2B4EA

Crystal structure of murine coronin-1: monoclinic form
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
386
structure length
386
Chain Sequence
b'SKFRHVFGQPAKADQCYEDVRVSQTTWDSGFCAVNPKFMALICEASGGGAFLVLPLGKTGRVDKNVPLVCGHTAPVLDIAWCPHNDNVIASGSEDCTVMVWEIPDGGLVLPLREPVITLEGHTKRVGIVAWHPTAQNVLLSAGCDNVILVWDVGTGAAVLTLGPDVHPDTIYSVDWSRDGALICTSCRDKRVRVIEPRKGTVVAEKDRPHEGTRPVHAVFVSEGKILTTGFSRMSERQVALWDTKHLEEPLSLQELDTSSGVLLPFFDPDTNIVYLCGKGDSSIRYFEITSEAPFLHYLSMFSSKESQRGMGYMPKRGLEVNKCEIARFYKLHERKCEPIAMTVPRKSDLFQEDLYPPTAGPDPALTAEEWLGGRDAGPLLISLKD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coronin-1A
publication title The crystal structure of murine coronin-1: a regulator of actin cytoskeletal dynamics in lymphocytes
pubmed doi rcsb
source organism Mus musculus
molecule tags Structural protein
total genus 95
structure length 386
sequence length 386
ec nomenclature
pdb deposition date 2005-09-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
A PF08953 DUF1899 Domain of unknown function (DUF1899)
A PF16300 WD40_4 Type of WD40 repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2b4eA01
3SMRA 2AQ5A 3EMHA 3I7NA 2I3SA 2W18A 5IGQA 1ERJA 3EI1B 2G99A 1JMXB 4D6VA 5EMJB 4A0AB 3JAMg 3RFGA 3DXMC 1SQ9A 4GZ8A 5C9ZB 4A7JA 3DWLC 4CY1A 2YNOA 3RMZD 4CI8A 4FA9D 3UKRC 4CI2A 4J79A 3DXKC 3EWEA 5AJAA 4PNKB 2P9SC 3AFCA 4FB1D 4PBYA 3IIWA 3RN0D 3JROA 3C99A 5EM2A 2J56H 5A2Qg 3AL8B 5H14A 5EAPA 4Z8LA 3VGZA 3MKQA 3L4MD 3SWSD 3KRXB 4G56B 4A0BB 3CFSB 4O3TB 4A08B 1PBYB 3PXSD 5EARA 2Z2OA 3AL9A 2AGWA 3JZHA 3UVNA 2I3TA 2IAAA 2PBIB 2YNNA 2H9NA 3V5WB 3EI2A 1A0RB 3L4OD 5FKTA 3I7KA 5TEFA 2PM7B 5SXMA 5GSAA 5CXCB 2OK4A 4A2MA 3UR4A 4BUJC 2YMUA 2HXCA 1P22A 1S4UX 1U4CA 5IGOA 5HE2B 4GGCA 2CO0C 3EI1A 3N0DA 1XIPA 4YVDA 5K1CC 4U1EI 1XKSA 4PBZA 4A0AA 2BBKH 3MXXA 4L3GD 2H9LA 5HYNB 2H3XA 4X61B 4CZVA 1JMZB 3OKYB 3VH0A 4J81A 4X63B 3DSMA 4ZOVA 3NVQA 5FKRA 2B5MA 2B5NA 3C9CA 3SCYA 4U7AA 2IUVA 4OWRA 2OVPB 3AL8A 4JT6C 4PSWB 1R5MA 2TRCB 3V9FA 4A0BA 2HJ4A 4A08A 1TYQC 3SXTD 3E0CA 3SBRA 4GMBA 2QXVA 4J0WA 4UI9R 1VYHC 2H47A 2P9KC 3FRXA 3I7HA 4FWWA 5AMSA 3SN6B 2H14A 2IUPA 5FA5B 3V7DB 4CY5A 5FQDA 2XYIA 4GM9A 4CI1A 3EU7A 5IC7A 3JZGA 4GGAA 1N6EA 3SFZA 4CY2A 2CN3A 2HESX 3IJ1A 3RRMC 3IJCA 2CO0A 2Z2NA 3ODTA 2OVRB 4K3ID 5H17A 5C2VB 3F3GA 4FA5D 4JT5C 5TDHB 1MG2A 3SLED 3F3PA 4BL0A 2PM6B 1GP2B 4R7AB 1YFQA 3ZWLB 3U4YA 4LGNA 4ERYA 4L9OA 4FHLA 4J84A 2H68A 3OKYA 3EI4B 4XYHA 2I0SA 5CXBB 3NVNA 5I5JA 1QNIA 1B9XA 3N0EA 2IURA 5FKQA 5CYKB 4PXWA 4GQ1A 4O9DA 5B4WA 3I7PA 4FAND 2HKMA 4JSXC 3JRPA 3K26A 2AGLA 4D0KA 3P4FA 5FXYA 3JPXA 4KFMB 4JD2C 2MTAH 3MZKA 2AH0A 3MKSB 2YNPA 3EI3A 4QL1A 2XL3A 4ZN4A 5KDOB 1GXRA 2H6NA 3OW8A 2H6QA 4LG8A 3JB9L 2H9MA 4A2LA 5TEEA 4XYIA 1NEXB 4OZUA 3IKOA 2BCJB 2YBAA 4L3HD 4QQEA 3UVOA 5IJ7E 2P9NC 3SBQA 3RSEC 1GG2B 2HYEA 1OLZA 4CY3A 2B5LA 2O9KA 3JZNA 2AH1A 3OKWA 4J8GA 1MG3A 3IJ0A 1XHMA 5FLXg 4NSXA 3A0FA 2I0TA 4E54B 4LG9A 4GQBB 4I79A 2EBSA 1U2VC 4J82A 4JSVC 3W15A 4ZOZA 4J86A 3F3FA 3C5MA 2IWKA 2B4EA 5C2WB 3SBPA 4O3UB 3GREA 3ORVD 2AGZA 2CE8A 4L1QD 3I7LA 4A09B 3EI4A 2QC5A 3I8CA 3IIYA 2Z2PA 3CIKB 4HDJA 4BH6A 4IMMA 5CYKA 4PSXB 4J8BA 5HE3B 5EAMA 1MDAH 4O1QD 3KRWB 1K32A 2GNQA 4J73A 3OL2B 4J77A 4ZOXA 4XEIC 5CXCA 2J55H 3EG6A 3PSCB 4JXMA 5THAA 4ERZA 2AGXA 3RFHA 5EMLB 4E5ZB 4A11B 2G9AA 2UZXB 3BWSA 2H9PA 5JWZA 4X60B 3OTTA 5AFU3 4N14A 4MK0B 2OK6A 2CN2A 2XU7A 4CZXA 2P9UC 1Q47A 2IUQA 4IA9A 4CI3A 3OKTA 2XL2A 1PGUA 4ZOYA 