2B4EA

Crystal structure of murine coronin-1: monoclinic form
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
386
structure length
386
Chain Sequence
SKFRHVFGQPAKADQCYEDVRVSQTTWDSGFCAVNPKFMALICEASGGGAFLVLPLGKTGRVDKNVPLVCGHTAPVLDIAWCPHNDNVIASGSEDCTVMVWEIPDGGLVLPLREPVITLEGHTKRVGIVAWHPTAQNVLLSAGCDNVILVWDVGTGAAVLTLGPDVHPDTIYSVDWSRDGALICTSCRDKRVRVIEPRKGTVVAEKDRPHEGTRPVHAVFVSEGKILTTGFSRMSERQVALWDTKHLEEPLSLQELDTSSGVLLPFFDPDTNIVYLCGKGDSSIRYFEITSEAPFLHYLSMFSSKESQRGMGYMPKRGLEVNKCEIARFYKLHERKCEPIAMTVPRKSDLFQEDLYPPTAGPDPALTAEEWLGGRDAGPLLISLKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Coronin-1A
publication title The crystal structure of murine coronin-1: a regulator of actin cytoskeletal dynamics in lymphocytes
pubmed doi rcsb
source organism Mus musculus
total genus 95
structure length 386
sequence length 386
ec nomenclature
pdb deposition date 2005-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
A PF08953 DUF1899 Domain of unknown function (DUF1899)
A PF16300 WD40_4 Type of WD40 repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2b4eA01
4E54A 2J55H 4FA5D 2XL3A 4JSVC 3DXMC 4ZN4A 3K27A 2Z2PA 3KRWB 3AL9A 4GM3A 3C99A 2W18A 5FKSA 4JT6C 3MKQA 3B7FA 3FM0A 3DSMA 4PSWB 2PBIB 3SXTD 2HKRA 3I7KA 2PM7B 4E5ZA 4PBZA 2IUVA 3NVXA 4L1QD 1MG2A 4L3HD 4ERZA 3I7LA 3JAMg 2Z2OA 3IJ0A 5FXYA 4GGCA 3MKSB 3NVQA 4CC9A 4A08A 2IUQA 3IKOA 3ULEC 5EMMB 3JZHA 1JOFA 3JZGA 3VH0A 1U2VC 2P9NC 5I5MA 4FA1D 4YVDA 3C5MA 1Q47A 1FWXA 3SVWD 3OKTA 2XYIA 4R7AB 5FKRA 2P9SC 4J73A 5AFU3 3SCYA 5FLXg 3JB9L 5TEEA 4PNKB 1K32A 3MZKA 5GSAA 3HFQA 3SBQA 4BH6A 4GGDA 4L3GD 5GMKn 3PXWD 1JJUB 1QNIA 2CNXA 5FKQA 3IJ1A 2Z2NA 2P9PC 2AGXA 1NR0A 3JRPA 3E0CA 3V9FA 2P9LC 2IWFA 1XIPA 2AH1A 4PSXB 3VGZA 5H17A 3EG6A 4K3JB 5IT9g 4GGAA 4ZOXA 3SJLD 3RN1D 4XEIC 4Z8LA 4JSXC 3EI1B 2J57G 4J0WA 4E54B 5CYKA 5GXIA 3EU7A 5HE2B 3SFZA 1N6FA 3JZNA 1GP2B 3EMHA 2P9IC 4JSNC 2QC5A 4J81A 1VYHC 2YNOA 3N0DA 1K8KC 1NEXB 3UVLA 3NVNA 3RSEC 1PGUA 2UZYB 4I79A 5EAPA 3J80g 3EI4A 5JWZA 2CE8A 3MZLA 4CY2A 3RFHA 3N0EA 4FA9D 2CO0C 3SHFA 3UVOA 2I3TA 2EBSA 5A2Qg 5EMKB 4A08B 1SQ9A 5FKTA 4CY5A 4X61B 1JMXB 1JMZB 5GXHA 2YNNA 4O3TB 4GM9A 5SXMA 4ERQA 1A0RB 2H9PA 1TBGA 2MTAH 2IUPA 4N14A 3SBRA 4JSPC 3MMYA 2PM9A 2YB8B 4Y5RD 4GQ2P 5EM2A 3PVWB 2AGWA 3AL8B 3EWEA 5EARA 2H3XA 2UZXB 3BWSA 4AOWA 4J82A 4A2MA 3BG1A 3VA6A 5EALA 3ORVD 3IIYA 4H5IA 5I5IA 4GM8A 4ZOYA 2BBKH 4BL0A 4CZYA 4ESGA 4A09A 4D6VA 2B5MA 4J8GA 2BCJB 3F3FA 3OL2A 2I0RA 3PVUB 5K1CC 1P22A 2PM6B 3PXSD 5CXBA 5FA5B 4A7JA 5C9ZB 2CO0A 3IJCA 2QXVA 3V7DB 3MXXA 1R5MA 4BUJC 3CFSB 4FAND 5EAMA 3UVMA 5CYKB 4QT8A 4LG9A 4JD2C 4G56B 2H9NA 5K19A 4J87A 5TEFA 2H6KA 3FRXA 3RMZD 5IJ7E 2O9KA 3UVNA 3SLED 2B4EA 3J81g 5HE1B 2I0SA 2H68A 4A0BA 5EMJB 1YFQA 5IC7A 3W15A 2AH0A 3DXKC 2OVQB 4GQBB 3V5WB 3EI4B 1B9YA 1PBYB 2IAAA 3OKYA 5IGQA 2HKMA 3F3GA 4X63B 4CY1A 3C75H 5HE0B 2OVPB 2GNQA 1TYQC 2G9AA 2B5NA 3RRMC 4QQEA 3SWSD 3OW8A 5TDHB 3PSCB 2CN3A 4ZOVA 4GQ1A 4ES0A 3I7NA 2CN2A 5H14A 3EI3A 4A2LA 3L4OD 4MK0B 1PI6A 3KRXB 5FQDA 2YNPA 2CE9A 3P4FA 4E5ZB 5EM2B 4O45A 2AQ5A 2B5LA 4PBYA 3CIKB 4J78A 2IURA 3RN0D 4CZXA 4QL1A 4CI1A 1N6EA 4CY3A 4A09B 1GG2B 5TF2A 4UI9R 3DWLC 3I89A 5I5JA 5B4WA 2AGLA 5CXCA 4IMMA 1GOTB 3I8CA 1XKSA 5CXBB 4O9DA 3RLMD 5H1MA 4HDJA 5C2VB 1OLZA 4CI3A 2I0TA 2OK4A 3EI2A 2J56H 4A0AA 4LGNA 4A11A 2Q7QA 1GXRA 4FHLA 1ERJA 3RFGA 2H47A 4PXWA 1MDAH 4JT5C 1SQJA 3BG0A 2OIZA 2P9UC 4O1QD 5THAA 3AFCA 1SHYB 2AGYA 3I2NA 5HQGA 