3I2NA

Crystal structure of wd40 repeats protein wdr92
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
349
structure length
345
Chain Sequence
EKPQIIAHIQKGFNYTVFDCKWVPCSAKFVTMGNRGTGVIQLYEIQHGDLKLLREIEKAKPIKCGTFGATSLQQRYLATGDFGGNLHIWNLEAPEMPVYSVKGHKEIINAIDGIGGLGIGEGAPEIVTGSRDGTVKVWDPRQKDDPVANMEPVQGENKRDCWTVAFGNAYNQEERVVCAGYDNGDIKLFDLRNMALRWETNIKNGVCSLEFDRKDISMNKLVATSLEGKFHVFDMRTQHPTKGFASVSEKAHKSTVWQVRHLPQNRELFLTAGGAGGLHLWKYEYPIQRKDSEGIEMGVAGSVSLLQNVTLSTQPISSLDWSPDKRGLCVCSSFDQTVRVLIVTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords WD repeat-containing protein 92
publication title Structure and function of WD40 domain proteins.
pubmed doi rcsb
source organism Homo sapiens
total genus 79
structure length 345
sequence length 349
ec nomenclature
pdb deposition date 2009-06-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3i2nA00
2OVPB 3CFVA 3SFZA 3MMYA 3OKTA 3ZWLB 1GP2B 3BG0A 5EMMB 3FRXA 3ODTA 4EWRA 3I89A 3I7LA 4PBYA 5I5IA 3A0FA 2B5MA 3EI4B 3RFGA 4ES0A 4BUJC 2XU7A 2AGWA 3VH0A 4LG8A 5K1CC 4QRJA 4A2LA 4A0AB 3SBRA 3EI4A 3FM0A 3W15A 3FGBA 3OTTA 3IKOA 4J82A 1TBGA 5IT9g 2AH1A 3NVNA 4A0AA 1NR0A 3RN0D 4L3HD 2J57G 5B4WA 3RFHA 2Q7QA 4L1QD 4Y5RD 3I7NA 3VA6A 1GOTB 4JT6C 5C2WB 3MXXA 2CO0A 5IC7A 1SHYB 4Y7RA 1JMXB 5IJ7E 4IMMA 4ZOXA 3L4OD 3VGZA 4FB1D 1MG2A 4YVDA 2GC7A 3SXTD 3EU7A 2H14A 2IWFA 3PXSD 5HQGA 4OWRA 3PVUB 4XYIA 2P9SC 3CIKB 4QQEA 5I5MA 2HYEA 4ZOVA 4D6VA 1K32A 2J56H 4D0KA 3EI1A 2OIZA 1OMWB 3DSMA 5CXBB 2YNNA 3K26A 3MKQA 3SN6B 5IJ8E 1VYHC 4GQBB 3PSLA 1U4CA 4X61B 1Q47A 2H9MA 3SMRA 5CXBA 2H9NA 2IAAA 2IWKA 3JB9L 3DXMC 4U7AA 4JD2C 4X63B 2AGLA 2QXVA 1GG2B 4X3EA 4KFMB 4UI9R 2UZXB 2YBAA 4A0BB 3EI3B 3IIYA 1XHMA 2PM7B 3SBPA 1P22A 2P9KC 2B5NA 3GREA 4J0WA 4AOWA 3B7FA 4JSXC 3BWSA 2HKRA 4JT5C 4A0BA 3EI3A 1MDAH 2H6KA 3E0CA 3NVQA 2GNQA 2HESX 4BL0A 4QL1A 3JROA 3JZNA 3F3GA 3C5MA 4I79A 3J80g 5HE2B 4O1QD 2I0SA 3JPXA 3C75H 3V5WB 2HJ4A 5SXMA 5JWZA 2YB8B 5TEFA 2XL2A 3F3PA 2P9NC 5C2VB 2IUPA 1R5MA 3EMHA 2H9PA 5FKRA 2OVQB 3V9FA 4TZ4A 3OKWA 3IJCA 5GXHA 4J87A 1N6DA 4GMBA 1SQJA 3SLED 4A7JA 4CY5A 4PSWB 5EARA 4GGCA 4CY2A 1XKSA 4CI2A 4O3TB 3IIWA 4G56B 4GQ1A 3AH8B 2I3TA 3JZHA 2B4EA 5CYKA 3IJ1A 4XYHA 3I8EA 3AL9A 1PEVA 2O9KA 3EWEA 4GGAA 4BH6A 4HDJA 4ZOYA 3NVXA 4PBZA 1JOFA 2GC4A 5FKSA 1TYQC 5A2Qg 3EI1B 3JZGA 2G99A 5FA5B 3AL8B 4JXMA 4N14A 2P9PC 5C9ZB 1QNIA 4CC9A 3UKRC 4GM9A 3AL8A 4CZXA 2OVRB 4CI1A 4ERZA 2Z2OA 2I0TA 4J73A 2HJBA 4J81A 1PI6A 1ERJA 5GMKn 2IUQA 4CZYA 3N0EA 3DXKC 3MKSB 4ZOZA 1PBYB 3I7HA 3V7DB 4GGDA 4PXWA 2CNXA 2B5LA 1OLZA 3I8CA 2PM9A 4NSXA 3UVMA 4A09B 3I7KA 5EMKB 4FA4D 3PVWB 4JSPC 5EMLB 4CI3A 2CE9A 4J8GA 2P9UC 3C99A 5FQDA 4L3GD 5EM2A 4A09A 3SCYA 3OKYA 5GSAA 3DM0A 3I2NA 3SVWD 4FA5D 2W18A 2I0RA 3RN1D 3K27A 2Z2PA 3UVOA 4J84A 2UZYB 4ESGA 3PXWD 3J81g 4A08A 4FAND 2H68A 4J8BA 4GM3A 4J79A 1PGUA 4R7AB 3OL2B 3MZKA 2PM6B 1U2VC 3UVKA 2HKMA 4FA9D 2H6QA 3OL2A 2IUVA 5FKQA 5THAA 2H9LA 4J78A 5I5JA 4A2MA 1YFQA 1L0QA 1NEXB 5AJAA 3L4MD 2XL3A 2CO0C 2P9IC 2H3XA 5CXCB 5CYKB 4FHLA 3RMZD 2AGXA 4CZVA 2H6NA 3N0DA 3ULEC 1JMZB 5CXCA 2XYIA 3U4YA 3SJLD 3IJ0A 4PC0A 3CFSB 1A0RB 1GXRA 2H13A 4CY1A 3PE7A 3C9CA 3OW8A 3JRPA 2G9AA 1RI6A 5FLXg 3EG6A 2YNOA 2OK4A 5TDHB 4MK0B 5GXIA 3RRMC 4CY3A 4U1EI 3PSCB 2OJYA 5TEEA 1JJUB 4H5JA 4K3JB 3RLMD 4E54B 4OZUA 2CE8A 4O3UB 5HE0B 4H5IA 3ORVD 2AGYA 2QC5A 4IA9A 2PBIB 4PSXB 5HE3B 4PNKB 4GZ8A 4E54A 4JSNC 3AFCA 3HFQA 2YNPA 4QT8A 3BG1A 1N6EA 