4GQ2P 1N6DA 1B9YA 1PEVA 3PVWB 5I5IA 1OMWB 2GC4A 4FAVD 2PM9B 4E54A 3J80g 3C75H 2P9LC 4O45A 4GM8A 3PVUB 3MMYA 1TBGA 1PI6A 5EALA 4J0XA 3BG0A 2YB8B 5HE1B 3PXTD 4EWRA 4AOWA 3SHFA 3PE7A 3PSLA 3UVMA 4QRJA 4CC9A 4ESGA 4FA1D 5H1MA 5GXHA 4A09A 3I2NA 3SVWD 4J78A 3K27A 2OIZA 5TF2A 1JOFA 3AH8B 3CFVA 2H13A 3NVXA 5FKSA 3J81g 2GC7A 2CNXA 5GXIA 3SJLD 4AEZA 2H6KA 4ERQA 4Y5RD 3OL2A 3PXWD 1K8KC 3GFCA 3RN1D 5HQGA 1GOTB 3UKUC 1L0QA 4E5ZA 4A11A 5EM2B 2I0RA 3ULEC 3I7OA 5HE0B 2AGYA 4FA4D 5EMMB 3RLMD 4H5JA 2UZYB 3BG1A 3B7FA 5GMKn 4H5IA 2OVQB 1NR0A 3UVKA 3VA6A 3FM0A 4JSPC 1RI6A 2Q7QA 3HFQA 3I8EA 2P9PC 3UVLA 2HKRA 5IT9g 2J57G 1N6FA 4ES0A 4GM3A 4PC0A 5IJ8E 5K19A 2IWFA 3EI2B 2P9IC 5CXBA 2OJYA 2HJBA 4J87A 1SQJA 2PM9A 4Y7RA 4K3JB 5EMKB 3I89A 1JJUB 4TZ4A 4CZYA 4GGDA 4JSNC 4QT8A 2CE9A 3EI3B 3DM0A 3FGBA 3MZLA 4X3EA 5I5MA 1FWXA 1SHYB
chains in the Genus database with same CATH superfamily
3SMRA 2AQ5A 3EMHA 3I7NA 4NC4A 2I3SA 2VDPA 2W18A 5IGQA 4WJKA 1U8CA 4BP8A 3ZE1A 1ERJA 3EI1B 2G99A 1JMXB 4D6VA 5EMJB 4A0AB 3JAMg 4AN1A 3OF7A 3RFGA 3DXMC 1SQ9A 4GZ8A 5C9ZB 2XDWA 4A7JA 3DWLC 4CY1A 2YNOA 3RMZD 4CI8A 2QR5A 4FA9D 1GOGA 3UKRC 4CI2A 4J79A 3DXKC 3IUQA 3EWEA 5AJAA 4PNKB 2P9SC 1UTCA 3AFCA 4FB1D 3ZE0A 1C9IA 4PBYA 3T3MA 2XZGA 3IIWA 1TYEA 5E6SA 3RN0D 3JROA 3C99A 3MUNA 5EM2A 2J56H 5A2Qg 3AL8B 5H14A 5EAPA 4Z8LA 3VGZA 3MKQA 3L4MD 3SWSD 3NIDA 3KRXB 3EQ8A 4G56B 4A0BB 3CFSB 4O3TB 4A08B 1PBYB 3PXSD 5EARA 2Z2OA 3AL9A 5FFOA 2AGWA 3JZHA 3UVNA 5E6UA 1I2MB 2I3TA 2IAAA 2HU5A 2PBIB 1UOPA 2YNNA 2H9NA 3V5WB 3EI2A 1VE6A 1A0RB 3L4OD 5FKTA 3I7KA 4NENA 5TEFA 2PM7B 5SXMA 5GSAA 5CXCB 2OK4A 4A2MA 3UR4A 4BUJC 2YMUA 3EQ9A 3IVMA 2HXCA 1QFMA 1P22A 1S4UX 1U4CA 1GOHA 4BP9A 1T2XA 5IGOA 3ZE2A 5HE2B 2VDKA 4GGCA 2CO0C 5M5TA 2WQ8A 3VI3A 3EI1A 3N0DA 3V4PA 1XIPA 4YVDA 5K1CC 2EIEA 4U1EI 1XKSA 4PBZA 4A0AA 2BBKH 3MXXA 4L3GD 2H9LA 5HYNB 2H3XA 2VZ1A 3O4HA 4X61B 4NAAA 4CZVA 1JMZB 3OKYB 1GOFA 3VH0A 2BKLA 5M5RA 4J81A 1JV2A 4X63B 3DSMA 4ZOVA 4MMXA 3NVQA 1YR2A 2B5MA 5FKRA 2B5NA 3C9CA 2VDOA 3SCYA 4U7AA 2IUVA 3O4GA 4OWRA 2OVPB 3AL8A 4JT6C 4PSWB 1VZ3A 3K72A 1H2XA 1R5MA 2TRCB 3V9FA 4A0BA 2HJ4A 4A08A 1TYQC 3DDUA 3SXTD 3E0CA 2EIBA 4GMBA 3SBRA 3FCSA 2QXVA 4J0WA 1QFSA 1VYHC 2H47A 4UI9R 2P9KC 3FRXA 3I7HA 4FWWA 5AMSA 3SN6B 2XE4A 3ZDYA 2H14A 2IUPA 5FA5B 3V7DB 4CY5A 5FQDA 2XYIA 4GM9A 4CI1A 4RE5A 3EU7A 5IC7A 3JZGA 2VZ3A 4GGAA 1N6EA 2VDLA 3SFZA 4CY2A 4WK4A 2CN3A 2HESX 3IJ1A 5M5UA 3IUMA 3RRMC 3GD1I 3IJCA 2CO0A 2Z2NA 5FFGA 3ODTA 2OVRB 4K3ID 5H17A 5C2VB 1A12A 3F3GA 4FA5D 4JT5C 5TDHB 1MG2A 3SLED 3F3PA 4BL0A 2PM6B 1GP2B 4R7AB 1YFQA 4BCCA 1VZ2A 3ZWLB 2EIDA 3U4YA 4LGNA 4ERYA 4L9OA 4FHLA 4J84A 2H68A 3OKYA 3O4JA 3EI4B 4JHNA 4AMYA 4XYHA 2I0SA 5CXBB 4QAMA 3NVNA 5I5JA 1QNIA 1B9XA 3N0EA 2IURA 5FKQA 2VC2A 5CYKB 3MVDK 4PXWA 4WK0A 4GQ1A 4O9DA 5B4WA 4WK2A 3I7PA 2HU7A 4FAND 2HKMA 4JSXC 1E8MA 3JRPA 3K26A 2AGLA 4IRZA 5C92A 4D0KA 3P4FA 5FXYA 3JPXA 4KFMB 4JD2C 2MTAH 3MZKA 2AH0A 2VDNA 3MKSB 2YNPA 3EI3A 4QL1A 2XL3A 4ZN4A 1JTDB 5KDOB 1GXRA 1E5TA 2H6NA 3OW8A 2H6QA 4LG8A 3JB9L 2H9MA 4A2LA 5TEEA 4XYIA 4AX4A 1NEXB 4OZUA 3IKOA 2BCJB 4MMZA 2YBAA 1K3IA 4L3HD 4QQEA 3UVOA 5IJ7E 3IURA 4G1MA 2P9NC 3SBQA 3RSEC 1GG2B 2HYEA 1OLZA 4CY3A 2B5LA 2O9KA 3JZNA 2AH1A 3OKWA 4J8GA 1MG3A 3IJ0A 1XHMA 5FLXg 4NSXA 3K6SA 3A0FA 2I0TA 4E54B 4LG9A 4GQBB 4I79A 2EBSA 1U2VC 3KCIA 4J82A 4JSVC 3W15A 3IULA 4ZOZA 4RE6A 3V4VA 4J86A 5E6RA 3GC3B 3F3FA 3C5MA 2IWKA 3ZDXA 2B4EA 5C2WB 3SBPA 4O3UB 2EICA 3GREA 3ORVD 2AGZA 