4CZVA 4XYIA 3I7PA 3ZWLB 3JPXA 4D0KA 4A0BB 2HESX 4XYHA 4J86A 2XU7A 4NSXA 2TRCB 1PEVA 1B9XA 2YMUA 2H13A 2GC4A 4TZ4A 3L4MD 3OKYB 2XL2A 2H6QA 1S4UX 5C2WB 5IJ8E 1U4CA 4X60B 3SN6B 4Y7RA 3UKUC 4JXMA 2OJYA 2HYEA 3JROA 4FB1D 2HXCA 3F3PA 3EI3B 3C9CA 3U4YA 1L0QA 2H9MA 3PXTD 1XHMA 1OMWB 4KFMB 4FA4D 3UKRC 4CI2A 3AL8A 5EMLB 3UR4A 4FWWA 3SMRA 3CFVA 4LG8A 1N6DA 4OWRA 5AMSA 2G99A 4H5JA 2H9LA 4U1EI 4AEZA 2IWKA 3I7HA 4QRJA 4X3EA 2H14A 5IGOA 2YBAA 3PE7A 4EWRA 4ERYA 1MG3A 2OK6A 5CXCB 3A0FA 4FAVD 4IA9A 5AJAA 3GREA 3FGBA 2GC7A 4GMBA 5HYNB 1RI6A 2PM9B 3SBPA 3UVKA 4ZOZA 5KDOB 3AH8B 4J79A 2HJBA 4A0AB 3EI2B 4A11B 4J0XA 4CI8A 4L9OA 2OVRB 2AGZA 4J77A 2HJ4A 3OKWA 4J84A 3DM0A 4J8BA 2H6NA 3I8EA 5HE3B 4OZUA 2P9KC 3OTTA 3I7OA 4GZ8A 4U7AA 2I3SA 4K3ID 3PSLA 3IIWA 4PC0A 3K26A 3GFCA 3ODTA 3OL2B 4O3UB 3EI1A
chains in the Genus database with same CATH superfamily
1C9IA 4E54A 2J55H 3K71A 4FA5D 2XL3A 4JSVC 3DXMC 4ZN4A 3K27A 2Z2PA 3KRWB 3ZE2A 3AL9A 4GM3A 3C99A 2W18A 5FKSA 4JT6C 3MKQA 1U8CA 3B7FA 3FM0A 3DSMA 2VZ1A 4PSWB 2PBIB 4UM9A 3SXTD 3I7KA 2HKRA 2PM7B 4NAAA 4E5ZA 1E8MA 4PBZA 2IUVA 3NVXA 4L1QD 1MG2A 4L3HD 4ERZA 3I7LA 3JAMg 2Z2OA 3IJ0A 5FXYA 1BPOA 4GGCA 3MKSB 3NVQA 4CC9A 4A08A 2XDWA 2IUQA 3IKOA 3ULEC 5EMMB 2WQ8A 3JZHA 1JOFA 1H2YA 3JZGA 3VH0A 1U2VC 2P9NC 5I5MA 4FA1D 4YVDA 4NC4A 3C5MA 1Q47A 1FWXA 3SVWD 3OKTA 2XYIA 4R7AB 5FKRA 2P9SC 4J73A 5AFU3 3SCYA 5FLXg 3JB9L 5TEEA 4PNKB 4BP9A 1K32A 4BCCA 1T2XA 3MZKA 5GSAA 3HFQA 3SBQA 4BH6A 1K3IA 4GGDA 4MMXA 3NIGA 2XE4A 3MVDK 1M1XA 4L3GD 5GMKn 3PXWD 1JJUB 1QNIA 2CNXA 5FKQA 4L1MA 2QR5A 5FFGA 3IJ1A 2Z2NA 2P9PC 2AGXA 1NR0A 3JRPA 3E0CA 3ZDYA 3V9FA 2P9LC 2IWFA 1XIPA 2AH1A 4PSXB 4WJKA 3VGZA 5H17A 3EG6A 4K3JB 5IT9g 4GGAA 4ZOXA 3SJLD 3RN1D 4XEIC 4Z8LA 4JSXC 1GOGA 2J57G 3EI1B 4J0WA 4Z7NA 4E54B 2VDQA 5E6UA 5CYKA 5GXIA 1O6GA 3EU7A 5HE2B 3SFZA 1N6FA 4MMYA 4WK2A 3JZNA 1GP2B 3EMHA 2P9IC 2HU7A 4JSNC 2QC5A 4J81A 4Z7QA 1VYHC 5C92A 2YNOA 3N0DA 1K8KC 2EIBA 1I2MB 1NEXB 3UVLA 3NVNA 3RSEC 1PGUA 3O4HA 2XZGA 2UZYB 4I79A 5EAPA 4BCDA 1O6FA 3J80g 3EI4A 5JWZA 2VDKA 4O2WA 1VZ2A 2CE8A 2JKXA 3EQ7A 3MZLA 3ZDZA 4CY2A 3RFHA 3N0EA 4FA9D 2CO0C 3SHFA 3UVOA 2I3TA 2EBSA 5A2Qg 3K72A 5EMKB 5HDBA 4A08B 1SQ9A 4AN0A 5FKTA 4CY5A 4X61B 1JMXB 1VZ3A 1JMZB 5GXHA 2YNNA 1UTCA 4O3TB 4GM9A 4DNWA 5SXMA 3T3PA 4ERQA 1A0RB 2H9PA 1TBGA 2MTAH 2IUPA 4N14A 3FCUA 3SBRA 1E5TA 4JSPC 3MMYA 2PM9A 2YB8B 1UOQA 4Y5RD 4GQ2P 5EM2A 5C86A 1H2WA 3PVWB 2AGWA 4Z7OA 3AL8B 3EWEA 5EARA 2H3XA 2UZXB 3BWSA 4AOWA 4J82A 5M61A 4A2MA 3BG1A 3VA6A 3IULA 5EALA 3ORVD 3IIYA 4NBMA 4H5IA 5I5IA 4GM8A 4ZOYA 3EQ8A 1YR2A 2BBKH 4BL0A 4CZYA 4ESGA 4A09A 4D6VA 2B5MA 4NENA 3ZDXA 4J8GA 3IURA 4MMZA 2BCJB 3F3FA 3OL2A 4AMYA 2I0RA 3PVUB 5K1CC 2HU5A 2VDRA 5M5RA 1P22A 3MUNA 1JV2A 2PM6B 3PXSD 5CXBA 5FA5B 4A7JA 5C9ZB 2CO0A 3IJCA 4G55A 2QXVA 2QZPA 3V7DB 4D9SA 3MXXA 1R5MA 4BUJC 3CFSB 4FAND 5EAMA 3UVMA 5CYKB 4QT8A 4LG9A 4JD2C 4G56B 2H9NA 5K19A 4J87A 5TEFA 3V4VA 2H6KA 3FRXA 3RMZD 5IJ7E 2O9KA 2VZ3A 3UVNA 3QI0A 4BP8A 3SLED 3GD1I 4AN1A 2B4EA 3J81g 5HE1B 2I0SA 2EIEA 2H68A 1QFSA 4A0BA 5EMJB 1YFQA 5IC7A 3W15A 1L5GA 3KCIA 2AH0A 3DXKC 2OVQB 1GOFA 3IUJA 4GQBB 3V5WB 3EI4B 1B9YA 1PBYB 2IAAA 3OKYA 5IGQA 2HKMA 3F3GA 3VI3A 4X63B 4CY1A 3C75H 2BKLA 5HE0B 2OVPB 3NIFA 2GNQA 1TYQC 2G9AA 2B5NA 3RRMC 4IRZA 4QQEA 3SWSD 1E8NA 3OW8A 5TDHB 5E6RA 3PSCB 2CN3A 4ZOVA 4GQ1A 4ES0A 3I7NA 2CN2A 5H14A 3EI3A 3QHYB 4A2LA 3L4OD 4AMZA 4MK0B 1PI6A 3KRXB 5FQDA 2YNPA 2VDLA 3O4IA 2VDPA 1UOOA 2CE9A 3P4FA 