2VC2A

Re-refinement of integrin alphaiibbeta3 headpiece bound to antagonist l-739758
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
452
structure length
452
Chain Sequence
LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell adhesion/immune system
molecule keywords INTEGRIN ALPHA-IIB
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
total genus 111
structure length 452
sequence length 452
ec nomenclature
pdb deposition date 2007-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 2vc2A00
3ZE0A 4IRZA 3K6SA 3T3MA 4Z7QA 4MMXA 2VDLA 4G1MA 3ZE2A 3FCUA 3IJEA 4UM8A 4Z7OA 3K71A 2VDQA 1M1XA 5HDBA 5E6UA 2VDPA 5FFGA 5E6SA 2VDMA 3ZDYA 3NIDA 4O02A 1U8CA 1TYEA 1JV2A 3VI4A 3VI3A 2VDOA 4WK2A 3V4PA 3ZDZA 1L5GA 4G1EA 2VC2A 4WK4A 5FFOA 4NENA 2VDNA 2VDRA 3V4VA 3ZE1A 3NIGA 4UM9A 3ZDXA 5E6RA 3K72A 3T3PA 4Z7NA 4WK0A 4WJKA 4MMZA 3NIFA 2VDKA 4MMYA 3FCSA
chains in the Genus database with same CATH superfamily
4O9DA 3MMYA 4Z7QA 3MXXA 4O3UB 3MZKA 1RI6A 3K71A 4BCCA 1SQ9A 3UVNA 2H13A 3I89A 4J79A 1UTCA 2QC5A 2G99A 4O02A 4LG8A 3VI3A 3FM0A 3EMHA 5FKTA 5FKQA 3U4YA 5H1MA 5SXMA 4E54B 3V4VA 4ES0A 2IAAA 3NVNA 3DXKC 2H6NA 4MK0B 1GP2B 2OIZA 1VZ2A 5JWZA 2TRCB 5IJ7E 1E5TA 5C2VB 4ESGA 2IUPA 2VZ1A 2VDQA 4A09A 3PXWD 2VDPA 4L1QD 5B4WA 1UOPA 2J57G 3EI1A 2AGLA 1NEXB 5AJAA 3SXTD 4CZVA 3PVWB 3MUNA 5M5SA 5HYNB 2OVPB 3EI2A 3IURA 2AGZA 4OWRA 4JHNA 4QAMA 3E0CA 1PEVA 3EWEA 1YR2A 2XZGA 5CXBB 2P9IC 4Y5RD 3DXMC 5FXYA 3IJ1A 4TZ4A 3GC3B 2GC4A 3A0FA 4JT6C 3SWSD 1GOHA 3MUOA 4BP8A 1VE7A 3JPXA 3I2NA 1Q47A 2IUQA 3EG6A 4PBYA 2VDMA 4BCBA 3ZDYA 4D0KA 3KCIA 2PM9A 4J84A 4XYIA 3GFCA 4GQ2P 4WK2A 5EMKB 4ZOXA 5TEFA 1JJUB 4FAND 1JOFA 3K27A 3IUMA 3MZLA 4A0AA 4AN0A 4O1QD 5M5TA 3RN1D 4NSXA 4JSPC 5CXCA 3AFCA 3GD1I 3OL2A 4GGAA 3ULEC 4LGNA 1QNIA 4X60B 2CNXA 4JT5C 1K3IA 4A0BA 3IIWA 4GZ8A 2IUVA 4JD2C 4MMXA 3OKWA 4AN1A 3NVQA 4ZOVA 1VYHC 1N6FA 4K3ID 4RE5A 1N6DA 1U2VC 3RSEC 3DM0A 1QFMA 3JZNA 2XYIA 3EQ7A 3RFGA 4A11B 1TYEA 2W18A 4UI9R 5I5MA 3EI4B 2VC2A 2J55H 4BUJC 5EMMB 4OZUA 2VDNA 4QRJA 4CI3A 3C5MA 3SCYA 5E6RA 2AQ5A 3T3PA 1H2YA 2I0TA 2YNOA 3PE7A 3SLED 4CI2A 4FB1D 3OTTA 3OKTA 2VDKA 4IRZA 4R7AB 3K6SA 2EIBA 3W15A 3EQ8A 