2CE8A 4L1QD 3I7LA 4JHPC 4A09B 4BCBA 5M5SA 3EI4A 2QC5A 3QHYB 2QZPA 4Z7OA 3I8CA 3IIYA 2Z2PA 3O4IA 3CIKB 4HDJA 4BH6A 4Z7QA 4IMMA 5CYKA 4PSXB 4AMZA 4J8BA 5HE3B 5EAMA 4O02A 1MDAH 4O1QD 3KRWB 1K32A 3FCUA 2GNQA 1M1XA 4J73A 3OL2B 4J77A 4ZOXA 4XEIC 5CXCA 2J55H 1O6GA 3EG6A 4D9SA 3PSCB 4JXMA 1UOQA 5THAA 4ERZA 2AGXA 3RFHA 5EMLB 4E5ZB 4A11B 2G9AA 2UZXB 4L1MA 3BWSA 2H9PA 5JWZA 4X60B 1BPOA 1O6FA 1H2YA 3OTTA 2VDQA 5AFU3 3IUNA 4N14A 4MK0B 2OK6A 2CN2A 2XU7A 4CZXA 2P9UC 1Q47A 3IUJA 2IUQA 4G55A 4IA9A 4MMYA 3OKTA 2XL2A 4CI3A 1PGUA 4ZOYA 4GQ2P 1VE7A 1N6DA 1B9YA 1PEVA 3PVWB 3IJEA 5M61A 5I5IA 1OMWB 2GC4A 4FAVD 2PM9B 4E54A 4Z7NA 3J80g 3C75H 2P9LC 4O45A 4GM8A 3PVUB 3ZDZA 3MMYA 3NIFA 1TBGA 3EQ7A 1PI6A 5EALA 4J0XA 3BG0A 2YB8B 5HE1B 3PXTD 4EWRA 4AOWA 3SHFA 3PE7A 3PSLA 3UVMA 4QRJA 4CC9A 4ESGA 4O2WA 4FA1D 5H1MA 5GXHA 4A09A 3I2NA 3SVWD 4UM8A 4J78A 1C9LA 4UM9A 3K27A 2OIZA 5TF2A 1JOFA 3AH8B 3CFVA 2H13A 3NVXA 5FKSA 1E8NA 3J81g 1UOOA 2GC7A 1L5GA 2CNXA 5GXIA 3SJLD 4AEZA 2H6KA 4ERQA 4Y5RD 3OL2A 3PXWD 3NIGA 1K8KC 3GFCA 4G1EA 3RN1D 5HQGA 1GOTB 3UKUC 1L0QA 4E5ZA 4A11A 2HU8A 5EM2B 5C86A 2I0RA 1H2WA 3ULEC 3I7OA 5HE0B 4DNVA 2AGYA 5M5VA 4FA4D 5EMMB 3RLMD 4H5JA 2UZYB 3BG1A 3B7FA 5GMKn 4H5IA 2OVQB 1NR0A 3UVKA 3VA6A 3FM0A 4NBMA 2VDRA 4JSPC 1RI6A 2VDMA 2Q7QA 3HFQA 3I8EA 2P9PC 3T3PA 3UVLA 2HKRA 5IT9g 2J57G 1N6FA 4ES0A 4GM3A 4PC0A 3VI4A 5IJ8E 2IWFA 5K19A 2P9IC 3EI2B 2JKXA 5CXBA 3K71A 2OJYA 2HJBA 4BCDA 4J87A 1SQJA 2PM9A 4Y7RA 4K3JB 5EMKB 3I89A 1JJUB 4AN0A 3MUOA 4TZ4A 4CZYA 4DNUA 3QI0A 4GGDA 4JSNC 4QT8A 2CE9A 4DNWA 1H2ZA 3DM0A 3EI3B 3FGBA 5HDBA 3MZLA 4X3EA 5I5MA 1FWXA 1SHYB
chains in the Genus database with same CATH topology
3SMRA 2AQ5A 3EMHA 3I7NA 2I3SA 2W18A 5IGQA 1ERJA 3EI1B 2G99A 1JMXB 4D6VA 5EMJB 4A0AB 3JAMg 3RFGA 3DXMC 1SQ9A 4GZ8A 5C9ZB 4A7JA 3DWLC 4CY1A 2YNOA 3RMZD 4CI8A 4FA9D 3UKRC 4CI2A 4J79A 3DXKC 3EWEA 5AJAA 4PNKB 2P9SC 3AFCA 4FB1D 4PBYA 3IIWA 3RN0D 3JROA 3C99A 5EM2A 2J56H 5A2Qg 3AL8B 5H14A 5EAPA 4Z8LA 3VGZA 3MKQA 3L4MD 3SWSD 3KRXB 4G56B 4A0BB 3CFSB 4O3TB 4A08B 1PBYB 3PXSD 5EARA 2Z2OA 3AL9A 2AGWA 3JZHA 3UVNA 2I3TA 2IAAA 2PBIB 2YNNA 2H9NA 3V5WB 3EI2A 1A0RB 3L4OD 5FKTA 3I7KA 5TEFA 2PM7B 5SXMA 5GSAA 5CXCB 2OK4A 4A2MA 3UR4A 4BUJC 2YMUA 2HXCA 1P22A 1S4UX 1U4CA 5IGOA 5HE2B 4GGCA 2CO0C 3EI1A 3N0DA 1XIPA 4YVDA 5K1CC 4U1EI 1XKSA 4PBZA 4A0AA 2BBKH 3MXXA 4L3GD 2H9LA 5HYNB 2H3XA 4X61B 4CZVA 1JMZB 3OKYB 3VH0A 4J81A 4X63B 3DSMA 4ZOVA 3NVQA 5FKRA 2B5MA 2B5NA 3C9CA 3SCYA 4U7AA 2IUVA 4OWRA 2OVPB 3AL8A 4JT6C 4PSWB 1R5MA 2TRCB 3V9FA 4A0BA 2HJ4A 4A08A 1TYQC 3SXTD 3E0CA 3SBRA 4GMBA 2QXVA 4J0WA 4UI9R 1VYHC 2H47A 2P9KC 3FRXA 3I7HA 4FWWA 5AMSA 3SN6B 2H14A 2IUPA 5FA5B 3V7DB 4CY5A 5FQDA 2XYIA 4GM9A 4CI1A 3EU7A 5IC7A 3JZGA 4GGAA 1N6EA 3SFZA 4CY2A 2CN3A 2HESX 3IJ1A 3RRMC 3IJCA 2CO0A 2Z2NA 3ODTA 2OVRB 4K3ID 5H17A 5C2VB 3F3GA 4FA5D 4JT5C 5TDHB 1MG2A 3SLED 3F3PA 4BL0A 2PM6B 1GP2B 4R7AB 1YFQA 3ZWLB 3U4YA 4LGNA 4ERYA 4L9OA 4FHLA 4J84A 2H68A 3OKYA 3EI4B 4XYHA 2I0SA 5CXBB 3NVNA 5I5JA 1QNIA 1B9XA 3N0EA 2IURA 5FKQA 5CYKB 4PXWA 4GQ1A 4O9DA 5B4WA 3I7PA 4FAND 2HKMA 4JSXC 3JRPA 3K26A 2AGLA 4D0KA 3P4FA 5FXYA 3JPXA 4KFMB 4JD2C 2MTAH 3MZKA 2AH0A 3MKSB 2YNPA 3EI3A 4QL1A 2XL3A 4ZN4A 5KDOB 1GXRA 2H6NA 3OW8A 2H6QA 4LG8A 3JB9L 2H9MA 4A2LA 5TEEA 4XYIA 1NEXB 4OZUA 3IKOA 2BCJB 2YBAA 4L3HD 4QQEA 3UVOA 5IJ7E 2P9NC 3SBQA 3RSEC 1GG2B 2HYEA 1OLZA 4CY3A 2B5LA 2O9KA 3JZNA 2AH1A 3OKWA 4J8GA 1MG3A 3IJ0A 1XHMA 5FLXg 4NSXA 3A0FA 2I0TA 4E54B 