4E5ZB 5EM2B 4O45A 2AQ5A 2B5LA 4JHPC 4PBYA 3K6SA 3CIKB 4J78A 4AX4A 2IURA 3RN0D 1A12A 4BCBA 4CZXA 4QL1A 4CI1A 5M5VA 1N6EA 2VDNA 4CY3A 4A09B 1GG2B 5TF2A 4UI9R 3DWLC 3I89A 5M5TA 1H2XA 5I5JA 5B4WA 2AGLA 5CXCA 4IMMA 1GOTB 3I8CA 1XKSA 5CXBB 4O9DA 1VE7A 3RLMD 1TYEA 5H1MA 4HDJA 3ZE0A 5C2VB 1OLZA 4CI3A 4G1MA 2I0TA 2OK4A 2VDMA 2J56H 3EI2A 4LGNA 3DDUA 4A11A 4A0AA 2Q7QA 1GXRA 4FHLA 1ERJA 3RFGA 2H47A 4PXWA 3NIDA 4RE5A 1MDAH 4JT5C 4DNUA 1SQJA 3EQ9A 3BG0A 2OIZA 2P9UC 4O1QD 3OF7A 5THAA 3MUOA 3AFCA 3V4PA 1SHYB 2AGYA 3I2NA 5HQGA 4CZVA 4XYIA 3I7PA 3ZWLB 3JPXA 4D0KA 4A0BB 2HESX 4XYHA 4J86A 2XU7A 3T3MA 4NSXA 2EIDA 1PEVA 2TRCB 1B9XA 2YMUA 2H13A 2GC4A 4TZ4A 3L4MD 3OKYB 2XL2A 2H6QA 1S4UX 4QAMA 5C2WB 4RE6A 3IUNA 5IJ8E 1U4CA 4X60B 3SN6B 4Y7RA 3UKUC 2VDOA 4JXMA 2OJYA 2HYEA 3JROA 4FB1D 2HXCA 3F3PA 3EI3B 3C9CA 3U4YA 1L0QA 2H9MA 3PXTD 1XHMA 3O4GA 1OMWB 4KFMB 4DNVA 4FA4D 3UKRC 4CI2A 3AL8A 5EMLB 3UR4A 4G1EA 4FWWA 3SMRA 4JHNA 3O4JA 3CFVA 4LG8A 3FCSA 1N6DA 4OWRA 5AMSA 1GOHA 2G99A 4H5JA 2H9LA 1C9LA 4U1EI 4AEZA 2IWKA 5M5UA 3I7HA 1QFMA 4UM8A 4QRJA 4X3EA 1UOPA 2H14A 5IGOA 2YBAA 3PE7A 4EWRA 4WK0A 3IUQA 2VC2A 4ERYA 1MG3A 2OK6A 4O02A 3IVMA 5CXCB 3A0FA 4FAVD 4IA9A 1H2ZA 5AJAA 3GREA 3FGBA 2GC7A 4GMBA 5HYNB 1RI6A 2PM9B 3SBPA 1JTDB 3UVKA 4ZOZA 5KDOB 3AH8B 4J79A 2HJBA 4A0AB 3EI2B 4A11B 4J0XA 3IJEA 3OL2B 4CI8A 5M5SA 4L9OA 2OVRB 2AGZA 4J77A 3VI4A 2HJ4A 3OKWA 4J84A 3ZE1A 3DM0A 4J8BA 2H6NA 3I8EA 5HE3B 2P9KC 4OZUA 3IUMA 3OTTA 3I7OA 3GC3B 4GZ8A 4U7AA 2I3SA 4K3ID 1VE6A 4WK4A 3PSLA 3IIWA 2EICA 4PC0A 3K26A 3GFCA 3ODTA 5FFOA 2HU8A 5E6SA 4O3UB 3EI1A
chains in the Genus database with same CATH topology
4E54A 2J55H 4FA5D 2XL3A 4JSVC 3DXMC 4ZN4A 3K27A 2Z2PA 3KRWB 3AL9A 4GM3A 3C99A 2W18A 5FKSA 4JT6C 3MKQA 3B7FA 3FM0A 3DSMA 4PSWB 2PBIB 3SXTD 2HKRA 3I7KA 2PM7B 4E5ZA 4PBZA 2IUVA 3NVXA 4L1QD 1MG2A 4L3HD 4ERZA 3I7LA 3JAMg 2Z2OA 3IJ0A 5FXYA 4GGCA 3MKSB 3NVQA 4CC9A 4A08A 2IUQA 3IKOA 3ULEC 5EMMB 3JZHA 1JOFA 3JZGA 3VH0A 1U2VC 2P9NC 5I5MA 4FA1D 4YVDA 3C5MA 1Q47A 1FWXA 3SVWD 3OKTA 2XYIA 4R7AB 5FKRA 2P9SC 4J73A 5AFU3 3SCYA 5FLXg 3JB9L 5TEEA 4PNKB 1K32A 3MZKA 5GSAA 3HFQA 3SBQA 4BH6A 4GGDA 4L3GD 5GMKn 3PXWD 1JJUB 1QNIA 2CNXA 5FKQA 3IJ1A 2Z2NA 2P9PC 2AGXA 1NR0A 3JRPA 3E0CA 3V9FA 2P9LC 2IWFA 1XIPA 2AH1A 4PSXB 3VGZA 5H17A 3EG6A 4K3JB 5IT9g 4GGAA 4ZOXA 3SJLD 3RN1D 4XEIC 4Z8LA 4JSXC 3EI1B 2J57G 4J0WA 4E54B 5CYKA 5GXIA 3EU7A 5HE2B 3SFZA 1N6FA 3JZNA 1GP2B 3EMHA 2P9IC 4JSNC 2QC5A 4J81A 1VYHC 2YNOA 3N0DA 1K8KC 1NEXB 3UVLA 3NVNA 3RSEC 1PGUA 2UZYB 4I79A 5EAPA 3J80g 3EI4A 5JWZA 2CE8A 3MZLA 4CY2A 3RFHA 3N0EA 4FA9D 2CO0C 3SHFA 3UVOA 2I3TA 2EBSA 5A2Qg 5EMKB 4A08B 1SQ9A 5FKTA 4CY5A 4X61B 1JMXB 1JMZB 5GXHA 2YNNA 4O3TB 4GM9A 5SXMA 4ERQA 1A0RB 2H9PA 1TBGA 2MTAH 2IUPA 4N14A 3SBRA 4JSPC 3MMYA 2PM9A 2YB8B 4Y5RD 4GQ2P 5EM2A 3PVWB 2AGWA 3AL8B 3EWEA 5EARA 2H3XA 2UZXB 3BWSA 4AOWA 4J82A 4A2MA 3BG1A 3VA6A 5EALA 3ORVD 3IIYA 4H5IA 5I5IA 4GM8A 4ZOYA 2BBKH 4BL0A 4CZYA 4ESGA 4A09A 4D6VA 2B5MA 4J8GA 2BCJB 3F3FA 3OL2A 2I0RA 3PVUB 5K1CC 1P22A 2PM6B 3PXSD 5CXBA 5FA5B 4A7JA 5C9ZB 2CO0A 3IJCA 2QXVA 3V7DB 3MXXA 1R5MA 4BUJC 3CFSB 4FAND 5EAMA 3UVMA 5CYKB 4QT8A 4LG9A 4JD2C 4G56B 2H9NA 5K19A 4J87A 5TEFA 2H6KA 3FRXA 3RMZD 5IJ7E 2O9KA 3UVNA 3SLED 2B4EA 3J81g 5HE1B 2I0SA 2H68A 4A0BA 5EMJB 1YFQA 5IC7A 3W15A 2AH0A 3DXKC 2OVQB 4GQBB 3V5WB 3EI4B 1B9YA 1PBYB 2IAAA 3OKYA 5IGQA 2HKMA 3F3GA 4X63B 4CY1A 3C75H 5HE0B 2OVPB 2GNQA 1TYQC 2G9AA 2B5NA 3RRMC 4QQEA 3SWSD 