3UVLA 4JSVC 3CFVA 5A2Qg 5AFU3 2Z2PA 1GOFA 2OK4A 3EI3A 1PI6A 4XYHA 2HKMA 2CN3A 2AGXA 1L0QA 1P22A 2XU7A 4UM9A 1K8KC 4O45A 3CFSB 4J0XA 5KDOB 5CYKB 2AH1A 3NIFA 4A08B 2EICA 4AEZA 1R5MA 1GG2B 3MVDK 4FA5D 2H3XA 2P9PC 2B4EA 2IWFA 3I7OA 3KRWB 4G1MA 4J73A 1UOOA 2B5NA 4NBMA 3ODTA 3SJLD 2Z2OA 1XIPA 4CZYA 5C86A 4J8GA 2QR5A 3FRXA 5C2WB 5M5RA 1PGUA 5EMJB 3AL8A 4L3GD 1QFSA 3EQ9A 5TEEA 4HDJA 5EM2B 2CN2A 2BBKH 5HE0B 2CO0A 3EI1B 4JXMA 4MMZA 2HKRA 5GXIA 4FAVD 3O4IA 3PVUB 4BL0A 4BCDA 5EALA 3UR4A 3EI2B 3JZGA 4QT8A 2Q7QA 5FQDA 2P9SC 4Z7OA 5HQGA 3I7LA 1GXRA 4A7JA 1H2WA 3SFZA 2H9LA 1T2XA 3PXTD 2OVRB 4Z8LA 4E5ZA 4G56B 5C92A 4FHLA 5HE1B 3V4PA 4D9SA 1JMXB 3B7FA 4CY2A 1E8NA 2BCJB 3K72A 2HYEA 3O4HA 1K32A 5IJ8E 3RMZD 4O3TB 3L4MD 5AMSA 2HXCA 4CI1A 2PM9B 4YVDA 2WQ8A 3ZE0A 3IJCA 3T3MA 5TF2A 4X61B 2AGYA 4A0AB 2XL2A 2XE4A 4KFMB 3I7PA 3K26A 5CXCB 3VA6A 3PXSD 2P9KC 3MKQA 3OL2B 3UVKA 3L4OD 3ZDZA 4A0BB 3IVMA 4ZOZA 4ERQA 4J78A 3SBPA 4PXWA 3UVOA 2VZ3A 4Z7NA 4WK0A 5IC7A 4WJKA 5IT9g 2I0SA 2HJ4A 2UZYB 1ERJA 3V9FA 4U7AA 4ERYA 2EIEA 4ZOYA 1O6FA 1N6EA 2VDLA 4NC4A 3FCUA 5GMKn 4AOWA 2I3SA 4QL1A 4EWRA 2XL3A 2IWKA 4X63B 3C99A 5M61A 2AGWA 4G1EA 3J81g 2H14A 1MDAH 1O6GA 3NIGA 4JSNC 3JROA 1BPOA 3EI3B 4CC9A 4FA9D 2HU8A 4J77A 2EBSA 4GM3A 5K19A 3RLMD 5EMLB 3I7HA 3I8CA 4CY1A 4LG9A 4DNVA 2H47A 3IUNA 3SVWD 3N0DA 5I5IA 4CI8A 3QI0A 5E6SA 3JAMg 3IUQA 4AX4A 2BKLA 2PM6B 4CY5A 4J86A 4GGCA 2HESX 3AL9A 4H5JA 1UOQA 3FCSA 4DNWA 2HU7A 5H14A 1S4UX 3RFHA 2YBAA 1U4CA 3AL8B 4CZXA 5M5UA 1TYQC 3OKYA 2MTAH 4PC0A 1E8MA 4PNKB 5GSAA 4GM8A 3SBQA 3SMRA 2IURA 1JMZB 3O4JA 3F3FA 1C9LA 3IIYA 4NENA 5FKRA 3VH0A 5EAMA 2QXVA 3BG0A 2YNNA 2EIDA 4J8BA 4G55A 4A09B 3JRPA 2OK6A 1XKSA 4GGDA 4D6VA 3O4GA 1GOTB 4E5ZB 3SHFA 3RRMC 3IJEA 2H9MA 5CYKA 5FKSA 3JB9L 2PBIB 4A08A 3UVMA 4X3EA 3F3PA 1JV2A 3P4FA 3DWLC 5THAA 1GOGA 2HU5A 1L5GA 4WK4A 3PSLA 5HE2B 2VDRA 2YMUA 1H2ZA 2YB8B 5M5VA 2B5MA 4GQBB 3IULA 2O9KA 5EARA 3VGZA 4J82A 4JSXC 4H5IA 4E54A 1TBGA 4J81A 5EM2A 3JZHA 4DNUA 1H2XA 2B5LA 4FA4D 2QZPA 3BG1A 2H6QA 2H9NA 2H6KA 5IGOA 3RN0D 3UKRC 4PSXB 2GNQA 2VDOA 1XHMA 2XDWA 1VZ3A 3NVXA 4IMMA 4J87A 4AMZA 4J0WA 2YNPA 3OF7A 5EAPA 3ZE1A 3C75H 4AMYA 2CE9A 5K1CC 3IUJA 1OLZA 1C9IA 