3UVMA

Crystal structure of wdr5 in complex with the wdr5-interacting motif of mll4
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
304
structure length
304
Chain Sequence
VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords WD repeat-containing protein 5
publication title The plasticity of WDR5 peptide-binding cleft enables the binding of the SET1 family of histone methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
total genus 103
structure length 304
sequence length 304
ec nomenclature
pdb deposition date 2011-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3uvmA00
1PI6A 4J77A 3P4FA 3VGZA 3RFHA 1ERJA 4E54A 3EU7A 2IUQA 3OKYB 5CYKA 4CC9A 2IUVA 3UVMA 2P9UC 5HQGA 2HJBA 2H47A 4ZOXA 4ESGA 3JZNA 2CNXA 5TDHB 2YNPA 3SMRA 2CE9A 2OK6A 5TEFA 5EMMB 3OL2A 1TBGA 2GNQA 1SHYB 3IKOA 5IGOA 3BWSA 4CI2A 3I7OA 5EAMA 4FWWA 4I79A 2Q7QA 4H5JA 3I7KA 4QT8A 3PSLA 4XEIC 3IJ0A 2P9KC 1MG3A 4J8GA 2I0RA 2H9LA 3C75H 3SBQA 4GQ1A 4FA1D 4L3HD 5FKSA 1R5MA 1MDAH 1OLZA 2PM7B 4EWRA 2P9NC 3RLMD 2CN3A 2XL3A 4J8BA 4J79A 4FAVD 2XYIA 3I7NA 5EAPA 4CZXA 1VYHC 3AH8B 5FKRA 4A0BA 3EI1B 4R7AB 5IJ8E 3K26A 3SCYA 4A08A 2HXCA 4ZN4A 3OW8A 3V7DB 2J57G 3DXKC 2HJ4A 3IJ1A 3NVXA 1TYQC 3EI2A 5CXCA 5IT9g 5CXCB 5K19A 3ZWLB 3GREA 4GGDA 3HFQA 4A0AA 2OVQB 3U4YA 4E5ZA 2AGXA 3BG0A 3EWEA 4OWRA 4J87A 4CZYA 5HYNB 2PM9B 4J78A 2Z2PA 5THAA 2H14A 3DSMA 5H17A 2P9PC 3JROA 3UKRC 1XKSA 4JSVC 4U1EI 5SXMA 2AQ5A 2AGLA 3UVNA 5HE1B 3SBRA 3EMHA 3I7PA 1PEVA 5AMSA 4X61B 3ULEC 4J82A 4J84A 4O3UB 3EG6A 5CXBB 3PVUB 5IC7A 4IMMA 2W18A 1B9YA 5EARA 2H6NA 2I3SA 3PXTD 3OKYA 5GMKn 3IIYA 5HE2B 3KRWB 2PM6B 3DM0A 3N0EA 1JOFA 1SQ9A 4FAND 1N6DA 2YB8B 3EI4B 4A2MA 2OIZA 2IAAA 3EI3B 4A7JA 3C99A 4CI3A 3NVQA 5HE3B 3CFVA 3CFSB 2UZXB 2B4EA 3V5WB 5IGQA 2YBAA 5FKQA 3F3GA 2UZYB 2P9IC 1B9XA 3SVWD 1K32A 2I0SA 3IIWA 5H14A 3SFZA 4D6VA 2J55H 4ERYA 