2B4EA

Crystal structure of murine coronin-1: monoclinic form
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
386
structure length
386
Chain Sequence
SKFRHVFGQPAKADQCYEDVRVSQTTWDSGFCAVNPKFMALICEASGGGAFLVLPLGKTGRVDKNVPLVCGHTAPVLDIAWCPHNDNVIASGSEDCTVMVWEIPDGGLVLPLREPVITLEGHTKRVGIVAWHPTAQNVLLSAGCDNVILVWDVGTGAAVLTLGPDVHPDTIYSVDWSRDGALICTSCRDKRVRVIEPRKGTVVAEKDRPHEGTRPVHAVFVSEGKILTTGFSRMSERQVALWDTKHLEEPLSLQELDTSSGVLLPFFDPDTNIVYLCGKGDSSIRYFEITSEAPFLHYLSMFSSKESQRGMGYMPKRGLEVNKCEIARFYKLHERKCEPIAMTVPRKSDLFQEDLYPPTAGPDPALTAEEWLGGRDAGPLLISLKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of murine coronin-1: a regulator of actin cytoskeletal dynamics in lymphocytes
pubmed doi rcsb
source organism Mus musculus
molecule tags Structural protein
molecule keywords Coronin-1A
total genus 95
structure length 386
sequence length 386
ec nomenclature
pdb deposition date 2005-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
A PF08953 DUF1899 Domain of unknown function (DUF1899)
A PF16300 WD40_4 Type of WD40 repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2b4eA01
4FAVD 4PBZA 5CXCB 4J84A 4Y5RD 3PXTD 3EI3B 2TRCB 4ZOZA 4HDJA 4BH6A 5EMLB 4PC0A 4J86A 1YFQA 3DWLC 2HKRA 2H47A 2MTAH 4GM8A 3DXKC 3RN1D 3UVNA 4A08B 5CYKB 4A0BB 3RFGA 5C2VB 3IJ1A 2XL2A 4QRJA 3I7NA 4IA9A 4A0AA 2PM9B 3GFCA 3SHFA 5GMKn 1OMWB 5JWZA 1K8KC 1L0QA 2IUVA 3F3PA 4PNKB 1SQJA 3C75H 5EALA 1SQ9A 3P4FA 5CXCA 2OVQB 4O1QD 3MKSB 4CZYA 3SBPA 4CI3A 5C2WB 4FHLA 2HESX 2W18A 2YMUA 1SHYB 3HFQA 3V7DB 2P9PC 4ERZA 3OTTA 5THAA 5GXIA 5IT9g 2H9LA 3SCYA 4AEZA 4BUJC 4GGAA 5H1MA 3SLED 2YNNA 2Q7QA 5K1CC 2YNOA 5FKRA 4ERYA 4CC9A 3OL2B 3C5MA 1GOTB 3JROA 3RLMD 3V5WB 2IAAA 2GNQA 3RSEC 4XYIA 4ES0A 3UVLA 4A7JA 2AQ5A 3OKTA 2H13A 2AGWA 3PVWB 4FA5D 4KFMB 2OK4A 4JXMA 2QC5A 2H9PA 1A0RB 4XEIC 4JT5C 4Y7RA 5I5MA 3JZGA 5HQGA 3SN6B 4CY1A 1PI6A 4E54B 4GQ2P 4CZXA 5H17A 3I2NA 4CY2A 4A08A 3PXWD 3OW8A 3N0DA 4O45A 3SVWD 1NR0A 2AGXA 2P9LC 2P9IC 3FM0A 2AGLA 4AOWA 3PSCB 4GZ8A 3EMHA 2AH0A 2IUQA 5IJ7E 4JD2C 3K26A 3VA6A 3MKQA 1XKSA 2H6KA 3K27A 4G56B 4N14A 3MZLA 4D0KA 1MDAH 4A11B 4J8BA 3BG1A 2O9KA 5C9ZB 5IGQA 2OK6A 4JSVC 2OVPB 4XYHA 1S4UX 1NEXB 3E0CA 2PM6B 1XHMA 3IIWA 2G9AA 5AJAA 1R5MA 3IKOA 3C99A 2P9NC 5HE1B 3EU7A 4CY5A 2H9MA 5EMJB 2PBIB 3JPXA 4ZOXA 1GXRA 4OZUA 5HE2B 3L4OD 4ERQA 4A11A 2IUPA 3KRXB 3CIKB 4O3UB 3SXTD 2UZYB 4K3ID 3JAMg 4Z8LA 2OJYA 3I8EA 5EARA 2YB8B 4LGNA 3I7HA 1QNIA 5KDOB 3AH8B 4A0BA 4O3TB 3RFHA 2AGYA 2H9NA 2CNXA 4H5IA 1U4CA 1XIPA 4QQEA 4CI1A 1U2VC 4J0XA 5FA5B 4BL0A 2HKMA 4L3GD 4J82A 3OKWA 4J77A 3N0EA 2G99A 2HYEA 4J79A 4A09B 1PBYB 5TEFA 3PVUB 3UVMA 4A09A 5CXBA 5TEEA 3V9FA 4FAND 3MZKA 2J55H 2GC4A 4JSNC 4PSXB 2P9SC 3NVXA 2PM9A 4J73A 4L3HD 4D6VA 1B9XA 3RMZD 1N6EA 4X63B 4X60B 3J80g 2XL3A 3I7LA 4QL1A 3BG0A 2BCJB 3VH0A 2B5NA 3CFSB 5IJ8E 4E54A 2YNPA 2H6QA 3CFVA 3NVNA 5FKQA 4GM9A 2I3TA 4OWRA 2CO0C 5I5JA 3EI2A 2AGZA 4PSWB 3RN0D 1PGUA 1P22A 4E5ZB 4GM3A 2Z2PA 4UI9R 1N6FA 3SJLD 3EI1A 5H14A 3IJ0A 4LG8A 3AFCA 3I7KA 4CI8A 2XU7A 5B4WA 4K3JB 4I79A 4U7AA 4PBYA 5TF2A 5EM2A 3EG6A 4JT6C 4J78A 4O9DA 5I5IA 2AH1A 2B5LA 4GMBA 4JSXC 5EAMA 4ESGA 2GC7A 2UZXB 4YVDA 4ZN4A 1JMXB 3GREA 4E5ZA 5A2Qg 2CN3A 2P9KC 3UKUC 4GQBB 3W15A 3I7OA 2HJ4A 1TYQC 4U1EI 1K32A 3B7FA 2BBKH 1ERJA 1RI6A 3F3FA 2H6NA 3EI4A 4GGCA 4QT8A 1JOFA 3J81g 4CZVA 2CE9A 4FA4D 5IC7A 3DXMC 1JJUB 3PSLA 3NVQA 2B5MA 3JZHA 4GGDA 5GXHA 3MXXA 4ZOVA 3SBRA 5FKSA 2HXCA 4PXWA 3JRPA 1PEVA 1B9YA 3UVOA 