3OW8A 5TDHB 3PSCB 2CN3A 4ZOVA 4GQ1A 4ES0A 3I7NA 2CN2A 5H14A 3EI3A 4A2LA 3L4OD 4MK0B 1PI6A 3KRXB 5FQDA 2YNPA 2CE9A 3P4FA 4E5ZB 5EM2B 4O45A 2AQ5A 2B5LA 4PBYA 3CIKB 4J78A 2IURA 3RN0D 4CZXA 4QL1A 4CI1A 1N6EA 4CY3A 4A09B 1GG2B 5TF2A 4UI9R 3DWLC 3I89A 5I5JA 5B4WA 2AGLA 5CXCA 4IMMA 1GOTB 3I8CA 1XKSA 5CXBB 4O9DA 3RLMD 5H1MA 4HDJA 5C2VB 1OLZA 4CI3A 2I0TA 2OK4A 3EI2A 2J56H 4A0AA 4LGNA 4A11A 2Q7QA 1GXRA 4FHLA 1ERJA 3RFGA 2H47A 4PXWA 1MDAH 4JT5C 1SQJA 3BG0A 2OIZA 2P9UC 4O1QD 5THAA 3AFCA 1SHYB 2AGYA 3I2NA 5HQGA 4CZVA 4XYIA 3I7PA 3ZWLB 3JPXA 4D0KA 4A0BB 2HESX 4XYHA 4J86A 2XU7A 4NSXA 2TRCB 1PEVA 1B9XA 2YMUA 2H13A 2GC4A 4TZ4A 3L4MD 3OKYB 2XL2A 2H6QA 1S4UX 5C2WB 5IJ8E 1U4CA 4X60B 3SN6B 4Y7RA 3UKUC 4JXMA 2OJYA 2HYEA 3JROA 4FB1D 2HXCA 3F3PA 3EI3B 3C9CA 3U4YA 1L0QA 2H9MA 3PXTD 1XHMA 1OMWB 4KFMB 4FA4D 3UKRC 4CI2A 3AL8A 5EMLB 3UR4A 4FWWA 3SMRA 3CFVA 4LG8A 1N6DA 4OWRA 5AMSA 2G99A 4H5JA 2H9LA 4U1EI 4AEZA 2IWKA 3I7HA 4QRJA 4X3EA 2H14A 5IGOA 2YBAA 3PE7A 4EWRA 4ERYA 1MG3A 2OK6A 5CXCB 3A0FA 4FAVD 4IA9A 5AJAA 3GREA 3FGBA 2GC7A 4GMBA 5HYNB 1RI6A 2PM9B 3SBPA 3UVKA 4ZOZA 5KDOB 3AH8B 4J79A 2HJBA 4A0AB 3EI2B 4A11B 4J0XA 4CI8A 4L9OA 2OVRB 2AGZA 4J77A 2HJ4A 3OKWA 4J84A 3DM0A 4J8BA 2H6NA 3I8EA 5HE3B 4OZUA 2P9KC 3OTTA 3I7OA 4GZ8A 4U7AA 2I3SA 4K3ID 3PSLA 3IIWA 4PC0A 3K26A 3GFCA 3ODTA 3OL2B 4O3UB 3EI1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E54 A;  2J55 H;  4FA5 D;  2XL3 A;  4JSV C;  3DXM C;  4ZN4 A;  3K27 A;  2Z2P A;  3KRW B;  3AL9 A;  4GM3 A;  3C99 A;  2W18 A;  5FKS A;  4JT6 C;  3MKQ A;  3B7F A;  3FM0 A;  3DSM A;  4PSW B;  2PBI B;  3SXT D;  2HKR A;  3I7K A;  2PM7 B;  4E5Z A;  4PBZ A;  2IUV A;  3NVX A;  4L1Q D;  1MG2 A;  4L3H D;  4ERZ A;  3I7L A;  3JAM g;  2Z2O A;  3IJ0 A;  5FXY A;  4GGC A;  3MKS B;  3NVQ A;  4CC9 A;  4A08 A;  2IUQ A;  3IKO A;  3ULE C;  5EMM B;  3JZH A;  1JOF A;  3JZG A;  3VH0 A;  1U2V C;  2P9N C;  5I5M A;  4FA1 D;  4YVD A;  3C5M A;  1Q47 A;  1FWX A;  3SVW D;  3OKT A;  2XYI A;  4R7A B;  5FKR A;  2P9S C;  4J73 A;  5AFU 3;  3SCY A;  5FLX g;  3JB9 L;  5TEE A;  4PNK B;  1K32 A;  3MZK A;  5GSA A;  3HFQ A;  3SBQ A;  4BH6 A;  4GGD A;  4L3G D;  5GMK n;  3PXW D;  1JJU B;  1QNI A;  2CNX A;  5FKQ A;  3IJ1 A;  2Z2N A;  2P9P C;  2AGX A;  1NR0 A;  3JRP A;  3E0C A;  3V9F A;  2P9L C;  2IWF A;  1XIP A;  2AH1 A;  4PSX B;  3VGZ A;  5H17 A;  3EG6 A;  4K3J B;  5IT9 g;  4GGA A;  4ZOX A;  3SJL D;  3RN1 D;  4XEI C;  4Z8L A;  4JSX C;  3EI1 B;  2J57 G;  4J0W A;  4E54 B;  5CYK A;  5GXI A;  3EU7 A;  5HE2 B;  3SFZ A;  1N6F A;  3JZN A;  1GP2 B;  3EMH A;  2P9I C;  4JSN C;  2QC5 A;  4J81 A;  1VYH C;  2YNO A;  3N0D A;  1K8K C;  1NEX B;  3UVL A;  3NVN A;  3RSE C;  1PGU A;  2UZY B;  4I79 A;  5EAP A;  3J80 g;  3EI4 A;  5JWZ A;  2CE8 A;  3MZL A;  4CY2 A;  3RFH A;  3N0E A;  4FA9 D;  2CO0 C;  3SHF A;  3UVO A;  2I3T A;  2EBS A;  5A2Q g;  5EMK B;  4A08 B;  1SQ9 A;  5FKT A;  4CY5 A;  4X61 B;  1JMX B;  1JMZ B;  5GXH A;  2YNN A;  4O3T B;  4GM9 A;  5SXM A;  4ERQ A;  1A0R B;  2H9P A;  1TBG A;  2MTA H;  2IUP A;  4N14 A;  3SBR A;  4JSP C;  3MMY A;  2PM9 A;  2YB8 B;  4Y5R D;  4GQ2 P;  5EM2 A;  3PVW B;  2AGW A;  3AL8 B;  3EWE A;  5EAR A;  2H3X A;  2UZX B;  3BWS A;  4AOW A;  4J82 A;  4A2M A;  3BG1 A;  3VA6 A;  5EAL A;  3ORV D;  3IIY A;  4H5I A;  5I5I A;  4GM8 A;  4ZOY A;  2BBK H;  4BL0 A;  4CZY A;  4ESG A;  4A09 A;  4D6V A;  2B5M A;  4J8G A;  2BCJ B;  3F3F A;  3OL2 A;  2I0R A;  3PVU B;  5K1C C;  1P22 