4LG9A 4GQBB 4I79A 2EBSA 1U2VC 4J82A 4JSVC 3W15A 4ZOZA 4J86A 3F3FA 3C5MA 2IWKA 2B4EA 5C2WB 3SBPA 4O3UB 3GREA 3ORVD 2AGZA 2CE8A 4L1QD 3I7LA 4A09B 3EI4A 2QC5A 3I8CA 3IIYA 2Z2PA 3CIKB 4HDJA 4BH6A 4IMMA 5CYKA 4PSXB 4J8BA 5HE3B 5EAMA 1MDAH 4O1QD 3KRWB 1K32A 2GNQA 4J73A 3OL2B 4J77A 4ZOXA 4XEIC 5CXCA 2J55H 3EG6A 3PSCB 4JXMA 5THAA 4ERZA 2AGXA 3RFHA 5EMLB 4E5ZB 4A11B 2G9AA 2UZXB 3BWSA 2H9PA 5JWZA 4X60B 3OTTA 5AFU3 4N14A 4MK0B 2OK6A 2CN2A 2XU7A 4CZXA 2P9UC 1Q47A 2IUQA 4IA9A 4CI3A 3OKTA 2XL2A 1PGUA 4ZOYA 4GQ2P 1N6DA 1B9YA 1PEVA 3PVWB 5I5IA 1OMWB 2GC4A 4FAVD 2PM9B 4E54A 3J80g 3C75H 2P9LC 4O45A 4GM8A 3PVUB 3MMYA 1TBGA 1PI6A 5EALA 4J0XA 3BG0A 2YB8B 5HE1B 3PXTD 4EWRA 4AOWA 3SHFA 3PE7A 3PSLA 3UVMA 4QRJA 4CC9A 4ESGA 4FA1D 5H1MA 5GXHA 4A09A 3I2NA 3SVWD 4J78A 3K27A 2OIZA 5TF2A 1JOFA 3AH8B 3CFVA 2H13A 3NVXA 5FKSA 3J81g 2GC7A 2CNXA 5GXIA 3SJLD 4AEZA 2H6KA 4ERQA 4Y5RD 3OL2A 3PXWD 1K8KC 3GFCA 3RN1D 5HQGA 1GOTB 3UKUC 1L0QA 4E5ZA 4A11A 5EM2B 2I0RA 3ULEC 3I7OA 5HE0B 2AGYA 4FA4D 5EMMB 3RLMD 4H5JA 2UZYB 3BG1A 3B7FA 5GMKn 4H5IA 2OVQB 1NR0A 3UVKA 3VA6A 3FM0A 4JSPC 1RI6A 2Q7QA 3HFQA 3I8EA 2P9PC 3UVLA 2HKRA 5IT9g 2J57G 1N6FA 4ES0A 4GM3A 4PC0A 5IJ8E 5K19A 2IWFA 3EI2B 2P9IC 5CXBA 2OJYA 2HJBA 4J87A 1SQJA 2PM9A 4Y7RA 4K3JB 5EMKB 3I89A 1JJUB 4TZ4A 4CZYA 4GGDA 4JSNC 4QT8A 2CE9A 3EI3B 3DM0A 3FGBA 3MZLA 4X3EA 5I5MA 1FWXA 1SHYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SMR A;  2AQ5 A;  3EMH A;  3I7N A;  2I3S A;  2W18 A;  5IGQ A;  1ERJ A;  3EI1 B;  2G99 A;  1JMX B;  4D6V A;  5EMJ B;  4A0A B;  3JAM g;  3RFG A;  3DXM C;  1SQ9 A;  4GZ8 A;  5C9Z B;  4A7J A;  3DWL C;  4CY1 A;  2YNO A;  3RMZ D;  4CI8 A;  4FA9 D;  3UKR C;  4CI2 A;  4J79 A;  3DXK C;  3EWE A;  5AJA A;  4PNK B;  2P9S C;  3AFC A;  4FB1 D;  4PBY A;  3IIW A;  3RN0 D;  3JRO A;  3C99 A;  5EM2 A;  2J56 H;  5A2Q g;  3AL8 B;  5H14 A;  5EAP A;  4Z8L A;  3VGZ A;  3MKQ A;  3L4M D;  3SWS D;  3KRX B;  4G56 B;  4A0B B;  3CFS B;  4O3T B;  4A08 B;  1PBY B;  3PXS D;  5EAR A;  2Z2O A;  3AL9 A;  2AGW A;  3JZH A;  3UVN A;  2I3T A;  2IAA A;  2PBI B;  2YNN A;  2H9N A;  3V5W B;  3EI2 A;  1A0R B;  3L4O D;  5FKT A;  3I7K A;  5TEF A;  2PM7 B;  5SXM A;  5GSA A;  5CXC B;  2OK4 A;  4A2M A;  3UR4 A;  4BUJ C;  2YMU A;  2HXC A;  1P22 A;  1S4U X;  1U4C A;  5IGO A;  5HE2 B;  4GGC A;  2CO0 C;  3EI1 A;  3N0D A;  1XIP A;  4YVD A;  5K1C C;  4U1E I;  1XKS A;  4PBZ A;  4A0A A;  2BBK H;  3MXX A;  4L3G D;  2H9L A;  5HYN B;  2H3X A;  4X61 B;  4CZV A;  1JMZ B;  3OKY B;  3VH0 A;  4J81 A;  4X63 B;  3DSM A;  4ZOV A;  3NVQ A;  5FKR A;  2B5M A;  2B5N A;  3C9C A;  3SCY A;  4U7A A;  2IUV A;  4OWR A;  2OVP B;  3AL8 A;  4JT6 C;  4PSW B;  1R5M A;  2TRC B;  3V9F A;  4A0B A;  2HJ4 A;  4A08 A;  1TYQ C;  3SXT D;  3E0C A;  3SBR A;  4GMB A;  2QXV A;  4J0W A;  4UI9 R;  1VYH C;  2H47 A;  2P9K C;  3FRX A;  3I7H A;  4FWW A;  5AMS A;  3SN6 B;  2H14 A;  2IUP A;  5FA5 B;  3V7D B;  4CY5 A;  5FQD A;  2XYI A;  4GM9 A;  4CI1 A;  3EU7 A;  5IC7 A;  3JZG A;  4GGA A;  1N6E A;  3SFZ A;  4CY2 A;  2CN3 A;  2HES X;  3IJ1 A;  3RRM C;  3IJC A;  2CO0 A;  2Z2N A;  3ODT A;  2OVR B;  4K3I D;  5H17 A;  5C2V B;  3F3G A;  4FA5 D;  4JT5 C;  5TDH B;  1MG2 A;  3SLE D;  3F3P A;  4BL0 A;  2PM6 B;  1GP2 B;  4R7A B;  1YFQ A;  3ZWL B;  3U4Y A;  4LGN A;  4ERY A;  4L9O A;  4FHL A;  4J84 A;  2H68 A;  3OKY A;  3EI4 B;  4XYH A;  2I0S A;  5CXB B;  3NVN A;  5I5J A;  1QNI A;  1B9X A;  3N0E A;  2IUR A;  5FKQ A;  5CYK B;  