  4AEZ A;  5EM2 B;  4JHP C;  2JKX A;  1K3I A;  3SCY A;  3I8C A;  5TDH B;  3B7F A;  5TEE A;  3V9F A;  2IUP A;  2VC2 A;  2EBS A;  4GQB B;  1VZ3 A;  3IUL A;  5C2V B;  5FXY A;  2VDP A;  3PXT D;  5IGO A;  4A09 B;  2H6Q A;  3JZG A;  4Z8L A;  3GC3 B;  2B5L A;  4GM8 A;  3JAM g;  3RN1 D;  1U4C A;  4I79 A;  5JWZ A;  3SFZ A;  2Z2N A;  4NBM A;  4ZN4 A;  4ZOX A;  4K3J B;  3J80 g;  3FM0 A;  3NIG A;  4GMB A;  4J84 A;  5FKS A;  4L1Q D;  1L0Q A;  3RSE C;  3ZDY A;  2AGY A;  3SBR A;  2AGX A;  3PXS D;  4A08 A;  2J57 G;  2H9P A;  2YNN A;  2MTA H;  3IUN A;  4AN1 A;  3MKS B;  1GOF A;  3K72 A;  5K1C C;  2H3X A;  3EI4 B;  5H1M A;  2XE4 A;  4JSN C;  2AGZ A;  4FAV D;  5EAR A;  1QFS A;  4PBY A;  3J81 g;  3UR4 A;  5I5I A;  3IJC A;  4FHL A;  1U2V C;  4GZ8 A;  4O3T B;  3OKW A;  3ULE C;  3MXX A;  2G99 A;  4J79 A;  3OF7 A;  1L5G A;  4AX4 A;  2YBA A;  4NSX A;  4MMY A;  5EMK B;  4BL0 A;  5EAM A;  3N0E A;  3K71 A;  2HU8 A;  4KFM B;  4E5Z B;  3K26 A;  2I0S A;  2P9L C;  3I8E A;  1NEX B;  2OK4 A;  1JOF A;  4PSW B;  4QAM A;  4UM9 A;  5IT9 g;  1C9L A;  1JMX B;  3DXM C;  3EQ9 A;  3PXW D;  5K19 A;  4NC4 A;  3V5W B;  2EIE A;  4J78 A;  1XHM A;  2H68 A;  3K6S A;  3I7O A;  5FKT A;  2QXV A;  5GSA A;  3V4P A;  2EID A;  3I7N A;  2VDO A;  4L3H D;  2IUR A;  4NAA A;  1PEV A;  3IIY A;  1SQ9 A;  2HJ4 A;  2IAA A;  2P9N C;  3UVN A;  5KDO B;  1GOG A;  1A0R B;  4X61 B;  3SN6 B;  3JRP A;  4XYH A;  3KRW B;  2AGW A;  3I7L A;  4X60 B;  3FCU A;  2P9U C;  1QNI A;  2AH1 A;  4HDJ A;  3AH8 B;  3IVM A;  4A0B A;  2OVQ B;  4CZX A;  5C2W B;  3NVX A;  4RE5 A;  3SVW D;  3AL8 B;  5FLX g;  4E54 B;  4G1E A;  5M61 A;  3V4V A;  1JJU B;  4AMY A;  1BPO A;  4CY2 A;  3I2N A;  2YNP A;  3VH0 A;  1Q47 A;  3N0D A;  3OL2 B;  4R7A B;  2VDM A;  3UKR C;  3BG0 A;  4CI1 A;  2PM7 B;  3QHY B;  4A11 A;  1JTD B;  2IWF A;  5CXB B;  2H14 A;  4J73 A;  2HU7 A;  4FA9 D;  4Z7Q A;  4DNW A;  3RRM C;  5FFG A;  5FKR A;  4A09 A;  3DM0 A;  5FA5 B;  3ZE0 A;  2CO0 A;  2OVP B;  4J0X A;  3CIK B;  3MZL A;  3UVM A;  3MVD K;  4QQE A;  2P9S C;  4D6V A;  2HJB A;  3IUQ A;  5HE2 B;  1JV2 A;  3PSL A;  3T3M A;  4FB1 D;  4IRZ A;  1T2X A;  3EI2 B;  2I3T A;  5E6S A;  3PE7 