2B4EA

Crystal structure of murine coronin-1: monoclinic form
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
386
structure length
386
Chain Sequence
SKFRHVFGQPAKADQCYEDVRVSQTTWDSGFCAVNPKFMALICEASGGGAFLVLPLGKTGRVDKNVPLVCGHTAPVLDIAWCPHNDNVIASGSEDCTVMVWEIPDGGLVLPLREPVITLEGHTKRVGIVAWHPTAQNVLLSAGCDNVILVWDVGTGAAVLTLGPDVHPDTIYSVDWSRDGALICTSCRDKRVRVIEPRKGTVVAEKDRPHEGTRPVHAVFVSEGKILTTGFSRMSERQVALWDTKHLEEPLSLQELDTSSGVLLPFFDPDTNIVYLCGKGDSSIRYFEITSEAPFLHYLSMFSSKESQRGMGYMPKRGLEVNKCEIARFYKLHERKCEPIAMTVPRKSDLFQEDLYPPTAGPDPALTAEEWLGGRDAGPLLISLKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coronin-1A
publication title The crystal structure of murine coronin-1: a regulator of actin cytoskeletal dynamics in lymphocytes
pubmed doi rcsb
source organism Mus musculus
molecule tags Structural protein
total genus 95
structure length 386
sequence length 386
ec nomenclature
pdb deposition date 2005-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
A PF08953 DUF1899 Domain of unknown function (DUF1899)
A PF16300 WD40_4 Type of WD40 repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2b4eA01
3EI2B 4N14A 2AGXA 3NVNA 4GZ8A 4ZOZA 2IUPA 4FA4D 3IJCA 3ULEC 4QRJA 4J81A 4BH6A 4J77A 5IGQA 1A0RB 2P9IC 3HFQA 3PVUB 4ES0A 1SQJA 3PSLA 2XL2A 1PI6A 5TDHB 2HKRA 4Z8LA 2YB8B 4BUJC 4JSPC 3V5WB 4A11A 1R5MA 5IT9g 5FKTA 3AL9A 2OVQB 1TBGA 4A09B 1SHYB 3RFHA 3J81g 1QNIA 5FKSA 3K26A 3IIYA 4E54B 3I2NA 5EALA 2PM6B 1XIPA 3PVWB 2B4EA 1K32A 4ESGA 4XYHA 3JZHA 3PXSD 2P9SC 5I5MA 2PM7B 2P9LC 3UKRC 4O3TB 4XEIC 3FM0A 5EAPA 4J8GA 5FKQA 5K1CC 3AFCA 3JB9L 5AJAA 3VH0A 4H5JA 3SWSD 3PXTD 4FWWA 5GXIA 2YBAA 1N6FA 3OW8A 4AOWA 3FGBA 4Y7RA 4MK0B 2GNQA 5THAA 3ORVD 2IUQA 3MZKA 4GGDA 4GQBB 4FA1D 5B4WA 3UVNA 1GG2B 2Z2NA 4EWRA 2QXVA 1XKSA 2P9PC 2YNPA 4A08A 2HJ4A 3PXWD 4ERZA 3RN1D 2OK6A 3C9CA 5EMKB 2OJYA 1JMXB 2QC5A 3RSEC 4TZ4A 2PM9A 4Y5RD 4CI3A 3MZLA 4AEZA 4ZOVA 5IJ7E 2CN3A 1RI6A 1MDAH 2B5MA 4A2LA 5HE1B 3I89A 5GMKn 4PNKB 5AMSA 4J0XA 3KRWB 2OIZA 5EARA 4J73A 1SQ9A 4UI9R 5EAMA 4CZXA 4XYIA 4L3GD 3GREA 4CY3A 4D6VA 1TYQC 5CXCA 3EI3B 4PXWA 2HYEA 5FXYA 1U2VC 2IAAA 4X61B 3BWSA 2CN2A 4X60B 1NEXB 2B5NA 5TEFA 5KDOB 4E5ZB 2AGZA 3V7DB 5IC7A 3MKQA 5CYKB 2YNNA 5EMJB 1PGUA 2HJBA 2TRCB 4E54A 2HKMA 3AL8B 5IGOA 5HE2B 1GP2B 3DXMC 4J82A 4GQ2P 4OWRA 5A2Qg 5FA5B 3EI4B 2O9KA 3DSMA 3K27A 3EU7A 2IWKA 4G56B 3ODTA 3CFVA 5FQDA 2W18A 2H6QA 1MG3A 3I8CA 4J0WA 3UVLA 1P22A 4IMMA 3IJ0A 4CY2A 3NVXA 4J86A 3EG6A 4O9DA 3P4FA 2AQ5A 2AH0A 3I7OA 3CFSB 3FRXA 3MKSB 3U4YA 3GFCA 2CO0A 5H17A 5TEEA 3J80g 2YNOA 2CO0C 3DM0A 4JXMA 1Q47A 4OZUA 2G9AA 3OKYB 1JOFA 4J8BA 4CY1A 2Z2OA 2IWFA 2I0SA 2H13A 4HDJA 3OTTA 2Q7QA 4GGCA 5HQGA 4CC9A 3I7HA 1NR0A 3VA6A 1ERJA 2BBKH 1B9XA 3IJ1A 2PBIB 3UKUC 3SFZA 4NSXA 2AGWA 3C75H 3F3FA 4D0KA 2H14A 2G99A 1N6EA 4FA5D 4A0AA 2OVRB 2YMUA 3W15A 2GC7A 3SHFA 4JT6C 4X3EA 3EWEA 3RLMD 4ERQA 4L9OA 2AGLA 4IA9A 5TF2A 1GOTB 4JD2C 4LG8A 2Z2PA 5SXMA 3EI2A 3I7NA 4J84A 2AGYA 4QL1A 2XU7A 2UZYB 1GXRA 4K3JB 1S4UX 3EI1B 3EI3A 3IIWA 5GXHA 2EBSA 4FB1D 3OKTA 4J78A 5EM2B 2CE9A 4PSXB 3I8EA 4U1EI 5I5JA 2H6NA 3UVMA 4H5IA 5C2VB 4CI1A 1PBYB 2HXCA 4PSWB 2AH1A 3SMRA 1VYHC 3SBPA 4E5ZA 3SLED 3I7PA 4K3ID 3SXTD 3VGZA 5CYKA 4J87A 5CXBB 3N0EA 2IURA 3BG1A 5H1MA 3AL8A 4U7AA 4GM9A 4BL0A 4A0BB 3DXKC 3UR4A 4FHLA 4GGAA 3SVWD 4YVDA 3OL2B 5I5IA 4A09A 3ZWLB 4CZVA 3RFGA 5EMMB 3IKOA 3RRMC 3SN6B 3EI4A 2H9MA 4GMBA 2J56H 2OK4A 1OMWB 4LG9A 3JRPA 4O45A 2P9KC 4QQEA 2MTAH 2HESX 3SBRA 