4CI8A 2I3TA 3IJCA 3I8CA 2AGYA 1Q47A 3I2NA 3BG1A 4A2LA 3A0FA 3PSCB 3OKTA 2B5NA 2OJYA 3UVKA 5EM2B 4JD2C 5EMKB 5TF2A 2H68A 3MKQA 5GXIA 4GQ2P 5I5JA 5KDOB 1K8KC 2H9MA 4BL0A 2GC4A 4CI1A 5B4WA 3ORVD 1NEXB 3MZLA 3I89A 4G56B 3JZHA 4ZOVA 4OZUA 5K1CC 4O1QD 5I5MA 2HYEA 3EI1A 2HKRA 2YMUA 3I7LA 4TZ4A 4J86A 4JSXC 4JT6C 3I8EA 3B7FA 3DXMC 2CE8A 3PVWB 4JSNC 3SWSD 4CZVA 4K3JB 3N0DA 4ES0A 4CY5A 2YNNA 5FXYA 4QRJA 3E0CA 1JJUB 1NR0A 2P9LC 4GM8A 4CY1A 3FM0A 1S4UX 4IA9A 3L4OD 4GM3A 3W15A 2AH1A 1GXRA 2XL2A 4A09B 5EALA 4Y5RD 2H9NA 3F3FA 4GGCA 2PM9A 2OVPB 5TEEA 3I7HA 2BBKH 3UKUC 1JMZB 3RRMC 4QL1A 3NVNA 1N6FA 4GM9A 4PC0A 5H1MA 3AL8B 4FA4D 3RSEC 4AOWA 2IWFA 4GGAA 4PSWB 5CXBA 4ZOZA 5FA5B 2EBSA 5AFU3 4GZ8A 1MG2A 2IWKA 3JRPA 3UR4A 3EI4A 3PXWD 3UVOA 3EI3A 3JZGA 3SJLD 3VA6A 3KRXB 4A11B 3JAMg 2H3XA 3C9CA 4K3ID 3SLED 4XYHA 4CY2A 4KFMB 4L9OA 4LG9A 2P9SC 4GQBB 4JT5C 3V9FA 4PBZA 4FA9D 1SQJA 5FQDA 4X60B 1GP2B 1QNIA 4E54B 2MTAH 4ERQA 5CYKB 3F3PA 5HE0B 4BUJC 4Y7RA 5IJ7E 3PE7A 4D0KA 2XU7A 4GMBA 1XIPA 4J0XA 3RN1D 5EM2A 3AL9A 3FGBA 2B5MA 3FRXA 4FB1D 2H6QA 1GG2B 4O45A 2J56H 1U2VC 2AGZA 3MKSB 5EMJB 3SHFA 4CY3A 4UI9R 3C5MA 4PBYA 4YVDA 4XYIA 3OL2B 3RN0D 2TRCB 4O9DA 3PXSD 4X63B 2I0TA 4MK0B 5C2WB 5FKTA 3ODTA 2Z2OA 3JPXA 4NSXA 3J81g 4L1QD 2BCJB 3SN6B 1XHMA 5EMLB 2QC5A 1N6EA 1PGUA 4QQEA 4FA5D 2G9AA 2CO0A 2IURA 4LG8A 3CIKB 2CO0C 4ZOYA 3JB9L 5C9ZB 1PBYB 3RMZD 4N14A 3MMYA 2OK4A 4ERZA 1OMWB 2G99A 1U4CA 4U7AA 2H13A 2YNOA 2OVRB 4A0BB 1YFQA 4A09A 1GOTB 4PSXB 2PBIB 4J81A 4L3GD 4JSPC 2Z2NA 3UVLA 4A08B 2QXVA 3AL8A 5GSAA 5GXHA 3K27A 1L0QA 2AH0A 5FLXg 1P22A 3EI2B 4J73A 3L4MD 2H9PA 4FHLA 3RFGA 1RI6A 2B5LA 4J0WA 4X3EA 4LGNA 4HDJA 3OTTA 5C2VB 4A0AB 4O3TB 2IUPA 4E5ZB 2H6KA 3MXXA 2HKMA 3MZKA 3SBPA 5A2Qg 1JMXB 4H5IA 4PNKB 3VH0A 2GC7A 3DWLC 5AJAA 4PXWA 5I5IA 5JWZA 4BH6A 2O9KA 1FWXA 4A11A 3AFCA 2AGWA 4JXMA 2HESX 3SXTD 4Z8LA 3GFCA 3J80g 4AEZA 1A0RB 3OKWA 2CN2A