A;  3ZWL B;  4L9O A;  3HFQ A;  3AL8 A;  2PM9 B;  4Y7R A;  1JMZ B;  2CE8 A;  4CC9 A;  3PSC B;  4H5J A;  3SHF A;  3NVQ A;  3O4H A;  4G56 B;  5CYK A;  1GP2 B;  2CE9 A;  5GMK n;  3PVU B;  3C99 A;  1PI6 A;  4FWW A;  5CXB A;  4BP8 A;  3SMR A;  4GM3 A;  3PVW B;  3SBQ A;  4X63 B;  2CN2 A;  3KRX B;  4PC0 A;  1MG3 A;  1VE6 A;  3JRO A;  1C9I A;  4ERZ A;  3U4Y A;  3JZN A;  3EI4 A;  4L3G D;  2P9P C;  3SJL D;  3EU7 A;  4XEI C;  4JXM A;  3GRE A;  3OL2 A;  4G55 A;  1S4U X;  3DSM A;  3C9C A;  3NVN A;  3ZDX A;  3ZE2 A;  3UVO A;  4EWR A;  3O4J A;  4FA1 D;  3RFH A;  3C5M A;  4O45 A;  3AFC A;  2I3S A;  2BBK H;  1I2M B;  2B4E A;  3I7H A;  3T3P A;  1VYH C;  4IA9 A;  1UOP A;  2AGL A;  2OK6 A;  3DWL C;  2HKM A;  3UVL A;  3OKT A;  3EI1 A;  2XL2 A;  1TYE A;  2P9K C;  2VZ3 A;  3W15 A;  4ERY A;  2P9I C;  2H6N A;  3IUR A;  2QZP A;  4QT8 A;  3MMY A;  4QRJ A;  5EM2 A;  1GOT B;  3EG6 A;  4ZOZ A;  3KCI A;  5THA A;  1PGU A;  3CFV A;  4A0A B;  5HQG A;  3FRX A;  4Z7O A;  4NEN A;  5E6R A;  4J8G A;  1UOQ A;  2VDQ A;  1E5T A;  3IKO A;  4CY3 A;  1MDA H;  4CI3 A;  5HE3 B;  2EIB A;  4ZOY A;  3EMH A;  5SXM A;  4J86 A;  1TBG A;  3UKU C;  2XL3 A;  4PNK B;  3ZDZ A;  4O02 A;  2J56 H;  2CN3 A;  2I0T A;  4A0A A;  1VZ2 A;  4O9D A;  1UOO A;  3SLE D;  2UZX B;  4WJK A;  1U8C A;  2EIC A;  4CI8 A;  1K32 A;  4PSX B;  2CNX A;  4J8B A;  3DDU A;  4CZV A;  3IIW A;  4ES0 A;  5GXI A;  3OW8 A;  5FKQ A;  4JSV C;  4MK0 B;  4RE6 A;  4JD2 C;  3MKQ A;  2I0R A;  5FFO A;  5HE1 B;  5HE0 B;  3F3P A;  3EI1 B;  5C86 A;  2YB8 B;  4A11 B;  3SXT D;  5HDB A;  4U1E I;  2QR5 A;  4J0W A;  4FA4 D;  2B5N A;  2H6K A;  3E0C A;  2O9K A;  3VA6 A;  4Y5R D;  4UI9 R;  3OKY B;  3I89 A;  1SHY B;  2YNO A;  3L4M D;  4LGN A;  4ERQ A;  3EI2 A;  3FGB A;  3K27 A;  3EI3 B;  5AJA A;  5IJ8 E;  1SQJ A;  4GQ2 P;  1GG2 B;  2GC4 A;  2HKR A;  2BCJ B;  3ODT A;  2QC5 A;  4E5Z A;  1XKS A;  2HXC A;  4DNU A;  5M5U A;  4ESG A;  2OJY A;  3IJ1 A;  2H47 A;  3RN0 D;  1N6F A;  2J55 H;  4IMM A;  1OMW B;  1ERJ A;  4OWR A;  4UM8 A;  4A2L A;  1FWX A;  4G1M A;  4CY1 A;  5EMJ B;  3EWE A;  4LG8 A;  5IGQ A;  3V7D B;  2XZG A;  3OTT A;  3SBP A;  3JPX A;  2W18 A;  4ZOV A;  