2P9NC 4L1QD 5CXCB 2H47A 4L3HD 2H9LA 3F3GA 3SJLD 2I3SA 3EMHA 4ZOXA 2CNXA 4GQ1A 3NVQA 4GM8A 3L4OD 3BG0A 1B9YA 4CY5A 3MMYA 4J79A 3OKYA 3I7LA 3JAMg 4R7AB 4ZOYA 5GSAA 2I0TA 4I79A 3V9FA 4FAVD 3UVKA 4A11B 5K19A 5HE3B 2B5LA 1JMZB 2H68A 4JSVC 3SBQA 3PE7A 3JROA 4JT5C 3CIKB 4PBZA 2H9NA 5HYNB 3F3PA 1MG2A 1PEVA 3AH8B 2IUVA 4PBYA 2H9PA 3RN0D 3OKWA 2P9UC 4O3UB 4KFMB 2J55H 3C99A 4FA9D 2XYIA 3RMZD 4ERYA 1K8KC 4X63B 2XL3A 3L4MD 3A0FA 3UVOA 5JWZA 4JSXC 4FAND 5C2WB 4PC0A 3EI1A 4CI2A 4ZN4A 1U4CA 5EM2A 5HE0B 3JZGA 4LGNA 4GM3A 3JPXA 1OLZA 2BCJB 4A2MA 2I3TA 3C5MA 4QT8A 3PSCB 2J57G 2GC4A 4A7JA 1JJUB 4O1QD 3MXXA 4JSNC 5IJ8E 5CXBA 5FKRA 4CZYA 4CI8A 1L0QA 1XHMA 4A0BA 3DWLC 2OVPB 4A08B 5AFU3 1YFQA 2UZXB 2H3XA 3JZNA 5EMLB 2CE8A 4A0AB 3OL2A 5H14A 2H6KA 1FWXA 5FLXg 3E0CA 2I0RA 3B7FA 3KRXB 3I7KA 3SCYA 1N6DA 3N0DA 5C9ZB 2PM9B
chains in the Genus database with same CATH superfamily
3EI2B 4N14A 1H2ZA 2AGXA 3IURA 3NVNA 4GZ8A 3IUNA 2VC2A 4ZOZA 3ZDXA 2IUPA 4RE6A 4BP9A 3IJEA 4FA4D 1E8MA 3IJCA 3ULEC 4QRJA 4J81A 4BH6A 4J77A 5IGQA 1A0RB 2P9IC 3HFQA 3PVUB 4ES0A 3EQ8A 4UM8A 1SQJA 3PSLA 2XL2A 1QFMA 4Z7QA 1PI6A 5TDHB 2HKRA 4Z8LA 2YB8B 4BUJC 1UOQA 4JSPC 3V5WB 4A11A 1R5MA 5IT9g 5FKTA 2QR5A 3AL9A 2OVQB 3T3PA 1TBGA 4A09B 1SHYB 3RFHA 3V4PA 3J81g 5M61A 1QNIA 5FKSA 3K26A 3IIYA 4E54B 3I2NA 5EALA 5FFOA 2PM6B 1XIPA 2VZ1A 3PVWB 2B4EA 3FCUA 2VDQA 1K32A 1L5GA 3FCSA 4ESGA 4XYHA 3JZHA 3PXSD 2P9SC 5I5MA 2PM7B 2P9LC 2HU8A 3UKRC 4O3TB 4XEIC 1K3IA 1YR2A 3FM0A 5EAPA 4J8GA 5FKQA 5K1CC 3AFCA 3JB9L 5AJAA 3VH0A 4H5JA 3SWSD 3PXTD 4FWWA 5GXIA 1BPOA 1H2WA 4JHPC 3ZDYA 1UOPA 2YBAA 1N6FA 3O4GA 3OW8A 4AOWA 3FGBA 4Y7RA 4MK0B 2GNQA 5THAA 3MUOA 3ORVD 2IUQA 3MZKA 4GGDA 4GQBB 4FA1D 5B4WA 3UVNA 1GG2B 2Z2NA 4EWRA 2QXVA 1XKSA 2P9PC 2YNPA 4A08A 2HJ4A 2EICA 3IVMA 3PXWD 4ERZA 1VE7A 2VZ3A 4AMZA 3ZE1A 1H2XA 3RN1D 2OK6A 3C9CA 5EMKB 2OJYA 3EQ7A 1JMXB 2QC5A 3RSEC 4TZ4A 2PM9A 4Y5RD 4CI3A 3OF7A 3MZLA 4AEZA 4ZOVA 5IJ7E 2CN3A 4IRZA 1RI6A 1MDAH 1GOHA 1GOGA 2B5MA 4G1EA 4A2LA 5HE1B 3I89A 4WK2A 5GMKn 4O02A 4PNKB 5AMSA 4J0XA 3KRWB 2OIZA 5EARA 4J73A 1SQ9A 2XZGA 4UI9R 5EAMA 4CZXA 4G1MA 4XYIA 4L3GD 4BP8A 3GREA 4CY3A 4D6VA 5C92A 1TYQC 4UM9A 5CXCA 3EI3B 4PXWA 2HYEA 5M5VA 2VDNA 5FXYA 1U2VC 2IAAA 4X61B 3BWSA 2XDWA 2CN2A 3O4JA 4X60B 1NEXB 2B5NA 4NC4A 4AMYA 5M5UA 5TEFA 5KDOB 4AX4A 1GOFA 4E5ZB 3ZE2A 1C9LA 2AGZA 3V7DB 1TYEA 5IC7A 3MKQA 5CYKB 2YNNA 5EMJB 1PGUA 2HJBA 2TRCB 4E54A 2HKMA 3AL8B 5IGOA 2JKXA 5HE2B 4D9SA 1GP2B 3DXMC 4J82A 4GQ2P 4OWRA 5A2Qg 3T3MA 2VDOA 5FA5B 4MMXA 5FFGA 3EI4B 4AN1A 2O9KA 3DSMA 3K27A 3EU7A 3ZDZA 2IWKA 4G56B 3ODTA 3CFVA 5FQDA 1JV2A 2W18A 3IUJA 2H6QA 1MG3A 3I8CA 4J0WA 3UVLA 1P22A 4IMMA 3IJ0A 4CY2A 3NVXA 4L1MA 4J86A 3EG6A 4O9DA 1M1XA 3P4FA 2AQ5A 2AH0A 2HU7A 3GC3B 3NIFA 3I7OA 3CFSB 1U8CA 3FRXA 3MKSB 3ZE0A 3GFCA 3U4YA 2CO0A 5H17A 5TEEA 3J80g 2YNOA 2CO0C 3DM0A 4JXMA 1Q47A 4OZUA 1H2YA 2G9AA 5M5SA 3EQ9A 3OKYB 1JOFA 4J8BA 4CY1A 2Z2OA 2IWFA 2I0SA 2H13A 4HDJA 3OTTA 2Q7QA 4RE5A 4GGCA 5HQGA 4CC9A 3I7HA 3VI3A 1NR0A 3VA6A 1ERJA 2BBKH 1B9XA 1T2XA 4QAMA 3IJ1A 2PBIB 4AN0A 3UKUC 3SFZA 2BKLA 2EIDA 3V4VA 5E6SA 4NSXA 2AGWA 3C75H 3F3FA 4D0KA 1VE6A 4NENA 2H14A 3MVDK 4Z7NA 2G99A 1N6EA 4BCBA 4FA5D 4A0AA 2OVRB 2YMUA 3W15A 2EIEA 2GC7A 3SHFA 4JT6C 1JTDB 4X3EA 3NIDA 3EWEA 3RLMD 4ERQA 4L9OA 2AGLA 4WK0A 4Z7OA 4IA9A 2VDLA 5TF2A 1GOTB 4JD2C 4LG8A 2Z2PA 5SXMA 4NBMA 3EI2A 3I7NA 4J84A 2AGYA 4QL1A 2XU7A 2UZYB 1GXRA 4K3JB 1S4UX 3EI1B 3EI3A 3IIWA 5GXHA 2EBSA 4FB1D 