3ODTA 4LG9A 5SXMA 5HE3B 3SWSD 3FGBA 5TDHB 3EI1B 4CI2A 3AL9A 2I0TA 2PM7B 3AL8A 4FA9D 3EI4B 3IJCA 5EMKB 2YBAA 3AL8B 4H5JA 4J81A 5AMSA 3I7PA 5CXBB 2H14A 2I0SA 5FQDA 4EWRA 3SFZA 3MMYA 4J87A 4FB1D 4MK0B 3ZWLB 2Z2OA 3VGZA 3C9CA 5IGOA 5CYKA 3ORVD 4FA1D 1TBGA 4L9OA 3DM0A 1N6DA 4A2LA 3RRMC 3UKRC 5EM2B 5FLXg 1JMZB 3EI3A 5FXYA 3KRWB 2B4EA 2I3SA 4TZ4A 3F3GA 4FWWA 5HE0B 3UR4A 4GQ1A 5HYNB 4J0WA 1GG2B 2QXVA 2IURA 2IWKA 4R7AB 2I0RA 3JB9L 1OLZA 5GSAA 2HJBA 4J8GA 4A2MA 2P9UC 3U4YA 2CN2A 1MG2A 4IMMA 2EBSA 3UVKA 5AFU3 3L4MD 2XYIA 4JSPC 2OIZA 4X61B 3OL2A 1Q47A 4L1QD 2CO0A 2H3XA 2J57G 2Z2NA 4CY3A 2J56H 3IIYA 5FKTA 5EMMB 3SMRA 4NSXA 1GP2B 3FRXA 3I8CA 2IWFA 3I89A 5EAPA 4X3EA 1FWXA 3PXSD 3SBQA 3A0FA 3DSMA 3EI2B 3ULEC 1MG3A 3EWEA 2OVRB 3PE7A 1VYHC 3OKYA 3BWSA 4A0AB 3JZNA 3OKYB 2CE8A 2H68A 5K19A 4ZOYA
chains in the Genus database with same CATH superfamily
3IUJA 4PBZA 5CXCB 4J84A 4Y5RD 4FAVD 1JV2A 3PXTD 3O4HA 3EI3B 2TRCB 3IUMA 4ZOZA 5C86A 4HDJA 1UOOA 3ZE2A 4BH6A 1E8MA 5EMLB 4PC0A 4J86A 2BKLA 1YFQA 3DWLC 2HKRA 2WQ8A 1T2XA 2H47A 2VDMA 2MTAH 4GM8A 3DXKC 3RN1D 3UVNA 4A08B 5CYKB 4A0BB 3RFGA 5C2VB 1O6FA 3IJ1A 2XL2A 4QRJA 3I7NA 4IA9A 4A0AA 2PM9B 3GFCA 3SHFA 5GMKn 1OMWB 5JWZA 1K8KC 1L0QA 2IUVA 2VDOA 3F3PA 4PNKB 1SQJA 3C75H 5EALA 1SQ9A 3P4FA 5CXCA 2OVQB 1O6GA 5E6UA 4O1QD 3MKSB 4CZYA 3SBPA 3O4IA 4CI3A 5C2WB 4FHLA 2HESX 2W18A 2YMUA 1SHYB 3HFQA 5FFGA 3V7DB 2P9PC 4ERZA 3OTTA 2XZGA 5THAA 5GXIA 5IT9g 2H9LA 1L5GA 3SCYA 4AEZA 4BUJC 3O4GA 4GGAA 5H1MA 3SLED 2YNNA 2Q7QA 5K1CC 2YNOA 5FKRA 4ERYA 4CC9A 3OL2B 3C5MA 1GOTB 3JROA 3RLMD 4WK2A 2QR5A 3V5WB 2IAAA 2GNQA 3RSEC 4XYIA 4ES0A 3UVLA 4A7JA 3K6SA 2AQ5A 5M5SA 3OKTA 1VZ2A 2AGWA 2H13A 2VDQA 3PVWB 4FA5D 4KFMB 2OK4A 4JXMA 2QC5A 1UOPA 1A0RB 2H9PA 4NAAA 3IUNA 4XEIC 3T3PA 3VI3A 2HU7A 1M1XA 4JT5C 2HU8A 4Y7RA 3JZGA 5I5MA 5M5TA 5HQGA 3SN6B 4CY1A 1PI6A 4E54B 2JKXA 4GQ2P 4CZXA 5H17A 3I2NA 4CY2A 4A08A 4NBMA 3K71A 3PXWD 4JHNA 3OW8A 3ZDXA 3N0DA 4O45A 3ZE0A 3SVWD 1NR0A 2AGXA 2P9LC 1VE6A 2P9IC 3FM0A 2AGLA 4AOWA 3PSCB 4GZ8A 3EMHA 2AH0A 2IUQA 5IJ7E 4JD2C 3K26A 3VA6A 3GD1I 3MKQA 1XKSA 2H6KA 3K27A 4G56B 2VC2A 4N14A 3MUOA 3MZLA 4D0KA 1GOHA 1MDAH 4A11B 4J8BA 1U8CA 3BG1A 2O9KA 3IULA 5C9ZB 5IGQA 2OK6A 4JSVC 2OVPB 4XYHA 1S4UX 3NIFA 1NEXB 3E0CA 2PM6B 1XHMA 3IIWA 2G9AA 5AJAA 1R5MA 3IKOA 2EIEA 3C99A 2P9NC 5HE1B 3EU7A 4BCBA 4CY5A 2H9MA 5EMJB 3KCIA 2PBIB 3JPXA 4ZOXA 1GXRA 4OZUA 4D9SA 5HE2B 3ZE1A 3L4OD 5M5RA 4G1EA 4ERQA 4A11A 4Z7OA 2IUPA 3KRXB 3CIKB 4O3UB 3SXTD 2UZYB 4K3ID 3JAMg 3QHYB 4Z8LA 2OJYA 3I8EA 5EARA 2YB8B 4AMYA 4LGNA 3I7HA 1QNIA 5KDOB 3AH8B 4A0BA 4O3TB 4BP8A 3RFHA 4O02A 4UM8A 2AGYA 2H9NA 2CNXA 1I2MB 3IVMA 4IRZA 4H5IA 1U4CA 5E6RA 2HU5A 1XIPA 4QQEA 4CI1A 1U2VC 5M5UA 4J0XA 5FA5B 4BL0A 2HKMA 4L3GD 4J82A 1QFMA 3OKWA 4J77A 3V4VA 1H2XA 3N0EA 3ZDYA 4DNUA 2G99A 3NIGA 2HYEA 4J79A 4A09B 1PBYB 5TEFA 3PVUB 3UVMA 4A09A 1BPOA 5CXBA 5TEEA 1K3IA 3V9FA 4FAND 3MZKA 2QZPA 2J55H 2GC4A 2VZ3A 4JSNC 2VDRA 4PSXB 2P9SC 3NVXA 2VDKA 2PM9A 4J73A 4L3HD 4D6VA 1B9XA 3RMZD 1N6EA 4X63B 3DDUA 1VZ3A 4X60B 3J80g 2XL3A 3I7LA 4QL1A 3BG0A 2BCJB 1H2WA 2B5NA 3VH0A 3CFSB 5IJ8E 1C9LA 4E54A 2YNPA 2H6QA 3CFVA 3NVNA 3VI4A 3IURA 5FKQA 4GM9A 2I3TA 4OWRA 2CO0C 4UM9A 3NIDA 5I5JA 4AN1A 3EI2A 2AGZA 4PSWB 2EICA 4NC4A 3RN0D 1PGUA 4RE6A 4WK0A 1P22A 5C92A 4E5ZB 4GM3A 2Z2PA 4UI9R 1N6FA 4MMYA 3SJLD 2XE4A 3EI1A 5H14A 3IJ0A 2VZ1A 4LG8A 2EIDA 3AFCA 3I7KA 4CI8A 4NENA 2XU7A 5B4WA 4K3JB 4I79A 4U7AA 4PBYA 5TF2A 5EM2A 3EG6A 