2IUQ A;  4GGA A;  4L1M A;  5CYK B;  1M1X A;  4XYI A;  4QL1 A;  3ORV D;  3MUO A;  1GXR A;  5C92 A;  3GFC A;  3VI3 A;  4Z7N A;  5CXC B;  4H5I A;  4OZU A;  2HES X;  4GGD A;  5FQD A;  2PM6 B;  4A0B B;  4A08 B;  1QFM A;  5AMS A;  1MG2 A;  3I7K A;  1R5M A;  5IJ7 E;  5I5J A;  4E54 A;  4X3E A;  1P22 A;  2Z2P A;  4LG9 A;  5M5S A;  4WK4 A;  1H2Y A;  2VDN A;  2VZ1 A;  3VI4 A;  2AH0 A;  3BWS A;  4D0K A;  1B9Y A;  4MMZ A;  4GQ1 A;  4AMZ A;  3IJE A;  4PBZ A;  3ZE1 A;  4J82 A;  1H2Z A;  5I5M A;  1E8M A;  1XIP A;  4BH6 A;  4CZY A;  5GXH A;  4GM9 A;  3BG1 A;  5AFU 3;  3JZH A;  3EQ7 A;  2B5M A;  3A0F A;  1NR0 A;  5EML B;  1E8N A;  1VE7 A;  3RFG A;  5EAL A;  1UTC A;  4O2W A;  2WQ8 A;  5EMM B;  3IUM A;  3IUJ A;  1A12 A;  3O4G A;  4WK0 A;  5C9Z B;  3F3G A;  2H13 A;  3SWS D;  4A7J A;  5TF2 A;  4CY5 A;  3L4O D;  2XYI A;  4JSX C;  2Z2O A;  4BCB A;  1GOH A;  3QI0 A;  4AN0 A;  3DXK C;  4AOW A;  3I7P A;  2IUV A;  4N14 A;  2VDR A;  4A2M A;  4YVD A;  5M5R A;  2HYE A;  2YMU A;  3CFS B;  3MUN A;  5CXC A;  4MMX A;  2AQ5 A;  2VDK A;  2H9L A;  2PBI B;  2HU5 A;  4K3I D;  1O6G A;  1N6E A;  1K8K C;  4FA5 D;  2PM9 A;  2H9M A;  2GC7 A;  4DNV A;  5IC7 A;  1B9X A;  4JHN A;  3P4F A;  2XU7 A;  2H9N A;  1YR2 A;  3F3F A;  5B4W A;  5TEF A;  5HYN B;  1N6D A;  4BCC A;  2GNQ A;  2XDW A;  4JT5 C;  4WK2 A;  1H2W A;  4GGC A;  4BP9 A;  4TZ4 A;  4O1Q D;  3RMZ D;  5M5T A;  4J77 A;  4JT6 C;  2UZY B;  2VDL A;  2IWK A;  5E6U A;  2TRC B;  4PXW A;  3RLM D;  1OLZ A;  2BKL A;  3NIF A;  4J87 A;  5H17 A;  5H14 A;  3IJ0 A;  3NID A;  4D9S A;  2G9A A;  3EQ8 A;  1PBY B;  3AL9 A;  1YFQ A;  3O4I A;  1H2X A;  3GD1 I;  3UVK A;  3VGZ A;  2OVR B;  3FCS A;  5A2Q g;  5EAP A;  3C75 H; 
#chains in the Genus database with same CATH homology
 4O3U B;  3MZK A;  3JB9 L;  3OKY A;  4U7A A;  4CI2 A;  4BUJ C;  1RI6 A;  1TYQ C;  2OIZ A;  3EI3 A;  4J81 A;  2CO0 C;  4FAN D;  2Q7Q A;  4JSP C;  4AEZ A;  5EM2 B;  3SCY A;  3I8C A;  5TDH B;  3B7F A;  5TEE A;  3V9F A;  2IUP A;  2EBS A;  4GQB B;  5C2V B;  5FXY A;  3PXT D;  5IGO A;  4A09 B;  2H6Q A;  3JZG A;  4Z8L A;  2B5L A;  4GM8 A;  3JAM g;  3RN1 D;  1U4C A;  4I79 A;  5JWZ A;  3SFZ A;  2Z2N