3OKTA 4MMZA 3KCIA 3O4HA 4J78A 5EM2B 2CE9A 4PSXB 3DDUA 3I8EA 2VDMA 4U1EI 2H6NA 5I5JA 1A12A 3UVMA 1QFSA 4H5IA 5C2VB 4CI1A 1PBYB 2HXCA 4DNVA 4PSWB 1I2MB 1UOOA 2AH1A 3SMRA 3GD1I 1VYHC 3SBPA 4E5ZA 3SLED 3I7PA 4K3ID 3SXTD 3VGZA 5CYKA 5E6RA 4J87A 5CXBB 3N0EA 2IURA 3BG1A 5H1MA 3AL8A 4U7AA 4GM9A 4BL0A 1E5TA 4A0BB 3DXKC 3UR4A 4FHLA 4GGAA 3SVWD 4YVDA 3OL2B 5I5IA 4A09A 2HU5A 3ZWLB 4CZVA 3RFGA 5EMMB 3IKOA 3RRMC 3SN6B 3EI4A 2H9MA 4GMBA 2J56H 2OK4A 1OMWB 4LG9A 3JRPA 4O45A 2P9KC 4QQEA 2MTAH 2HESX 3SBRA 2P9NC 1UTCA 4L1QD 5CXCB 2H47A 5M5TA 4L3HD 2H9LA 3F3GA 3SJLD 2I3SA 3EMHA 4ZOXA 2CNXA 4GQ1A 3NVQA 4GM8A 3L4OD 3BG0A 3VI4A 1B9YA 4CY5A 3MMYA 4MMYA 2WQ8A 4J79A 3OKYA 2XE4A 3I7LA 3JAMg 4R7AB 4ZOYA 1O6GA 5GSAA 5E6UA 2I0TA 4I79A 3V9FA 5HDBA 4FAVD 3UVKA 4A11B 5K19A 3O4IA 3QI0A 4DNWA 5HE3B 2B5LA 1JMZB 2H68A 4JSVC 3SBQA 3PE7A 3MUNA 3JROA 4BCCA 3K6SA 4JT5C 3CIKB 3IUQA 4PBZA 2H9NA 1VZ2A 3F3PA 1MG2A 1PEVA 5HYNB 1O6FA 3AH8B 2IUVA 5M5RA 4PBYA 2H9PA 3K71A 3RN0D 3OKWA 2P9UC 2VDPA 4O3UB 4KFMB 2J55H 3C99A 4FA9D 2XYIA 3RMZD 3K72A 2EIBA 1K8KC 4X63B 4ERYA 2XL3A 3L4MD 3A0FA 3UVOA 5JWZA 4JSXC 4FAND 5C2WB 4PC0A 3EI1A 4CI2A 4ZN4A 1U4CA 4BCDA 5EM2A 4WJKA 5HE0B 3JZGA 4LGNA 4GM3A 3JPXA 4DNUA 1OLZA 2BCJB 4A2MA 1VZ3A 2I3TA 3C5MA 4QT8A 3PSCB 2J57G 2VDKA 2GC4A 4A7JA 1JJUB 4O1QD 1C9IA 3MXXA 4NAAA 4JSNC 5IJ8E 5CXBA 5FKRA 4CZYA 4JHNA 4CI8A 1L0QA 1XHMA 4A0BA 3DWLC 2OVPB 3NIGA 4A08B 1E8NA 5AFU3 1YFQA 2UZXB 2H3XA 3JZNA 4O2WA 2CE8A 5EMLB 3OL2A 2QZPA 5C86A 5H14A 4A0AB 2VDRA 2H6KA 1FWXA 3QHYB 5FLXg 3E0CA 2I0RA 3IUMA 4WK4A 3B7FA 3KRXB 4G55A 3IULA 3I7KA 3SCYA 1N6DA 3N0DA 5C9ZB 2PM9B
chains in the Genus database with same CATH topology
3EI2B 4N14A 2AGXA 3NVNA 4GZ8A 4ZOZA 2IUPA 4FA4D 3IJCA 3ULEC 4QRJA 4J81A 4BH6A 4J77A 5IGQA 1A0RB 2P9IC 3HFQA 3PVUB 4ES0A 1SQJA 3PSLA 2XL2A 1PI6A 5TDHB 2HKRA 4Z8LA 2YB8B 4BUJC 4JSPC 3V5WB 4A11A 1R5MA 5IT9g 5FKTA 3AL9A 2OVQB 1TBGA 4A09B 1SHYB 3RFHA 3J81g 1QNIA 5FKSA 3K26A 3IIYA 4E54B 3I2NA 5EALA 2PM6B 1XIPA 3PVWB 2B4EA 1K32A 4ESGA 4XYHA 3JZHA 3PXSD 2P9SC 5I5MA 2PM7B 2P9LC 3UKRC 4O3TB 4XEIC 3FM0A 5EAPA 4J8GA 5FKQA 5K1CC 3AFCA 3JB9L 5AJAA 3VH0A 4H5JA 3SWSD 3PXTD 4FWWA 5GXIA 2YBAA 1N6FA 3OW8A 4AOWA 3FGBA 4Y7RA 4MK0B 2GNQA 5THAA 3ORVD 2IUQA 3MZKA 4GGDA 4GQBB 4FA1D 5B4WA 3UVNA 1GG2B 2Z2NA 4EWRA 2QXVA 1XKSA 2P9PC 2YNPA 4A08A 2HJ4A 3PXWD 4ERZA 3RN1D 2OK6A 3C9CA 5EMKB 2OJYA 1JMXB 2QC5A 3RSEC 4TZ4A 2PM9A 4Y5RD 4CI3A 3MZLA 4AEZA 4ZOVA 5IJ7E 2CN3A 1RI6A 1MDAH 2B5MA 4A2LA 5HE1B 3I89A 5GMKn 4PNKB 5AMSA 4J0XA 3KRWB 2OIZA 5EARA 4J73A 1SQ9A 4UI9R 5EAMA 4CZXA 4XYIA 4L3GD 3GREA 4CY3A 4D6VA 1TYQC 5CXCA 3EI3B 4PXWA 2HYEA 5FXYA 1U2VC 2IAAA 4X61B 3BWSA 2CN2A 4X60B 1NEXB 2B5NA 5TEFA 5KDOB 4E5ZB 2AGZA 3V7DB 5IC7A 3MKQA 5CYKB 2YNNA 5EMJB 1PGUA 2HJBA 2TRCB 4E54A 2HKMA 3AL8B 5IGOA 5HE2B 1GP2B 3DXMC 4J82A 4GQ2P 4OWRA 5A2Qg 5FA5B 3EI4B 2O9KA 3DSMA 3K27A 3EU7A 2IWKA 4G56B 3ODTA 3CFVA 5FQDA 2W18A 2H6QA 1MG3A 3I8CA 4J0WA 3UVLA 1P22A 4IMMA 3IJ0A 4CY2A 3NVXA 4J86A 3EG6A 4O9DA 3P4FA 2AQ5A 2AH0A 3I7OA 3CFSB 3FRXA 3MKSB 3U4YA 3GFCA 2CO0A 5H17A 5TEEA 3J80g 2YNOA 2CO0C 3DM0A 4JXMA 1Q47A 4OZUA 2G9AA 3OKYB 1JOFA 4J8BA 4CY1A 2Z2OA 2IWFA 2I0SA 2H13A 4HDJA 3OTTA 2Q7QA 4GGCA 5HQGA 4CC9A 3I7HA 1NR0A 3VA6A 1ERJA 2BBKH 1B9XA 3IJ1A 2PBIB 3UKUC 3SFZA 4NSXA 2AGWA 3C75H 3F3FA 4D0KA 2H14A 2G99A 1N6EA 4FA5D 4A0AA 2OVRB 2YMUA 3W15A 2GC7A 3SHFA 4JT6C 4X3EA 3EWEA 3RLMD 4ERQA 4L9OA 2AGLA 4IA9A 5TF2A 1GOTB 4JD2C 4LG8A 2Z2PA 5SXMA 3EI2A 