2VC2A

Re-refinement of integrin alphaiibbeta3 headpiece bound to antagonist l-739758
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
452
structure length
452
Chain Sequence
b'LNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords INTEGRIN ALPHA-IIB
publication title Structural Basis for Distinctive Recognition of Fibrinogen Gammac Peptide by the Platelet Integrin Alphaiibbeta3.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion/immune system
total genus 111
structure length 452
sequence length 452
ec nomenclature
pdb deposition date 2007-09-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01839 FG-GAP FG-GAP repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.130 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Integrin alpha, N-terminal 2vc2A00
4WJKA 3ZDYA 1L5GA 3NIFA 5HDBA 2VDKA 3ZDZA 2VDPA 3NIDA 3FCUA 2VDNA 3K71A 4O02A 1U8CA 3ZE2A 5FFOA 4MMYA 5E6RA 4WK0A 3VI4A 3V4VA 3VI3A 5E6UA 5E6SA 3ZE0A 4MMZA 4MMXA 1JV2A 2VDQA 4NENA 3IJEA 1M1XA 3K6SA 2VDLA 4G1MA 4WK2A 5FFGA 4Z7QA 2VDRA 1TYEA 4UM9A 4G1EA 4Z7OA 3FCSA 3T3MA 4UM8A 2VC2A 2VDOA 3NIGA 3ZE1A 3K72A 3V4PA 4WK4A 3T3PA 2VDMA 3ZDXA 4IRZA 4Z7NA
chains in the Genus database with same CATH superfamily
5I5MA 5IGOA 3C9CA 3IIWA 3JROA 3NIDA 3IKOA 4Z8LA 4FA9D 2H3XA 3EQ9A 4CI3A 3EG6A 3SMRA 3V4VA 3IIYA 2IWFA 3OF7A 3IUNA 2IURA 3ORVD 2YB8B 1JV2A 4X3EA 2VDQA 2XL3A 1GOHA 3EI3B 4O3TB 5EMLB 2OVQB 1JOFA 5KDOB 5EAMA 3EMHA 2HYEA 5M5RA 3NIGA 2HU5A 3AFCA 3T3PA 4GQBB 3DXMC 4CY5A 3GREA 1SHYB 3EI1B 2AGLA 3MVDK 3CIKB 3O4IA 1XHMA 3ZDZA 4IA9A 1C9LA 3U4YA 2XZGA 4ERQA 3SJLD 4PBYA 3L4OD 4FA1D 5I5IA 4JSXC 1GP2B 3ODTA 4NAAA 2OJYA 4G1MA 4L3HD 2IWKA 3GFCA 1VZ2A 1GOGA 2H6KA 4UM9A 4A11A 1FWXA 1P22A 4Z7OA 1B9XA 3PXSD 1ERJA 2VC2A 4J8BA 4J81A 5FKRA 1H2YA 5C92A 4AMZA 3PVUB 2YMUA 4ERYA 1UOPA 5M61A 2P9KC 5H17A 4PSXB 2H13A 3FGBA 2VDKA 3FCUA 3IUQA 5GMKn 1N6FA 3JB9L 2CE8A 3J80g 5IGQA 3AL8B 2AH0A 3V7DB 2AGXA 2EIEA 4J0XA 3IUJA 4MMXA 2OIZA 4QT8A 3SHFA 4CI8A 2QXVA 2I0SA 4YVDA 4A08A 3NVXA 1S4UX 3UR4A 4QL1A 4BH6A 3IURA 4CC9A 2YNNA 2J56H 2BKLA 4MMYA 5TEEA 1I2MB 3RN0D 4PSWB 1JTDB 3UVOA 1B9YA 4ERZA 2BBKH 5HE1B 1MDAH 1U4CA 4ZOVA 4BP9A 2I3TA 4ZOXA 3EQ7A 4U7AA 3HFQA 4OZUA 2EICA 2I0TA 5HE2B 5B4WA 4X63B 1N6EA 4D9SA 4E5ZA 3PE7A 2VZ3A 4XEIC 4E54B 4GMBA 3ZDYA 4FWWA 4LG8A 1TBGA 5TEFA 5HQGA 5FLXg 3F3GA 2GNQA 2CN2A 1OLZA 3PSCB 2XE4A 5I5JA 4CY2A 4J77A 2EBSA 3NVQA 4WK0A 3RLMD 2P9IC 2HU7A 2B5NA 3DDUA 3K6SA 2HJBA 2CN3A 2QC5A 1PEVA 3BWSA 4Y7RA 2VDOA 3ZE1A 2VDMA 2H9MA 3UVNA 3I7KA 3RN1D 4WJKA 2Z2OA 4A7JA 4BP8A 3K71A 2P9PC 1TYQC 1H2XA 2Z2PA 2H6NA 4AX4A 3C75H 2B4EA 3MUNA 5E6RA 2P9NC 3VI4A 3BG0A 3SLED 4AN0A 5CXCA 5K19A 4GQ2P 1JJUB 1SQJA 2VDLA 4FAND 2IAAA 4JD2C 5EM2A 2EIBA 5THAA 4O3UB 2UZXB 3OKYA 3EQ8A 4A09A 3KCIA 3PSLA 4GGAA 1K32A 3SBRA 4H5IA 3ZDXA 3SBPA 5JWZA 2AGWA 4NBMA 4J84A 5CYKA 2H6QA 3VA6A 3IULA 2VDPA 5FKTA 4A08B 3ZE2A 5AMSA 2PM9A 5HE0B 2J55H 4GM3A 3OL2A 4DNWA 4D6VA 3DSMA 1NR0A 4JSVC 4CZVA 4LG9A 3MKQA 1PI6A 1TYEA 4K3ID 3C99A 5GSAA 1A0RB 4J73A 5HYNB 4K3JB 3UVLA 5A2Qg 5IJ8E 2AH1A 2P9LC 4L9OA 2VDNA 4N14A 4BL0A 1GOFA 2TRCB 1N6DA 4MK0B 4QRJA 3EWEA 2G99A 4E5ZB 4DNVA 3VI3A 1VE7A 4AN1A 1R5MA 3EI2A 5AFU3 2XL2A 3EI4A 3IJEA 2YNPA 3DWLC 4Z7QA 1U2VC 4A2MA 2QZPA 2CE9A 2H14A 1H2ZA 3IJCA 5H14A 1GG2B 3JZNA 2PM6B 1UOOA 3KRXB 3QHYB 4XYIA 5K1CC 5SXMA 1C9IA 2H9PA 2MTAH 2H9NA 1O6GA 2HU8A 4FA5D 1MG3A 2WQ8A 1U8CA 4UI9R 2CO0A 4RE6A 5FFOA 4FB1D 5IT9g 2H9LA 3IJ0A 5EMKB 3MMYA 4X61B 3RRMC 3IJ1A 2VZ1A 3JZGA 2B5MA 2PM7B 2UZYB 1UOQA 1YR2A 3OW8A 5FFGA 3SN6B 3T3MA 4AEZA 5M5VA 3UVKA 2H47A 4LGNA 4BCCA 1YFQA 2AGYA 2B5LA 1VE6A 5GXHA 5CXCB 4NC4A 2P9UC 3F3FA 3CFVA 2AQ5A 5EM2B 3OKYB 1XIPA 4ZOYA 4A09B 5TDHB 5E6UA 1SQ9A 5E6SA 3ZE0A 1A12A 4JSPC 5CYKB 3RSEC 4A0AA 4BUJC 4J79A 3JPXA 5C86A 4CZXA 4BCDA 3PVWB 3N0DA 5AJAA 5IJ7E 2QR5A 4L1QD 1OMWB 3OL2B 5FKQA 3EU7A 1VZ3A 2XU7A 2OVPB 4GM8A 1JMXB 3OTTA 3UKRC 5HDBA 3MUOA 1T2XA 3W15A 5M5TA 5IC7A 4A11B 5M5UA 1RI6A 4JT6C 4ES0A 4L1MA 4D0KA 2EIDA 3VH0A 3MZLA 4NENA 2YNOA 2VDRA 3O4GA 4ZOZA 2W18A 4WK4A 1E8MA 1QFSA 3EI2B 2GC7A 3O4HA 2GC4A 2IUQA 3E0CA 3EI4B 3MZKA 3KRWB 1L0QA 3ULEC 4FAVD 4O02A 1XKSA 4J0WA 4ZN4A 2I0RA 4L3GD 3VGZA 4E54A 4OWRA 3O4JA 1H2WA 2OVRB 5CXBA 3SBQA 3DM0A 3UVMA 1PGUA 2XYIA 4J86A 2I3SA 5EALA 3FCSA 3I8EA 3SXTD 4ESGA 4JHPC 2H68A 4H5JA 2BCJB 4DNUA 1L5GA 4IMMA 3B7FA 3UKUC 3I7LA 4A0BA 2J57G 4FHLA 2HKRA 3SVWD 3MKSB 4JXMA 3NVNA 3OKTA 1Q47A 4XYHA 2IUVA 3L4MD 4I79A 2HXCA 3GC3B 3A0FA 3ZWLB 