4LG9A 5H17A 4O9DA 3SBQA 4XEIC 3UKUC 5EALA 5EAPA 4AEZA 4K3ID 2HXCA 5FXYA 1MG3A 3GFCA 4O45A 4FA1D 5H14A 3EI2B 3UVLA 4ERQA 2PM9B 1FWXA 2IURA 5EAMA 3EI2A 2H47A 1SQ9A 2AH0A 4LGNA 2J55H 5IGQA 2Z2NA 3SWSD 5K19A 3I7OA 5KDOB 3KRXB 3JAMg 2YMUA 3SHFA 5EM2B 3PXTD 3OKYB 4GM8A 4JSVC 5EMJB 2MTAH 1N6FA 2BCJB 2TRCB 3UR4A 2P9LC 2I3SA 2AGZA 4E5ZB 5FKTA 4J0XA 3P4FA 3F3FA 4ERYA 4A08B 2OK6A 4J86A 1B9YA 4E5ZA 4Z8LA 3DWLC 1K8KC 5AFU3 4CI8A 5AMSA 4GQ2P 4A11B 5HE1B 5IGOA 1B9XA 1S4UX 2BBKH 4J77A 2CN3A 2CN2A 5TF2A 4FAVD 4L9OA 3UVNA 1XIPA 4A11A 2EBSA 3MZLA 3I7PA 5H1MA 3KRWB 4ZN4A 3RSEC 5HYNB 4FWWA 4X60B 2AQ5A
chains in the Genus database with same CATH superfamily
2VDNA 2OVPB 3CFVA 1E5TA 3MMYA 3SFZA 3FCSA 3OKTA 3ZWLB 1GP2B 3K71A 3BG0A 5EMMB 1UOPA 3FRXA 3ODTA 4EWRA 3I89A 3I7LA 4L1MA 4PBYA 2VDRA 3NIFA 5I5IA 3A0FA 2HU7A 2B5MA 3EI4B 3RFGA 1UOQA 4ES0A 4BUJC 2XU7A 1JV2A 2AGWA 3VH0A 4WK4A 3IUNA 4LG8A 5K1CC 4QRJA 4NBMA 4A2LA 4A0AB 3SBRA 3EI4A 3FM0A 3W15A 3FGBA 3V4VA 3OTTA 3IKOA 4J82A 1TBGA 5IT9g 2AH1A 3NVNA 4A0AA 1NR0A 3RN0D 4L3HD 2J57G 5B4WA 3RFHA 2Q7QA 4L1QD 3NIGA 4Y5RD 3I7NA 3VA6A 1GOTB 4UM9A 4JT6C 1E8MA 3K72A 5C2WB 1E8NA 3MXXA 2CO0A 4QAMA 5IC7A 1SHYB 4Y7RA 1JMXB 5IJ7E 3MVDK 4G1MA 4IMMA 3L4OD 4ZOXA 3VGZA 4BCDA 1MG2A 4FB1D 4YVDA 2GC7A 3SXTD 3EU7A 2H14A 2IWFA 3PXSD 5HQGA 4OWRA 3ZE0A 3PVUB 4XYIA 2P9SC 2VDKA 3CIKB 4QQEA 5I5MA 2HYEA 4MMZA 4ZOVA 4D6VA 1K32A 2HU5A 2J56H 4D0KA 3EI1A 1A12A 2OIZA 1OMWB 3GC3B 3DSMA 5CXBB 4AMZA 2YNNA 3K26A 3MKQA 3SN6B 3ZE2A 5IJ8E 2VDLA 4DNWA 1VYHC 4GQBB 3PSLA 1U4CA 4X61B 3IUQA 1Q47A 2H9MA 3VI3A 3SMRA 5CXBA 2H9NA 2IAAA 2IWKA 3JB9L 3DXMC 4U7AA 4JD2C 4X63B 2AGLA 2WQ8A 1TYEA 2QXVA 3O4IA 1GG2B 4X3EA 4KFMB 4UI9R 3QI0A 2UZXB 2YBAA 3IULA 4A0BB 3EI3B 3IIYA 1XHMA 4MMYA 2PM7B 1VZ3A 3SBPA 1P22A 2P9KC 2B5NA 3GREA 4J0WA 3ZE1A 3MUNA 4AOWA 3B7FA 4O2WA 2XE4A 4JSXC 1QFSA 3BWSA 2HKRA 4JT5C 4A0BA 3EI3A 4G1EA 1MDAH 2H6KA 3E0CA 3T3PA 1H2ZA 3NVQA 2GNQA 2HESX 5M5SA 4BL0A 1L5GA 4QL1A 3JROA 3JZNA 3F3GA 3C5MA 4I79A 4D9SA 3J80g 5HE2B 4O1QD 2I0SA 3JPXA 4Z7NA 3ZDZA 3C75H 3V5WB 2HJ4A 5SXMA 5JWZA 2YB8B 4NAAA 5TEFA 2XL2A 3F3PA 2P9NC 5C2VB 2IUPA 1R5MA 3EMHA 2H9PA 4G55A 1VE6A 2JKXA 3O4HA 5FKRA 2OVQB 3V9FA 4JHNA 4TZ4A 3OKWA 3IJCA 4IRZA 5C92A 5GXHA 4J87A 1N6DA 2QR5A 4BCCA 4GMBA 1H2YA 1SQJA 3SLED 4A7JA 4CY5A 4PSWB 5EARA 4GGCA 4CY2A 1XKSA 4CI2A 4O3TB 3IIWA 4AMYA 4G56B 4GQ1A 5FFGA 3EQ7A 3AH8B 2I3TA 3JZHA 2B4EA 5CYKA 3IJ1A 3EQ8A 4XYHA 2QZPA 3I8EA 1QFMA 3AL9A 1PEVA 1BPOA 2O9KA 3EWEA 4GGAA 4BH6A 4RE5A 4HDJA 5HDBA 4WJKA 4ZOYA 4WK0A 3NVXA 4Z7QA 3EQ9A 4PBZA 1JOFA 5C86A 2GC4A 5FKSA 1TYQC 5FFOA 5A2Qg 3EI1B 3JZGA 2G99A 4AX4A 5FA5B 3AL8B 4JXMA 4N14A 2EIBA 2P9PC 2VDMA 5M5TA 3IUMA 5C9ZB 1QNIA 4CC9A 3UKRC 1M1XA 4GM9A 3AL8A 4UM8A 4CZXA 2OVRB 4CI1A 4ERZA 2Z2OA 2I0TA 4J73A 2HJBA 4J81A 1PI6A 1ERJA 5GMKn 2IUQA 4CZYA 4JHPC 3N0EA 3O4JA 2VDQA 3DXKC 5M5VA 3MKSB 4ZOZA 1PBYB 3I7HA 3V7DB 1YR2A 4GGDA 4PXWA 5M5UA 2CNXA 2B5LA 2XDWA 1OLZA 3I8CA 3ZDYA 2PM9A 4NSXA 5M61A 3UVMA 4A09B 3I7KA 5EMKB 4FA4D 3VI4A 3PVWB 5E6RA 4JSPC 5EMLB 4CI3A 2CE9A 4J8GA 2P9UC 3C99A 5FQDA 4L3GD 5EM2A 1H2XA 4A09A 3SCYA 3OKYA 5GSAA 3DM0A 3I2NA 3SVWD 2BKLA 3GD1I 4FA5D 2W18A 2I0RA 3RN1D 3K27A 2Z2PA 3UVOA 4J84A 2UZYB 4ESGA 3PXWD 3J81g 4A08A 4FAND 2H68A 4J8BA 3V4PA 1I2MB 4GM3A 4J79A 1PGUA 4R7AB 3OL2B 3MZKA 3T3MA 2PM6B 1U2VC 3UVKA 2HKMA 2EICA 4FA9D 2H6QA 1JTDB 3OL2A 2IUVA 5FKQA 4WK2A 5THAA 2H9LA 4J78A 5M5RA 5I5JA 4A2MA 