4JT6C 1UTCA 5HDBA 4J78A 4O9DA 5I5IA 2AH1A 3ZDZA 1QFSA 2B5LA 4GMBA 4JSXC 4WJKA 5EAMA 4ESGA 2GC7A 2UZXB 4YVDA 4ZN4A 1JMXB 3GREA 3O4JA 4E5ZA 5A2Qg 2CN3A 2P9KC 3QI0A 3UKUC 4GQBB 1C9IA 3W15A 3T3MA 3I7OA 2HJ4A 1TYQC 4U1EI 1K32A 3B7FA 2BBKH 1ERJA 1RI6A 3F3FA 2H6NA 1TYEA 3EI4A 4GGCA 4BP9A 4QT8A 1JOFA 3J81g 1H2ZA 4CZVA 2CE9A 4FA4D 5E6SA 1YR2A 1VE7A 4G1MA 5IC7A 3DXMC 3PSLA 1JJUB 3NVQA 2B5MA 3JZHA 4GGDA 5GXHA 1JTDB 4Z7NA 3MXXA 3GC3B 4ZOVA 3SBRA 3K72A 5FKSA 2HXCA 1A12A 4PXWA 3JRPA 1PEVA 1B9YA 3UVOA 3ODTA 4LG9A 5SXMA 5HE3B 3EQ8A 3SWSD 3FGBA 5TDHB 3EI1B 4CI2A 3AL9A 2I0TA 2PM7B 3AL8A 3FCSA 3MUNA 4FA9D 3EI4B 4L1MA 4DNVA 3IJCA 5EMKB 2YBAA 3AL8B 4H5JA 4J81A 5AMSA 3I7PA 5M61A 5CXBB 3MVDK 2H14A 2VDNA 2I0SA 5FQDA 4O2WA 4EWRA 3SFZA 3MMYA 4J87A 4AX4A 4MK0B 4FB1D 3ZWLB 2Z2OA 3VGZA 1E8NA 2VDLA 3C9CA 1GOGA 5IGOA 5CYKA 5M5VA 3ORVD 4FA1D 1TBGA 4L9OA 4BCCA 3DM0A 1N6DA 4A2LA 3RRMC 3FCUA 3UKRC 5EM2B 5FLXg 1JMZB 3EI3A 4G55A 5FXYA 3KRWB 2B4EA 3IJEA 2I3SA 4TZ4A 3F3GA 4FWWA 4RE5A 5HE0B 3UR4A 4GQ1A 5HYNB 4BCDA 4MMXA 4J0WA 1GG2B 2QXVA 2IURA 1H2YA 2IWKA 4R7AB 2I0RA 3JB9L 1OLZA 5GSAA 2HJBA 4WK4A 4JHPC 3EQ7A 4J8GA 4A2MA 4DNWA 2P9UC 3U4YA 2CN2A 2EIBA 4AMZA 1MG2A 4IMMA 2EBSA 3UVKA 4Z7QA 5AFU3 3L4MD 2XYIA 4JSPC 2OIZA 3EQ9A 3OL2A 4X61B 3V4PA 1Q47A 4L1QD 2CO0A 2H3XA 2J57G 2Z2NA 4CY3A 2J56H 3IIYA 1E5TA 5FKTA 5EMMB 3SMRA 1GOFA 4NSXA 1GP2B 3FRXA 3I8CA 2IWFA 3I89A 5EAPA 4X3EA 1FWXA 3PXSD 3SBQA 1UOQA 3A0FA 3DSMA 3EI2B 3ULEC 1MG3A 3EWEA 2OVRB 3PE7A 3OF7A 2VDPA 5FFOA 1VYHC 3OKYA 3BWSA 4AN0A 4A0AB 2XDWA 3IUQA 3JZNA 3OKYB 4QAMA 2CE8A 2H68A 5K19A 4MMZA 4ZOYA
chains in the Genus database with same CATH topology
4FAVD 4PBZA 5CXCB 4J84A 4Y5RD 3PXTD 3EI3B 2TRCB 4ZOZA 4HDJA 4BH6A 5EMLB 4PC0A 4J86A 1YFQA 3DWLC 2HKRA 2H47A 2MTAH 4GM8A 3DXKC 3RN1D 3UVNA 4A08B 5CYKB 4A0BB 3RFGA 5C2VB 3IJ1A 2XL2A 4QRJA 3I7NA 4IA9A 4A0AA 2PM9B 3GFCA 3SHFA 5GMKn 1OMWB 5JWZA 1K8KC 1L0QA 2IUVA 3F3PA 4PNKB 1SQJA 3C75H 5EALA 1SQ9A 3P4FA 5CXCA 2OVQB 4O1QD 3MKSB 4CZYA 3SBPA 4CI3A 5C2WB 4FHLA 2HESX 2W18A 2YMUA 1SHYB 3HFQA 3V7DB 2P9PC 4ERZA 3OTTA 5THAA 5GXIA 5IT9g 2H9LA 3SCYA 4AEZA 4BUJC 4GGAA 5H1MA 3SLED 2YNNA 2Q7QA 5K1CC 2YNOA 5FKRA 4ERYA 4CC9A 3OL2B 3C5MA 1GOTB 3JROA 3RLMD 3V5WB 2IAAA 2GNQA 3RSEC 4XYIA 4ES0A 3UVLA 4A7JA 2AQ5A 3OKTA 2H13A 2AGWA 3PVWB 4FA5D 4KFMB 2OK4A 4JXMA 2QC5A 2H9PA 1A0RB 4XEIC 4JT5C 4Y7RA 5I5MA 3JZGA 5HQGA 3SN6B 4CY1A 1PI6A 4E54B 4GQ2P 4CZXA 5H17A 3I2NA 4CY2A 4A08A 3PXWD 3OW8A 3N0DA 4O45A 3SVWD 1NR0A 2AGXA 2P9LC 2P9IC 3FM0A 2AGLA 4AOWA 3PSCB 4GZ8A 3EMHA 2AH0A 2IUQA 5IJ7E 4JD2C 3K26A 3VA6A 3MKQA 1XKSA 2H6KA 3K27A 4G56B 4N14A 3MZLA 4D0KA 1MDAH 4A11B 4J8BA 3BG1A 2O9KA 5C9ZB 5IGQA 2OK6A 4JSVC 2OVPB 4XYHA 1S4UX 1NEXB 3E0CA 2PM6B 1XHMA 3IIWA 2G9AA 5AJAA 1R5MA 3IKOA 3C99A 2P9NC 5HE1B 3EU7A 4CY5A 2H9MA 5EMJB 2PBIB 3JPXA 4ZOXA 1GXRA 4OZUA 5HE2B 3L4OD 4ERQA 4A11A 2IUPA 3KRXB 3CIKB 4O3UB 3SXTD 2UZYB 4K3ID 3JAMg 4Z8LA 2OJYA 3I8EA 5EARA 2YB8B 4LGNA 3I7HA 1QNIA 5KDOB 3AH8B 4A0BA 4O3TB 3RFHA 2AGYA 2H9NA 2CNXA 4H5IA 1U4CA 1XIPA 4QQEA 4CI1A 1U2VC 4J0XA 5FA5B 4BL0A 2HKMA 4L3GD 4J82A 3OKWA 4J77A 3N0EA 2G99A 2HYEA 4J79A 4A09B 1PBYB 5TEFA 3PVUB 3UVMA 4A09A 5CXBA 5TEEA 3V9FA 4FAND 3MZKA 2J55H 2GC4A 4JSNC 4PSXB 2P9SC 3NVXA 2PM9A 4J73A 4L3HD 4D6VA 1B9XA 3RMZD 1N6EA 4X63B 4X60B 3J80g 2XL3A 3I7LA 4QL1A 3BG0A 2BCJB 3VH0A 2B5NA 3CFSB 5IJ8E 4E54A 2YNPA 2H6QA 3CFVA 3NVNA 5FKQA 4GM9A 2I3TA 4OWRA 2CO0C 5I5JA 3EI2A 2AGZA 4PSWB 3RN0D 1PGUA 