5C9ZB 5IGQA 1FWXA 3BWSA 2Z2NA 2PM7B 1MG3A 4PSWB 1OMWB 3MKSB 2AH0A 3KRXB 1MG2A 4UM8A 5CXBA 4IA9A 4A2MA 1NR0A 2HJBA 5HE3B 4FA1D 3NIDA 3CIKB 3DDUA 3OW8A 2H9PA 3QHYB 2G9AA 2CE8A 4ERZA 1B9XA 2CO0C 5FFOA 4BH6A 2I3TA 2P9UC 3UKUC 3SBRA 1YFQA 4K3JB 5TDHB 1A12A 4RE6A 1SHYB 4Y7RA 5I5JA 4NAAA 3V7DB 4L1MA 5GXHA 4XEIC 3AH8B 3IJ0A 1PBYB 4I79A 5HDBA 4U1EI 3I7KA 3EU7A 3F3GA 5FA5B 2I0RA 2H68A 1U8CA 2P9NC 2OJYA 3I8EA 5H17A 4GQ1A 3SN6B 3IKOA 3GREA 4O2WA 4L9OA 2P9LC 4CY3A 1B9YA 3OKYB 3C9CA 3J80g 4L3HD 3DSMA 4PBZA 4A11A 3EI4A 3ORVD 2J56H 4GM9A 4A2LA 3ZE2A 2UZXB 3ZWLB 1M1XA 3FGBA 5E6UA 5FFGA 1A0RB 2GC7A 3VI4A 1VE6A 3N0EA 3V5WB 4ZN4A 4BP9A 4QQEA 5FLXg 1SQJA 3I7NA 3ZDXA 3HFQA 4JHPC 1I2MB 4FWWA 2OVQB 2JKXA 4N14A 3PSCB 4MMYA 1JTDB 4GMBA
chains in the Genus database with same CATH topology
3ZE0A 4IRZA 3K6SA 3T3MA 4Z7QA 4MMXA 2VDLA 4G1MA 3ZE2A 3FCUA 3IJEA 4UM8A 4Z7OA 3K71A 2VDQA 1M1XA 5HDBA 5E6UA 2VDPA 5FFGA 5E6SA 2VDMA 3ZDYA 3NIDA 4O02A 1U8CA 1TYEA 1JV2A 3VI4A 3VI3A 2VDOA 4WK2A 3V4PA 3ZDZA 1L5GA 4G1EA 2VC2A 4WK4A 5FFOA 4NENA 2VDNA 2VDRA 3V4VA 3ZE1A 3NIGA 4UM9A 3ZDXA 5E6RA 3K72A 3T3PA 4Z7NA 4WK0A 4WJKA 4MMZA 3NIFA 2VDKA 4MMYA 3FCSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZE0 A;  4IRZ A;  3K6S A;  3T3M A;  4Z7Q A;  4MMX A;  2VDL A;  4G1M A;  3ZE2 A;  3FCU A;  3IJE A;  4UM8 A;  4Z7O A;  3K71 A;  2VDQ A;  1M1X A;  5HDB A;  5E6U A;  2VDP A;  5FFG A;  5E6S A;  2VDM A;  3ZDY A;  3NID A;  4O02 A;  1U8C A;  1TYE A;  1JV2 A;  3VI4 A;  3VI3 A;  2VDO A;  4WK2 A;  3V4P A;  3ZDZ A;  1L5G A;  4G1E A;  2VC2 A;  4WK4 A;  5FFO A;  4NEN A;  2VDN A;  2VDR A;  3V4V A;  3ZE1 A;  3NIG A;  4UM9 A;  3ZDX A;  5E6R A;  3K72 A;  3T3P A;  4Z7N A;  4WK0 A;  4WJK A;  4MMZ A;  3NIF A;  2VDK A;  4MMY A;  3FCS A; 
#chains in the Genus database with same CATH topology
 4O9D A;  3MMY A;  4Z7Q A;  3MXX A;  4O3U B;  3MZK A;  1RI6 A;  3K71 A;  4BCC A;  1SQ9 A;  3UVN A;  2H13 A;  3I89 A;  4J79 A;  1UTC A;  2QC5 A;  2G99 A;  4O02 A;  4LG8 A;  3VI3 A;  3FM0 A;  3EMH A;  5FKT A;  5FKQ A;  3U4Y A;  5H1M A;  5SXM A;  4E54 B;  3V4V A;  4ES0 A;  2IAA A;  3NVN A;  3DXK C;  2H6N A;  4MK0 B;  1GP2 B;  2OIZ A;  1VZ2 