1YFQA 1L0QA 1NEXB 1VZ2A 5AJAA 3L4MD 1UTCA 1H2WA 2XL3A 4BP8A 2CO0C 2P9IC 2H3XA 5CXCB 5CYKB 4FHLA 3RMZD 1UOOA 2AGXA 4CZVA 2H6NA 3N0DA 3ULEC 1JMZB 5CXCA 2XYIA 3U4YA 2VZ3A 3SJLD 3IJ0A 4PC0A 3CFSB 1A0RB 1GXRA 2H13A 4MMXA 4CY1A 1K3IA 2EIDA 3PE7A 3C9CA 3OW8A 3JRPA 2G9AA 1RI6A 5FLXg 2YNOA 3EG6A 3MUOA 1O6GA 2OK4A 5TDHB 4MK0B 3OF7A 5GXIA 3RRMC 3ZDXA 4CY3A 4U1EI 1O6FA 3PSCB 2OJYA 5TEEA 1JJUB 4H5JA 4K3JB 3RLMD 4E54B 4OZUA 4RE6A 2CE8A 4O3UB 5HE0B 4H5IA 2VDPA 3ORVD 2AGYA 2QC5A 4IA9A 2PBIB 4Z7OA 4PSXB 5HE3B 1U8CA 4PNKB 4GZ8A 4E54A 4JSNC 3AFCA 3KCIA 3HFQA 2YNPA 4QT8A 3BG1A 2HU8A 1N6EA 4DNUA 3NIDA 4LG9A 5H17A 4O9DA 3SBQA 4XEIC 3UKUC 1GOHA 5EALA 4NENA 3IUJA 5EAPA 4AEZA 2VZ1A 4K3ID 2HXCA 5FXYA 1MG3A 3GFCA 4O45A 4AN1A 4FA1D 5H14A 2EIEA 4BP9A 3EI2B 3DDUA 3K6SA 3UVLA 4ERQA 2PM9B 1FWXA 2IURA 5EAMA 3EI2A 2H47A 1SQ9A 2AH0A 1T2XA 4LGNA 2J55H 2VDOA 5IGQA 2Z2NA 3SWSD 5K19A 3I7OA 5KDOB 3KRXB 3JAMg 2YMUA 3SHFA 4O02A 5EM2B 3PXTD 3IVMA 3OKYB 4GM8A 4JSVC 4NC4A 1GOFA 2MTAH 5EMJB 1N6FA 1GOGA 2BCJB 2TRCB 3UR4A 2P9LC 2I3SA 4BCBA 2AGZA 4E5ZB 5FKTA 4J0XA 3P4FA 5E6UA 3F3FA 4ERYA 4A08B 2OK6A 5E6SA 4J86A 1B9YA 4E5ZA 4Z8LA 3DWLC 1K8KC 4AN0A 5AFU3 4CI8A 5AMSA 4GQ2P 4A11B 5HE1B 5IGOA 1B9XA 1S4UX 2BBKH 4J77A 2CN3A 1C9IA 2CN2A 5TF2A 4FAVD 3IURA 2VC2A 4L9OA 4DNVA 3IJEA 3UVNA 1C9LA 1XIPA 4A11A 2EBSA 3MZLA 1VE7A 3I7PA 2XZGA 5H1MA 3KRWB 4ZN4A 3RSEC 5HYNB 3FCUA 4FWWA 3O4GA 4X60B 3QHYB 2AQ5A
chains in the Genus database with same CATH topology
2OVPB 3CFVA 3SFZA 3MMYA 3OKTA 3ZWLB 1GP2B 3BG0A 5EMMB 3FRXA 3ODTA 4EWRA 3I89A 3I7LA 4PBYA 5I5IA 3A0FA 2B5MA 3EI4B 3RFGA 4ES0A 4BUJC 2XU7A 2AGWA 3VH0A 4LG8A 5K1CC 4QRJA 4A2LA 4A0AB 3SBRA 3EI4A 3FM0A 3W15A 3FGBA 3OTTA 3IKOA 4J82A 1TBGA 5IT9g 2AH1A 3NVNA 4A0AA 1NR0A 3RN0D 4L3HD 2J57G 5B4WA 3RFHA 2Q7QA 4L1QD 4Y5RD 3I7NA 3VA6A 1GOTB 4JT6C 5C2WB 3MXXA 2CO0A 5IC7A 1SHYB 4Y7RA 1JMXB 5IJ7E 4IMMA 4ZOXA 3L4OD 3VGZA 4FB1D 1MG2A 4YVDA 2GC7A 3SXTD 3EU7A 2H14A 2IWFA 3PXSD 5HQGA 4OWRA 3PVUB 4XYIA 2P9SC 3CIKB 4QQEA 5I5MA 2HYEA 4ZOVA 4D6VA 1K32A 2J56H 4D0KA 3EI1A 2OIZA 1OMWB 3DSMA 5CXBB 2YNNA 3K26A 3MKQA 3SN6B 5IJ8E 1VYHC 4GQBB 3PSLA 1U4CA 4X61B 1Q47A 2H9MA 3SMRA 5CXBA 2H9NA 2IAAA 2IWKA 3JB9L 3DXMC 4U7AA 4JD2C 4X63B 2AGLA 2QXVA 1GG2B 4X3EA 4KFMB 4UI9R 2UZXB 2YBAA 4A0BB 3EI3B 3IIYA 1XHMA 2PM7B 3SBPA 1P22A 2P9KC 2B5NA 3GREA 4J0WA 4AOWA 3B7FA 4JSXC 3BWSA 2HKRA 4JT5C 4A0BA 3EI3A 1MDAH 2H6KA 3E0CA 3NVQA 2GNQA 2HESX 4BL0A 4QL1A 3JROA 3JZNA 3F3GA 3C5MA 4I79A 3J80g 5HE2B 4O1QD 2I0SA 3JPXA 3C75H 3V5WB 2HJ4A 5SXMA 5JWZA 2YB8B 5TEFA 2XL2A 3F3PA 2P9NC 5C2VB 2IUPA 1R5MA 3EMHA 2H9PA 5FKRA 2OVQB 3V9FA 4TZ4A 3OKWA 3IJCA 5GXHA 4J87A 1N6DA 4GMBA 1SQJA 3SLED 4A7JA 4CY5A 4PSWB 5EARA 4GGCA 4CY2A 1XKSA 4CI2A 4O3TB 3IIWA 4G56B 4GQ1A 3AH8B 2I3TA 3JZHA 2B4EA 5CYKA 3IJ1A 4XYHA 3I8EA 3AL9A 1PEVA 2O9KA 3EWEA 4GGAA 4BH6A 4HDJA 4ZOYA 3NVXA 4PBZA 1JOFA 2GC4A 5FKSA 1TYQC 5A2Qg 3EI1B 3JZGA 2G99A 5FA5B 3AL8B 4JXMA 4N14A 2P9PC 5C9ZB 1QNIA 4CC9A 3UKRC 4GM9A 3AL8A 4CZXA 2OVRB 4CI1A 4ERZA 2Z2OA 2I0TA 4J73A 2HJBA 4J81A 1PI6A 1ERJA 5GMKn 2IUQA 4CZYA 3N0EA 3DXKC 3MKSB 4ZOZA 1PBYB 3I7HA 3V7DB 4GGDA 4PXWA 2CNXA 2B5LA 1OLZA 3I8CA 2PM9A 4NSXA 3UVMA 4A09B 3I7KA 5EMKB 4FA4D 3PVWB 4JSPC 5EMLB 4CI3A 2CE9A 4J8GA 2P9UC 3C99A 5FQDA 4L3GD 5EM2A 4A09A 3SCYA 3OKYA 5GSAA 3DM0A 3I2NA 3SVWD 4FA5D 2W18A 2I0RA 3RN1D 3K27A 2Z2PA 3UVOA 4J84A 2UZYB 4ESGA 3PXWD 3J81g 4A08A 4FAND 2H68A 4J8BA 4GM3A 4J79A 1PGUA 