3I7NA 4J84A 2AGYA 4QL1A 2XU7A 2UZYB 1GXRA 4K3JB 1S4UX 3EI1B 3EI3A 3IIWA 5GXHA 2EBSA 4FB1D 3OKTA 4J78A 5EM2B 2CE9A 4PSXB 3I8EA 4U1EI 5I5JA 2H6NA 3UVMA 4H5IA 5C2VB 4CI1A 1PBYB 2HXCA 4PSWB 2AH1A 3SMRA 1VYHC 3SBPA 4E5ZA 3SLED 3I7PA 4K3ID 3SXTD 3VGZA 5CYKA 4J87A 5CXBB 3N0EA 2IURA 3BG1A 5H1MA 3AL8A 4U7AA 4GM9A 4BL0A 4A0BB 3DXKC 3UR4A 4FHLA 4GGAA 3SVWD 4YVDA 3OL2B 5I5IA 4A09A 3ZWLB 4CZVA 3RFGA 5EMMB 3IKOA 3RRMC 3SN6B 3EI4A 2H9MA 4GMBA 2J56H 2OK4A 1OMWB 4LG9A 3JRPA 4O45A 2P9KC 4QQEA 2MTAH 2HESX 3SBRA 2P9NC 4L1QD 5CXCB 2H47A 4L3HD 2H9LA 3F3GA 3SJLD 2I3SA 3EMHA 4ZOXA 2CNXA 4GQ1A 3NVQA 4GM8A 3L4OD 3BG0A 1B9YA 4CY5A 3MMYA 4J79A 3OKYA 3I7LA 3JAMg 4R7AB 4ZOYA 5GSAA 2I0TA 4I79A 3V9FA 4FAVD 3UVKA 4A11B 5K19A 5HE3B 2B5LA 1JMZB 2H68A 4JSVC 3SBQA 3PE7A 3JROA 4JT5C 3CIKB 4PBZA 2H9NA 5HYNB 3F3PA 1MG2A 1PEVA 3AH8B 2IUVA 4PBYA 2H9PA 3RN0D 3OKWA 2P9UC 4O3UB 4KFMB 2J55H 3C99A 4FA9D 2XYIA 3RMZD 4ERYA 1K8KC 4X63B 2XL3A 3L4MD 3A0FA 3UVOA 5JWZA 4JSXC 4FAND 5C2WB 4PC0A 3EI1A 4CI2A 4ZN4A 1U4CA 5EM2A 5HE0B 3JZGA 4LGNA 4GM3A 3JPXA 1OLZA 2BCJB 4A2MA 2I3TA 3C5MA 4QT8A 3PSCB 2J57G 2GC4A 4A7JA 1JJUB 4O1QD 3MXXA 4JSNC 5IJ8E 5CXBA 5FKRA 4CZYA 4CI8A 1L0QA 1XHMA 4A0BA 3DWLC 2OVPB 4A08B 5AFU3 1YFQA 2UZXB 2H3XA 3JZNA 5EMLB 2CE8A 4A0AB 3OL2A 5H14A 2H6KA 1FWXA 5FLXg 3E0CA 2I0RA 3B7FA 3KRXB 3I7KA 3SCYA 1N6DA 3N0DA 5C9ZB 2PM9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EI2 B;  4N14 A;  2AGX A;  3NVN A;  4GZ8 A;  4ZOZ A;  2IUP A;  4FA4 D;  3IJC A;  3ULE C;  4QRJ A;  4J81 A;  4BH6 A;  4J77 A;  5IGQ A;  1A0R B;  2P9I C;  3HFQ A;  3PVU B;  4ES0 A;  1SQJ A;  3PSL A;  2XL2 A;  1PI6 A;  5TDH B;  2HKR A;  4Z8L A;  2YB8 B;  4BUJ C;  4JSP C;  3V5W B;  4A11 A;  1R5M A;  5IT9 g;  5FKT A;  3AL9 A;  2OVQ B;  1TBG A;  4A09 B;  1SHY B;  3RFH A;  3J81 g;  1QNI A;  5FKS A;  3K26 A;  3IIY A;  4E54 B;  3I2N A;  5EAL A;  2PM6 B;  1XIP A;  3PVW B;  2B4E A;  1K32 A;  4ESG A;  4XYH A;  3JZH A;  3PXS D;  2P9S C;  5I5M A;  2PM7 B;  2P9L C;  3UKR C;  4O3T B;  4XEI C;  3FM0 A;  5EAP A;  4J8G A;  5FKQ A;  5K1C C;  3AFC A;  3JB9 L;  5AJA A;  3VH0 A;  4H5J A;  3SWS D;  3PXT D;  4FWW A;  5GXI A;  2YBA A;  1N6F A;  3OW8 A;  4AOW A;  3FGB A;  4Y7R A;  4MK0 B;  2GNQ A;  5THA A;  3ORV D;  2IUQ A;  3MZK A;  4GGD A;  4GQB B;  4FA1 D;  5B4W A;  3UVN A;  1GG2 B;  2Z2N A;  4EWR A;  2QXV A;  1XKS A;  2P9P C;  2YNP A;  4A08 A;  2HJ4 A;  3PXW D;  4ERZ A;  3RN1 D;  2OK6 A;  3C9C A;  5EMK B;  2OJY A;  1JMX B;  2QC5 A;  3RSE C;  4TZ4 A;  2PM9 A;  4Y5R D;  4CI3 A;  3MZL A;  4AEZ A;  4ZOV A;  5IJ7 E;  2CN3 A;  1RI6 A;  1MDA H;  2B5M A;  4A2L A;  5HE1 B;  3I89 A;  5GMK n;  4PNK B;  5AMS A;  4J0X A;  3KRW B;  2OIZ A;  5EAR A;  4J73 A;  1SQ9 A;  4UI9 R;  5EAM A;  4CZX A;  4XYI A;  4L3G D;  3GRE A;  4CY3 A;  4D6V A;  1TYQ C;  5CXC A;  3EI3 B;  4PXW A;  2HYE A;  5FXY A;  1U2V C;  2IAA A;  4X61 B;  3BWS A;  2CN2 A;  4X60 B;  1NEX B;  2B5N A;  5TEF A;  5KDO B;  4E5Z B;  2AGZ A;  3V7D B;  5IC7 A;  3MKQ A;  5CYK B;  2YNN A;  5EMJ B;  1PGU A;  2HJB A;  2TRC B;  4E54 A;  2HKM A;  3AL8 B;  5IGO A;  5HE2 B;  1GP2 B;  3DXM C;  4J82 A;  4GQ2 P;  4OWR A;  5A2Q g;  5FA5 B;  3EI4 B;  2O9K A;  3DSM A;  3K27 A;  3EU7 A;  2IWK A;  4G56 B;  3ODT A;  3CFV A;  5FQD A;  2W18 A;  2H6Q A;  1MG3 A;  3I8C A;  4J0W A;  3UVL A;  1P22 A;  4IMM A;  3IJ0 A;  4CY2 A;  3NVX A;  4J86 A;  3EG6 A;  4O9D A;  3P4F A;  2AQ5 A;  2AH0 A;  3I7O A;  3CFS B;  3FRX A;  3MKS