A;  5JWZ A;  2TRC B;  5IJ7 E;  1E5T A;  5C2V B;  4ESG A;  2IUP A;  2VZ1 A;  2VDQ A;  4A09 A;  3PXW D;  2VDP A;  4L1Q D;  5B4W A;  1UOP A;  2J57 G;  3EI1 A;  2AGL A;  1NEX B;  5AJA A;  3SXT D;  4CZV A;  3PVW B;  3MUN A;  5M5S A;  5HYN B;  2OVP B;  3EI2 A;  3IUR A;  2AGZ A;  4OWR A;  4JHN A;  4QAM A;  3E0C A;  1PEV A;  3EWE A;  1YR2 A;  2XZG A;  5CXB B;  2P9I C;  4Y5R D;  3DXM C;  5FXY A;  3IJ1 A;  4TZ4 A;  3GC3 B;  2GC4 A;  3A0F A;  4JT6 C;  3SWS D;  1GOH A;  3MUO A;  4BP8 A;  1VE7 A;  3JPX A;  3I2N A;  1Q47 A;  2IUQ A;  3EG6 A;  4PBY A;  2VDM A;  4BCB A;  3ZDY A;  4D0K A;  3KCI A;  2PM9 A;  4J84 A;  4XYI A;  3GFC A;  4GQ2 P;  4WK2 A;  5EMK B;  4ZOX A;  5TEF A;  1JJU B;  4FAN D;  1JOF A;  3K27 A;  3IUM A;  3MZL A;  4A0A A;  4AN0 A;  4O1Q D;  5M5T A;  3RN1 D;  4NSX A;  4JSP C;  5CXC A;  3AFC A;  3GD1 I;  3OL2 A;  4GGA A;  3ULE C;  4LGN A;  1QNI A;  4X60 B;  2CNX A;  4JT5 C;  1K3I A;  4A0B A;  3IIW A;  4GZ8 A;  2IUV A;  4JD2 C;  4MMX A;  3OKW A;  4AN1 A;  3NVQ A;  4ZOV A;  1VYH C;  1N6F A;  4K3I D;  4RE5 A;  1N6D A;  1U2V C;  3RSE C;  3DM0 A;  1QFM A;  3JZN A;  2XYI A;  3EQ7 A;  3RFG A;  4A11 B;  1TYE A;  2W18 A;  4UI9 R;  5I5M A;  3EI4 B;  2VC2 A;  2J55 H;  4BUJ C;  5EMM B;  4OZU A;  2VDN A;  4QRJ A;  4CI3 A;  3C5M A;  3SCY A;  5E6R A;  2AQ5 A;  3T3P A;  1H2Y A;  2I0T A;  2YNO A;  3PE7 A;  3SLE D;  4CI2 A;  4FB1 D;  3OTT A;  3OKT A;  2VDK A;  4IRZ A;  4R7A B;  3K6S A;  2EIB A;  3W15 A;  3EQ8 A;  3UVL A;  4JSV C;  3CFV A;  5A2Q g;  5AFU 3;  2Z2P A;  1GOF A;  2OK4 A;  3EI3 A;  1PI6 A;  4XYH A;  2HKM A;  2CN3 A;  2AGX A;  1L0Q A;  1P22 A;  2XU7 A;  4UM9 A;  1K8K C;  4O45 A;  3CFS B;  4J0X A;  5KDO B;  5CYK B;  2AH1 A;  3NIF A;  4A08 B;  2EIC A;  4AEZ A;  1R5M A;  1GG2 B;  3MVD K;  4FA5 D;  2H3X A;  2P9P C;  2B4E A;  2IWF A;  3I7O A;  3KRW B;  4G1M A;  4J73 A;  1UOO A;  2B5N A;  4NBM A;  3ODT A;  3SJL D;  2Z2O A;  1XIP A;  4CZY A;  5C86 A;  4J8G A;  2QR5 A;  3FRX A;  5C2W B;  5M5R A;  1PGU A;  5EMJ B;  3AL8 A;  4L3G D;  1QFS A;  3EQ9 A;  5TEE A;  4HDJ A;  5EM2 B;  2CN2 A;  2BBK H;  5HE0 B;  2CO0 A;  3EI1 B;  4JXM A;  4MMZ A;  2HKR A;  5GXI A;  4FAV D;  3O4I