A;  4ZN4 A;  4ZOX A;  4K3J B;  3J80 g;  3FM0 A;  4GMB A;  4J84 A;  5FKS A;  4L1Q D;  1L0Q A;  3RSE C;  2AGY A;  3SBR A;  2AGX A;  3PXS D;  4A08 A;  2J57 G;  2H9P A;  2YNN A;  2MTA H;  3MKS B;  5K1C C;  2H3X A;  3EI4 B;  5H1M A;  4JSN C;  2AGZ A;  4FAV D;  5EAR A;  3J81 g;  4PBY A;  3UR4 A;  5I5I A;  3IJC A;  4FHL A;  1U2V C;  4GZ8 A;  4O3T B;  3OKW A;  3ULE C;  3MXX A;  2G99 A;  4J79 A;  2YBA A;  4NSX A;  5EMK B;  4BL0 A;  5EAM A;  3N0E A;  4KFM B;  4E5Z B;  3K26 A;  2I0S A;  2P9L C;  3I8E A;  1NEX B;  2OK4 A;  1JOF A;  4PSW B;  5IT9 g;  1JMX B;  3DXM C;  3PXW D;  5K19 A;  3V5W B;  4J78 A;  1XHM A;  2H68 A;  3I7O A;  5FKT A;  2QXV A;  5GSA A;  3I7N A;  4L3H D;  2IUR A;  1PEV A;  3IIY A;  1SQ9 A;  2HJ4 A;  2IAA A;  2P9N C;  3UVN A;  5KDO B;  1A0R B;  4X61 B;  3SN6 B;  3JRP A;  4XYH A;  3KRW B;  2AGW A;  3I7L A;  4X60 B;  2P9U C;  1QNI A;  2AH1 A;  4HDJ A;  3AH8 B;  4A0B A;  2OVQ B;  4CZX A;  5C2W B;  3NVX A;  3SVW D;  3AL8 B;  5FLX g;  4E54 B;  1JJU B;  4CY2 A;  3VH0 A;  3I2N A;  2YNP A;  1Q47 A;  3N0D A;  3OL2 B;  4R7A B;  3UKR C;  3BG0 A;  4CI1 A;  2PM7 B;  4A11 A;  2IWF A;  5CXB B;  2H14 A;  4J73 A;  4FA9 D;  3RRM C;  5FKR A;  4A09 A;  3DM0 A;  5FA5 B;  2CO0 A;  2OVP B;  4J0X A;  3CIK B;  3MZL A;  3UVM A;  4QQE A;  2P9S C;  4D6V A;  2HJB A;  5HE2 B;  3PSL A;  4FB1 D;  3EI2 B;  2I3T A;  3PE7 A;  3ZWL B;  4L9O A;  3HFQ A;  3AL8 A;  2PM9 B;  4Y7R A;  1JMZ B;  2CE8 A;  4CC9 A;  3PSC B;  4H5J A;  3SHF A;  3NVQ A;  4G56 B;  5CYK A;  1GP2 B;  2CE9 A;  5GMK n;  3PVU B;  3C99 A;  1PI6 A;  4FWW A;  5CXB A;  3SMR A;  4GM3 A;  3PVW B;  3SBQ A;  4X63 B;  2CN2 A;  3KRX B;  4PC0 A;  1MG3 A;  3JRO A;  4ERZ A;  3U4Y A;  3JZN A;  3EI4 A;  4L3G D;  2P9P C;  3SJL D;  3EU7 A;  4XEI C;  4JXM A;  3GRE A;  3OL2 A;  1S4U X;  3DSM A;  3C9C A;  3NVN A;  4EWR A;  3UVO A;  4FA1 D;  3RFH A;  3C5M A;  4O45 A;  3AFC A;  2I3S A;  2BBK H;  2B4E A;  3I7H A;  1VYH C;  4IA9 A;  2AGL A;  2OK6 A;  3DWL C;  2HKM A;  3UVL A;  3OKT A;  3EI1 A;  2XL2 A;  2P9K C;  3W15 A;  4ERY A;  2P9I C;  2H6N A;  4QT8 A;  3MMY A;  4QRJ A;  5EM2 A;  1GOT B;  3EG6 A;  4ZOZ A;  5THA A;  1PGU A;  3CFV A;  4A0A B;  5HQG A;  3FRX A;  4J8G A;  3IKO A;  4CY3 A;  1MDA H;  4CI3 A;  5HE3 B;  4ZOY A;  3EMH A;  5SXM A;  4J86 A;  1TBG A;  3UKU C;  2XL3 A;  4PNK B;  2J56 H;  2CN3 A;  2I0T A;  4A0A A;  4O9D A;  3SLE D;  2UZX B;  4CI8 A;  1K32 A;  4PSX B;  2CNX A;  4J8B A;  4CZV A;  3IIW A;  4ES0 A;  5GXI A;  3OW8 A;  5FKQ A;  4JSV C;  4MK0 B;  4JD2 C;  3MKQ A;  2I0R A;  5HE1 B;  5HE0 B;  3F3P A;  3EI1 B;  2YB8 B;  4A11 B;  3SXT D;  4U1E I;  4J0W A;  4FA4 D;  2B5N A;  2H6K A;  3E0C A;  2O9K A;  3VA6 A;  4Y5R D;  4UI9 R;  3OKY B;  3I89 A;  1SHY B;  2YNO A;  3L4M D;  4LGN A;  4ERQ A;  3EI2 A;  3FGB A;  3K27 A;  3EI3 B;  5AJA A;  5IJ8 E;  1SQJ A;  4GQ2 P;  1GG2 B;  2GC4 A;  2HKR A;  2BCJ B;  3ODT A;  2QC5 A;  4E5Z A;  1XKS A;  2HXC A;  4ESG A;  2OJY A;  3IJ1 A;  2H47 A;  3RN0 D;  1N6F A;  2J55 H;  4IMM A;  1OMW B;  1ERJ A;  4OWR A;  4A2L A;  1FWX A;  4CY1 A;  5EMJ B;  3EWE A;  4LG8 A;  5IGQ A;  3V7D B;  3OTT A;  3SBP A;  3JPX A;  2W18 A;  4ZOV A;  2IUQ A;  4GGA A;  5CYK B;  4XYI A;  4QL1 A;  3ORV D;  1GXR A;  3GFC A;  5CXC B;  4H5I A;  4OZU A;  2HES X;  4GGD A;  5FQD A;  2PM6 B;  4A0B B;  4A08 B;  5AMS A;  1MG2 A;  3I7K A;  1R5M A;  5IJ7 E;  5I5J A;  4E54 A;  4X3E A;  1P22 A;  2Z2P A;  4LG9 A;  4D0K A;  2AH0 A;  3BWS A;  1B9Y A;  4GQ1 A;  4PBZ A;  4J82 A;  5I5M A;  1XIP A;  4BH6 A;  4CZY A;  5GXH A;  4GM9 A;  3BG1 A;  5AFU 3;  3JZH A;  2B5M A;  3A0F A;  1NR0 A;  5EML B;  3RFG A;  5EAL A;  5EMM B;  5C9Z B;  3F3G A;  2H13 A;  3SWS D;  4A7J A;  5TF2 A;  4CY5 A;  3L4O D;  2XYI A;  4JSX C;  2Z2O A;  3DXK C;  4AOW A;  3I7P A;  2IUV A;  4N14 A;  4A2M A;  4YVD A;  2HYE A;  2YMU A;  3CFS B;  5CXC A;  2AQ5 A;  2H9L A;  2PBI B;  4K3I D;  1N6E A;  1K8K C;  4FA5 D;  2PM9 A;  2H9M A;  2GC7 A;  5IC7 A;  1B9X A;  3P4F A;  2XU7 A;  2H9N A;  5B4W A;  3F3F A;  5TEF A;  5HYN B;  1N6D A;  2GNQ A;  4JT5 C;  4GGC A;  4TZ4 A;  4O1Q D;  3RMZ D;  4J77 A;  4JT6 C;  2UZY B;  2IWK A;  2TRC B;  4PXW A;  3RLM D;  1OLZ A;  5H14 A;  4J87 A;  5H17 A;  3IJ0 A;  2G9A A;  1PBY B;  3AL9 A;  1YFQ A;  3UVK A;  3VGZ A;  5A2Q g;  2OVR B;  5EAP A;  3C75 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...