B;  3U4Y A;  3GFC A;  2CO0 A;  5H17 A;  5TEE A;  3J80 g;  2YNO A;  2CO0 C;  3DM0 A;  4JXM A;  1Q47 A;  4OZU A;  2G9A A;  3OKY B;  1JOF A;  4J8B A;  4CY1 A;  2Z2O A;  2IWF A;  2I0S A;  2H13 A;  4HDJ A;  3OTT A;  2Q7Q A;  4GGC A;  5HQG A;  4CC9 A;  3I7H A;  1NR0 A;  3VA6 A;  1ERJ A;  2BBK H;  1B9X A;  3IJ1 A;  2PBI B;  3UKU C;  3SFZ A;  4NSX A;  2AGW A;  3C75 H;  3F3F A;  4D0K A;  2H14 A;  2G99 A;  1N6E A;  4FA5 D;  4A0A A;  2OVR B;  2YMU A;  3W15 A;  2GC7 A;  3SHF A;  4JT6 C;  4X3E A;  3EWE A;  3RLM D;  4ERQ A;  4L9O A;  2AGL A;  4IA9 A;  5TF2 A;  1GOT B;  4JD2 C;  4LG8 A;  2Z2P A;  5SXM A;  3EI2 A;  3I7N A;  4J84 A;  2AGY A;  4QL1 A;  2XU7 A;  2UZY B;  1GXR A;  4K3J B;  1S4U X;  3EI1 B;  3EI3 A;  3IIW A;  5GXH A;  2EBS A;  4FB1 D;  3OKT A;  4J78 A;  5EM2 B;  2CE9 A;  4PSX B;  3I8E A;  4U1E I;  5I5J A;  2H6N A;  3UVM A;  4H5I A;  5C2V B;  4CI1 A;  1PBY B;  2HXC A;  4PSW B;  2AH1 A;  3SMR A;  1VYH C;  3SBP A;  4E5Z A;  3SLE D;  3I7P A;  4K3I D;  3SXT D;  3VGZ A;  5CYK A;  4J87 A;  5CXB B;  3N0E A;  2IUR A;  3BG1 A;  5H1M A;  3AL8 A;  4U7A A;  4GM9 A;  4BL0 A;  4A0B B;  3DXK C;  3UR4 A;  4FHL A;  4GGA A;  3SVW D;  4YVD A;  3OL2 B;  5I5I A;  4A09 A;  3ZWL B;  4CZV A;  3RFG A;  5EMM B;  3IKO A;  3RRM C;  3SN6 B;  3EI4 A;  2H9M A;  4GMB A;  2J56 H;  2OK4 A;  1OMW B;  4LG9 A;  3JRP A;  4O45 A;  2P9K C;  4QQE A;  2MTA H;  2HES X;  3SBR A;  2P9N C;  4L1Q D;  5CXC B;  2H47 A;  4L3H D;  2H9L A;  3F3G A;  3SJL D;  2I3S A;  3EMH A;  4ZOX A;  2CNX A;  4GQ1 A;  3NVQ A;  4GM8 A;  3L4O D;  3BG0 A;  1B9Y A;  4CY5 A;  3MMY A;  4J79 A;  3OKY A;  3I7L A;  3JAM g;  4R7A B;  4ZOY A;  5GSA A;  2I0T A;  4I79 A;  3V9F A;  4FAV D;  3UVK A;  4A11 B;  5K19 A;  5HE3 B;  2B5L A;  1JMZ B;  2H68 A;  4JSV C;  3SBQ A;  3PE7 A;  3JRO A;  4JT5 C;  3CIK B;  4PBZ A;  2H9N A;  5HYN B;  3F3P A;  1MG2 A;  1PEV A;  3AH8 B;  2IUV A;  4PBY A;  2H9P A;  3RN0 D;  3OKW A;  2P9U C;  4O3U B;  4KFM B;  2J55 H;  3C99 A;  4FA9 D;  2XYI A;  3RMZ D;  4ERY A;  1K8K C;  4X63 B;  2XL3 A;  3L4M D;  3A0F A;  3UVO A;  5JWZ A;  4JSX C;  4FAN D;  5C2W B;  4PC0 A;  3EI1 A;  4CI2 A;  4ZN4 A;  1U4C A;  5EM2 A;  5HE0 B;  3JZG A;  4LGN A;  4GM3 A;  3JPX A;  1OLZ A;  2BCJ B;  4A2M A;  2I3T A;  3C5M A;  4QT8 A;  3PSC B;  2J57 G;  2GC4 A;  4A7J A;  1JJU B;  4O1Q D;  3MXX A;  4JSN C;  5IJ8 E;  5CXB A;  5FKR A;  4CZY A;  4CI8 A;  1L0Q A;  1XHM A;  4A0B A;  3DWL C;  2OVP B;  4A08 B;  5AFU 3;  1YFQ A;  2UZX B;  2H3X A;  3JZN A;  5EML B;  2CE8 A;  4A0A B;  3OL2 A;  5H14 A;  2H6K A;  1FWX A;  5FLX g;  3E0C A;  2I0R A;  3B7F A;  3KRX B;  3I7K A;  3SCY A;  1N6D A;  3N0D A;  5C9Z B;  2PM9 B; 
#chains in the Genus database with same CATH topology
 3EI2 B;  4N14 A;  1H2Z A;  2AGX A;  3IUR A;  3NVN A;  4GZ8 A;  3IUN A;  2VC2 A;  4ZOZ A;  3ZDX A;  2IUP A;  4RE6 A;  4BP9 A;  3IJE A;  4FA4 D;  1E8M A;  3IJC A;  3ULE C;  4QRJ A;  4J81 A;  4BH6 A;  4J77 A;  5IGQ A;  1A0R B;  2P9I C;  3HFQ A;  3PVU B;  4ES0 A;  3EQ8 A;  4UM8 A;  1SQJ A;  3PSL A;  2XL2 A;  1QFM A;  4Z7Q A;  1PI6 A;  5TDH B;  2HKR A;  4Z8L A;  2YB8 B;  4BUJ C;  1UOQ A;  4JSP C;  3V5W B;  4A11 A;  1R5M A;  5IT9 g;  5FKT A;  2QR5 A;  3AL9 A;  2OVQ B;  3T3P A;  1TBG A;  4A09 B;  1SHY B;  3RFH A;  3V4P A;  3J81 g;  5M61 A;  1QNI A;  5FKS A;  3K26 A;  3IIY A;  4E54 B;  3I2N A;  5EAL A;  5FFO A;  2PM6 B;  1XIP A;  2VZ1 A;  3PVW B;  2B4E A;  3FCU A;  2VDQ A;  1K32 A;  