4PXW A;  4GQ1 A;  4O9D A;  5B4W A;  3I7P A;  4FAN D;  2HKM A;  4JSX C;  3JRP A;  3K26 A;  2AGL A;  4D0K A;  3P4F A;  5FXY A;  3JPX A;  4KFM B;  4JD2 C;  2MTA H;  3MZK A;  2AH0 A;  3MKS B;  2YNP A;  3EI3 A;  4QL1 A;  2XL3 A;  4ZN4 A;  5KDO B;  1GXR A;  2H6N A;  3OW8 A;  2H6Q A;  4LG8 A;  3JB9 L;  2H9M A;  4A2L A;  5TEE A;  4XYI A;  1NEX B;  4OZU A;  3IKO A;  2BCJ B;  2YBA A;  4L3H D;  4QQE A;  3UVO A;  5IJ7 E;  2P9N C;  3SBQ A;  3RSE C;  1GG2 B;  2HYE A;  1OLZ A;  4CY3 A;  2B5L A;  2O9K A;  3JZN A;  2AH1 A;  3OKW A;  4J8G A;  1MG3 A;  3IJ0 A;  1XHM A;  5FLX g;  4NSX A;  3A0F A;  2I0T A;  4E54 B;  4LG9 A;  4GQB B;  4I79 A;  2EBS A;  1U2V C;  4J82 A;  4JSV C;  3W15 A;  4ZOZ A;  4J86 A;  3F3F A;  3C5M A;  2IWK A;  2B4E A;  5C2W B;  3SBP A;  4O3U B;  3GRE A;  3ORV D;  2AGZ A;  2CE8 A;  4L1Q D;  3I7L A;  4A09 B;  3EI4 A;  2QC5 A;  3I8C A;  3IIY A;  2Z2P A;  3CIK B;  4HDJ A;  4BH6 A;  4IMM A;  5CYK A;  4PSX B;  4J8B A;  5HE3 B;  5EAM A;  1MDA H;  4O1Q D;  3KRW B;  1K32 A;  2GNQ A;  4J73 A;  3OL2 B;  4J77 A;  4ZOX A;  4XEI C;  5CXC A;  2J55 H;  3EG6 A;  3PSC B;  4JXM A;  5THA A;  4ERZ A;  2AGX A;  3RFH A;  5EML B;  4E5Z B;  4A11 B;  2G9A A;  2UZX B;  3BWS A;  2H9P A;  5JWZ A;  4X60 B;  3OTT A;  5AFU 3;  4N14 A;  4MK0 B;  2OK6 A;  2CN2 A;  2XU7 A;  4CZX A;  2P9U C;  1Q47 A;  2IUQ A;  4IA9 A;  4CI3 A;  3OKT A;  2XL2 A;  1PGU A;  4ZOY A;  4GQ2 P;  1N6D A;  1B9Y A;  1PEV A;  3PVW B;  5I5I A;  1OMW B;  2GC4 A;  4FAV D;  2PM9 B;  4E54 A;  3J80 g;  3C75 H;  2P9L C;  4O45 A;  4GM8 A;  3PVU B;  3MMY A;  1TBG A;  1PI6 A;  5EAL A;  4J0X A;  3BG0 A;  2YB8 B;  5HE1 B;  3PXT D;  4EWR A;  4AOW A;  3SHF A;  3PE7 A;  3PSL A;  3UVM A;  4QRJ A;  4CC9 A;  4ESG A;  4FA1 D;  5H1M A;  5GXH A;  4A09 A;  3I2N A;  3SVW D;  4J78 A;  3K27 A;  2OIZ A;  5TF2 A;  1JOF A;  3AH8 B;  3CFV A;  2H13 A;  3NVX A;  5FKS A;  3J81 g;  2GC7 A;  2CNX A;  5GXI A;  3SJL D;  4AEZ A;  2H6K A;  4ERQ A;  4Y5R D;  3OL2 A;  3PXW D;  1K8K C;  3GFC A;  3RN1 D;  5HQG A;  1GOT B;  3UKU C;  1L0Q A;  4E5Z A;  4A11 A;  5EM2 B;  2I0R A;  3ULE C;  3I7O A;  5HE0 B;  2AGY A;  4FA4 D;  5EMM B;  3RLM D;  4H5J A;  2UZY B;  3BG1 A;  3B7F A;  5GMK n;  4H5I A;  2OVQ B;  1NR0 A;  3UVK A;  3VA6 A;  3FM0 A;  4JSP C;  1RI6 A;  2Q7Q A;  3HFQ A;  3I8E A;  2P9P C;  3UVL A;  2HKR A;  5IT9 g;  2J57 G;  1N6F A;  4ES0 A;  4GM3 A;  4PC0 A;  5IJ8 E;  5K19 A;  2IWF A;  3EI2 B;  2P9I C;  5CXB A;  2OJY A;  2HJB A;  4J87 A;  1SQJ A;  2PM9 A;  4Y7R A;  4K3J B;  5EMK B;  3I89 A;  1JJU B;  4TZ4 A;  4CZY A;  4GGD A;  4JSN C;  4QT8 A;  2CE9 A;  3EI3 B;  3DM0 A;  3FGB A;  3MZL A;  4X3E A;  5I5M A;  1FWX A;  1SHY B; 
#chains in the Genus database with same CATH topology
 3SMR A;  2AQ5 A;  3EMH A;  3I7N A;  4NC4 A;  2I3S A;  2VDP A;  2W18 A;  5IGQ A;  4WJK A;  1U8C A;  4BP8 A;  3ZE1 A;  1ERJ A;  3EI1 B;  2G99 A;  1JMX B;  4D6V A;  5EMJ B;  4A0A B;  3JAM g;  4AN1 A;  3OF7 A;  3RFG A;  3DXM C;  1SQ9 A;  4GZ8 A;  5C9Z B;  2XDW A;  4A7J A;  3DWL C;  4CY1 A;  2YNO A;  3RMZ D;  4CI8 A;  2QR5 A;  4FA9 D;  1GOG A;  3UKR C;  4CI2 A;  4J79 A;  3DXK C;  3IUQ A;  3EWE A;  5AJA A;  4PNK B;  2P9S C;  1UTC A;  3AFC A;  4FB1 D;  3ZE0 A;  1C9I A;  4PBY A;  3T3M A;  2XZG A;  3IIW A;  1TYE A;  5E6S A;  3RN0 D;  3JRO A;  3C99 A;  3MUN A;  5EM2 A;  2J56 H;  5A2Q g;  3AL8 B;  5H14 A;  5EAP A;  4Z8L A;  3VGZ A;  3MKQ A;  3L4M D;  3SWS D;  3NID A;  3KRX B;  3EQ8 A;  