chains in the Genus database with same CATH superfamily
3ZDXA 1PI6A 3IUJA 3P4FA 4J77A 3VGZA 3RFHA 1ERJA 4E54A 3EU7A 2IUQA 3OKYB 5CYKA 4CC9A 2BKLA 4RE5A 2IUVA 3V4VA 3UVMA 2P9UC 5HQGA 2HJBA 2H47A 4ZOXA 3OF7A 4ESGA 3JZNA 2CNXA 3MUOA 5TDHB 3ZDYA 2YNPA 3SMRA 4NC4A 2CE9A 1L5GA 2OK6A 5TEFA 5EMMB 4O02A 3OL2A 1TBGA 3T3PA 2GNQA 1SHYB 3MUNA 3IKOA 5IGOA 3BWSA 4CI2A 3I7OA 5EAMA 4FWWA 4I79A 2Q7QA 4H5JA 3I7KA 4QT8A 2VDMA 3PSLA 4XEIC 3IJ0A 3MVDK 2P9KC 1MG3A 4J8GA 3IUQA 2I0RA 2H9LA 3C75H 3SBQA 4GQ1A 4FA1D 4L3HD 5FKSA 3VI3A 1T2XA 4UM9A 1R5MA 1MDAH 1OLZA 2PM7B 4EWRA 2P9NC 3RLMD 2CN3A 3O4JA 2XL3A 4J8BA 4J79A 4FAVD 2XYIA 3I7NA 5EAPA 1I2MB 4BCDA 4CZXA 1K3IA 1VYHC 1UOQA 3AH8B 1E8NA 5FKRA 4A0BA 2HU8A 3EI1B 4R7AB 2JKXA 5IJ8E 3K26A 3SCYA 4A08A 3EQ9A 2HXCA 4ZN4A 3OW8A 3V7DB 4DNVA 2J57G 3DXKC 2HJ4A 3IJ1A 3NVXA 3EQ8A 3GC3B 1TYQC 3EI2A 5CXCA 5IT9g 2VDLA 5CXCB 5K19A 1O6GA 3ZWLB 1YR2A 3GREA 4GGDA 1GOHA 5M5UA 3HFQA 4A0AA 2OVQB 3U4YA 4E5ZA 2AGXA 3BG0A 3EWEA 4OWRA 4J87A 2EIBA 1O6FA 3IVMA 4CZYA 5HYNB 2PM9B 5M5SA 4J78A 2Z2PA 5THAA 3O4IA 2H14A 3DSMA 5E6RA 2EICA 5H17A 2P9PC 3JROA 3UKRC 1XKSA 4G1MA 2XE4A 4JSVC 4U1EI 5SXMA 2AQ5A 2AGLA 3UVNA 5HE1B 1H2WA 3SBRA 3EMHA 3I7PA 1PEVA 5AMSA 4X61B 3ULEC 4J82A 4J84A 4O3UB 3EG6A 5CXBB 3PVUB 5IC7A 4IMMA 2W18A 1B9YA 1QFMA 2HU5A 2H6NA 5EARA 2I3SA 1UOPA 3PXTD 3OKYA 5GMKn 3IIYA 5HE2B 3KRWB 2PM6B 3DM0A 1E5TA 3N0EA 1JOFA 1SQ9A 4FAND 1N6DA 2YB8B 3IJEA 4Z7OA 3EI4B 3ZDZA 4A2MA 4AMZA 2OIZA 2IAAA 3EI3B 4JHPC 4A7JA 3C99A 4CI3A 3DDUA 3NVQA 5HE3B 3CFVA 3CFSB 4L1MA 3K71A 3FCUA 2UZXB 2B4EA 3V5WB 5IGQA 2YBAA 5FKQA 3O4HA 3F3GA 2UZYB 2P9IC 1B9XA 3NIFA 3SVWD 2VZ3A 1K32A 2I0SA 3IIWA 5E6UA 5H14A 3SFZA 4D6VA 1C9LA 4IRZA 2J55H 4BP9A 4ERYA 4CI8A 2I3TA 3IJCA 3I8CA 2AGYA 1Q47A 2VDOA 5M5VA 3I2NA 3BG1A 4A2LA 3A0FA 3PSCB 3OKTA 2B5NA 2OJYA 3UVKA 5EM2B 4JD2C 