4R7AB 3OL2B 3MZKA 2PM6B 1U2VC 3UVKA 2HKMA 4FA9D 2H6QA 3OL2A 2IUVA 5FKQA 5THAA 2H9LA 4J78A 5I5JA 4A2MA 1YFQA 1L0QA 1NEXB 5AJAA 3L4MD 2XL3A 2CO0C 2P9IC 2H3XA 5CXCB 5CYKB 4FHLA 3RMZD 2AGXA 4CZVA 2H6NA 3N0DA 3ULEC 1JMZB 5CXCA 2XYIA 3U4YA 3SJLD 3IJ0A 4PC0A 3CFSB 1A0RB 1GXRA 2H13A 4CY1A 3PE7A 3C9CA 3OW8A 3JRPA 2G9AA 1RI6A 5FLXg 3EG6A 2YNOA 2OK4A 5TDHB 4MK0B 5GXIA 3RRMC 4CY3A 4U1EI 3PSCB 2OJYA 5TEEA 1JJUB 4H5JA 4K3JB 3RLMD 4E54B 4OZUA 2CE8A 4O3UB 5HE0B 4H5IA 3ORVD 2AGYA 2QC5A 4IA9A 2PBIB 4PSXB 5HE3B 4PNKB 4GZ8A 4E54A 4JSNC 3AFCA 3HFQA 2YNPA 4QT8A 3BG1A 1N6EA 4LG9A 5H17A 4O9DA 3SBQA 4XEIC 3UKUC 5EALA 5EAPA 4AEZA 4K3ID 2HXCA 5FXYA 1MG3A 3GFCA 4O45A 4FA1D 5H14A 3EI2B 3UVLA 4ERQA 2PM9B 1FWXA 2IURA 5EAMA 3EI2A 2H47A 1SQ9A 2AH0A 4LGNA 2J55H 5IGQA 2Z2NA 3SWSD 5K19A 3I7OA 5KDOB 3KRXB 3JAMg 2YMUA 3SHFA 5EM2B 3PXTD 3OKYB 4GM8A 4JSVC 5EMJB 2MTAH 1N6FA 2BCJB 2TRCB 3UR4A 2P9LC 2I3SA 2AGZA 4E5ZB 5FKTA 4J0XA 3P4FA 3F3FA 4ERYA 4A08B 2OK6A 4J86A 1B9YA 4E5ZA 4Z8LA 3DWLC 1K8KC 5AFU3 4CI8A 5AMSA 4GQ2P 4A11B 5HE1B 5IGOA 1B9XA 1S4UX 2BBKH 4J77A 2CN3A 2CN2A 5TF2A 4FAVD 4L9OA 3UVNA 1XIPA 4A11A 2EBSA 3MZLA 3I7PA 5H1MA 3KRWB 4ZN4A 3RSEC 5HYNB 4FWWA 4X60B 2AQ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OVP B;  3CFV A;  3SFZ A;  3MMY A;  3OKT A;  3ZWL B;  1GP2 B;  3BG0 A;  5EMM B;  3FRX A;  3ODT A;  4EWR A;  3I89 A;  3I7L A;  4PBY A;  5I5I A;  3A0F A;  2B5M A;  3EI4 B;  3RFG A;  4ES0 A;  4BUJ C;  2XU7 A;  2AGW A;  3VH0 A;  4LG8 A;  5K1C C;  4QRJ A;  4A2L A;  4A0A B;  3SBR A;  3EI4 A;  3FM0 A;  3W15 A;  3FGB A;  3OTT A;  3IKO A;  4J82 A;  1TBG A;  5IT9 g;  2AH1 A;  3NVN A;  4A0A A;  1NR0 A;  3RN0 D;  4L3H D;  2J57 G;  5B4W A;  3RFH A;  2Q7Q A;  4L1Q D;  4Y5R D;  3I7N A;  3VA6 A;  1GOT B;  4JT6 C;  5C2W B;  3MXX A;  2CO0 A;  5IC7 A;  1SHY B;  4Y7R A;  1JMX B;  5IJ7 E;  4IMM A;  4ZOX A;  3L4O D;  3VGZ A;  4FB1 D;  1MG2 A;  4YVD A;  2GC7 A;  3SXT D;  3EU7 A;  2H14 A;  2IWF A;  3PXS D;  5HQG A;  4OWR A;  3PVU B;  4XYI A;  2P9S C;  3CIK B;  4QQE A;  5I5M A;  2HYE A;  4ZOV A;  4D6V A;  1K32 A;  2J56 H;  4D0K A;  3EI1 A;  2OIZ A;  1OMW B;  3DSM A;  5CXB B;  2YNN A;  3K26 A;  3MKQ A;  3SN6 B;  5IJ8 E;  1VYH C;  4GQB B;  3PSL A;  1U4C A;  4X61 B;  1Q47 A;  2H9M A;  3SMR A;  5CXB A;  2H9N A;  2IAA A;  2IWK A;  3JB9 L;  3DXM C;  4U7A A;  4JD2 C;  4X63 B;  2AGL A;  2QXV A;  1GG2 B;  4X3E A;  4KFM B;  4UI9 R;  2UZX B;  2YBA A;  4A0B B;  3EI3 B;  3IIY A;  1XHM A;  2PM7 B;  3SBP A;  1P22 A;  2P9K C;  2B5N A;  3GRE A;  4J0W A;  4AOW A;  3B7F A;  4JSX C;  3BWS A;  2HKR A;  4JT5 C;  4A0B A;  3EI3 A;  1MDA H;  2H6K A;  3E0C A;  3NVQ A;  2GNQ A;  2HES X;  4BL0 A;  4QL1 A;  3JRO A;  3JZN A;  3F3G A;  3C5M A;  4I79 A;  3J80 g;  5HE2 B;  4O1Q D;  2I0S A;  3JPX A;  3C75 H;  3V5W B;  2HJ4 A;  5SXM A;  5JWZ A;  2YB8 B;  5TEF A;  2XL2 A;  3F3P A;  2P9N C;  5C2V B;  2IUP A;  1R5M A;  3EMH A;  2H9P A;  5FKR A;  2OVQ B;  3V9F A;  4TZ4 A;  3OKW A;  3IJC A;  5GXH A;  4J87 A;  1N6D A;  4GMB A;  1SQJ A;  3SLE D;  4A7J A;  4CY5 A;  4PSW B;  5EAR A;  4GGC A;  4CY2 A;  1XKS A;  4CI2 A;  4O3T B;  3IIW A;  4G56 B;  4GQ1 A;  3AH8 B;  2I3T A;  3JZH A;  2B4E A;  5CYK A;  3IJ1 A;  4XYH A;  3I8E A;  3AL9 A;  1PEV A;  2O9K A;  3EWE A;  4GGA A;  4BH6 A;  4HDJ A;  4ZOY A;  3NVX A;  4PBZ A;  1JOF A;  2GC4 A;  5FKS A;  1TYQ C;  5A2Q g;  3EI1 B;  3JZG A;  2G99 A;  5FA5 B;  3AL8 B;  