4G56 B;  4A0B B;  3CFS B;  4O3T B;  4A08 B;  1PBY B;  3PXS D;  5EAR A;  2Z2O A;  3AL9 A;  5FFO A;  2AGW A;  3JZH A;  3UVN A;  5E6U A;  1I2M B;  2I3T A;  2IAA A;  2HU5 A;  2PBI B;  1UOP A;  2YNN A;  2H9N A;  3V5W B;  3EI2 A;  1VE6 A;  1A0R B;  3L4O D;  5FKT A;  3I7K A;  4NEN A;  5TEF A;  2PM7 B;  5SXM A;  5GSA A;  5CXC B;  2OK4 A;  4A2M A;  3UR4 A;  4BUJ C;  2YMU A;  3EQ9 A;  3IVM A;  2HXC A;  1QFM A;  1P22 A;  1S4U X;  1U4C A;  1GOH A;  4BP9 A;  1T2X A;  5IGO A;  3ZE2 A;  5HE2 B;  2VDK A;  4GGC A;  2CO0 C;  5M5T A;  2WQ8 A;  3VI3 A;  3EI1 A;  3N0D A;  3V4P A;  1XIP A;  4YVD A;  5K1C C;  2EIE A;  4U1E I;  1XKS A;  4PBZ A;  4A0A A;  2BBK H;  3MXX A;  4L3G D;  2H9L A;  5HYN B;  2H3X A;  2VZ1 A;  3O4H A;  4X61 B;  4NAA A;  4CZV A;  1JMZ B;  3OKY B;  1GOF A;  3VH0 A;  2BKL A;  5M5R A;  4J81 A;  1JV2 A;  4X63 B;  3DSM A;  4ZOV A;  4MMX A;  3NVQ A;  1YR2 A;  2B5M A;  5FKR A;  2B5N A;  3C9C A;  2VDO A;  3SCY A;  4U7A A;  2IUV A;  3O4G A;  4OWR A;  2OVP B;  3AL8 A;  4JT6 C;  4PSW B;  1VZ3 A;  3K72 A;  1H2X A;  1R5M A;  2TRC B;  3V9F A;  4A0B A;  2HJ4 A;  4A08 A;  1TYQ C;  3DDU A;  3SXT D;  3E0C A;  2EIB A;  4GMB A;  3SBR A;  3FCS A;  2QXV A;  4J0W A;  1QFS A;  1VYH C;  2H47 A;  4UI9 R;  2P9K C;  3FRX A;  3I7H A;  4FWW A;  5AMS A;  3SN6 B;  2XE4 A;  3ZDY A;  2H14 A;  2IUP A;  5FA5 B;  3V7D B;  4CY5 A;  5FQD A;  2XYI A;  4GM9 A;  4CI1 A;  4RE5 A;  3EU7 A;  5IC7 A;  3JZG A;  2VZ3 A;  4GGA A;  1N6E A;  2VDL A;  3SFZ A;  4CY2 A;  4WK4 A;  2CN3 A;  2HES X;  3IJ1 A;  5M5U A;  3IUM A;  3RRM C;  3GD1 I;  3IJC A;  2CO0 A;  2Z2N A;  5FFG A;  3ODT A;  2OVR B;  4K3I D;  5H17 A;  5C2V B;  1A12 A;  3F3G A;  4FA5 D;  4JT5 C;  5TDH B;  1MG2 A;  3SLE D;  3F3P A;  4BL0 A;  2PM6 B;  1GP2 B;  4R7A B;  1YFQ A;  4BCC A;  1VZ2 A;  3ZWL B;  2EID A;  3U4Y A;  4LGN A;  4ERY A;  4L9O A;  4FHL A;  4J84 A;  2H68 A;  3OKY A;  3O4J A;  3EI4 B;  4JHN A;  4AMY A;  4XYH A;  2I0S A;  5CXB B;  4QAM A;  3NVN A;  5I5J A;  1QNI A;  1B9X A;  3N0E A;  2IUR A;  5FKQ A;  2VC2 A;  5CYK B;  3MVD K;  4PXW A;  4WK0 A;  4GQ1 A;  4O9D A;  5B4W A;  4WK2 A;  3I7P A;  2HU7 A;  4FAN D;  2HKM A;  4JSX C;  1E8M A;  3JRP A;  3K26 A;  2AGL A;  4IRZ A;  5C92 A;  4D0K A;  3P4F A;  5FXY A;  3JPX A;  4KFM B;  4JD2 C;  2MTA H;  3MZK A;  2AH0 A;  2VDN A;  3MKS B;  2YNP A;  3EI3 A;  4QL1 A;  2XL3 A;  4ZN4 A;  1JTD B;  5KDO B;  1GXR A;  1E5T A;  2H6N A;  3OW8 A;  2H6Q A;  4LG8 A;  3JB9 L;  2H9M A;  4A2L A;  5TEE A;  4XYI A;  4AX4 A;  1NEX B;  4OZU A;  3IKO A;  2BCJ B;  4MMZ A;  2YBA A;  1K3I A;  4L3H D;  4QQE A;  3UVO A;  5IJ7 E;  3IUR A;  4G1M A;  2P9N C;  3SBQ A;  3RSE C;  1GG2 B;  2HYE A;  1OLZ A;  4CY3 A;  2B5L A;  2O9K A;  3JZN A;  2AH1 A;  3OKW A;  4J8G A;  1MG3 A;  3IJ0 A;  1XHM A;  5FLX g;  4NSX A;  3K6S A;  3A0F A;  2I0T A;  4E54 B;  4LG9 A;  4GQB B;  4I79 A;  2EBS A;  1U2V C;  3KCI A;  4J82 A;  4JSV C;  3W15 A;  3IUL A;  4ZOZ A;  4RE6 A;  3V4V A;  4J86 A;  5E6R A;  3GC3 B;  3F3F A;  3C5M A;  2IWK A;  3ZDX A;  2B4E A;  5C2W B;  3SBP A;  4O3U B;  2EIC A;  3GRE A;  3ORV D;  2AGZ A;  2CE8 A;  4L1Q D;  3I7L A;  4JHP C;  4A09 B;  4BCB A;  5M5S A;  3EI4 A;  2QC5 A;  3QHY B;  2QZP A;  4Z7O A;  3I8C A;  3IIY A;  2Z2P A;  3O4I A;  3CIK B;  4HDJ A;  4BH6 A;  4Z7Q A;  4IMM A;  5CYK A;  4PSX B;  4AMZ A;  4J8B A;  5HE3 B;  5EAM A;  4O02 A;  1MDA H;  4O1Q D;  3KRW B;  1K32 A;  3FCU A;  2GNQ A;  1M1X A;  4J73 A;  3OL2 B;  