1P22A 4E5ZB 4GM3A 2Z2PA 4UI9R 1N6FA 3SJLD 3EI1A 5H14A 3IJ0A 4LG8A 3AFCA 3I7KA 4CI8A 2XU7A 5B4WA 4K3JB 4I79A 4U7AA 4PBYA 5TF2A 5EM2A 3EG6A 4JT6C 4J78A 4O9DA 5I5IA 2AH1A 2B5LA 4GMBA 4JSXC 5EAMA 4ESGA 2GC7A 2UZXB 4YVDA 4ZN4A 1JMXB 3GREA 4E5ZA 5A2Qg 2CN3A 2P9KC 3UKUC 4GQBB 3W15A 3I7OA 2HJ4A 1TYQC 4U1EI 1K32A 3B7FA 2BBKH 1ERJA 1RI6A 3F3FA 2H6NA 3EI4A 4GGCA 4QT8A 1JOFA 3J81g 4CZVA 2CE9A 4FA4D 5IC7A 3DXMC 1JJUB 3PSLA 3NVQA 2B5MA 3JZHA 4GGDA 5GXHA 3MXXA 4ZOVA 3SBRA 5FKSA 2HXCA 4PXWA 3JRPA 1PEVA 1B9YA 3UVOA 3ODTA 4LG9A 5SXMA 5HE3B 3SWSD 3FGBA 5TDHB 3EI1B 4CI2A 3AL9A 2I0TA 2PM7B 3AL8A 4FA9D 3EI4B 3IJCA 5EMKB 2YBAA 3AL8B 4H5JA 4J81A 5AMSA 3I7PA 5CXBB 2H14A 2I0SA 5FQDA 4EWRA 3SFZA 3MMYA 4J87A 4FB1D 4MK0B 3ZWLB 2Z2OA 3VGZA 3C9CA 5IGOA 5CYKA 3ORVD 4FA1D 1TBGA 4L9OA 3DM0A 1N6DA 4A2LA 3RRMC 3UKRC 5EM2B 5FLXg 1JMZB 3EI3A 5FXYA 3KRWB 2B4EA 2I3SA 4TZ4A 3F3GA 4FWWA 5HE0B 3UR4A 4GQ1A 5HYNB 4J0WA 1GG2B 2QXVA 2IURA 2IWKA 4R7AB 2I0RA 3JB9L 1OLZA 5GSAA 2HJBA 4J8GA 4A2MA 2P9UC 3U4YA 2CN2A 1MG2A 4IMMA 2EBSA 3UVKA 5AFU3 3L4MD 2XYIA 4JSPC 2OIZA 4X61B 3OL2A 1Q47A 4L1QD 2CO0A 2H3XA 2J57G 2Z2NA 4CY3A 2J56H 3IIYA 5FKTA 5EMMB 3SMRA 4NSXA 1GP2B 3FRXA 3I8CA 2IWFA 3I89A 5EAPA 4X3EA 1FWXA 3PXSD 3SBQA 3A0FA 3DSMA 3EI2B 3ULEC 1MG3A 3EWEA 2OVRB 3PE7A 1VYHC 3OKYA 3BWSA 4A0AB 3JZNA 3OKYB 2CE8A 2H68A 5K19A 4ZOYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FAV D;  4PBZ A;  5CXC B;  4J84 A;  4Y5R D;  3PXT D;  3EI3 B;  2TRC B;  4ZOZ A;  4HDJ A;  4BH6 A;  5EML B;  4PC0 A;  4J86 A;  1YFQ A;  3DWL C;  2HKR A;  2H47 A;  2MTA H;  4GM8 A;  3DXK C;  3RN1 D;  3UVN A;  4A08 B;  5CYK B;  4A0B B;  3RFG A;  5C2V B;  3IJ1 A;  2XL2 A;  4QRJ A;  3I7N A;  4IA9 A;  4A0A A;  2PM9 B;  3GFC A;  3SHF A;  5GMK n;  1OMW B;  5JWZ A;  1K8K C;  1L0Q A;  2IUV A;  3F3P A;  4PNK B;  1SQJ A;  3C75 H;  5EAL A;  1SQ9 A;  3P4F A;  5CXC A;  2OVQ B;  4O1Q D;  3MKS B;  4CZY A;  3SBP A;  4CI3 A;  5C2W B;  4FHL A;  2HES X;  2W18 A;  2YMU A;  1SHY B;  3HFQ A;  3V7D B;  2P9P C;  4ERZ A;  3OTT A;  5THA A;  5GXI A;  5IT9 g;  2H9L A;  3SCY A;  4AEZ A;  4BUJ C;  4GGA A;  5H1M A;  3SLE D;  2YNN A;  2Q7Q A;  5K1C C;  2YNO A;  5FKR A;  4ERY A;  4CC9 A;  3OL2 B;  3C5M A;  1GOT B;  3JRO A;  3RLM D;  3V5W B;  2IAA A;  2GNQ A;  3RSE C;  4XYI A;  4ES0 A;  3UVL A;  4A7J A;  2AQ5 A;  3OKT A;  2H13 A;  2AGW A;  3PVW B;  4FA5 D;  4KFM B;  2OK4 A;  4JXM A;  2QC5 A;  2H9P A;  1A0R B;  4XEI C;  4JT5 C;  4Y7R A;  5I5M A;  3JZG A;  5HQG A;  3SN6 B;  4CY1 A;  1PI6 A;  4E54 B;  4GQ2 P;  4CZX A;  5H17 A;  3I2N A;  4CY2 A;  4A08 A;  3PXW D;  3OW8 A;  3N0D A;  4O45 A;  3SVW D;  1NR0 A;  2AGX A;  2P9L C;  2P9I C;  3FM0 A;  2AGL A;  4AOW A;  3PSC B;  4GZ8 A;  3EMH A;  2AH0 A;  2IUQ A;  5IJ7 E;  4JD2 C;  3K26 A;  3VA6 A;  3MKQ A;  1XKS A;  2H6K A;  3K27 A;  4G56 B;  4N14 A;  3MZL A;  4D0K A;  1MDA H;  4A11 B;  4J8B A;  3BG1 A;  2O9K A;  5C9Z B;  5IGQ A;  2OK6 A;  4JSV C;  2OVP B;  4XYH A;  1S4U X;  1NEX B;  3E0C A;  2PM6 B;  1XHM A;  3IIW A;  2G9A A;  5AJA A;  1R5M A;  3IKO A;  3C99 A;  2P9N C;  5HE1 B;  3EU7 A;  4CY5 A;  2H9M A;  5EMJ B;  2PBI B;  3JPX A;  4ZOX A;  1GXR A;  4OZU A;  5HE2 B;  3L4O D;  4ERQ A;  4A11 A;  2IUP A;  3KRX B;  3CIK B;  4O3U B;  3SXT D;  2UZY B;  4K3I D;  3JAM g;  4Z8L A;  2OJY A;  3I8E A;  5EAR A;  2YB8 B;  4LGN A;  3I7H A;  1QNI A;  5KDO B;  3AH8 B;  4A0B A;  4O3T B;  3RFH A;  2AGY A;  2H9N A;  2CNX A;  4H5I A;  1U4C