5EMKB 5E6SA 5TF2A 2H68A 3MKQA 5GXIA 4GQ2P 5I5JA 5KDOB 2EIEA 1K8KC 2H9MA 4BL0A 2GC4A 4AMYA 4CI1A 5B4WA 3ORVD 1NEXB 3MZLA 3I89A 4G56B 2XZGA 3JZHA 4ZOVA 4OZUA 5K1CC 4O1QD 3ZE0A 5I5MA 4BP8A 2HYEA 3EI1A 1H2YA 2HKRA 4JHNA 2YMUA 1H2ZA 3I7LA 4TZ4A 4J86A 4JSXC 4JT6C 3I8EA 3ZE2A 2XDWA 3B7FA 2CE8A 3DXMC 3PVWB 4JSNC 3SWSD 4CZVA 4G55A 4K3JB 4AX4A 3N0DA 4ES0A 3NIDA 4CY5A 2YNNA 5FXYA 4QRJA 2VDRA 3E0CA 1JJUB 1NR0A 1GOGA 2P9LC 4D9SA 4GM8A 4CY1A 3FM0A 3FCSA 1S4UX 4IA9A 1VE7A 3L4OD 1VE6A 1VZ2A 4GM3A 3W15A 2AH1A 1GXRA 2XL2A 4DNWA 4A09B 5EALA 4Y5RD 2H9NA 3F3FA 4GGCA 2PM9A 2OVPB 5TEEA 3I7HA 2BBKH 3UKUC 1JMZB 4MMZA 3RRMC 4QL1A 3NVNA 1N6FA 4GM9A 4PC0A 5H1MA 3AL8B 1JTDB 3IUNA 4FA4D 3RSEC 4AOWA 4G1EA 2IWFA 5M5RA 2EIDA 1QFSA 4GGAA 4PSWB 3V4PA 5CXBA 4ZOZA 5FA5B 2EBSA 5AFU3 3K72A 4GZ8A 3ZE1A 1UTCA 1MG2A 2IWKA 1H2XA 4Z7QA 3JRPA 3UR4A 3EI4A 3PXWD 3UVOA 3K6SA 3EI3A 3JZGA 3SJLD 3VA6A 3KRXB 4AN0A 1UOOA 4Z7NA 4A11B 5FFOA 3JAMg 2H3XA 3C9CA 4K3ID 3SLED 2VC2A 4XYHA 4CY2A 2VDKA 4KFMB 3O4GA 4L9OA 4LG9A 2P9SC 4GQBB 4JT5C 4QAMA 3V9FA 4PBZA 4FA9D 1SQJA 5FQDA 4X60B 4DNUA 1GP2B 1QNIA 4E54B 2MTAH 4ERQA 5CYKB 3F3PA 3IUMA 5HE0B 4BUJC 3T3MA 4Y7RA 5IJ7E 3PE7A 4D0KA 2XU7A 4GMBA 1XIPA 4J0XA 3RN1D 5EM2A 3AL9A 3FGBA 4MMXA 2B5MA 2VZ1A 2VDPA 3FRXA 4FB1D 2H6QA 1GG2B 4O45A 2J56H 1U2VC 2AGZA 3MKSB 5EMJB 3SHFA 4CY3A 4UI9R 3C5MA 4PBYA 4UM8A 4YVDA 4NBMA 4XYIA 5FFGA 2VDNA 3OL2B 3RN0D 2TRCB 2VDQA 4O9DA 3PXSD 4X63B 2I0TA 5C86A 4MK0B 5C2WB 5FKTA 3ODTA 2Z2OA 3JPXA 4NSXA 3J81g 1U8CA 4L1QD 4O2WA 2BCJB 3GD1I 3SN6B 1XHMA 4WJKA 5EMLB 2QC5A 4WK4A 1N6EA 1PGUA 4QQEA 4FA5D 2QZPA 2G9AA 1A12A 2CO0A 2IURA 4LG8A 3CIKB 1TYEA 2CO0C 4ZOYA 2HU7A 3JB9L 5C9ZB 1PBYB 3RMZD 4N14A 3MMYA 4NENA 2OK4A 4ERZA 1OMWB 2G99A 1U4CA 4U7AA 2H13A 3VI4A 2YNOA 2OVRB 3KCIA 4A0BB 3NIGA 1BPOA 1YFQA 4A09A 1GOTB 3EQ7A 2PBIB 4PSXB 4J81A 4L3GD 4JSPC 2Z2NA 1E8MA 