4J77 A;  4ZOX A;  4XEI C;  5CXC A;  2J55 H;  1O6G A;  3EG6 A;  4D9S A;  3PSC B;  4JXM A;  1UOQ A;  5THA A;  4ERZ A;  2AGX A;  3RFH A;  5EML B;  4E5Z B;  4A11 B;  2G9A A;  2UZX B;  4L1M A;  3BWS A;  2H9P A;  5JWZ A;  4X60 B;  1BPO A;  1O6F A;  1H2Y A;  3OTT A;  2VDQ A;  5AFU 3;  3IUN A;  4N14 A;  4MK0 B;  2OK6 A;  2CN2 A;  2XU7 A;  4CZX A;  2P9U C;  1Q47 A;  3IUJ A;  2IUQ A;  4G55 A;  4IA9 A;  4MMY A;  3OKT A;  2XL2 A;  4CI3 A;  1PGU A;  4ZOY A;  4GQ2 P;  1VE7 A;  1N6D A;  1B9Y A;  1PEV A;  3PVW B;  3IJE A;  5M61 A;  5I5I A;  1OMW B;  2GC4 A;  4FAV D;  2PM9 B;  4E54 A;  4Z7N A;  3J80 g;  3C75 H;  2P9L C;  4O45 A;  4GM8 A;  3PVU B;  3ZDZ A;  3MMY A;  3NIF A;  1TBG A;  3EQ7 A;  1PI6 A;  5EAL A;  4J0X A;  3BG0 A;  2YB8 B;  5HE1 B;  3PXT D;  4EWR A;  4AOW A;  3SHF A;  3PE7 A;  3PSL A;  3UVM A;  4QRJ A;  4CC9 A;  4ESG A;  4O2W A;  4FA1 D;  5H1M A;  5GXH A;  4A09 A;  3I2N A;  3SVW D;  4UM8 A;  4J78 A;  1C9L A;  4UM9 A;  3K27 A;  2OIZ A;  5TF2 A;  1JOF A;  3AH8 B;  3CFV A;  2H13 A;  3NVX A;  5FKS A;  1E8N A;  3J81 g;  1UOO A;  2GC7 A;  1L5G A;  2CNX A;  5GXI A;  3SJL D;  4AEZ A;  2H6K A;  4ERQ A;  4Y5R D;  3OL2 A;  3PXW D;  3NIG A;  1K8K C;  3GFC A;  4G1E A;  3RN1 D;  5HQG A;  1GOT B;  3UKU C;  1L0Q A;  4E5Z A;  4A11 A;  2HU8 A;  5EM2 B;  5C86 A;  2I0R A;  1H2W A;  3ULE C;  3I7O A;  5HE0 B;  4DNV A;  2AGY A;  5M5V A;  4FA4 D;  5EMM B;  3RLM D;  4H5J A;  2UZY B;  3BG1 A;  3B7F A;  5GMK n;  4H5I A;  2OVQ B;  1NR0 A;  3UVK A;  3VA6 A;  3FM0 A;  4NBM A;  2VDR A;  4JSP C;  1RI6 A;  2VDM A;  2Q7Q A;  3HFQ A;  3I8E A;  2P9P C;  3T3P A;  3UVL A;  2HKR A;  5IT9 g;  2J57 G;  1N6F A;  4ES0 A;  4GM3 A;  4PC0 A;  3VI4 A;  5IJ8 E;  2IWF A;  5K19 A;  2P9I C;  3EI2 B;  2JKX A;  5CXB A;  3K71 A;  2OJY A;  2HJB A;  4BCD A;  4J87 A;  1SQJ A;  2PM9 A;  4Y7R A;  4K3J B;  5EMK B;  3I89 A;  1JJU B;  4AN0 A;  3MUO A;  4TZ4 A;  4CZY A;  4DNU A;  3QI0 A;  4GGD A;  4JSN C;  4QT8 A;  2CE9 A;  4DNW A;  1H2Z A;  3DM0 A;  3EI3 B;  3FGB A;  5HDB A;  3MZL A;  4X3E A;  5I5M A;  1FWX A;  1SHY B; 
#chains in the Genus database with same CATH homology
 3SMR A;  2AQ5 A;  3EMH A;  3I7N A;  2I3S A;  2W18 A;  5IGQ A;  1ERJ A;  3EI1 B;  2G99 A;  1JMX B;  4D6V A;  5EMJ B;  4A0A B;  3JAM g;  3RFG A;  3DXM C;  1SQ9 A;  4GZ8 A;  5C9Z B;  4A7J A;  3DWL C;  4CY1 A;  2YNO A;  3RMZ D;  4CI8 A;  4FA9 D;  3UKR C;  4CI2 A;  4J79 A;  3DXK C;  3EWE A;  5AJA A;  4PNK B;  2P9S C;  3AFC A;  4FB1 D;  4PBY A;  3IIW A;  3RN0 D;  3JRO A;  3C99 A;  5EM2 A;  2J56 H;  5A2Q g;  3AL8 B;  5H14 A;  5EAP A;  4Z8L A;  3VGZ A;  3MKQ A;  3L4M D;  3SWS D;  3KRX B;  4G56 B;  4A0B B;  3CFS B;  4O3T B;  4A08 B;  1PBY B;  3PXS D;  5EAR A;  2Z2O A;  3AL9 A;  2AGW A;  3JZH A;  3UVN A;  2I3T A;  2IAA A;  2PBI B;  2YNN A;  2H9N A;  3V5W B;  3EI2 A;  1A0R B;  3L4O D;  5FKT A;  3I7K A;  5TEF A;  2PM7 B;  5SXM A;  5GSA A;  5CXC B;  2OK4 A;  4A2M A;  3UR4 A;  4BUJ C;  2YMU A;  2HXC A;  1P22 A;  1S4U X;  1U4C A;  5IGO A;  5HE2 B;  4GGC A;  2CO0 C;  3EI1 A;  3N0D A;  1XIP A;  4YVD A;  5K1C C;  4U1E I;  1XKS A;  4PBZ A;  4A0A A;  2BBK H;  3MXX A;  4L3G D;  2H9L A;  5HYN B;  2H3X A;  4X61 B;  4CZV A;  1JMZ B;  3OKY B;  3VH0 A;  4J81 A;  4X63 B;  3DSM A;  4ZOV A;  3NVQ A;  5FKR A;  2B5M A;  2B5N A;  3C9C A;  3SCY A;  4U7A A;  2IUV A;  4OWR A;  2OVP B;  3AL8 A;  4JT6 C;  4PSW B;  1R5M A;  2TRC B;  3V9F A;  4A0B A;  2HJ4 A;  4A08 A;  1TYQ C;  3SXT D;  3E0C A;  3SBR A;  4GMB A;  2QXV A;  4J0W A;  4UI9 R;  1VYH C;  2H47 A;  2P9K C;  3FRX A;  3I7H A;  4FWW A;  5AMS A;  3SN6 B;  2H14 A;  2IUP A;  5FA5 B;  3V7D B;  4CY5 A;  5FQD A;  2XYI A;  4GM9 A;  4CI1 A;  3EU7 A;  5IC7 A;  3JZG A;  4GGA A;  1N6E A;  3SFZ A;  4CY2 A;  2CN3 A;  2HES X;  3IJ1 A;  3RRM C;  3IJC A;  2CO0 A;  2Z2N A;  3ODT A;  2OVR B;  4K3I D;  5H17 A;  5C2V B;  3F3G A;  4FA5 D;  4JT5 C;  5TDH B;  1MG2 A;  3SLE D;  3F3P A;  4BL0 A;  2PM6 B;  1GP2 B;  4R7A B;  1YFQ A;  3ZWL B;  3U4Y A;  4LGN A;  4ERY A;  4L9O A;  4FHL A;  4J84 A;  2H68 A;  3OKY A;  3EI4 B;  4XYH A;  2I0S A;  5CXB B;  3NVN A;  5I5J A;  1QNI A;  1B9X A;  3N0E A;  2IUR A;  5FKQ A;  5CYK B;  4PXW A;  4GQ1 A;  4O9D A;  5B4W A;  3I7P A;  4FAN D;  2HKM A;  4JSX C;  3JRP A;  3K26 A;  2AGL A;  4D0K A;  3P4F A;  5FXY A;  3JPX A;  4KFM B;  4JD2 C;  2MTA H;  3MZK A;  2AH0 A;  3MKS B;  2YNP A;  3EI3 A;  4QL1 A;  2XL3 A;  4ZN4 A;  5KDO B;  1GXR A;  2H6N A;  3OW8 A;  2H6Q A;  4LG8 A;  3JB9 L;  2H9M A;  4A2L A;  5TEE A;  4XYI A;  1NEX B;  4OZU A;  3IKO A;  2BCJ B;  2YBA A;  4L3H D;  4QQE A;  3UVO A;  5IJ7 E;  2P9N C;  3SBQ A;  3RSE C;  1GG2 B;  2HYE A;  1OLZ A;  4CY3 A;  2B5L A;  2O9K A;  3JZN A;  2AH1 A;  3OKW A;  4J8G A;  1MG3 A;  3IJ0 A;  1XHM A;  5FLX g;  4NSX A;  3A0F A;  2I0T A;  4E54 B;  4LG9 A;  4GQB B;  4I79 A;  2EBS A;  1U2V C;  4J82 A;  4JSV C;  3W15 A;  4ZOZ A;  4J86 A;  3F3F A;  3C5M A;  2IWK A;  2B4E A;  5C2W B;  3SBP A;  4O3U B;  3GRE A;  3ORV D;  2AGZ A;  2CE8 A;  4L1Q D;  3I7L A;  4A09 B;  3EI4 A;  2QC5 A;  3I8C A;  3IIY A;  2Z2P A;  3CIK B;  4HDJ A;  4BH6 A;  4IMM A;  5CYK A;  4PSX B;  4J8B A;  5HE3 B;  5EAM A;  1MDA H;  4O1Q D;  3KRW B;  1K32 A;  2GNQ A;  4J73 A;  3OL2 B;  4J77 A;  4ZOX A;  4XEI C;  5CXC A;  2J55 H;  3EG6 A;  3PSC B;  4JXM A;  5THA A;  4ERZ A;  2AGX A;  3RFH A;  5EML B;  4E5Z B;  4A11 B;  2G9A A;  2UZX B;  3BWS A;  2H9P A;  5JWZ A;  4X60 B;  3OTT A;  5AFU 3;  4N14 A;  4MK0 B;  2OK6 A;  2CN2 A;  2XU7 A;  4CZX A;  2P9U C;  1Q47 A;  2IUQ A;  4IA9 A;  4CI3 A;  3OKT A;  2XL2 A;  1PGU A;  4ZOY A;  4GQ2 P;  1N6D A;  1B9Y A;  1PEV A;  3PVW B;  5I5I A;  1OMW B;  2GC4 A;  4FAV D;  2PM9 B;  4E54 A;  3J80 g;  3C75 H;  2P9L C;  4O45 A;  4GM8 A;  3PVU B;  3MMY A;  1TBG A;  1PI6 A;  5EAL A;  4J0X A;  3BG0 A;  2YB8 B;  5HE1 B;  3PXT D;  4EWR A;  4AOW A;  3SHF A;  3PE7 A;  3PSL A;  3UVM A;  4QRJ A;  4CC9 A;  4ESG A;  4FA1 D;  5H1M A;  5GXH A;  4A09 A;  3I2N A;  3SVW D;  4J78 A;  3K27 A;  2OIZ A;  5TF2 A;  1JOF A;  3AH8 B;  3CFV A;  2H13 A;  3NVX A;  5FKS A;  3J81 g;  2GC7 A;  2CNX A;  5GXI A;  3SJL D;  4AEZ A;  2H6K A;  4ERQ A;  4Y5R D;  3OL2 A;  3PXW D;  1K8K C;  3GFC A;  3RN1 D;  5HQG A;  1GOT B;  3UKU C;  1L0Q A;  4E5Z A;  4A11 A;  5EM2 B;  2I0R A;  3ULE C;  3I7O A;  5HE0 B;  2AGY A;  4FA4 D;  5EMM B;  3RLM D;  4H5J A;  2UZY B;  3BG1 A;  3B7F A;  5GMK n;  4H5I A;  2OVQ B;  1NR0 A;  3UVK A;  3VA6 A;  3FM0 A;  4JSP C;  1RI6 A;  2Q7Q A;  3HFQ A;  3I8E A;  2P9P C;  3UVL A;  2HKR A;  5IT9 g;  2J57 G;  1N6F A;  4ES0 A;  4GM3 A;  4PC0 A;  5IJ8 E;  5K19 A;  2IWF A;  3EI2 B;  2P9I C;  5CXB A;  2OJY A;  2HJB A;  4J87 A;  1SQJ A;  2PM9 A;  4Y7R A;  4K3J B;  5EMK B;  3I89 A;  1JJU B;  4TZ4 A;  4CZY A;  4GGD A;  4JSN C;  4QT8 A;  2CE9 A;  3EI3 B;  3DM0 A;  3FGB A;  3MZL A;  4X3E A;  5I5M A;  1FWX A;  1SHY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...