A;  2PM6 B;  3PXS D;  5CXB A;  5FA5 B;  4A7J A;  5C9Z B;  2CO0 A;  3IJC A;  2QXV A;  3V7D B;  3MXX A;  1R5M A;  4BUJ C;  3CFS B;  4FAN D;  5EAM A;  3UVM A;  5CYK B;  4QT8 A;  4LG9 A;  4JD2 C;  4G56 B;  2H9N A;  5K19 A;  4J87 A;  5TEF A;  2H6K A;  3FRX A;  3RMZ D;  5IJ7 E;  2O9K A;  3UVN A;  3SLE D;  2B4E A;  3J81 g;  5HE1 B;  2I0S A;  2H68 A;  4A0B A;  5EMJ B;  1YFQ A;  5IC7 A;  3W15 A;  2AH0 A;  3DXK C;  2OVQ B;  4GQB B;  3V5W B;  3EI4 B;  1B9Y A;  1PBY B;  2IAA A;  3OKY A;  5IGQ A;  2HKM A;  3F3G A;  4X63 B;  4CY1 A;  3C75 H;  5HE0 B;  2OVP B;  2GNQ A;  1TYQ C;  2G9A A;  2B5N A;  3RRM C;  4QQE A;  3SWS D;  3OW8 A;  5TDH B;  3PSC B;  2CN3 A;  4ZOV A;  4GQ1 A;  4ES0 A;  3I7N A;  2CN2 A;  5H14 A;  3EI3 A;  4A2L A;  3L4O D;  4MK0 B;  1PI6 A;  3KRX B;  5FQD A;  2YNP A;  2CE9 A;  3P4F A;  4E5Z B;  5EM2 B;  4O45 A;  2AQ5 A;  2B5L A;  4PBY A;  3CIK B;  4J78 A;  2IUR A;  3RN0 D;  4CZX A;  4QL1 A;  4CI1 A;  1N6E A;  4CY3 A;  4A09 B;  1GG2 B;  5TF2 A;  4UI9 R;  3DWL C;  3I89 A;  5I5J A;  5B4W A;  2AGL A;  5CXC A;  4IMM A;  1GOT B;  3I8C A;  1XKS A;  5CXB B;  4O9D A;  3RLM D;  5H1M A;  4HDJ A;  5C2V B;  1OLZ A;  4CI3 A;  2I0T A;  2OK4 A;  3EI2 A;  2J56 H;  4A0A A;  4LGN A;  4A11 A;  2Q7Q A;  1GXR A;  4FHL A;  1ERJ A;  3RFG A;  2H47 A;  4PXW A;  1MDA H;  4JT5 C;  1SQJ A;  3BG0 A;  2OIZ A;  2P9U C;  4O1Q D;  5THA A;  3AFC A;  1SHY B;  2AGY A;  3I2N A;  5HQG A;  4CZV A;  4XYI A;  3I7P A;  3ZWL B;  3JPX A;  4D0K A;  4A0B B;  2HES X;  4XYH A;  4J86 A;  2XU7 A;  4NSX A;  2TRC B;  1PEV A;  1B9X A;  2YMU A;  2H13 A;  2GC4 A;  4TZ4 A;  3L4M D;  3OKY B;  2XL2 A;  2H6Q A;  1S4U X;  5C2W B;  5IJ8 E;  1U4C A;  4X60 B;  3SN6 B;  4Y7R A;  3UKU C;  4JXM A;  2OJY A;  2HYE A;  3JRO A;  4FB1 D;  2HXC A;  3F3P A;  3EI3 B;  3C9C A;  3U4Y A;  1L0Q A;  2H9M A;  3PXT D;  1XHM A;  1OMW B;  4KFM B;  4FA4 D;  3UKR C;  4CI2 A;  3AL8 A;  5EML B;  3UR4 A;  4FWW A;  3SMR A;  3CFV A;  4LG8 A;  1N6D A;  4OWR A;  5AMS A;  2G99 A;  4H5J A;  2H9L A;  4U1E I;  4AEZ A;  2IWK A;  3I7H A;  4QRJ A;  4X3E A;  2H14 A;  5IGO A;  2YBA A;  3PE7 A;  4EWR A;  4ERY A;  1MG3 A;  2OK6 A;  5CXC B;  3A0F A;  4FAV D;  4IA9 A;  5AJA A;  3GRE A;  3FGB A;  2GC7 A;  4GMB A;  5HYN B;  1RI6 A;  2PM9 B;  3SBP A;  3UVK A;  4ZOZ A;  5KDO B;  3AH8 B;  4J79 A;  2HJB A;  4A0A B;  3EI2 B;  4A11 B;  4J0X A;  4CI8 A;  4L9O A;  2OVR B;  2AGZ A;  4J77 A;  2HJ4 A;  3OKW A;  4J84 A;  3DM0 A;  4J8B A;  2H6N A;  3I8E A;  5HE3 B;  4OZU A;  2P9K C;  3OTT A;  3I7O A;  4GZ8 A;  4U7A A;  2I3S A;  4K3I D;  3PSL A;  3IIW A;  4PC0 A;  3K26 A;  3GFC A;  3ODT A;  3OL2 B;  4O3U B;  3EI1 A; 
#chains in the Genus database with same CATH topology
 1C9I A;  4E54 A;  2J55 H;  3K71 A;  4FA5 D;  2XL3 A;  4JSV C;  3DXM C;  4ZN4 A;  3K27 A;  2Z2P A;  3KRW B;  3ZE2 A;  3AL9 A;  4GM3 A;  3C99 A;  2W18 A;  5FKS A;  4JT6 C;  3MKQ A;  1U8C A;  3B7F A;  3FM0 A;  3DSM A;  2VZ1 A;  4PSW B;  2PBI B;  4UM9 A;  3SXT D;  3I7K A;  2HKR A;  2PM7 B;  4NAA A;  4E5Z A;  1E8M A;  4PBZ A;  2IUV A;  3NVX A;  4L1Q D;  1MG2 A;  4L3H D;  4ERZ A;  3I7L A;  3JAM g;  2Z2O A;  3IJ0 A;  5FXY A;  1BPO A;  4GGC A;  3MKS B;  3NVQ A;  4CC9 A;  4A08 A;  2XDW A;  2IUQ A;  3IKO A;  3ULE C;  5EMM B;  2WQ8 A;  3JZH A;  1JOF A;  1H2Y A;  3JZG A;  3VH0 A;  1U2V C;  2P9N C;  5I5M A;  4FA1 D;  4YVD A;  4NC4 A;  3C5M A;  1Q47 A;  1FWX A;  3SVW D;  3OKT A;  2XYI A;  4R7A B;  5FKR