3UVLA 4A08B 2QR5A 4NAAA 4RE6A 2QXVA 3AL8A 5GSAA 5GXHA 3K27A 1L0QA 2AH0A 1M1XA 5FLXg 1P22A 3EI2B 1GOFA 4J73A 3IURA 1JV2A 3L4MD 2H9PA 5M61A 5HDBA 4FHLA 3RFGA 4BCCA 3IULA 1RI6A 2B5LA 4J0WA 4X3EA 4AN1A 4LGNA 4HDJA 3OTTA 5C2VB 4A0AB 1C9IA 4WK2A 4O3TB 2IUPA 4E5ZB 3QHYB 2WQ8A 2H6KA 3MXXA 1VZ3A 4MMYA 4BCBA 2HKMA 3MZKA 5C92A 4WK0A 3SBPA 5A2Qg 1JMXB 4H5IA 4PNKB 3VH0A 2GC7A 3DWLC 5AJAA 4PXWA 5I5IA 5JWZA 4BH6A 2O9KA 1FWXA 4A11A 3AFCA 2AGWA 4JXMA 5M5TA 2HESX 3SXTD 4Z8LA 3GFCA 3J80g 3QI0A 4AEZA 1A0RB 3OKWA 2CN2A
chains in the Genus database with same CATH topology
1PI6A 4J77A 3P4FA 3VGZA 3RFHA 1ERJA 4E54A 3EU7A 2IUQA 3OKYB 5CYKA 4CC9A 2IUVA 3UVMA 2P9UC 5HQGA 2HJBA 2H47A 4ZOXA 4ESGA 3JZNA 2CNXA 5TDHB 2YNPA 3SMRA 2CE9A 2OK6A 5TEFA 5EMMB 3OL2A 1TBGA 2GNQA 1SHYB 3IKOA 5IGOA 3BWSA 4CI2A 3I7OA 5EAMA 4FWWA 4I79A 2Q7QA 4H5JA 3I7KA 4QT8A 3PSLA 4XEIC 3IJ0A 2P9KC 1MG3A 4J8GA 2I0RA 2H9LA 3C75H 3SBQA 4GQ1A 4FA1D 4L3HD 5FKSA 1R5MA 1MDAH 1OLZA 2PM7B 4EWRA 2P9NC 3RLMD 2CN3A 2XL3A 4J8BA 4J79A 4FAVD 2XYIA 3I7NA 5EAPA 4CZXA 1VYHC 3AH8B 5FKRA 4A0BA 3EI1B 4R7AB 5IJ8E 3K26A 3SCYA 4A08A 2HXCA 4ZN4A 3OW8A 3V7DB 2J57G 3DXKC 2HJ4A 3IJ1A 3NVXA 1TYQC 3EI2A 5CXCA 5IT9g 5CXCB 5K19A 3ZWLB 3GREA 4GGDA 3HFQA 4A0AA 2OVQB 3U4YA 4E5ZA 2AGXA 3BG0A 3EWEA 4OWRA 4J87A 4CZYA 5HYNB 2PM9B 4J78A 2Z2PA 5THAA 2H14A 3DSMA 5H17A 2P9PC 3JROA 3UKRC 1XKSA 4JSVC 4U1EI 5SXMA 2AQ5A 2AGLA 3UVNA 5HE1B 3SBRA 3EMHA 3I7PA 1PEVA 5AMSA 4X61B 3ULEC 4J82A 4J84A 4O3UB 3EG6A 5CXBB 3PVUB 5IC7A 4IMMA 2W18A 1B9YA 5EARA 2H6NA 2I3SA 3PXTD 3OKYA 5GMKn 3IIYA 5HE2B 3KRWB 2PM6B 3DM0A 3N0EA 1JOFA 1SQ9A 4FAND 1N6DA 2YB8B 3EI4B 4A2MA 2OIZA 2IAAA 3EI3B 4A7JA 3C99A 4CI3A 3NVQA 5HE3B 3CFVA 3CFSB 2UZXB 2B4EA 3V5WB 5IGQA 2YBAA 5FKQA 3F3GA 2UZYB 2P9IC 1B9XA 3SVWD 1K32A 2I0SA 3IIWA 5H14A 3SFZA 4D6VA 2J55H 4ERYA 4CI8A 2I3TA 3IJCA 3I8CA 2AGYA 1Q47A 3I2NA 