2YBAA 3P4FA 5FKSA 3RFGA 1K8KC 4PXWA 4O45A 1MG2A 4J82A 4PNKB 4RE5A 3AL9A 4G55A 4TZ4A 4HDJA 3NIFA 3MXXA 4A0AB 2Q7QA 3EI3A 1QNIA 4A2LA 3QI0A 4R7AB 4NSXA 3JAMg 5H1MA 2OK4A 4KFMB 4J8GA 4MMZA 5FXYA 3OKWA 3JZHA 1O6FA 5M5SA 3EI1A 1M1XA 5EAPA 4AMYA 4WK2A 3CFSB 3I7PA 1E8NA 4QAMA 3I89A 3AH8B 5EARA 3SWSD 2XDWA 4QQEA 2P9SC 3I7HA 1GXRA 3V5WB 2HESX 3I8CA 4IRZA 4PC0A 4JT5C 3K27A 2CO0C 4O2WA 2CNXA 3C5MA 1NEXB 2O9KA 2G9AA 4U1EI 4J87A 4Y5RD 4GGDA 3N0EA 3FM0A 4JHNA 3I2NA 1JMZB 2HKMA 2JKXA 3V9FA 3SFZA 4G56B 1K3IA 3JRPA 3SCYA 5TF2A 3PXWD 4GQ1A 4J78A 4G1EA 1QFMA 4AOWA 4CZYA 2AGZA 4UM8A 4FA4D 2PM9B 3K72A 3V4PA 5FQDA 4GZ8A 2IUPA 3GD1I 3RFHA 4CI2A 4CI1A 4BCBA 3AL8A 3J81g 5EMJB 5HE3B 3RMZD 2OK6A 4GM9A 5CXBB 5C2VB 5C2WB 1E5TA 4GGCA 1PBYB 1VYHC 4X60B 4O1QD 2PBIB 3K26A 4JSNC 2Z2NA 3PXTD 1GOTB 1UTCA 2HJ4A 3I7OA 3F3PA 5FA5B 4PBZA 3I7NA 4A0BB 3IVMA 3BG1A 5EMMB 5C9ZB 4CY3A 4EWRA 5GXIA 1BPOA 4O9DA 3DXKC 3IUMA 3FRXA 4Z7NA 4CY1A
chains in the Genus database with same CATH topology
4WJKA 3ZDYA 1L5GA 3NIFA 5HDBA 2VDKA 3ZDZA 2VDPA 3NIDA 3FCUA 2VDNA 3K71A 4O02A 1U8CA 3ZE2A 5FFOA 4MMYA 5E6RA 4WK0A 3VI4A 3V4VA 3VI3A 5E6UA 5E6SA 3ZE0A 4MMZA 4MMXA 1JV2A 2VDQA 4NENA 3IJEA 1M1XA 3K6SA 2VDLA 4G1MA 4WK2A 5FFGA 4Z7QA 2VDRA 1TYEA 4UM9A 4G1EA 4Z7OA 3FCSA 3T3MA 4UM8A 2VC2A 2VDOA 3NIGA 3ZE1A 3K72A 3V4PA 4WK4A 3T3PA 2VDMA 3ZDXA 4IRZA 4Z7NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WJK A;  3ZDY A;  1L5G A;  3NIF A;  5HDB A;  2VDK A;  3ZDZ A;  2VDP A;  3NID A;  3FCU A;  2VDN A;  3K71 A;  4O02 A;  1U8C A;  3ZE2 A;  5FFO A;  4MMY A;  5E6R A;  4WK0 A;  3VI4 A;  3V4V A;  3VI3 A;  5E6U A;  5E6S A;  3ZE0 A;  4MMZ A;  4MMX A;  1JV2 A;  2VDQ A;  4NEN A;  3IJE A;  1M1X A;  3K6S A;  2VDL A;  4G1M A;  4WK2 A;  5FFG A;  4Z7Q A;  2VDR A;  1TYE A;  4UM9 A;  4G1E A;  4Z7O A;  3FCS A;  3T3M A;  4UM8 A;  2VC2 A;  2VDO A;  3NIG A;  3ZE1 A;  3K72 A;  3V4P A;  4WK4 A;  3T3P A;  2VDM A;  3ZDX A;  4IRZ A;  4Z7N A; 
#chains in the Genus database with same CATH topology