1L5G A;  3FCS A;  4ESG A;  4XYH A;  3JZH A;  3PXS D;  2P9S C;  5I5M A;  2PM7 B;  2P9L C;  2HU8 A;  3UKR C;  4O3T B;  4XEI C;  1K3I A;  1YR2 A;  3FM0 A;  5EAP A;  4J8G A;  5FKQ A;  5K1C C;  3AFC A;  3JB9 L;  5AJA A;  3VH0 A;  4H5J A;  3SWS D;  3PXT D;  4FWW A;  5GXI A;  1BPO A;  1H2W A;  4JHP C;  3ZDY A;  1UOP A;  2YBA A;  1N6F A;  3O4G A;  3OW8 A;  4AOW A;  3FGB A;  4Y7R A;  4MK0 B;  2GNQ A;  5THA A;  3MUO A;  3ORV D;  2IUQ A;  3MZK A;  4GGD A;  4GQB B;  4FA1 D;  5B4W A;  3UVN A;  1GG2 B;  2Z2N A;  4EWR A;  2QXV A;  1XKS A;  2P9P C;  2YNP A;  4A08 A;  2HJ4 A;  2EIC A;  3IVM A;  3PXW D;  4ERZ A;  1VE7 A;  2VZ3 A;  4AMZ A;  3ZE1 A;  1H2X A;  3RN1 D;  2OK6 A;  3C9C A;  5EMK B;  2OJY A;  3EQ7 A;  1JMX B;  2QC5 A;  3RSE C;  4TZ4 A;  2PM9 A;  4Y5R D;  4CI3 A;  3OF7 A;  3MZL A;  4AEZ A;  4ZOV A;  5IJ7 E;  2CN3 A;  4IRZ A;  1RI6 A;  1MDA H;  1GOH A;  1GOG A;  2B5M A;  4G1E A;  4A2L A;  5HE1 B;  3I89 A;  4WK2 A;  5GMK n;  4O02 A;  4PNK B;  5AMS A;  4J0X A;  3KRW B;  2OIZ A;  5EAR A;  4J73 A;  1SQ9 A;  2XZG A;  4UI9 R;  5EAM A;  4CZX A;  4G1M A;  4XYI A;  4L3G D;  4BP8 A;  3GRE A;  4CY3 A;  4D6V A;  5C92 A;  1TYQ C;  4UM9 A;  5CXC A;  3EI3 B;  4PXW A;  2HYE A;  5M5V A;  2VDN A;  5FXY A;  1U2V C;  2IAA A;  4X61 B;  3BWS A;  2XDW A;  2CN2 A;  3O4J A;  4X60 B;  1NEX B;  2B5N A;  4NC4 A;  4AMY A;  5M5U A;  5TEF A;  5KDO B;  4AX4 A;  1GOF A;  4E5Z B;  3ZE2 A;  1C9L A;  2AGZ A;  3V7D B;  1TYE A;  5IC7 A;  3MKQ A;  5CYK B;  2YNN A;  5EMJ B;  1PGU A;  2HJB A;  2TRC B;  4E54 A;  2HKM A;  3AL8 B;  5IGO A;  2JKX A;  5HE2 B;  4D9S A;  1GP2 B;  3DXM C;  4J82 A;  4GQ2 P;  4OWR A;  5A2Q g;  3T3M A;  2VDO A;  5FA5 B;  4MMX A;  5FFG A;  3EI4 B;  4AN1 A;  2O9K A;  3DSM A;  3K27 A;  3EU7 A;  3ZDZ A;  2IWK A;  4G56 B;  3ODT A;  3CFV A;  5FQD A;  1JV2 A;  2W18 A;  3IUJ A;  2H6Q A;  1MG3 A;  3I8C A;  4J0W A;  3UVL A;  1P22 A;  4IMM A;  3IJ0 A;  4CY2 A;  3NVX A;  4L1M A;  4J86 A;  3EG6 A;  4O9D A;  1M1X A;  3P4F A;  2AQ5 A;  2AH0 A;  2HU7 A;  3GC3 B;  3NIF A;  3I7O A;  3CFS B;  1U8C A;  3FRX A;  3MKS B;  3ZE0 A;  3GFC A;  3U4Y A;  2CO0 A;  5H17 A;  5TEE A;  3J80 g;  2YNO A;  2CO0 C;  3DM0 A;  4JXM A;  1Q47 A;  4OZU A;  1H2Y A;  2G9A A;  5M5S A;  3EQ9 A;  3OKY B;  1JOF A;  4J8B A;  4CY1 A;  2Z2O A;  2IWF A;  2I0S A;  2H13 A;  4HDJ A;  3OTT A;  2Q7Q A;  4RE5 A;  4GGC A;  5HQG A;  4CC9 A;  3I7H A;  3VI3 A;  1NR0 A;  3VA6 A;  1ERJ A;  2BBK H;  1B9X A;  1T2X A;  4QAM A;  3IJ1 A;  2PBI B;  4AN0 A;  3UKU C;  3SFZ A;  2BKL A;  2EID A;  3V4V A;  5E6S A;  4NSX A;  2AGW A;  3C75 H;  3F3F A;  4D0K A;  1VE6 A;  4NEN A;  2H14 A;  3MVD K;  4Z7N A;  2G99 A;  1N6E A;  4BCB A;  4FA5 D;  4A0A A;  2OVR B;  2YMU A;  3W15 A;  2EIE A;  2GC7 A;  3SHF A;  4JT6 C;  1JTD B;  4X3E A;  3NID A;  3EWE A;  3RLM D;  4ERQ A;  4L9O A;  2AGL A;  4WK0 A;  4Z7O A;  4IA9 A;  2VDL A;  5TF2 A;  1GOT B;  4JD2 C;  4LG8 A;  2Z2P A;  5SXM A;  4NBM A;  3EI2 A;  3I7N A;  4J84 A;  2AGY A;  4QL1 A;  2XU7 A;  2UZY B;  1GXR A;  4K3J B;  1S4U X;  3EI1 B;  3EI3 A;  3IIW A;  5GXH A;  2EBS A;  4FB1 D;  3OKT A;  4MMZ A;  3KCI A;  3O4H A;  4J78 A;  5EM2 B;  2CE9 A;  4PSX B;  3DDU A;  3I8E A;  2VDM A;  4U1E I;  2H6N A;  5I5J A;  1A12 A;  3UVM A;  1QFS A;  4H5I A;  5C2V B;  4CI1 A;  1PBY B;  2HXC A;  4DNV A;  4PSW B;  1I2M B;  1UOO A;  2AH1 A;  3SMR A;  3GD1 I;  1VYH C;  3SBP A;  4E5Z A;  3SLE D;  3I7P A;  4K3I D;  3SXT D;  3VGZ A;  