3BG1A 4A2LA 3A0FA 3PSCB 3OKTA 2B5NA 2OJYA 3UVKA 5EM2B 4JD2C 5EMKB 5TF2A 2H68A 3MKQA 5GXIA 4GQ2P 5I5JA 5KDOB 1K8KC 2H9MA 4BL0A 2GC4A 4CI1A 5B4WA 3ORVD 1NEXB 3MZLA 3I89A 4G56B 3JZHA 4ZOVA 4OZUA 5K1CC 4O1QD 5I5MA 2HYEA 3EI1A 2HKRA 2YMUA 3I7LA 4TZ4A 4J86A 4JSXC 4JT6C 3I8EA 3B7FA 3DXMC 2CE8A 3PVWB 4JSNC 3SWSD 4CZVA 4K3JB 3N0DA 4ES0A 4CY5A 2YNNA 5FXYA 4QRJA 3E0CA 1JJUB 1NR0A 2P9LC 4GM8A 4CY1A 3FM0A 1S4UX 4IA9A 3L4OD 4GM3A 3W15A 2AH1A 1GXRA 2XL2A 4A09B 5EALA 4Y5RD 2H9NA 3F3FA 4GGCA 2PM9A 2OVPB 5TEEA 3I7HA 2BBKH 3UKUC 1JMZB 3RRMC 4QL1A 3NVNA 1N6FA 4GM9A 4PC0A 5H1MA 3AL8B 4FA4D 3RSEC 4AOWA 2IWFA 4GGAA 4PSWB 5CXBA 4ZOZA 5FA5B 2EBSA 5AFU3 4GZ8A 1MG2A 2IWKA 3JRPA 3UR4A 3EI4A 3PXWD 3UVOA 3EI3A 3JZGA 3SJLD 3VA6A 3KRXB 4A11B 3JAMg 2H3XA 3C9CA 4K3ID 3SLED 4XYHA 4CY2A 4KFMB 4L9OA 4LG9A 2P9SC 4GQBB 4JT5C 3V9FA 4PBZA 4FA9D 1SQJA 5FQDA 4X60B 1GP2B 1QNIA 4E54B 2MTAH 4ERQA 5CYKB 3F3PA 5HE0B 4BUJC 4Y7RA 5IJ7E 3PE7A 4D0KA 2XU7A 4GMBA 1XIPA 4J0XA 3RN1D 5EM2A 3AL9A 3FGBA 2B5MA 3FRXA 4FB1D 2H6QA 1GG2B 4O45A 2J56H 1U2VC 2AGZA 3MKSB 5EMJB 3SHFA 4CY3A 4UI9R 3C5MA 4PBYA 4YVDA 4XYIA 3OL2B 3RN0D 2TRCB 4O9DA 3PXSD 4X63B 2I0TA 4MK0B 5C2WB 5FKTA 3ODTA 2Z2OA 3JPXA 4NSXA 3J81g 4L1QD 2BCJB 3SN6B 1XHMA 5EMLB 2QC5A 1N6EA 1PGUA 4QQEA 4FA5D 2G9AA 2CO0A 2IURA 4LG8A 3CIKB 2CO0C 4ZOYA 3JB9L 5C9ZB 1PBYB 3RMZD 4N14A 3MMYA 2OK4A 4ERZA 1OMWB 2G99A 1U4CA 4U7AA 2H13A 2YNOA 2OVRB 4A0BB 1YFQA 4A09A 1GOTB 4PSXB 2PBIB 4J81A 4L3GD 4JSPC 2Z2NA 3UVLA 4A08B 2QXVA 3AL8A 5GSAA 5GXHA 3K27A 1L0QA 2AH0A 5FLXg 1P22A 3EI2B 4J73A 3L4MD 2H9PA 4FHLA 3RFGA 1RI6A 2B5LA 4J0WA 4X3EA 4LGNA 4HDJA 3OTTA 5C2VB 4A0AB 4O3TB 2IUPA 4E5ZB 2H6KA 3MXXA 2HKMA 3MZKA 3SBPA 5A2Qg 1JMXB 4H5IA 4PNKB 3VH0A 2GC7A 3DWLC 5AJAA 4PXWA 5I5IA 5JWZA 4BH6A 2O9KA 1FWXA 4A11A 3AFCA 2AGWA 4JXMA 2HESX 3SXTD 4Z8LA 3GFCA 3J80g 4AEZA 1A0RB 3OKWA 