A;  1XIP A;  4QQE A;  4CI1 A;  1U2V C;  4J0X A;  5FA5 B;  4BL0 A;  2HKM A;  4L3G D;  4J82 A;  3OKW A;  4J77 A;  3N0E A;  2G99 A;  2HYE A;  4J79 A;  4A09 B;  1PBY B;  5TEF A;  3PVU B;  3UVM A;  4A09 A;  5CXB A;  5TEE A;  3V9F A;  4FAN D;  3MZK A;  2J55 H;  2GC4 A;  4JSN C;  4PSX B;  2P9S C;  3NVX A;  2PM9 A;  4J73 A;  4L3H D;  4D6V A;  1B9X A;  3RMZ D;  1N6E A;  4X63 B;  4X60 B;  3J80 g;  2XL3 A;  3I7L A;  4QL1 A;  3BG0 A;  2BCJ B;  3VH0 A;  2B5N A;  3CFS B;  5IJ8 E;  4E54 A;  2YNP A;  2H6Q A;  3CFV A;  3NVN A;  5FKQ A;  4GM9 A;  2I3T A;  4OWR A;  2CO0 C;  5I5J A;  3EI2 A;  2AGZ A;  4PSW B;  3RN0 D;  1PGU A;  1P22 A;  4E5Z B;  4GM3 A;  2Z2P A;  4UI9 R;  1N6F A;  3SJL D;  3EI1 A;  5H14 A;  3IJ0 A;  4LG8 A;  3AFC A;  3I7K A;  4CI8 A;  2XU7 A;  5B4W A;  4K3J B;  4I79 A;  4U7A A;  4PBY A;  5TF2 A;  5EM2 A;  3EG6 A;  4JT6 C;  4J78 A;  4O9D A;  5I5I A;  2AH1 A;  2B5L A;  4GMB A;  4JSX C;  5EAM A;  4ESG A;  2GC7 A;  2UZX B;  4YVD A;  4ZN4 A;  1JMX B;  3GRE A;  4E5Z A;  5A2Q g;  2CN3 A;  2P9K C;  3UKU C;  4GQB B;  3W15 A;  3I7O A;  2HJ4 A;  1TYQ C;  4U1E I;  1K32 A;  3B7F A;  2BBK H;  1ERJ A;  1RI6 A;  3F3F A;  2H6N A;  3EI4 A;  4GGC A;  4QT8 A;  1JOF A;  3J81 g;  4CZV A;  2CE9 A;  4FA4 D;  5IC7 A;  3DXM C;  1JJU B;  3PSL A;  3NVQ A;  2B5M A;  3JZH A;  4GGD A;  5GXH A;  3MXX A;  4ZOV A;  3SBR A;  5FKS A;  2HXC A;  4PXW A;  3JRP A;  1PEV A;  1B9Y A;  3UVO A;  3ODT A;  4LG9 A;  5SXM A;  5HE3 B;  3SWS D;  3FGB A;  5TDH B;  3EI1 B;  4CI2 A;  3AL9 A;  2I0T A;  2PM7 B;  3AL8 A;  4FA9 D;  3EI4 B;  3IJC A;  5EMK B;  2YBA A;  3AL8 B;  4H5J A;  4J81 A;  5AMS A;  3I7P A;  5CXB B;  2H14 A;  2I0S A;  5FQD A;  4EWR A;  3SFZ A;  3MMY A;  4J87 A;  4FB1 D;  4MK0 B;  3ZWL B;  2Z2O A;  3VGZ A;  3C9C A;  5IGO A;  5CYK A;  3ORV D;  4FA1 D;  1TBG A;  4L9O A;  3DM0 A;  1N6D A;  4A2L A;  3RRM C;  3UKR C;  5EM2 B;  5FLX g;  1JMZ B;  3EI3 A;  5FXY A;  3KRW B;  2B4E A;  2I3S A;  4TZ4 A;  3F3G A;  4FWW A;  5HE0 B;  3UR4 A;  4GQ1 A;  5HYN B;  4J0W A;  1GG2 B;  2QXV A;  2IUR A;  2IWK A;  4R7A B;  2I0R A;  3JB9 L;  1OLZ A;  5GSA A;  2HJB A;  4J8G A;  4A2M A;  2P9U C;  3U4Y A;  2CN2 A;  1MG2 A;  4IMM A;  2EBS A;  3UVK A;  5AFU 3;  3L4M D;  2XYI A;  4JSP C;  2OIZ A;  4X61 B;  3OL2 A;  1Q47 A;  4L1Q D;  2CO0 A;  2H3X A;  2J57 G;  2Z2N A;  4CY3 A;  2J56 H;  3IIY A;  5FKT A;  5EMM B;  3SMR A;  4NSX A;  1GP2 B;  3FRX A;  3I8C A;  2IWF A;  3I89 A;  5EAP A;  4X3E A;  1FWX A;  3PXS D;  3SBQ A;  3A0F A;  3DSM A;  3EI2 B;  3ULE C;  1MG3 A;  3EWE A;  2OVR B;  3PE7 A;  1VYH C;  3OKY A;  3BWS A;  4A0A B;  3JZN A;  3OKY B;  2CE8 A;  2H68 A;  5K19 A;  4ZOY A; 
#chains in the Genus database with same CATH topology
 3IUJ A;  4PBZ A;  5CXC B;  4J84 A;  4Y5R D;  4FAV D;  1JV2 A;  3PXT D;  3O4H A;  3EI3 B;  2TRC B;  3IUM A;  4ZOZ A;  5C86 A;  4HDJ A;  1UOO A;  3ZE2 A;  4BH6 A;  1E8M A;  5EML B;  4PC0 A;  4J86 A;  2BKL A;  1YFQ A;  3DWL C;  2HKR A;  2WQ8 A;  1T2X A;  2H47 A;  2VDM A;  2MTA H;  4GM8 A;  3DXK C;  3RN1 D;  3UVN A;  4A08 B;  5CYK B;  4A0B B;  3RFG A;  5C2V B;  1O6F A;  3IJ1 A;  2XL2 A;  4QRJ A;  3I7N A;  4IA9 A;  4A0A A;  2PM9 B;  3GFC A;  3SHF A;  5GMK n;  1OMW B;  5JWZ A;  1K8K C;  1L0Q A;  2IUV A;  2VDO A;  3F3P A;  4PNK B;  1SQJ A;  3C75 H;  5EAL A;  1SQ9 A;  3P4F A;  5CXC A;  2OVQ B;  1O6G A;  5E6U A;  4O1Q D;  3MKS B;  4CZY A;  3SBP A;  3O4I A;  4CI3 A;  5C2W B;  4FHL A;  2HES X;  