4JXM A;  4N14 A;  2P9P C;  5C9Z B;  1QNI A;  4CC9 A;  3UKR C;  4GM9 A;  3AL8 A;  4CZX A;  2OVR B;  4CI1 A;  4ERZ A;  2Z2O A;  2I0T A;  4J73 A;  2HJB A;  4J81 A;  1PI6 A;  1ERJ A;  5GMK n;  2IUQ A;  4CZY A;  3N0E A;  3DXK C;  3MKS B;  4ZOZ A;  1PBY B;  3I7H A;  3V7D B;  4GGD A;  4PXW A;  2CNX A;  2B5L A;  1OLZ A;  3I8C A;  2PM9 A;  4NSX A;  3UVM A;  4A09 B;  3I7K A;  5EMK B;  4FA4 D;  3PVW B;  4JSP C;  5EML B;  4CI3 A;  2CE9 A;  4J8G A;  2P9U C;  3C99 A;  5FQD A;  4L3G D;  5EM2 A;  4A09 A;  3SCY A;  3OKY A;  5GSA A;  3DM0 A;  3I2N A;  3SVW D;  4FA5 D;  2W18 A;  2I0R A;  3RN1 D;  3K27 A;  2Z2P A;  3UVO A;  4J84 A;  2UZY B;  4ESG A;  3PXW D;  3J81 g;  4A08 A;  4FAN D;  2H68 A;  4J8B A;  4GM3 A;  4J79 A;  1PGU A;  4R7A B;  3OL2 B;  3MZK A;  2PM6 B;  1U2V C;  3UVK A;  2HKM A;  4FA9 D;  2H6Q A;  3OL2 A;  2IUV A;  5FKQ A;  5THA A;  2H9L A;  4J78 A;  5I5J A;  4A2M A;  1YFQ A;  1L0Q A;  1NEX B;  5AJA A;  3L4M D;  2XL3 A;  2CO0 C;  2P9I C;  2H3X A;  5CXC B;  5CYK B;  4FHL A;  3RMZ D;  2AGX A;  4CZV A;  2H6N A;  3N0D A;  3ULE C;  1JMZ B;  5CXC A;  2XYI A;  3U4Y A;  3SJL D;  3IJ0 A;  4PC0 A;  3CFS B;  1A0R B;  1GXR A;  2H13 A;  4CY1 A;  3PE7 A;  3C9C A;  3OW8 A;  3JRP A;  2G9A A;  1RI6 A;  5FLX g;  3EG6 A;  2YNO A;  2OK4 A;  5TDH B;  4MK0 B;  5GXI A;  3RRM C;  4CY3 A;  4U1E I;  3PSC B;  2OJY A;  5TEE A;  1JJU B;  4H5J A;  4K3J B;  3RLM D;  4E54 B;  4OZU A;  2CE8 A;  4O3U B;  5HE0 B;  4H5I A;  3ORV D;  2AGY A;  2QC5 A;  4IA9 A;  2PBI B;  4PSX B;  5HE3 B;  4PNK B;  4GZ8 A;  4E54 A;  4JSN C;  3AFC A;  3HFQ A;  2YNP A;  4QT8 A;  3BG1 A;  1N6E A;  4LG9 A;  5H17 A;  4O9D A;  3SBQ A;  4XEI C;  3UKU C;  5EAL A;  5EAP A;  4AEZ A;  4K3I D;  2HXC A;  5FXY A;  1MG3 A;  3GFC A;  4O45 A;  4FA1 D;  5H14 A;  3EI2 B;  3UVL A;  4ERQ A;  2PM9 B;  1FWX A;  2IUR A;  5EAM A;  3EI2 A;  2H47 A;  1SQ9 A;  2AH0 A;  4LGN A;  2J55 H;  5IGQ A;  2Z2N A;  3SWS D;  5K19 A;  3I7O A;  5KDO B;  3KRX B;  3JAM g;  2YMU A;  3SHF A;  5EM2 B;  3PXT D;  3OKY B;  4GM8 A;  4JSV C;  5EMJ B;  2MTA H;  1N6F A;  2BCJ B;  2TRC B;  3UR4 A;  2P9L C;  2I3S A;  2AGZ A;  4E5Z B;  5FKT A;  4J0X A;  3P4F A;  3F3F A;  4ERY A;  4A08 B;  2OK6 A;  4J86 A;  1B9Y A;  4E5Z A;  4Z8L A;  3DWL C;  1K8K C;  5AFU 3;  4CI8 A;  5AMS A;  4GQ2 P;  4A11 B;  5HE1 B;  5IGO A;  1B9X A;  1S4U X;  2BBK H;  4J77 A;  2CN3 A;  2CN2 A;  5TF2 A;  4FAV D;  4L9O A;  3UVN A;  1XIP A;  4A11 A;  2EBS A;  3MZL A;  3I7P A;  5H1M A;  3KRW B;  4ZN4 A;  3RSE C;  5HYN B;  4FWW A;  4X60 B;  2AQ5 A; 
#chains in the Genus database with same CATH topology
 2VDN A;  2OVP B;  3CFV A;  1E5T A;  3MMY A;  3SFZ A;  3FCS A;  3OKT A;  3ZWL B;  1GP2 B;  3K71 A;  3BG0 A;  5EMM B;  1UOP A;  3FRX A;  3ODT A;  4EWR A;  3I89 A;  3I7L A;  4L1M A;  4PBY A;  2VDR A;  3NIF A;  5I5I A;  3A0F A;  2HU7 A;  2B5M A;  3EI4 B;  3RFG A;  1UOQ A;  4ES0 A;  4BUJ C;  2XU7 A;  1JV2 A;  2AGW A;  3VH0 A;  4WK4 A;  3IUN A;  4LG8 A;  5K1C C;  4QRJ A;  4NBM A;  4A2L A;  4A0A B;  3SBR A;  3EI4 A;  3FM0 A;  3W15 A;  3FGB A;  3V4V A;  3OTT A;  3IKO A;  4J82 A;  1TBG A;  5IT9 g;  2AH1 A;  3NVN A;  4A0A A;  1NR0 A;  3RN0 D;  4L3H D;  2J57 G;  5B4W A;  3RFH A;  2Q7Q A;  4L1Q D;  3NIG A;  4Y5R D;  3I7N A;  3VA6 A;  1GOT B;  4UM9 A;  4JT6 C;  1E8M A;  3K72 A;  5C2W B;  1E8N A;  3MXX A;  2CO0 A;  4QAM A;  5IC7 A;  1SHY B;  4Y7R A;  1JMX B;  5IJ7 E;  3MVD K;  4G1M