2CN2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PI6 A;  4J77 A;  3P4F A;  3VGZ A;  3RFH A;  1ERJ A;  4E54 A;  3EU7 A;  2IUQ A;  3OKY B;  5CYK A;  4CC9 A;  2IUV A;  3UVM A;  2P9U C;  5HQG A;  2HJB A;  2H47 A;  4ZOX A;  4ESG A;  3JZN A;  2CNX A;  5TDH B;  2YNP A;  3SMR A;  2CE9 A;  2OK6 A;  5TEF A;  5EMM B;  3OL2 A;  1TBG A;  2GNQ A;  1SHY B;  3IKO A;  5IGO A;  3BWS A;  4CI2 A;  3I7O A;  5EAM A;  4FWW A;  4I79 A;  2Q7Q A;  4H5J A;  3I7K A;  4QT8 A;  3PSL A;  4XEI C;  3IJ0 A;  2P9K C;  1MG3 A;  4J8G A;  2I0R A;  2H9L A;  3C75 H;  3SBQ A;  4GQ1 A;  4FA1 D;  4L3H D;  5FKS A;  1R5M A;  1MDA H;  1OLZ A;  2PM7 B;  4EWR A;  2P9N C;  3RLM D;  2CN3 A;  2XL3 A;  4J8B A;  4J79 A;  4FAV D;  2XYI A;  3I7N A;  5EAP A;  4CZX A;  1VYH C;  3AH8 B;  5FKR A;  4A0B A;  3EI1 B;  4R7A B;  5IJ8 E;  3K26 A;  3SCY A;  4A08 A;  2HXC A;  4ZN4 A;  3OW8 A;  3V7D B;  2J57 G;  3DXK C;  2HJ4 A;  3IJ1 A;  3NVX A;  1TYQ C;  3EI2 A;  5CXC A;  5IT9 g;  5CXC B;  5K19 A;  3ZWL B;  3GRE A;  4GGD A;  3HFQ A;  4A0A A;  2OVQ B;  3U4Y A;  4E5Z A;  2AGX A;  3BG0 A;  3EWE A;  4OWR A;  4J87 A;  4CZY A;  5HYN B;  2PM9 B;  4J78 A;  2Z2P A;  5THA A;  2H14 A;  3DSM A;  5H17 A;  2P9P C;  3JRO A;  3UKR C;  1XKS A;  4JSV C;  4U1E I;  5SXM A;  2AQ5 A;  2AGL A;  3UVN A;  5HE1 B;  3SBR A;  3EMH A;  3I7P A;  1PEV A;  5AMS A;  4X61 B;  3ULE C;  4J82 A;  4J84 A;  4O3U B;  3EG6 A;  5CXB B;  3PVU B;  5IC7 A;  4IMM A;  2W18 A;  1B9Y A;  5EAR A;  2H6N A;  2I3S A;  3PXT D;  3OKY A;  5GMK n;  3IIY A;  5HE2 B;  3KRW B;  2PM6 B;  3DM0 A;  3N0E A;  1JOF A;  1SQ9 A;  4FAN D;  1N6D A;  2YB8 B;  3EI4 B;  4A2M A;  2OIZ A;  2IAA A;  3EI3 B;  4A7J A;  3C99 A;  4CI3 A;  3NVQ A;  5HE3 B;  3CFV A;  3CFS B;  2UZX B;  2B4E A;  3V5W B;  5IGQ A;  2YBA A;  5FKQ A;  3F3G A;  2UZY B;  2P9I C;  1B9X A;  3SVW D;  1K32 A;  2I0S A;  3IIW A;  5H14 A;  