 5I5M A;  5IGO A;  3C9C A;  3IIW A;  3JRO A;  3NID A;  3IKO A;  4Z8L A;  4FA9 D;  2H3X A;  3EQ9 A;  4CI3 A;  3EG6 A;  3SMR A;  3V4V A;  3IIY A;  2IWF A;  3OF7 A;  3IUN A;  2IUR A;  3ORV D;  2YB8 B;  1JV2 A;  4X3E A;  2VDQ A;  2XL3 A;  1GOH A;  3EI3 B;  4O3T B;  5EML B;  2OVQ B;  1JOF A;  5KDO B;  5EAM A;  3EMH A;  2HYE A;  5M5R A;  3NIG A;  2HU5 A;  3AFC A;  3T3P A;  4GQB B;  3DXM C;  4CY5 A;  3GRE A;  1SHY B;  3EI1 B;  2AGL A;  3MVD K;  3CIK B;  3O4I A;  1XHM A;  3ZDZ A;  4IA9 A;  1C9L A;  3U4Y A;  2XZG A;  4ERQ A;  3SJL D;  4PBY A;  3L4O D;  4FA1 D;  5I5I A;  4JSX C;  1GP2 B;  3ODT A;  4NAA A;  2OJY A;  4G1M A;  4L3H D;  2IWK A;  3GFC A;  1VZ2 A;  1GOG A;  2H6K A;  4UM9 A;  4A11 A;  1FWX A;  1P22 A;  4Z7O A;  1B9X A;  3PXS D;  1ERJ A;  2VC2 A;  4J8B A;  4J81 A;  5FKR A;  1H2Y A;  5C92 A;  4AMZ A;  3PVU B;  2YMU A;  4ERY A;  1UOP A;  5M61 A;  2P9K C;  5H17 A;  4PSX B;  2H13 A;  3FGB A;  2VDK A;  3FCU A;  3IUQ A;  5GMK n;  1N6F A;  3JB9 L;  2CE8 A;  3J80 g;  5IGQ A;  3AL8 B;  2AH0 A;  3V7D B;  2AGX A;  2EIE A;  4J0X A;  3IUJ A;  4MMX A;  2OIZ A;  4QT8 A;  3SHF A;  4CI8 A;  2QXV A;  2I0S A;  4YVD A;  4A08 A;  3NVX A;  1S4U X;  3UR4 A;  4QL1 A;  4BH6 A;  3IUR A;  4CC9 A;  2YNN A;  2J56 H;  2BKL A;  4MMY A;  5TEE A;  1I2M B;  3RN0 D;  4PSW B;  1JTD B;  3UVO A;  1B9Y A;  4ERZ A;  2BBK H;  5HE1 B;  1MDA H;  1U4C A;  4ZOV A;  4BP9 A;  2I3T A;  4ZOX A;  3EQ7 A;  4U7A A;  3HFQ A;  4OZU A;  2EIC A;  2I0T A;  5HE2 B;  5B4W A;  4X63 B;  1N6E A;  4D9S A;  4E5Z A;  3PE7 A;  2VZ3 A;  4XEI C;  4E54 B;  4GMB A;  3ZDY A;  4FWW A;  4LG8 A;  1TBG A;  5TEF A;  5HQG A;  5FLX g;  3F3G A;  2GNQ A;  2CN2 A;  1OLZ A;  3PSC B;  2XE4 A;  5I5J A;  4CY2 A;  4J77 A;  2EBS A;  3NVQ A;  4WK0 A;  3RLM D;  2P9I C;  2HU7 A;  2B5N A;  3DDU A;  3K6S A;  2HJB A;  2CN3 A;  2QC5 A;  1PEV A;  3BWS A;  4Y7R A;  2VDO A;  3ZE1 A;  2VDM A;  2H9M A;  3UVN A;  3I7K A;  3RN1 D;  4WJK A;  2Z2O A;  4A7J A;  4BP8 A;  3K71 A;  2P9P C;  1TYQ C;  1H2X A;  2Z2P A;  2H6N A;  4AX4 A;  3C75 H;  2B4E A;  3MUN A;  5E6R A;  2P9N C;  3VI4 A;  3BG0 A;  3SLE D;  4AN0 A;  5CXC A;  5K19 A;  4GQ2 P;  1JJU B;  1SQJ A;  2VDL A;  4FAN D;  2IAA A;  4JD2 C;  5EM2 A;  2EIB A;  5THA A;  4O3U B;  2UZX B;  3OKY A;  3EQ8 A;  4A09 A;  3KCI A;  3PSL A;  4GGA A;  1K32 A;  3SBR A;  4H5I A;  3ZDX A;  3SBP A;  5JWZ A;  2AGW A;  4NBM A;  4J84 A;  5CYK A;  2H6Q A;  3VA6 A;  3IUL