5CYK A;  5E6R A;  4J87 A;  5CXB B;  3N0E A;  2IUR A;  3BG1 A;  5H1M A;  3AL8 A;  4U7A A;  4GM9 A;  4BL0 A;  1E5T A;  4A0B B;  3DXK C;  3UR4 A;  4FHL A;  4GGA A;  3SVW D;  4YVD A;  3OL2 B;  5I5I A;  4A09 A;  2HU5 A;  3ZWL B;  4CZV A;  3RFG A;  5EMM B;  3IKO A;  3RRM C;  3SN6 B;  3EI4 A;  2H9M A;  4GMB A;  2J56 H;  2OK4 A;  1OMW B;  4LG9 A;  3JRP A;  4O45 A;  2P9K C;  4QQE A;  2MTA H;  2HES X;  3SBR A;  2P9N C;  1UTC A;  4L1Q D;  5CXC B;  2H47 A;  5M5T A;  4L3H D;  2H9L A;  3F3G A;  3SJL D;  2I3S A;  3EMH A;  4ZOX A;  2CNX A;  4GQ1 A;  3NVQ A;  4GM8 A;  3L4O D;  3BG0 A;  3VI4 A;  1B9Y A;  4CY5 A;  3MMY A;  4MMY A;  2WQ8 A;  4J79 A;  3OKY A;  2XE4 A;  3I7L A;  3JAM g;  4R7A B;  4ZOY A;  1O6G A;  5GSA A;  5E6U A;  2I0T A;  4I79 A;  3V9F A;  5HDB A;  4FAV D;  3UVK A;  4A11 B;  5K19 A;  3O4I A;  3QI0 A;  4DNW A;  5HE3 B;  2B5L A;  1JMZ B;  2H68 A;  4JSV C;  3SBQ A;  3PE7 A;  3MUN A;  3JRO A;  4BCC A;  3K6S A;  4JT5 C;  3CIK B;  3IUQ A;  4PBZ A;  2H9N A;  1VZ2 A;  3F3P A;  1MG2 A;  1PEV A;  5HYN B;  1O6F A;  3AH8 B;  2IUV A;  5M5R A;  4PBY A;  2H9P A;  3K71 A;  3RN0 D;  3OKW A;  2P9U C;  2VDP A;  4O3U B;  4KFM B;  2J55 H;  3C99 A;  4FA9 D;  2XYI A;  3RMZ D;  3K72 A;  2EIB A;  1K8K C;  4X63 B;  4ERY A;  2XL3 A;  3L4M D;  3A0F A;  3UVO A;  5JWZ A;  4JSX C;  4FAN D;  5C2W B;  4PC0 A;  3EI1 A;  4CI2 A;  4ZN4 A;  1U4C A;  4BCD A;  5EM2 A;  4WJK A;  5HE0 B;  3JZG A;  4LGN A;  4GM3 A;  3JPX A;  4DNU A;  1OLZ A;  2BCJ B;  4A2M A;  1VZ3 A;  2I3T A;  3C5M A;  4QT8 A;  3PSC B;  2J57 G;  2VDK A;  2GC4 A;  4A7J A;  1JJU B;  4O1Q D;  1C9I A;  3MXX A;  4NAA A;  4JSN C;  5IJ8 E;  5CXB A;  5FKR A;  4CZY A;  4JHN A;  4CI8 A;  1L0Q A;  1XHM A;  4A0B A;  3DWL C;  2OVP B;  3NIG A;  4A08 B;  1E8N A;  5AFU 3;  1YFQ A;  2UZX B;  2H3X A;  3JZN A;  4O2W A;  2CE8 A;  5EML B;  3OL2 A;  2QZP A;  5C86 A;  5H14 A;  4A0A B;  2VDR A;  2H6K A;  1FWX A;  3QHY B;  5FLX g;  3E0C A;  2I0R A;  3IUM A;  4WK4 A;  3B7F A;  3KRX B;  4G55 A;  3IUL A;  3I7K A;  3SCY A;  1N6D A;  3N0D A;  5C9Z B;  2PM9 B; 
#chains in the Genus database with same CATH homology
 3EI2 B;  4N14 A;  2AGX A;  3NVN A;  4GZ8 A;  4ZOZ A;  2IUP A;  4FA4 D;  3IJC A;  3ULE C;  4QRJ A;  4J81 A;  4BH6 A;  4J77 A;  5IGQ A;  1A0R B;  2P9I C;  3HFQ A;  3PVU B;  4ES0 A;  1SQJ A;  3PSL A;  2XL2 A;  1PI6 A;  5TDH B;  2HKR A;  4Z8L A;  2YB8 B;  4BUJ C;  4JSP C;  3V5W B;  4A11 A;  1R5M A;  5IT9 g;  5FKT A;  3AL9 A;  2OVQ B;  1TBG A;  4A09 B;  1SHY B;  3RFH A;  3J81 g;  1QNI A;  5FKS A;  3K26 A;  3IIY A;  4E54 B;  3I2N A;  5EAL A;  2PM6 B;  1XIP A;  3PVW B;  2B4E A;  1K32 A;  4ESG A;  4XYH A;  3JZH A;  3PXS D;  2P9S C;  5I5M A;  2PM7 B;  2P9L C;  3UKR C;  4O3T B;  4XEI C;  3FM0 A;  5EAP A;  4J8G A;  5FKQ A;  5K1C C;  3AFC A;  3JB9 L;  5AJA A;  3VH0 A;  4H5J A;  3SWS D;  3PXT D;  4FWW A;  5GXI A;  2YBA A;  1N6F A;  3OW8 A;  4AOW A;  3FGB A;  4Y7R A;  4MK0 B;  2GNQ A;  5THA A;  3ORV D;  2IUQ A;  3MZK A;  4GGD A;  4GQB B;  4FA1 D;  5B4W A;  3UVN A;  1GG2 B;  2Z2N A;  4EWR A;  2QXV A;  1XKS A;  2P9P C;  2YNP A;  4A08 A;  2HJ4 A;  3PXW D;  4ERZ A;  3RN1 D;  2OK6 A;  3C9C A;  5EMK B;  2OJY A;  1JMX B;  2QC5 A;  3RSE C;  4TZ4 A;  2PM9 A;  4Y5R D;  4CI3 A;  3MZL A;  4AEZ A;  4ZOV A;  5IJ7 E;  2CN3 A;  1RI6 A;  1MDA H;  2B5M A;  4A2L A;  5HE1 B;  3I89 A;  5GMK n;  4PNK B;  5AMS A;  4J0X A;  3KRW B;  2OIZ A;  5EAR A;  4J73 A;  1SQ9 A;  4UI9 R;  