A;  4IMM A;  3L4O D;  4ZOX A;  3VGZ A;  4BCD A;  1MG2 A;  4FB1 D;  4YVD A;  2GC7 A;  3SXT D;  3EU7 A;  2H14 A;  2IWF A;  3PXS D;  5HQG A;  4OWR A;  3ZE0 A;  3PVU B;  4XYI A;  2P9S C;  2VDK A;  3CIK B;  4QQE A;  5I5M A;  2HYE A;  4MMZ A;  4ZOV A;  4D6V A;  1K32 A;  2HU5 A;  2J56 H;  4D0K A;  3EI1 A;  1A12 A;  2OIZ A;  1OMW B;  3GC3 B;  3DSM A;  5CXB B;  4AMZ A;  2YNN A;  3K26 A;  3MKQ A;  3SN6 B;  3ZE2 A;  5IJ8 E;  2VDL A;  4DNW A;  1VYH C;  4GQB B;  3PSL A;  1U4C A;  4X61 B;  3IUQ A;  1Q47 A;  2H9M A;  3VI3 A;  3SMR A;  5CXB A;  2H9N A;  2IAA A;  2IWK A;  3JB9 L;  3DXM C;  4U7A A;  4JD2 C;  4X63 B;  2AGL A;  2WQ8 A;  1TYE A;  2QXV A;  3O4I A;  1GG2 B;  4X3E A;  4KFM B;  4UI9 R;  3QI0 A;  2UZX B;  2YBA A;  3IUL A;  4A0B B;  3EI3 B;  3IIY A;  1XHM A;  4MMY A;  2PM7 B;  1VZ3 A;  3SBP A;  1P22 A;  2P9K C;  2B5N A;  3GRE A;  4J0W A;  3ZE1 A;  3MUN A;  4AOW A;  3B7F A;  4O2W A;  2XE4 A;  4JSX C;  1QFS A;  3BWS A;  2HKR A;  4JT5 C;  4A0B A;  3EI3 A;  4G1E A;  1MDA H;  2H6K A;  3E0C A;  3T3P A;  1H2Z A;  3NVQ A;  2GNQ A;  2HES X;  5M5S A;  4BL0 A;  1L5G A;  4QL1 A;  3JRO A;  3JZN A;  3F3G A;  3C5M A;  4I79 A;  4D9S A;  3J80 g;  5HE2 B;  4O1Q D;  2I0S A;  3JPX A;  4Z7N A;  3ZDZ A;  3C75 H;  3V5W B;  2HJ4 A;  5SXM A;  5JWZ A;  2YB8 B;  4NAA A;  5TEF A;  2XL2 A;  3F3P A;  2P9N C;  5C2V B;  2IUP A;  1R5M A;  3EMH A;  2H9P A;  4G55 A;  1VE6 A;  2JKX A;  3O4H A;  5FKR A;  2OVQ B;  3V9F A;  4JHN A;  4TZ4 A;  3OKW A;  3IJC A;  4IRZ A;  5C92 A;  5GXH A;  4J87 A;  1N6D A;  2QR5 A;  4BCC A;  4GMB A;  1H2Y A;  1SQJ A;  3SLE D;  4A7J A;  4CY5 A;  4PSW B;  5EAR A;  4GGC A;  4CY2 A;  1XKS A;  4CI2 A;  4O3T B;  3IIW A;  4AMY A;  4G56 B;  4GQ1 A;  5FFG A;  3EQ7 A;  3AH8 B;  2I3T A;  3JZH A;  2B4E A;  5CYK A;  3IJ1 A;  3EQ8 A;  4XYH A;  2QZP A;  3I8E A;  1QFM A;  3AL9 A;  1PEV A;  1BPO A;  2O9K A;  3EWE A;  4GGA A;  4BH6 A;  4RE5 A;  4HDJ A;  5HDB A;  4WJK A;  4ZOY A;  4WK0 A;  3NVX A;  4Z7Q A;  3EQ9 A;  4PBZ A;  1JOF A;  5C86 A;  2GC4 A;  5FKS A;  1TYQ C;  5FFO A;  5A2Q g;  3EI1 B;  3JZG A;  2G99 A;  4AX4 A;  5FA5 B;  3AL8 B;  4JXM A;  4N14 A;  2EIB A;  2P9P C;  2VDM A;  5M5T A;  3IUM A;  5C9Z B;  1QNI A;  4CC9 A;  3UKR C;  1M1X A;  4GM9 A;  3AL8 A;  4UM8 A;  4CZX A;  2OVR B;  4CI1 A;  4ERZ A;  2Z2O A;  2I0T A;  4J73 A;  2HJB A;  4J81 A;  1PI6 A;  1ERJ A;  5GMK n;  2IUQ A;  4CZY A;  4JHP C;  3N0E A;  3O4J A;  2VDQ A;  3DXK C;  5M5V A;  3MKS B;  4ZOZ A;  1PBY B;  3I7H A;  3V7D B;  1YR2 A;  4GGD A;  4PXW A;  5M5U A;  2CNX A;  2B5L A;  2XDW A;  1OLZ A;  3I8C A;  3ZDY A;  2PM9 A;  4NSX A;  5M61 A;  3UVM A;  4A09 B;  3I7K A;  5EMK B;  4FA4 D;  3VI4 A;  3PVW B;  5E6R A;  4JSP C;  5EML B;  4CI3 A;  2CE9 A;  4J8G A;  2P9U C;  3C99 A;  5FQD A;  4L3G D;  5EM2 A;  1H2X A;  4A09 A;  3SCY A;  3OKY A;  5GSA A;  3DM0 A;  3I2N A;  3SVW D;  2BKL A;  3GD1 I;  4FA5 D;  2W18 A;  2I0R A;  3RN1 D;  3K27 A;  2Z2P A;  3UVO A;  4J84 A;  2UZY B;  4ESG A;  3PXW D;  3J81 g;  4A08 A;  4FAN D;  2H68 A;  4J8B A;  3V4P A;  1I2M B;  4GM3 A;  4J79 A;  1PGU A;  4R7A B;  3OL2 B;  3MZK A;  3T3M A;  2PM6 B;  1U2V C;  3UVK A;  2HKM A;  2EIC A;  4FA9 D;  2H6Q A;  1JTD B;  3OL2 A;  2IUV A;  5FKQ A;  4WK2 A;  5THA A;  2H9L A;  4J78 A;  5M5R A;  5I5J A;  4A2M A;  1YFQ A;  1L0Q A;  1NEX B;  1VZ2 A;  5AJA A;  3L4M D;  1UTC A;  1H2W A;  2XL3 A;  4BP8 A;  2CO0 C;  2P9I C;  2H3X A;  