A;  2P9S C;  4J73 A;  5AFU 3;  3SCY A;  5FLX g;  3JB9 L;  5TEE A;  4PNK B;  4BP9 A;  1K32 A;  4BCC A;  1T2X A;  3MZK A;  5GSA A;  3HFQ A;  3SBQ A;  4BH6 A;  1K3I A;  4GGD A;  4MMX A;  3NIG A;  2XE4 A;  3MVD K;  1M1X A;  4L3G D;  5GMK n;  3PXW D;  1JJU B;  1QNI A;  2CNX A;  5FKQ A;  4L1M A;  2QR5 A;  5FFG A;  3IJ1 A;  2Z2N A;  2P9P C;  2AGX A;  1NR0 A;  3JRP A;  3E0C A;  3ZDY A;  3V9F A;  2P9L C;  2IWF A;  1XIP A;  2AH1 A;  4PSX B;  4WJK A;  3VGZ A;  5H17 A;  3EG6 A;  4K3J B;  5IT9 g;  4GGA A;  4ZOX A;  3SJL D;  3RN1 D;  4XEI C;  4Z8L A;  4JSX C;  1GOG A;  2J57 G;  3EI1 B;  4J0W A;  4Z7N A;  4E54 B;  2VDQ A;  5E6U A;  5CYK A;  5GXI A;  1O6G A;  3EU7 A;  5HE2 B;  3SFZ A;  1N6F A;  4MMY A;  4WK2 A;  3JZN A;  1GP2 B;  3EMH A;  2P9I C;  2HU7 A;  4JSN C;  2QC5 A;  4J81 A;  4Z7Q A;  1VYH C;  5C92 A;  2YNO A;  3N0D A;  1K8K C;  2EIB A;  1I2M B;  1NEX B;  3UVL A;  3NVN A;  3RSE C;  1PGU A;  3O4H A;  2XZG A;  2UZY B;  4I79 A;  5EAP A;  4BCD A;  1O6F A;  3J80 g;  3EI4 A;  5JWZ A;  2VDK A;  4O2W A;  1VZ2 A;  2CE8 A;  2JKX A;  3EQ7 A;  3MZL A;  3ZDZ A;  4CY2 A;  3RFH A;  3N0E A;  4FA9 D;  2CO0 C;  3SHF A;  3UVO A;  2I3T A;  2EBS A;  5A2Q g;  3K72 A;  5EMK B;  5HDB A;  4A08 B;  1SQ9 A;  4AN0 A;  5FKT A;  4CY5 A;  4X61 B;  1JMX B;  1VZ3 A;  1JMZ B;  5GXH A;  2YNN A;  1UTC A;  4O3T B;  4GM9 A;  4DNW A;  5SXM A;  3T3P A;  4ERQ A;  1A0R B;  2H9P A;  1TBG A;  2MTA H;  2IUP A;  4N14 A;  3FCU A;  3SBR A;  1E5T A;  4JSP C;  3MMY A;  2PM9 A;  2YB8 B;  1UOQ A;  4Y5R D;  4GQ2 P;  5EM2 A;  5C86 A;  1H2W A;  3PVW B;  2AGW A;  4Z7O A;  3AL8 B;  3EWE A;  5EAR A;  2H3X A;  2UZX B;  3BWS A;  4AOW A;  4J82 A;  5M61 A;  4A2M A;  3BG1 A;  3VA6 A;  3IUL A;  5EAL A;  3ORV D;  3IIY A;  4NBM A;  4H5I A;  5I5I A;  4GM8 A;  4ZOY A;  3EQ8 A;  1YR2 A;  2BBK H;  4BL0 A;  4CZY A;  4ESG A;  4A09 A;  4D6V A;  2B5M A;  4NEN A;  3ZDX A;  4J8G A;  3IUR A;  4MMZ A;  2BCJ B;  3F3F A;  3OL2 A;  4AMY A;  2I0R A;  3PVU B;  5K1C C;  2HU5 A;  2VDR A;  5M5R A;  1P22 A;  3MUN A;  1JV2 A;  2PM6 B;  3PXS D;  5CXB A;  5FA5 B;  4A7J A;  5C9Z B;  2CO0 A;  3IJC A;  4G55 A;  2QXV A;  2QZP A;  3V7D B;  4D9S A;  3MXX A;  1R5M A;  4BUJ C;  3CFS B;  4FAN D;  5EAM A;  3UVM A;  5CYK B;  4QT8 A;  4LG9 A;  4JD2 C;  4G56 B;  2H9N A;  5K19 A;  4J87 A;  5TEF A;  3V4V A;  2H6K A;  3FRX A;  3RMZ D;  5IJ7 E;  2O9K A;  2VZ3 A;  3UVN A;  3QI0 A;  4BP8 A;  3SLE D;  3GD1 I;  4AN1 A;  2B4E A;  3J81 g;  5HE1 B;  2I0S A;  2EIE A;  2H68 A;  1QFS A;  4A0B A;  5EMJ B;  1YFQ A;  5IC7 A;  3W15 A;  1L5G A;  3KCI A;  2AH0 A;  3DXK C;  2OVQ B;  1GOF A;  3IUJ A;  4GQB B;  3V5W B;  3EI4 B;  1B9Y A;  1PBY B;  2IAA A;  3OKY A;  5IGQ A;  2HKM A;  3F3G A;  3VI3 A;  4X63 B;  4CY1 A;  3C75 H;  2BKL A;  5HE0 B;  2OVP B;  3NIF A;  2GNQ A;  1TYQ C;  2G9A A;  2B5N A;  3RRM C;  4IRZ A;  4QQE A;  3SWS D;  1E8N A;  3OW8 A;  5TDH B;  5E6R A;  3PSC B;  2CN3 A;  4ZOV A;  4GQ1 A;  4ES0 A;  3I7N A;  2CN2 A;  5H14 A;  3EI3 A;  3QHY B;  4A2L A;  3L4O D;  4AMZ A;  4MK0 B;  1PI6 A;  3KRX B;  5FQD A;  2YNP A;  2VDL A;  3O4I A;  2VDP A;  1UOO A;  2CE9 A;  3P4F A;  4E5Z B;  5EM2 B;  4O45 A;  2AQ5 A;  2B5L A;  4JHP C;  4PBY A;  3K6S A;  3CIK B;  4J78 A;  4AX4 A;  2IUR A;  3RN0 D;  1A12 A;  4BCB A;  4CZX A;  4QL1 A;  4CI1 A;  5M5V A;  1N6E A;  2VDN A;  4CY3 A;  4A09 B;  1GG2 B;  5TF2 A;  4UI9 R;  3DWL C;  3I89 A;  5M5T A;  1H2X A;  5I5J A;  5B4W A;  2AGL A;  