A;  2VDP A;  5FKT A;  4A08 B;  3ZE2 A;  5AMS A;  2PM9 A;  5HE0 B;  2J55 H;  4GM3 A;  3OL2 A;  4DNW A;  4D6V A;  3DSM A;  1NR0 A;  4JSV C;  4CZV A;  4LG9 A;  3MKQ A;  1PI6 A;  1TYE A;  4K3I D;  3C99 A;  5GSA A;  1A0R B;  4J73 A;  5HYN B;  4K3J B;  3UVL A;  5A2Q g;  5IJ8 E;  2AH1 A;  2P9L C;  4L9O A;  2VDN A;  4N14 A;  4BL0 A;  1GOF A;  2TRC B;  1N6D A;  4MK0 B;  4QRJ A;  3EWE A;  2G99 A;  4E5Z B;  4DNV A;  3VI3 A;  1VE7 A;  4AN1 A;  1R5M A;  3EI2 A;  5AFU 3;  2XL2 A;  3EI4 A;  3IJE A;  2YNP A;  3DWL C;  4Z7Q A;  1U2V C;  4A2M A;  2QZP A;  2CE9 A;  2H14 A;  1H2Z A;  3IJC A;  5H14 A;  1GG2 B;  3JZN A;  2PM6 B;  1UOO A;  3KRX B;  3QHY B;  4XYI A;  5K1C C;  5SXM A;  1C9I A;  2H9P A;  2MTA H;  2H9N A;  1O6G A;  2HU8 A;  4FA5 D;  1MG3 A;  2WQ8 A;  1U8C A;  4UI9 R;  2CO0 A;  4RE6 A;  5FFO A;  4FB1 D;  5IT9 g;  2H9L A;  3IJ0 A;  5EMK B;  3MMY A;  4X61 B;  3RRM C;  3IJ1 A;  2VZ1 A;  3JZG A;  2B5M A;  2PM7 B;  2UZY B;  1UOQ A;  1YR2 A;  3OW8 A;  5FFG A;  3SN6 B;  3T3M A;  4AEZ A;  5M5V A;  3UVK A;  2H47 A;  4LGN A;  4BCC A;  1YFQ A;  2AGY A;  2B5L A;  1VE6 A;  5GXH A;  5CXC B;  4NC4 A;  2P9U C;  3F3F A;  3CFV A;  2AQ5 A;  5EM2 B;  3OKY B;  1XIP A;  4ZOY A;  4A09 B;  5TDH B;  5E6U A;  1SQ9 A;  5E6S A;  3ZE0 A;  1A12 A;  4JSP C;  5CYK B;  3RSE C;  4A0A A;  4BUJ C;  4J79 A;  3JPX A;  5C86 A;  4CZX A;  4BCD A;  3PVW B;  3N0D A;  5AJA A;  5IJ7 E;  2QR5 A;  4L1Q D;  1OMW B;  3OL2 B;  5FKQ A;  3EU7 A;  1VZ3 A;  2XU7 A;  2OVP B;  4GM8 A;  1JMX B;  3OTT A;  3UKR C;  5HDB A;  3MUO A;  1T2X A;  3W15 A;  5M5T A;  5IC7 A;  4A11 B;  5M5U A;  1RI6 A;  4JT6 C;  4ES0 A;  4L1M A;  4D0K A;  2EID A;  3VH0 A;  3MZL A;  4NEN A;  2YNO A;  2VDR A;  3O4G A;  4ZOZ A;  2W18 A;  4WK4 A;  1E8M A;  1QFS A;  3EI2 B;  2GC7 A;  3O4H A;  2GC4 A;  2IUQ A;  3E0C A;  3EI4 B;  3MZK A;  3KRW B;  1L0Q A;  3ULE C;  4FAV D;  4O02 A;  1XKS A;  4J0W A;  4ZN4 A;  2I0R A;  4L3G D;  3VGZ A;  4E54 A;  4OWR A;  3O4J A;  1H2W A;  2OVR B;  5CXB A;  3SBQ A;  3DM0 A;  3UVM A;  1PGU A;  2XYI A;  4J86 A;  2I3S A;  5EAL A;  3FCS A;  3I8E A;  3SXT D;  4ESG A;  4JHP C;  2H68 A;  4H5J A;  2BCJ B;  4DNU A;  1L5G A;  4IMM A;  3B7F A;  3UKU C;  3I7L A;  4A0B A;  2J57 