5CXC B;  5CYK B;  4FHL A;  3RMZ D;  1UOO A;  2AGX A;  4CZV A;  2H6N A;  3N0D A;  3ULE C;  1JMZ B;  5CXC A;  2XYI A;  3U4Y A;  2VZ3 A;  3SJL D;  3IJ0 A;  4PC0 A;  3CFS B;  1A0R B;  1GXR A;  2H13 A;  4MMX A;  4CY1 A;  1K3I A;  2EID A;  3PE7 A;  3C9C A;  3OW8 A;  3JRP A;  2G9A A;  1RI6 A;  5FLX g;  2YNO A;  3EG6 A;  3MUO A;  1O6G A;  2OK4 A;  5TDH B;  4MK0 B;  3OF7 A;  5GXI A;  3RRM C;  3ZDX A;  4CY3 A;  4U1E I;  1O6F A;  3PSC B;  2OJY A;  5TEE A;  1JJU B;  4H5J A;  4K3J B;  3RLM D;  4E54 B;  4OZU A;  4RE6 A;  2CE8 A;  4O3U B;  5HE0 B;  4H5I A;  2VDP A;  3ORV D;  2AGY A;  2QC5 A;  4IA9 A;  2PBI B;  4Z7O A;  4PSX B;  5HE3 B;  1U8C A;  4PNK B;  4GZ8 A;  4E54 A;  4JSN C;  3AFC A;  3KCI A;  3HFQ A;  2YNP A;  4QT8 A;  3BG1 A;  2HU8 A;  1N6E A;  4DNU A;  3NID A;  4LG9 A;  5H17 A;  4O9D A;  3SBQ A;  4XEI C;  3UKU C;  1GOH A;  5EAL A;  4NEN A;  3IUJ A;  5EAP A;  4AEZ A;  2VZ1 A;  4K3I D;  2HXC A;  5FXY A;  1MG3 A;  3GFC A;  4O45 A;  4AN1 A;  4FA1 D;  5H14 A;  2EIE A;  4BP9 A;  3EI2 B;  3DDU A;  3K6S A;  3UVL A;  4ERQ A;  2PM9 B;  1FWX A;  2IUR A;  5EAM A;  3EI2 A;  2H47 A;  1SQ9 A;  2AH0 A;  1T2X A;  4LGN A;  2J55 H;  2VDO A;  5IGQ A;  2Z2N A;  3SWS D;  5K19 A;  3I7O A;  5KDO B;  3KRX B;  3JAM g;  2YMU A;  3SHF A;  4O02 A;  5EM2 B;  3PXT D;  3IVM A;  3OKY B;  4GM8 A;  4JSV C;  4NC4 A;  1GOF A;  2MTA H;  5EMJ B;  1N6F A;  1GOG A;  2BCJ B;  2TRC B;  3UR4 A;  2P9L C;  2I3S A;  4BCB A;  2AGZ A;  4E5Z B;  5FKT A;  4J0X A;  3P4F A;  5E6U A;  3F3F A;  4ERY A;  4A08 B;  2OK6 A;  5E6S A;  4J86 A;  1B9Y A;  4E5Z A;  4Z8L A;  3DWL C;  1K8K C;  4AN0 A;  5AFU 3;  4CI8 A;  5AMS A;  4GQ2 P;  4A11 B;  5HE1 B;  5IGO A;  1B9X A;  1S4U X;  2BBK H;  4J77 A;  2CN3 A;  1C9I A;  2CN2 A;  5TF2 A;  4FAV D;  3IUR A;  2VC2 A;  4L9O A;  4DNV A;  3IJE A;  3UVN A;  1C9L A;  1XIP A;  4A11 A;  2EBS A;  3MZL A;  1VE7 A;  3I7P A;  2XZG A;  5H1M A;  3KRW B;  4ZN4 A;  3RSE C;  5HYN B;  3FCU A;  4FWW A;  3O4G A;  4X60 B;  3QHY B;  2AQ5 A; 
#chains in the Genus database with same CATH homology
 2OVP B;  3CFV A;  3SFZ A;  3MMY A;  3OKT A;  3ZWL B;  1GP2 B;  3BG0 A;  5EMM B;  3FRX A;  3ODT A;  4EWR A;  3I89 A;  3I7L A;  4PBY A;  5I5I A;  3A0F A;  2B5M A;  3EI4 B;  3RFG A;  4ES0 A;  4BUJ C;  2XU7 A;  2AGW A;  3VH0 A;  4LG8 A;  5K1C C;  4QRJ A;  4A2L A;  4A0A B;  3SBR A;  3EI4 A;  3FM0 A;  3W15 A;  3FGB A;  3OTT A;  3IKO A;  4J82 A;  1TBG A;  5IT9 g;  2AH1 A;  3NVN A;  4A0A A;  1NR0 A;  3RN0 D;  4L3H D;  2J57 G;  5B4W A;  3RFH A;  2Q7Q A;  4L1Q D;  4Y5R D;  3I7N A;  3VA6 A;  1GOT B;  4JT6 C;  5C2W B;  3MXX A;  2CO0 A;  5IC7 A;  1SHY B;  4Y7R A;  1JMX B;  5IJ7 E;  4IMM A;  4ZOX A;  3L4O D;  3VGZ A;  4FB1 D;  1MG2 A;  4YVD A;  2GC7 A;  3SXT D;  3EU7 A;  2H14 A;  2IWF A;  3PXS D;  5HQG A;  4OWR A;  3PVU B;  4XYI A;  2P9S C;  3CIK B;  4QQE A;  5I5M A;  2HYE A;  4ZOV A;  4D6V A;  1K32 A;  2J56 H;  4D0K A;  3EI1 A;  2OIZ A;  1OMW B;  3DSM A;  5CXB B;  2YNN A;  3K26 A;  3MKQ A;  3SN6 B;  5IJ8 E;  1VYH C;  4GQB B;  3PSL A;  1U4C A;  4X61 B;  1Q47 A;  2H9M A;  3SMR A;  5CXB A;  2H9N A;  2IAA A;  2IWK A;  3JB9 L;  3DXM C;  4U7A A;  4JD2 C;  4X63 B;  2AGL A;  2QXV A;  1GG2 B;  4X3E A;  4KFM B;  4UI9 R;  2UZX B;  2YBA A;  4A0B B;  3EI3 B;  3IIY A;  1XHM A;  2PM7 B;  3SBP A;  1P22 A;  2P9K C;  2B5N A;  3GRE A;  4J0W A;  4AOW A;  3B7F A;  4JSX C;  3BWS A;  2HKR A;  4JT5 C;  