5CXC A;  4IMM A;  1GOT B;  3I8C A;  1XKS A;  5CXB B;  4O9D A;  1VE7 A;  3RLM D;  1TYE A;  5H1M A;  4HDJ A;  3ZE0 A;  5C2V B;  1OLZ A;  4CI3 A;  4G1M A;  2I0T A;  2OK4 A;  2VDM A;  2J56 H;  3EI2 A;  4LGN A;  3DDU A;  4A11 A;  4A0A A;  2Q7Q A;  1GXR A;  4FHL A;  1ERJ A;  3RFG A;  2H47 A;  4PXW A;  3NID A;  4RE5 A;  1MDA H;  4JT5 C;  4DNU A;  1SQJ A;  3EQ9 A;  3BG0 A;  2OIZ A;  2P9U C;  4O1Q D;  3OF7 A;  5THA A;  3MUO A;  3AFC A;  3V4P A;  1SHY B;  2AGY A;  3I2N A;  5HQG A;  4CZV A;  4XYI A;  3I7P A;  3ZWL B;  3JPX A;  4D0K A;  4A0B B;  2HES X;  4XYH A;  4J86 A;  2XU7 A;  3T3M A;  4NSX A;  2EID A;  1PEV A;  2TRC B;  1B9X A;  2YMU A;  2H13 A;  2GC4 A;  4TZ4 A;  3L4M D;  3OKY B;  2XL2 A;  2H6Q A;  1S4U X;  4QAM A;  5C2W B;  4RE6 A;  3IUN A;  5IJ8 E;  1U4C A;  4X60 B;  3SN6 B;  4Y7R A;  3UKU C;  2VDO A;  4JXM A;  2OJY A;  2HYE A;  3JRO A;  4FB1 D;  2HXC A;  3F3P A;  3EI3 B;  3C9C A;  3U4Y A;  1L0Q A;  2H9M A;  3PXT D;  1XHM A;  3O4G A;  1OMW B;  4KFM B;  4DNV A;  4FA4 D;  3UKR C;  4CI2 A;  3AL8 A;  5EML B;  3UR4 A;  4G1E A;  4FWW A;  3SMR A;  4JHN A;  3O4J A;  3CFV A;  4LG8 A;  3FCS A;  1N6D A;  4OWR A;  5AMS A;  1GOH A;  2G99 A;  4H5J A;  2H9L A;  1C9L A;  4U1E I;  4AEZ A;  2IWK A;  5M5U A;  3I7H A;  1QFM A;  4UM8 A;  4QRJ A;  4X3E A;  1UOP A;  2H14 A;  5IGO A;  2YBA A;  3PE7 A;  4EWR A;  4WK0 A;  3IUQ A;  2VC2 A;  4ERY A;  1MG3 A;  2OK6 A;  4O02 A;  3IVM A;  5CXC B;  3A0F A;  4FAV D;  4IA9 A;  1H2Z A;  5AJA A;  3GRE A;  3FGB A;  2GC7 A;  4GMB A;  5HYN B;  1RI6 A;  2PM9 B;  3SBP A;  1JTD B;  3UVK A;  4ZOZ A;  5KDO B;  3AH8 B;  4J79 A;  2HJB A;  4A0A B;  3EI2 B;  4A11 B;  4J0X A;  3IJE A;  3OL2 B;  4CI8 A;  5M5S A;  4L9O A;  2OVR B;  2AGZ A;  4J77 A;  3VI4 A;  2HJ4 A;  3OKW A;  4J84 A;  3ZE1 A;  3DM0 A;  4J8B A;  2H6N A;  3I8E A;  5HE3 B;  2P9K C;  4OZU A;  3IUM A;  3OTT A;  3I7O A;  3GC3 B;  4GZ8 A;  4U7A A;  2I3S A;  4K3I D;  1VE6 A;  4WK4 A;  3PSL A;  3IIW A;  2EIC A;  4PC0 A;  3K26 A;  3GFC A;  3ODT A;  5FFO A;  2HU8 A;  5E6S A;  4O3U B;  3EI1 A; 
#chains in the Genus database with same CATH homology
 4E54 A;  2J55 H;  4FA5 D;  2XL3 A;  4JSV C;  3DXM C;  4ZN4 A;  3K27 A;  2Z2P A;  3KRW B;  3AL9 A;  4GM3 A;  3C99 A;  2W18 A;  5FKS A;  4JT6 C;  3MKQ A;  3B7F A;  3FM0 A;  3DSM A;  4PSW B;  2PBI B;  3SXT D;  2HKR A;  3I7K A;  2PM7 B;  4E5Z A;  4PBZ A;  2IUV A;  3NVX A;  4L1Q D;  1MG2 A;  4L3H D;  4ERZ A;  3I7L A;  3JAM g;  2Z2O A;  3IJ0 A;  5FXY A;  4GGC A;  3MKS B;  3NVQ A;  4CC9 A;  4A08 A;  2IUQ A;  3IKO A;  3ULE C;  5EMM B;  3JZH A;  1JOF A;  3JZG A;  3VH0 A;  1U2V C;  2P9N C;  5I5M A;  4FA1 D;  4YVD A;  3C5M A;  1Q47 A;  1FWX A;  3SVW D;  3OKT A;  2XYI A;  4R7A B;  5FKR A;  2P9S C;  4J73 A;  5AFU 3;  3SCY A;  5FLX g;  3JB9 L;  5TEE A;  4PNK B;  1K32 A;  3MZK A;  5GSA A;  3HFQ A;  3SBQ A;  4BH6 A;  4GGD A;  4L3G D;  5GMK n;  3PXW D;  1JJU B;  1QNI A;  2CNX A;  5FKQ A;  3IJ1 A;  2Z2N A;  2P9P C;  2AGX A;  1NR0 A;  3JRP A;  3E0C A;  3V9F A;  2P9L C;  2IWF A;  1XIP A;  2AH1 A;  4PSX B;  3VGZ A;  5H17 A;  3EG6 A;  4K3J B;  5IT9 g;  4GGA A;  4ZOX A;  3SJL D;  3RN1 D;  4XEI C;  4Z8L A;  4JSX C;  3EI1 B;  2J57 G;  4J0W A;  4E54 B;  5CYK A;  5GXI A;  3EU7 A;  5HE2 B;  3SFZ A;  1N6F A;  3JZN A;  1GP2 B;  3EMH A;  2P9I C;  4JSN C;  2QC5 A;  4J81 A;  1VYH C;  2YNO A;  3N0D A;  1K8K C;  1NEX B;  3UVL A;  3NVN A;  3RSE C;  1PGU A;  2UZY B;  4I79 A;  5EAP A;  3J80 g;  3EI4 A;  5JWZ A;  2CE8 A;  3MZL A;  4CY2 A;  3RFH A;  3N0E A;  4FA9 D;  2CO0 C;  3SHF A;  3UVO A;  2I3T A;  2EBS A;  5A2Q g;  5EMK B;  4A08 B;  1SQ9 A;  5FKT A;  4CY5 A;  4X61 B;  1JMX B;  1JMZ B;  5GXH A;  2YNN A;  4O3T B;  4GM9 A;  5SXM A;  4ERQ A;  1A0R B;  2H9P A;  1TBG A;  2MTA H;  2IUP A;  4N14 A;  3SBR A;  4JSP C;  3MMY A;  2PM9 A;  2YB8 B;  4Y5R D;  4GQ2 P;  5EM2 A;  3PVW B;  2AGW A;  3AL8 B;  3EWE A;  5EAR A;  2H3X A;  2UZX B;  3BWS A;  4AOW A;  4J82 A;  4A2M A;  3BG1 A;  3VA6 A;  5EAL A;  3ORV D;  3IIY A;  4H5I A;  5I5I A;  4GM8 A;  4ZOY A;  2BBK H;  4BL0 A;  4CZY A;  4ESG A;  4A09 A;  4D6V A;  2B5M A;  4J8G A;  2BCJ B;  3F3F A;  3OL2 A;  2I0R A;  3PVU B;  5K1C C;  1P22 A;  2PM6 B;  3PXS D;  5CXB A;  5FA5 B;  4A7J A;  5C9Z B;  2CO0 A;  3IJC A;  2QXV A;  3V7D B;  3MXX A;  1R5M A;  4BUJ C;  3CFS B;  4FAN D;  5EAM A;  3UVM A;  5CYK B;  4QT8 A;  4LG9 A;  4JD2 C;  4G56 B;  2H9N A;  5K19 A;  4J87 A;  5TEF A;  2H6K A;  3FRX A;  3RMZ D;  5IJ7 E;  2O9K A;  3UVN A;  3SLE D;  2B4E A;  3J81 g;  5HE1 B;  2I0S A;  2H68 A;  4A0B A;  5EMJ B;  1YFQ A;  5IC7 A;  3W15 A;  2AH0 A;  3DXK C;  2OVQ B;  4GQB B;  3V5W B;  3EI4 B;  1B9Y A;  1PBY B;  2IAA A;  3OKY A;  5IGQ A;  2HKM A;  3F3G A;  4X63 B;  4CY1 A;  3C75 H;  5HE0 B;  2OVP B;  2GNQ A;  1TYQ C;  2G9A A;  2B5N A;  3RRM C;  4QQE A;  3SWS D;  3OW8 A;  5TDH B;  3PSC B;  2CN3 A;  4ZOV A;  4GQ1 A;  4ES0 A;  3I7N A;  2CN2 A;  5H14 A;  3EI3 A;  4A2L A;  3L4O D;  4MK0 B;  1PI6 A;  3KRX B;  5FQD A;  2YNP A;  2CE9 A;  3P4F A;  4E5Z B;  5EM2 B;  4O45 A;  2AQ5 A;  2B5L A;  4PBY A;  3CIK B;  4J78 A;  2IUR A;  3RN0 D;  4CZX A;  4QL1 A;  4CI1 A;  1N6E A;  4CY3 A;  4A09 B;  1GG2 B;  5TF2 A;  4UI9 R;  3DWL C;  3I89 A;  5I5J A;  5B4W A;  2AGL A;  5CXC A;  4IMM A;  1GOT B;  3I8C A;  1XKS A;  5CXB B;  4O9D A;  3RLM D;  5H1M A;  4HDJ A;  5C2V B;  1OLZ A;  4CI3 A;  2I0T A;  2OK4 A;  3EI2 A;  2J56 H;  4A0A A;  4LGN A;  4A11 A;  2Q7Q A;  1GXR A;  4FHL A;  1ERJ A;  3RFG A;  2H47 A;  4PXW A;  1MDA H;  4JT5 C;  1SQJ A;  3BG0 A;  2OIZ A;  2P9U C;  4O1Q D;  5THA A;  3AFC A;  1SHY B;  2AGY A;  3I2N A;  5HQG A;  4CZV A;  4XYI A;  3I7P A;  3ZWL B;  3JPX A;  4D0K A;  4A0B B;  2HES X;  4XYH A;  4J86 A;  2XU7 A;  4NSX A;  2TRC B;  1PEV A;  1B9X A;  2YMU A;  2H13 A;  2GC4 A;  4TZ4 A;  3L4M D;  3OKY B;  2XL2 A;  2H6Q A;  1S4U X;  5C2W B;  5IJ8 E;  1U4C A;  4X60 B;  3SN6 B;  4Y7R A;  3UKU C;  4JXM A;  2OJY A;  2HYE A;  3JRO A;  4FB1 D;  2HXC A;  3F3P A;  3EI3 B;  3C9C A;  3U4Y A;  1L0Q A;  2H9M A;  3PXT D;  1XHM A;  1OMW B;  4KFM B;  4FA4 D;  3UKR C;  4CI2 A;  3AL8 A;  5EML B;  3UR4 A;  4FWW A;  3SMR A;  3CFV A;  4LG8 A;  1N6D A;  4OWR A;  5AMS A;  2G99 A;  4H5J A;  2H9L A;  4U1E I;  4AEZ A;  2IWK A;  3I7H A;  4QRJ A;  4X3E A;  2H14 A;  5IGO A;  2YBA A;  3PE7 A;  4EWR A;  4ERY A;  1MG3 A;  2OK6 A;  5CXC B;  3A0F A;  4FAV D;  4IA9 A;  5AJA A;  3GRE A;  3FGB A;  2GC7 A;  4GMB A;  5HYN B;  1RI6 A;  2PM9 B;  3SBP A;  3UVK A;  4ZOZ A;  5KDO B;  3AH8 B;  4J79 A;  2HJB A;  4A0A B;  3EI2 B;  4A11 B;  4J0X A;  4CI8 A;  4L9O A;  2OVR B;  2AGZ A;  4J77 A;  2HJ4 A;  3OKW A;  4J84 A;  3DM0 A;  4J8B A;  2H6N A;  3I8E A;  5HE3 B;  4OZU A;  2P9K C;  3OTT A;  3I7O A;  4GZ8 A;  4U7A A;  2I3S A;  4K3I D;  3PSL A;  3IIW A;  4PC0 A;  3K26 A;  3GFC A;  3ODT A;  3OL2 B;  4O3U B;  3EI1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...