2W18 A;  2YMU A;  1SHY B;  3HFQ A;  5FFG A;  3V7D B;  2P9P C;  4ERZ A;  3OTT A;  2XZG A;  5THA A;  5GXI A;  5IT9 g;  2H9L A;  1L5G A;  3SCY A;  4AEZ A;  4BUJ C;  3O4G A;  4GGA A;  5H1M A;  3SLE D;  2YNN A;  2Q7Q A;  5K1C C;  2YNO A;  5FKR A;  4ERY A;  4CC9 A;  3OL2 B;  3C5M A;  1GOT B;  3JRO A;  3RLM D;  4WK2 A;  2QR5 A;  3V5W B;  2IAA A;  2GNQ A;  3RSE C;  4XYI A;  4ES0 A;  3UVL A;  4A7J A;  3K6S A;  2AQ5 A;  5M5S A;  3OKT A;  1VZ2 A;  2AGW A;  2H13 A;  2VDQ A;  3PVW B;  4FA5 D;  4KFM B;  2OK4 A;  4JXM A;  2QC5 A;  1UOP A;  1A0R B;  2H9P A;  4NAA A;  3IUN A;  4XEI C;  3T3P A;  3VI3 A;  2HU7 A;  1M1X A;  4JT5 C;  2HU8 A;  4Y7R A;  3JZG A;  5I5M A;  5M5T A;  5HQG A;  3SN6 B;  4CY1 A;  1PI6 A;  4E54 B;  2JKX A;  4GQ2 P;  4CZX A;  5H17 A;  3I2N A;  4CY2 A;  4A08 A;  4NBM A;  3K71 A;  3PXW D;  4JHN A;  3OW8 A;  3ZDX A;  3N0D A;  4O45 A;  3ZE0 A;  3SVW D;  1NR0 A;  2AGX A;  2P9L C;  1VE6 A;  2P9I C;  3FM0 A;  2AGL A;  4AOW A;  3PSC B;  4GZ8 A;  3EMH A;  2AH0 A;  2IUQ A;  5IJ7 E;  4JD2 C;  3K26 A;  3VA6 A;  3GD1 I;  3MKQ A;  1XKS A;  2H6K A;  3K27 A;  4G56 B;  2VC2 A;  4N14 A;  3MUO A;  3MZL A;  4D0K A;  1GOH A;  1MDA H;  4A11 B;  4J8B A;  1U8C A;  3BG1 A;  2O9K A;  3IUL A;  5C9Z B;  5IGQ A;  2OK6 A;  4JSV C;  2OVP B;  4XYH A;  1S4U X;  3NIF A;  1NEX B;  3E0C A;  2PM6 B;  1XHM A;  3IIW A;  2G9A A;  5AJA A;  1R5M A;  3IKO A;  2EIE A;  3C99 A;  2P9N C;  5HE1 B;  3EU7 A;  4BCB A;  4CY5 A;  2H9M A;  5EMJ B;  3KCI A;  2PBI B;  3JPX A;  4ZOX A;  1GXR A;  4OZU A;  4D9S A;  5HE2 B;  3ZE1 A;  3L4O D;  5M5R A;  4G1E A;  4ERQ A;  4A11 A;  4Z7O A;  2IUP A;  3KRX B;  3CIK B;  4O3U B;  3SXT D;  2UZY B;  4K3I D;  3JAM g;  3QHY B;  4Z8L A;  2OJY A;  3I8E A;  5EAR A;  2YB8 B;  4AMY A;  4LGN A;  3I7H A;  1QNI A;  5KDO B;  3AH8 B;  4A0B A;  4O3T B;  4BP8 A;  3RFH A;  4O02 A;  4UM8 A;  2AGY A;  2H9N A;  2CNX A;  1I2M B;  3IVM A;  4IRZ A;  4H5I A;  1U4C A;  5E6R A;  2HU5 A;  1XIP A;  4QQE A;  4CI1 A;  1U2V C;  5M5U A;  4J0X A;  5FA5 B;  4BL0 A;  2HKM A;  4L3G D;  4J82 A;  1QFM A;  3OKW A;  4J77 A;  3V4V A;  1H2X A;  3N0E A;  3ZDY A;  4DNU A;  2G99 A;  3NIG A;  2HYE A;  4J79 A;  4A09 B;  1PBY B;  5TEF A;  3PVU B;  3UVM A;  4A09 A;  1BPO A;  5CXB A;  5TEE A;  1K3I A;  3V9F A;  4FAN D;  3MZK A;  2QZP A;  2J55 H;  2GC4 A;  2VZ3 A;  4JSN C;  2VDR A;  4PSX B;  2P9S C;  3NVX A;  2VDK A;  2PM9 A;  4J73 A;  4L3H D;  4D6V A;  1B9X A;  3RMZ D;  1N6E A;  4X63 B;  3DDU A;  1VZ3 A;  4X60 B;  3J80 g;  2XL3 A;  3I7L A;  4QL1 A;  3BG0 A;  2BCJ B;  1H2W A;  2B5N A;  3VH0 A;  3CFS B;  5IJ8 E;  1C9L A;  4E54 A;  2YNP A;  2H6Q A;  3CFV A;  3NVN A;  3VI4 A;  3IUR A;  5FKQ A;  4GM9 A;  2I3T A;  4OWR A;  2CO0 C;  4UM9 A;  3NID A;  5I5J A;  4AN1 A;  3EI2 A;  2AGZ A;  4PSW B;  2EIC A;  4NC4 A;  3RN0 D;  1PGU A;  4RE6 A;  4WK0 A;  1P22 A;  5C92 A;  4E5Z B;  4GM3 A;  2Z2P A;  4UI9 R;  1N6F A;  4MMY A;  3SJL D;  2XE4 A;  3EI1 A;  5H14 A;  3IJ0 A;  2VZ1 A;  4LG8 A;  2EID A;  3AFC A;  3I7K A;  4CI8 A;  4NEN A;  2XU7 A;  5B4W A;  4K3J B;  4I79 A;  4U7A A;  4PBY A;  5TF2 A;  5EM2 A;  3EG6 A;  4JT6 C;  1UTC A;  5HDB A;  4J78 A;  4O9D A;  5I5I A;  2AH1 A;  3ZDZ A;  1QFS A;  2B5L A;  4GMB A;  4JSX C;  4WJK A;  5EAM A;  4ESG A;  2GC7 A;  2UZX B;  4YVD A;  4ZN4 A;  1JMX B;  3GRE A;  3O4J A;  4E5Z A;  5A2Q g;  2CN3 A;  2P9K C;  3QI0 A;  3UKU C;  4GQB B;  1C9I A;  3W15 A;  3T3M A;  3I7O A;  2HJ4 A;  1TYQ C;  4U1E I;  1K32 A;  3B7F A;  2BBK H;  1ERJ A;  1RI6 A;  3F3F A;  2H6N A;  1TYE A;  3EI4 A;  4GGC A;  4BP9 A;  4QT8 A;  1JOF A;  3J81 g;  1H2Z A;  4CZV A;  2CE9 A;  4FA4 D;  5E6S A;  1YR2 A;  1VE7 A;  4G1M A;  5IC7 A;  3DXM C;  3PSL A;  1JJU B;  3NVQ A;  2B5M A;  3JZH A;  4GGD A;  5GXH A;  1JTD B;  4Z7N A;  3MXX A;  3GC3 B;  4ZOV A;  3SBR A;  3K72 A;  5FKS A;  2HXC A;  1A12 A;  4PXW A;  3JRP A;  1PEV A;  1B9Y A;  3UVO A;  3ODT A;  4LG9 A;  5SXM A;  5HE3 B;  3EQ8 A;  3SWS D;  3FGB A;  5TDH B;  3EI1 B;  4CI2 A;  3AL9 A;  2I0T A;  2PM7 B;  3AL8 A;  3FCS A;  3MUN A;  4FA9 D;  3EI4 B;  4L1M A;  4DNV A;  3IJC A;  5EMK B;  2YBA A;  3AL8 B;  4H5J A;  4J81 A;  5AMS A;  3I7P A;  5M61 A;  5CXB B;  3MVD K;  2H14 A;  2VDN A;  2I0S A;  5FQD A;  4O2W A;  4EWR A;  3SFZ A;  3MMY A;  4J87 A;  4AX4 A;  4MK0 B;  4FB1 D;  3ZWL B;  2Z2O A;  3VGZ A;  1E8N A;  2VDL A;  3C9C A;  1GOG A;  5IGO A;  5CYK A;  5M5V A;  3ORV D;  4FA1 D;  1TBG A;  4L9O A;  4BCC A;  3DM0 A;  1N6D A;  4A2L A;  3RRM C;  3FCU A;  3UKR C;  5EM2 B;  5FLX g;  1JMZ B;  3EI3 A;  4G55 A;  5FXY A;  3KRW B;  2B4E A;  3IJE A;  2I3S A;  4TZ4 A;  3F3G A;  4FWW A;  4RE5 A;  5HE0 B;  3UR4 A;  4GQ1 A;  5HYN B;  4BCD A;  4MMX A;  4J0W A;  1GG2 B;  2QXV A;  2IUR A;  1H2Y A;  2IWK A;  4R7A B;  2I0R A;  3JB9 L;  1OLZ A;  5GSA A;  2HJB A;  4WK4 A;  4JHP C;  3EQ7 A;  4J8G A;  4A2M A;  4DNW A;  2P9U C;  3U4Y A;  2CN2 A;  2EIB A;  4AMZ A;  1MG2 A;  4IMM A;  2EBS A;  3UVK A;  4Z7Q A;  5AFU 3;  3L4M D;  2XYI A;  4JSP C;  2OIZ A;  3EQ9 A;  3OL2 A;  4X61 B;  3V4P A;  1Q47 A;  4L1Q D;  2CO0 A;  2H3X A;  2J57 G;  2Z2N A;  4CY3 A;  2J56 H;  3IIY A;  1E5T A;  5FKT A;  5EMM B;  3SMR A;  1GOF A;  4NSX A;  1GP2 B;  3FRX A;  3I8C A;  2IWF A;  3I89 A;  5EAP A;  4X3E A;  1FWX A;  3PXS D;  3SBQ A;  1UOQ A;  3A0F A;  3DSM A;  3EI2 B;  3ULE C;  1MG3 A;  3EWE A;  2OVR B;  3PE7 A;  3OF7 A;  2VDP A;  5FFO A;  1VYH C;  3OKY A;  3BWS A;  4AN0 A;  4A0A B;  2XDW A;  3IUQ A;  3JZN A;  3OKY B;  4QAM A;  2CE8 A;  2H68 A;  5K19 A;  4MMZ A;  4ZOY A; 
#chains in the Genus database with same CATH homology
 4FAV D;  4PBZ A;  5CXC B;  4J84 A;  4Y5R D;  3PXT D;  3EI3 B;  2TRC B;  4ZOZ A;  4HDJ A;  4BH6 A;  5EML B;  4PC0 A;  4J86 A;  1YFQ A;  3DWL C;  2HKR A;  2H47 A;  2MTA H;  4GM8 A;  3DXK C;  3RN1 D;  3UVN A;  4A08 B;  5CYK B;  4A0B B;  3RFG A;  5C2V B;  3IJ1 A;  2XL2 A;  4QRJ A;  3I7N A;  4IA9 A;  4A0A A;  2PM9 B;  3GFC A;  3SHF A;  5GMK n;  1OMW B;  5JWZ A;  1K8K C;  1L0Q A;  2IUV A;  3F3P A;  4PNK B;  1SQJ A;  3C75 H;  5EAL A;  1SQ9 A;  3P4F A;  5CXC A;  2OVQ B;  4O1Q D;  3MKS B;  4CZY A;  3SBP A;  4CI3 A;  5C2W B;  4FHL A;  2HES X;  2W18 A;  2YMU A;  1SHY B;  3HFQ A;  3V7D B;  2P9P C;  4ERZ A;  3OTT A;  5THA A;  5GXI A;  5IT9 g;  2H9L A;  3SCY A;  4AEZ A;  4BUJ C;  4GGA A;  5H1M A;  3SLE D;  2YNN A;  2Q7Q A;  5K1C C;  2YNO A;  5FKR A;  4ERY A;  4CC9 A;  3OL2 B;  3C5M A;  1GOT B;  3JRO A;  3RLM D;  3V5W B;  2IAA A;  2GNQ A;  3RSE C;  4XYI A;  4ES0 A;  3UVL A;  4A7J A;  2AQ5 A;  3OKT A;  2H13 A;  2AGW A;  3PVW B;  4FA5 D;  4KFM B;  2OK4 A;  4JXM A;  2QC5 A;  2H9P A;  1A0R B;  4XEI C;  4JT5 C;  4Y7R A;  5I5M A;  3JZG A;  5HQG A;  3SN6 B;  4CY1 A;  1PI6 A;  4E54 B;  4GQ2 P;  4CZX A;  5H17 A;  3I2N A;  4CY2 A;  4A08 A;  3PXW D;  3OW8 A;  3N0D A;  4O45 A;  3SVW D;  1NR0 A;  2AGX A;  2P9L C;  2P9I C;  3FM0 A;  2AGL A;  4AOW A;  3PSC B;  4GZ8 A;  