A;  3PVU B;  4BL0 A;  4BCD A;  5EAL A;  3UR4 A;  3EI2 B;  3JZG A;  4QT8 A;  2Q7Q A;  5FQD A;  2P9S C;  4Z7O A;  5HQG A;  3I7L A;  1GXR A;  4A7J A;  1H2W A;  3SFZ A;  2H9L A;  1T2X A;  3PXT D;  2OVR B;  4Z8L A;  4E5Z A;  4G56 B;  5C92 A;  4FHL A;  5HE1 B;  3V4P A;  4D9S A;  1JMX B;  3B7F A;  4CY2 A;  1E8N A;  2BCJ B;  3K72 A;  2HYE A;  3O4H A;  1K32 A;  5IJ8 E;  3RMZ D;  4O3T B;  3L4M D;  5AMS A;  2HXC A;  4CI1 A;  2PM9 B;  4YVD A;  2WQ8 A;  3ZE0 A;  3IJC A;  3T3M A;  5TF2 A;  4X61 B;  2AGY A;  4A0A B;  2XL2 A;  2XE4 A;  4KFM B;  3I7P A;  3K26 A;  5CXC B;  3VA6 A;  3PXS D;  2P9K C;  3MKQ A;  3OL2 B;  3UVK A;  3L4O D;  3ZDZ A;  4A0B B;  3IVM A;  4ZOZ A;  4ERQ A;  4J78 A;  3SBP A;  4PXW A;  3UVO A;  2VZ3 A;  4Z7N A;  4WK0 A;  5IC7 A;  4WJK A;  5IT9 g;  2I0S A;  2HJ4 A;  2UZY B;  1ERJ A;  3V9F A;  4U7A A;  4ERY A;  2EIE A;  4ZOY A;  1O6F A;  1N6E A;  2VDL A;  4NC4 A;  3FCU A;  5GMK n;  4AOW A;  2I3S A;  4QL1 A;  4EWR A;  2XL3 A;  2IWK A;  4X63 B;  3C99 A;  5M61 A;  2AGW A;  4G1E A;  3J81 g;  2H14 A;  1MDA H;  1O6G A;  3NIG A;  4JSN C;  3JRO A;  1BPO A;  3EI3 B;  4CC9 A;  4FA9 D;  2HU8 A;  4J77 A;  2EBS A;  4GM3 A;  5K19 A;  3RLM D;  5EML B;  3I7H A;  3I8C A;  4CY1 A;  4LG9 A;  4DNV A;  2H47 A;  3IUN A;  3SVW D;  3N0D A;  5I5I A;  4CI8 A;  3QI0 A;  5E6S A;  3JAM g;  3IUQ A;  4AX4 A;  2BKL A;  2PM6 B;  4CY5 A;  4J86 A;  4GGC A;  2HES X;  3AL9 A;  4H5J A;  1UOQ A;  3FCS A;  4DNW A;  2HU7 A;  5H14 A;  1S4U X;  3RFH A;  2YBA A;  1U4C A;  3AL8 B;  4CZX A;  5M5U A;  1TYQ C;  3OKY A;  2MTA H;  4PC0 A;  1E8M A;  4PNK B;  5GSA A;  4GM8 A;  3SBQ A;  3SMR A;  2IUR A;  1JMZ B;  3O4J A;  3F3F A;  1C9L A;  3IIY A;  4NEN A;  5FKR A;  3VH0 A;  5EAM A;  2QXV A;  3BG0 A;  2YNN A;  2EID A;  4J8B A;  4G55 A;  4A09 B;  3JRP A;  2OK6 A;  1XKS A;  4GGD A;  4D6V A;  3O4G A;  1GOT B;  4E5Z B;  3SHF A;  3RRM C;  3IJE A;  2H9M A;  5CYK A;  5FKS A;  3JB9 L;  2PBI B;  4A08 A;  3UVM A;  4X3E A;  3F3P A;  1JV2 A;  3P4F A;  3DWL C;  5THA A;  1GOG A;  2HU5 A;  1L5G A;  4WK4 A;  3PSL A;  5HE2 B;  2VDR A;  2YMU A;  1H2Z A;  2YB8 B;  5M5V A;  2B5M A;  4GQB B;  3IUL A;  2O9K A;  5EAR A;  3VGZ A;  4J82 A;  4JSX C;  4H5I A;  4E54 A;  1TBG A;  4J81 A;  5EM2 A;  3JZH A;  4DNU A;  1H2X A;  2B5L A;  4FA4 D;  2QZP A;  3BG1 A;  2H6Q A;  2H9N A;  2H6K A;  5IGO A;  3RN0 D;  3UKR C;  4PSX B;  2GNQ A;  2VDO A;  1XHM A;  2XDW A;  1VZ3 A;  3NVX A;  4IMM A;  4J87 A;  4AMZ A;  4J0W A;  2YNP A;  3OF7 A;  5EAP A;  3ZE1 A;  3C75 H;  4AMY A;  2CE9 A;  5K1C C;  3IUJ A;  1OLZ A;  1C9I A;  5C9Z B;  5IGQ A;  1FWX A;  3BWS A;  2Z2N A;  2PM7 B;  1MG3 A;  4PSW B;  1OMW B;  3MKS B;  2AH0 A;  3KRX B;  1MG2 A;  4UM8 A;  5CXB A;  4IA9 A;  4A2M A;  1NR0 A;  2HJB A;  5HE3 B;  4FA1 D;  3NID A;  3CIK B;  3DDU A;  3OW8 A;  2H9P A;  3QHY B;  2G9A A;  2CE8 A;  4ERZ A;  1B9X A;  2CO0 C;  5FFO A;  4BH6 A;  2I3T A;  2P9U C;  3UKU C;  3SBR A;  1YFQ A;  4K3J B;  5TDH B;  1A12 A;  4RE6 A;  1SHY B;  4Y7R A;  5I5J A;  4NAA A;  3V7D B;  4L1M A;  5GXH A;  4XEI C;  3AH8 B;  3IJ0 A;  1PBY B;  4I79 A;  5HDB A;  4U1E I;  3I7K A;  3EU7 A;  3F3G A;  5FA5 B;  2I0R A;  2H68 A;  1U8C A;  2P9N C;  2OJY A;  3I8E A;  5H17 A;  4GQ1 A;  3SN6 B;  3IKO A;  3GRE A;  4O2W A;  4L9O A;  2P9L C;  4CY3 A;  1B9Y A;  3OKY B;  3C9C A;  3J80 g;  4L3H D;  3DSM A;  4PBZ A;  4A11 A;  3EI4 A;  3ORV D;  2J56 H;  4GM9 A;  4A2L A;  3ZE2 A;  2UZX B;  3ZWL B;  1M1X A;  3FGB A;  5E6U A;  5FFG A;  1A0R B;  2GC7 A;  3VI4 A;  1VE6 A;  3N0E A;  3V5W B;  4ZN4 A;  4BP9 A;  4QQE A;  5FLX g;  1SQJ A;  3I7N A;  3ZDX A;  3HFQ A;  4JHP C;  1I2M B;  4FWW A;  2OVQ B;  2JKX A;  4N14 A;  3PSC B;  4MMY A;  1JTD B;  4GMB A; 
#chains in the Genus database with same CATH homology
 3ZE0 A;  4IRZ A;  3K6S A;  3T3M A;  4Z7Q A;  4MMX A;  2VDL A;  4G1M A;  3ZE2 A;  3FCU A;  3IJE A;  4UM8 A;  4Z7O A;  3K71 A;  2VDQ A;  1M1X A;  5HDB A;  5E6U A;  2VDP A;  5FFG A;  5E6S A;  2VDM A;  3ZDY A;  3NID A;  4O02 A;  1U8C A;  1TYE A;  1JV2 A;  3VI4 A;  3VI3 A;  2VDO A;  4WK2 A;  3V4P A;  3ZDZ A;  1L5G A;  4G1E A;  2VC2 A;  4WK4 A;  5FFO A;  4NEN A;  2VDN A;  2VDR A;  3V4V A;  3ZE1 A;  3NIG A;  4UM9 A;  3ZDX A;  5E6R A;  3K72 A;  3T3P A;  4Z7N A;  4WK0 A;  4WJK A;  4MMZ A;  3NIF A;  2VDK A;  4MMY A;  3FCS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...