4A0B A;  3EI3 A;  1MDA H;  2H6K A;  3E0C A;  3NVQ A;  2GNQ A;  2HES X;  4BL0 A;  4QL1 A;  3JRO A;  3JZN A;  3F3G A;  3C5M A;  4I79 A;  3J80 g;  5HE2 B;  4O1Q D;  2I0S A;  3JPX A;  3C75 H;  3V5W B;  2HJ4 A;  5SXM A;  5JWZ A;  2YB8 B;  5TEF A;  2XL2 A;  3F3P A;  2P9N C;  5C2V B;  2IUP A;  1R5M A;  3EMH A;  2H9P A;  5FKR A;  2OVQ B;  3V9F A;  4TZ4 A;  3OKW A;  3IJC A;  5GXH A;  4J87 A;  1N6D A;  4GMB A;  1SQJ A;  3SLE D;  4A7J A;  4CY5 A;  4PSW B;  5EAR A;  4GGC A;  4CY2 A;  1XKS A;  4CI2 A;  4O3T B;  3IIW A;  4G56 B;  4GQ1 A;  3AH8 B;  2I3T A;  3JZH A;  2B4E A;  5CYK A;  3IJ1 A;  4XYH A;  3I8E A;  3AL9 A;  1PEV A;  2O9K A;  3EWE A;  4GGA A;  4BH6 A;  4HDJ A;  4ZOY A;  3NVX A;  4PBZ A;  1JOF A;  2GC4 A;  5FKS A;  1TYQ C;  5A2Q g;  3EI1 B;  3JZG A;  2G99 A;  5FA5 B;  3AL8 B;  4JXM A;  4N14 A;  2P9P C;  5C9Z B;  1QNI A;  4CC9 A;  3UKR C;  4GM9 A;  3AL8 A;  4CZX A;  2OVR B;  4CI1 A;  4ERZ A;  2Z2O A;  2I0T A;  4J73 A;  2HJB A;  4J81 A;  1PI6 A;  1ERJ A;  5GMK n;  2IUQ A;  4CZY A;  3N0E A;  3DXK C;  3MKS B;  4ZOZ A;  1PBY B;  3I7H A;  3V7D B;  4GGD A;  4PXW A;  2CNX A;  2B5L A;  1OLZ A;  3I8C A;  2PM9 A;  4NSX A;  3UVM A;  4A09 B;  3I7K A;  5EMK B;  4FA4 D;  3PVW B;  4JSP C;  5EML B;  4CI3 A;  2CE9 A;  4J8G A;  2P9U C;  3C99 A;  5FQD A;  4L3G D;  5EM2 A;  4A09 A;  3SCY A;  3OKY A;  5GSA A;  3DM0 A;  3I2N A;  3SVW D;  4FA5 D;  2W18 A;  2I0R A;  3RN1 D;  3K27 A;  2Z2P A;  3UVO A;  4J84 A;  2UZY B;  4ESG A;  3PXW D;  3J81 g;  4A08 A;  4FAN D;  2H68 A;  4J8B A;  4GM3 A;  4J79 A;  1PGU A;  4R7A B;  3OL2 B;  3MZK A;  2PM6 B;  1U2V C;  3UVK A;  2HKM A;  4FA9 D;  2H6Q A;  3OL2 A;  2IUV A;  5FKQ A;  5THA A;  2H9L A;  4J78 A;  5I5J A;  4A2M A;  1YFQ A;  1L0Q A;  1NEX B;  5AJA A;  3L4M D;  2XL3 A;  2CO0 C;  2P9I C;  2H3X A;  5CXC B;  5CYK B;  4FHL A;  3RMZ D;  2AGX A;  4CZV A;  2H6N A;  3N0D A;  3ULE C;  1JMZ B;  5CXC A;  2XYI A;  3U4Y A;  3SJL D;  3IJ0 A;  4PC0 A;  3CFS B;  1A0R B;  1GXR A;  2H13 A;  4CY1 A;  3PE7 A;  3C9C A;  3OW8 A;  3JRP A;  2G9A A;  1RI6 A;  5FLX g;  3EG6 A;  2YNO A;  2OK4 A;  5TDH B;  4MK0 B;  5GXI A;  3RRM C;  4CY3 A;  4U1E I;  3PSC B;  2OJY A;  5TEE A;  1JJU B;  4H5J A;  4K3J B;  3RLM D;  4E54 B;  4OZU A;  2CE8 A;  4O3U B;  5HE0 B;  4H5I A;  3ORV D;  2AGY A;  2QC5 A;  4IA9 A;  2PBI B;  4PSX B;  5HE3 B;  4PNK B;  4GZ8 A;  4E54 A;  4JSN C;  3AFC A;  3HFQ A;  2YNP A;  4QT8 A;  3BG1 A;  1N6E A;  4LG9 A;  5H17 A;  4O9D A;  3SBQ A;  4XEI C;  3UKU C;  5EAL A;  5EAP A;  4AEZ A;  4K3I D;  2HXC A;  5FXY A;  1MG3 A;  3GFC A;  4O45 A;  4FA1 D;  5H14 A;  3EI2 B;  3UVL A;  4ERQ A;  2PM9 B;  1FWX A;  2IUR A;  5EAM A;  3EI2 A;  2H47 A;  1SQ9 A;  2AH0 A;  4LGN A;  2J55 H;  5IGQ A;  2Z2N A;  3SWS D;  5K19 A;  3I7O A;  5KDO B;  3KRX B;  3JAM g;  2YMU A;  3SHF A;  5EM2 B;  3PXT D;  3OKY B;  4GM8 A;  4JSV C;  5EMJ B;  2MTA H;  1N6F A;  2BCJ B;  2TRC B;  3UR4 A;  2P9L C;  2I3S A;  2AGZ A;  4E5Z B;  5FKT A;  4J0X A;  3P4F A;  3F3F A;  4ERY A;  4A08 B;  2OK6 A;  4J86 A;  1B9Y A;  4E5Z A;  4Z8L A;  3DWL C;  1K8K C;  5AFU 3;  4CI8 A;  5AMS A;  4GQ2 P;  4A11 B;  5HE1 B;  5IGO A;  1B9X A;  1S4U X;  2BBK H;  4J77 A;  2CN3 A;  2CN2 A;  5TF2 A;  4FAV D;  4L9O A;  3UVN A;  1XIP A;  4A11 A;  2EBS A;  3MZL A;  3I7P A;  5H1M A;  3KRW B;  4ZN4 A;  3RSE C;  5HYN B;  4FWW A;  4X60 B;  2AQ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...