3EMH A;  2AH0 A;  2IUQ A;  5IJ7 E;  4JD2 C;  3K26 A;  3VA6 A;  3MKQ A;  1XKS A;  2H6K A;  3K27 A;  4G56 B;  4N14 A;  3MZL A;  4D0K A;  1MDA H;  4A11 B;  4J8B A;  3BG1 A;  2O9K A;  5C9Z B;  5IGQ A;  2OK6 A;  4JSV C;  2OVP B;  4XYH A;  1S4U X;  1NEX B;  3E0C A;  2PM6 B;  1XHM A;  3IIW A;  2G9A A;  5AJA A;  1R5M A;  3IKO A;  3C99 A;  2P9N C;  5HE1 B;  3EU7 A;  4CY5 A;  2H9M A;  5EMJ B;  2PBI B;  3JPX A;  4ZOX A;  1GXR A;  4OZU A;  5HE2 B;  3L4O D;  4ERQ A;  4A11 A;  2IUP A;  3KRX B;  3CIK B;  4O3U B;  3SXT D;  2UZY B;  4K3I D;  3JAM g;  4Z8L A;  2OJY A;  3I8E A;  5EAR A;  2YB8 B;  4LGN A;  3I7H A;  1QNI A;  5KDO B;  3AH8 B;  4A0B A;  4O3T B;  3RFH A;  2AGY A;  2H9N A;  2CNX A;  4H5I A;  1U4C A;  1XIP A;  4QQE A;  4CI1 A;  1U2V C;  4J0X A;  5FA5 B;  4BL0 A;  2HKM A;  4L3G D;  4J82 A;  3OKW A;  4J77 A;  3N0E A;  2G99 A;  2HYE A;  4J79 A;  4A09 B;  1PBY B;  5TEF A;  3PVU B;  3UVM A;  4A09 A;  5CXB A;  5TEE A;  3V9F A;  4FAN D;  3MZK A;  2J55 H;  2GC4 A;  4JSN C;  4PSX B;  2P9S C;  3NVX A;  2PM9 A;  4J73 A;  4L3H D;  4D6V A;  1B9X A;  3RMZ D;  1N6E A;  4X63 B;  4X60 B;  3J80 g;  2XL3 A;  3I7L A;  4QL1 A;  3BG0 A;  2BCJ B;  3VH0 A;  2B5N A;  3CFS B;  5IJ8 E;  4E54 A;  2YNP A;  2H6Q A;  3CFV A;  3NVN A;  5FKQ A;  4GM9 A;  2I3T A;  4OWR A;  2CO0 C;  5I5J A;  3EI2 A;  2AGZ A;  4PSW B;  3RN0 D;  1PGU A;  1P22 A;  4E5Z B;  4GM3 A;  2Z2P A;  4UI9 R;  1N6F A;  3SJL D;  3EI1 A;  5H14 A;  3IJ0 A;  4LG8 A;  3AFC A;  3I7K A;  4CI8 A;  2XU7 A;  5B4W A;  4K3J B;  4I79 A;  4U7A A;  4PBY A;  5TF2 A;  5EM2 A;  3EG6 A;  4JT6 C;  4J78 A;  4O9D A;  5I5I A;  2AH1 A;  2B5L A;  4GMB A;  4JSX C;  5EAM A;  4ESG A;  2GC7 A;  2UZX B;  4YVD A;  4ZN4 A;  1JMX B;  3GRE A;  4E5Z A;  5A2Q g;  2CN3 A;  2P9K C;  3UKU C;  4GQB B;  3W15 A;  3I7O A;  2HJ4 A;  1TYQ C;  4U1E I;  1K32 A;  3B7F A;  2BBK H;  1ERJ A;  1RI6 A;  3F3F A;  2H6N A;  3EI4 A;  4GGC A;  4QT8 A;  1JOF A;  3J81 g;  4CZV A;  2CE9 A;  4FA4 D;  5IC7 A;  3DXM C;  1JJU B;  3PSL A;  3NVQ A;  2B5M A;  3JZH A;  4GGD A;  5GXH A;  3MXX A;  4ZOV A;  3SBR A;  5FKS A;  2HXC A;  4PXW A;  3JRP A;  1PEV A;  1B9Y A;  3UVO A;  3ODT A;  4LG9 A;  5SXM A;  5HE3 B;  3SWS D;  3FGB A;  5TDH B;  3EI1 B;  4CI2 A;  3AL9 A;  2I0T A;  2PM7 B;  3AL8 A;  4FA9 D;  3EI4 B;  3IJC A;  5EMK B;  2YBA A;  3AL8 B;  4H5J A;  4J81 A;  5AMS A;  3I7P A;  5CXB B;  2H14 A;  2I0S A;  5FQD A;  4EWR A;  3SFZ A;  3MMY A;  4J87 A;  4FB1 D;  4MK0 B;  3ZWL B;  2Z2O A;  3VGZ A;  3C9C A;  5IGO A;  5CYK A;  3ORV D;  4FA1 D;  1TBG A;  4L9O A;  3DM0 A;  1N6D A;  4A2L A;  3RRM C;  3UKR C;  5EM2 B;  5FLX g;  1JMZ B;  3EI3 A;  5FXY A;  3KRW B;  2B4E A;  2I3S A;  4TZ4 A;  3F3G A;  4FWW A;  5HE0 B;  3UR4 A;  4GQ1 A;  5HYN B;  4J0W A;  1GG2 B;  2QXV A;  2IUR A;  2IWK A;  4R7A B;  2I0R A;  3JB9 L;  1OLZ A;  5GSA A;  2HJB A;  4J8G A;  4A2M A;  2P9U C;  3U4Y A;  2CN2 A;  1MG2 A;  4IMM A;  2EBS A;  3UVK A;  5AFU 3;  3L4M D;  2XYI A;  4JSP C;  2OIZ A;  4X61 B;  3OL2 A;  1Q47 A;  4L1Q D;  2CO0 A;  2H3X A;  2J57 G;  2Z2N A;  4CY3 A;  2J56 H;  3IIY A;  5FKT A;  5EMM B;  3SMR A;  4NSX A;  1GP2 B;  3FRX A;  3I8C A;  2IWF A;  3I89 A;  5EAP A;  4X3E A;  1FWX A;  3PXS D;  3SBQ A;  3A0F A;  3DSM A;  3EI2 B;  3ULE C;  1MG3 A;  3EWE A;  2OVR B;  3PE7 A;  1VYH C;  3OKY A;  3BWS A;  4A0A B;  3JZN A;  3OKY B;  2CE8 A;  2H68 A;  5K19 A;  4ZOY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...