G;  4FHL A;  2HKR A;  3SVW D;  3MKS B;  4JXM A;  3NVN A;  3OKT A;  1Q47 A;  4XYH A;  2IUV A;  3L4M D;  4I79 A;  2HXC A;  3GC3 B;  3A0F A;  3ZWL B;  2YBA A;  3P4F A;  5FKS A;  3RFG A;  1K8K C;  4PXW A;  4O45 A;  1MG2 A;  4J82 A;  4PNK B;  4RE5 A;  3AL9 A;  4G55 A;  4TZ4 A;  4HDJ A;  3NIF A;  3MXX A;  4A0A B;  2Q7Q A;  3EI3 A;  1QNI A;  4A2L A;  3QI0 A;  4R7A B;  4NSX A;  3JAM g;  5H1M A;  2OK4 A;  4KFM B;  4J8G A;  4MMZ A;  5FXY A;  3OKW A;  3JZH A;  1O6F A;  5M5S A;  3EI1 A;  1M1X A;  5EAP A;  4AMY A;  4WK2 A;  3CFS B;  3I7P A;  1E8N A;  4QAM A;  3I89 A;  3AH8 B;  5EAR A;  3SWS D;  2XDW A;  4QQE A;  2P9S C;  3I7H A;  1GXR A;  3V5W B;  2HES X;  3I8C A;  4IRZ A;  4PC0 A;  4JT5 C;  3K27 A;  2CO0 C;  4O2W A;  2CNX A;  3C5M A;  1NEX B;  2O9K A;  2G9A A;  4U1E I;  4J87 A;  4Y5R D;  4GGD A;  3N0E A;  3FM0 A;  4JHN A;  3I2N A;  1JMZ B;  2HKM A;  2JKX A;  3V9F A;  3SFZ A;  4G56 B;  1K3I A;  3JRP A;  3SCY A;  5TF2 A;  3PXW D;  4GQ1 A;  4J78 A;  4G1E A;  1QFM A;  4AOW A;  4CZY A;  2AGZ A;  4UM8 A;  4FA4 D;  2PM9 B;  3K72 A;  3V4P A;  5FQD A;  4GZ8 A;  2IUP A;  3GD1 I;  3RFH A;  4CI2 A;  4CI1 A;  4BCB A;  3AL8 A;  3J81 g;  5EMJ B;  5HE3 B;  3RMZ D;  2OK6 A;  4GM9 A;  5CXB B;  5C2V B;  5C2W B;  1E5T A;  4GGC A;  1PBY B;  1VYH C;  4X60 B;  4O1Q D;  2PBI B;  3K26 A;  4JSN C;  2Z2N A;  3PXT D;  1GOT B;  1UTC A;  2HJ4 A;  3I7O A;  3F3P A;  5FA5 B;  4PBZ A;  3I7N A;  4A0B B;  3IVM A;  3BG1 A;  5EMM B;  5C9Z B;  4CY3 A;  4EWR A;  5GXI A;  1BPO A;  4O9D A;  3DXK C;  3IUM A;  3FRX A;  4Z7N A;  4CY1 A; 
#chains in the Genus database with same CATH homology
 4WJK A;  3ZDY A;  1L5G A;  3NIF A;  5HDB A;  2VDK A;  3ZDZ A;  2VDP A;  3NID A;  3FCU A;  2VDN A;  3K71 A;  4O02 A;  1U8C A;  3ZE2 A;  5FFO A;  4MMY A;  5E6R A;  4WK0 A;  3VI4 A;  3V4V A;  3VI3 A;  5E6U A;  5E6S A;  3ZE0 A;  4MMZ A;  4MMX A;  1JV2 A;  2VDQ A;  4NEN A;  3IJE A;  1M1X A;  3K6S A;  2VDL A;  4G1M A;  4WK2 A;  5FFG A;  4Z7Q A;  2VDR A;  1TYE A;  4UM9 A;  4G1E A;  4Z7O A;  3FCS A;  3T3M A;  4UM8 A;  2VC2 A;  2VDO A;  3NIG A;  3ZE1 A;  3K72 A;  3V4P A;  4WK4 A;  3T3P A;  2VDM A;  3ZDX A;  4IRZ A;  4Z7N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...