5EAM A;  4CZX A;  4XYI A;  4L3G D;  3GRE A;  4CY3 A;  4D6V A;  1TYQ C;  5CXC A;  3EI3 B;  4PXW A;  2HYE A;  5FXY A;  1U2V C;  2IAA A;  4X61 B;  3BWS A;  2CN2 A;  4X60 B;  1NEX B;  2B5N A;  5TEF A;  5KDO B;  4E5Z B;  2AGZ A;  3V7D B;  5IC7 A;  3MKQ A;  5CYK B;  2YNN A;  5EMJ B;  1PGU A;  2HJB A;  2TRC B;  4E54 A;  2HKM A;  3AL8 B;  5IGO A;  5HE2 B;  1GP2 B;  3DXM C;  4J82 A;  4GQ2 P;  4OWR A;  5A2Q g;  5FA5 B;  3EI4 B;  2O9K A;  3DSM A;  3K27 A;  3EU7 A;  2IWK A;  4G56 B;  3ODT A;  3CFV A;  5FQD A;  2W18 A;  2H6Q A;  1MG3 A;  3I8C A;  4J0W A;  3UVL A;  1P22 A;  4IMM A;  3IJ0 A;  4CY2 A;  3NVX A;  4J86 A;  3EG6 A;  4O9D A;  3P4F A;  2AQ5 A;  2AH0 A;  3I7O A;  3CFS B;  3FRX A;  3MKS B;  3U4Y A;  3GFC A;  2CO0 A;  5H17 A;  5TEE A;  3J80 g;  2YNO A;  2CO0 C;  3DM0 A;  4JXM A;  1Q47 A;  4OZU A;  2G9A A;  3OKY B;  1JOF A;  4J8B A;  4CY1 A;  2Z2O A;  2IWF A;  2I0S A;  2H13 A;  4HDJ A;  3OTT A;  2Q7Q A;  4GGC A;  5HQG A;  4CC9 A;  3I7H A;  1NR0 A;  3VA6 A;  1ERJ A;  2BBK H;  1B9X A;  3IJ1 A;  2PBI B;  3UKU C;  3SFZ A;  4NSX A;  2AGW A;  3C75 H;  3F3F A;  4D0K A;  2H14 A;  2G99 A;  1N6E A;  4FA5 D;  4A0A A;  2OVR B;  2YMU A;  3W15 A;  2GC7 A;  3SHF A;  4JT6 C;  4X3E A;  3EWE A;  3RLM D;  4ERQ A;  4L9O A;  2AGL A;  4IA9 A;  5TF2 A;  1GOT B;  4JD2 C;  4LG8 A;  2Z2P A;  5SXM A;  3EI2 A;  3I7N A;  4J84 A;  2AGY A;  4QL1 A;  2XU7 A;  2UZY B;  1GXR A;  4K3J B;  1S4U X;  3EI1 B;  3EI3 A;  3IIW A;  5GXH A;  2EBS A;  4FB1 D;  3OKT A;  4J78 A;  5EM2 B;  2CE9 A;  4PSX B;  3I8E A;  4U1E I;  5I5J A;  2H6N A;  3UVM A;  4H5I A;  5C2V B;  4CI1 A;  1PBY B;  2HXC A;  4PSW B;  2AH1 A;  3SMR A;  1VYH C;  3SBP A;  4E5Z A;  3SLE D;  3I7P A;  4K3I D;  3SXT D;  3VGZ A;  5CYK A;  4J87 A;  5CXB B;  3N0E A;  2IUR A;  3BG1 A;  5H1M A;  3AL8 A;  4U7A A;  4GM9 A;  4BL0 A;  4A0B B;  3DXK C;  3UR4 A;  4FHL A;  4GGA A;  3SVW D;  4YVD A;  3OL2 B;  5I5I A;  4A09 A;  3ZWL B;  4CZV A;  3RFG A;  5EMM B;  3IKO A;  3RRM C;  3SN6 B;  3EI4 A;  2H9M A;  4GMB A;  2J56 H;  2OK4 A;  1OMW B;  4LG9 A;  3JRP A;  4O45 A;  2P9K C;  4QQE A;  2MTA H;  2HES X;  3SBR A;  2P9N C;  4L1Q D;  5CXC B;  2H47 A;  4L3H D;  2H9L A;  3F3G A;  3SJL D;  2I3S A;  3EMH A;  4ZOX A;  2CNX A;  4GQ1 A;  3NVQ A;  4GM8 A;  3L4O D;  3BG0 A;  1B9Y A;  4CY5 A;  3MMY A;  4J79 A;  3OKY A;  3I7L A;  3JAM g;  4R7A B;  4ZOY A;  5GSA A;  2I0T A;  4I79 A;  3V9F A;  4FAV D;  3UVK A;  4A11 B;  5K19 A;  5HE3 B;  2B5L A;  1JMZ B;  2H68 A;  4JSV C;  3SBQ A;  3PE7 A;  3JRO A;  4JT5 C;  3CIK B;  4PBZ A;  2H9N A;  5HYN B;  3F3P A;  1MG2 A;  1PEV A;  3AH8 B;  2IUV A;  4PBY A;  2H9P A;  3RN0 D;  3OKW A;  2P9U C;  4O3U B;  4KFM B;  2J55 H;  3C99 A;  4FA9 D;  2XYI A;  3RMZ D;  4ERY A;  1K8K C;  4X63 B;  2XL3 A;  3L4M D;  3A0F A;  3UVO A;  5JWZ A;  4JSX C;  4FAN D;  5C2W B;  4PC0 A;  3EI1 A;  4CI2 A;  4ZN4 A;  1U4C A;  5EM2 A;  5HE0 B;  3JZG A;  4LGN A;  4GM3 A;  3JPX A;  1OLZ A;  2BCJ B;  4A2M A;  2I3T A;  3C5M A;  4QT8 A;  3PSC B;  2J57 G;  2GC4 A;  4A7J A;  1JJU B;  4O1Q D;  3MXX A;  4JSN C;  5IJ8 E;  5CXB A;  5FKR A;  4CZY A;  4CI8 A;  1L0Q A;  1XHM A;  4A0B A;  3DWL C;  2OVP B;  4A08 B;  5AFU 3;  1YFQ A;  2UZX B;  2H3X A;  3JZN A;  5EML B;  2CE8 A;  4A0A B;  3OL2 A;  5H14 A;  2H6K A;  1FWX A;  5FLX g;  3E0C A;  2I0R A;  3B7F A;  3KRX B;  3I7K A;  3SCY A;  1N6D A;  3N0D A;  5C9Z B;  2PM9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...