3SFZ A;  4D6V A;  2J55 H;  4ERY A;  4CI8 A;  2I3T A;  3IJC A;  3I8C A;  2AGY A;  1Q47 A;  3I2N A;  3BG1 A;  4A2L A;  3A0F A;  3PSC B;  3OKT A;  2B5N A;  2OJY A;  3UVK A;  5EM2 B;  4JD2 C;  5EMK B;  5TF2 A;  2H68 A;  3MKQ A;  5GXI A;  4GQ2 P;  5I5J A;  5KDO B;  1K8K C;  2H9M A;  4BL0 A;  2GC4 A;  4CI1 A;  5B4W A;  3ORV D;  1NEX B;  3MZL A;  3I89 A;  4G56 B;  3JZH A;  4ZOV A;  4OZU A;  5K1C C;  4O1Q D;  5I5M A;  2HYE A;  3EI1 A;  2HKR A;  2YMU A;  3I7L A;  4TZ4 A;  4J86 A;  4JSX C;  4JT6 C;  3I8E A;  3B7F A;  3DXM C;  2CE8 A;  3PVW B;  4JSN C;  3SWS D;  4CZV A;  4K3J B;  3N0D A;  4ES0 A;  4CY5 A;  2YNN A;  5FXY A;  4QRJ A;  3E0C A;  1JJU B;  1NR0 A;  2P9L C;  4GM8 A;  4CY1 A;  3FM0 A;  1S4U X;  4IA9 A;  3L4O D;  4GM3 A;  3W15 A;  2AH1 A;  1GXR A;  2XL2 A;  4A09 B;  5EAL A;  4Y5R D;  2H9N A;  3F3F A;  4GGC A;  2PM9 A;  2OVP B;  5TEE A;  3I7H A;  2BBK H;  3UKU C;  1JMZ B;  3RRM C;  4QL1 A;  3NVN A;  1N6F A;  4GM9 A;  4PC0 A;  5H1M A;  3AL8 B;  4FA4 D;  3RSE C;  4AOW A;  2IWF A;  4GGA A;  4PSW B;  5CXB A;  4ZOZ A;  5FA5 B;  2EBS A;  5AFU 3;  4GZ8 A;  1MG2 A;  2IWK A;  3JRP A;  3UR4 A;  3EI4 A;  3PXW D;  3UVO A;  3EI3 A;  3JZG A;  3SJL D;  3VA6 A;  3KRX B;  4A11 B;  3JAM g;  2H3X A;  3C9C A;  4K3I D;  3SLE D;  4XYH A;  4CY2 A;  4KFM B;  4L9O A;  4LG9 A;  2P9S C;  4GQB B;  4JT5 C;  3V9F A;  4PBZ A;  4FA9 D;  1SQJ A;  5FQD A;  4X60 B;  1GP2 B;  1QNI A;  4E54 B;  2MTA H;  4ERQ A;  5CYK B;  3F3P A;  5HE0 B;  4BUJ C;  4Y7R A;  5IJ7 E;  3PE7 A;  4D0K A;  2XU7 A;  4GMB A;  1XIP A;  4J0X A;  3RN1 D;  5EM2 A;  3AL9 A;  3FGB A;  2B5M A;  3FRX A;  4FB1 D;  2H6Q A;  1GG2 B;  4O45 A;  2J56 H;  1U2V C;  2AGZ A;  3MKS B;  5EMJ B;  3SHF A;  4CY3 A;  4UI9 R;  3C5M A;  4PBY A;  4YVD A;  4XYI A;  3OL2 B;  3RN0 D;  2TRC B;  4O9D A;  3PXS D;  4X63 B;  2I0T A;  4MK0 B;  5C2W B;  5FKT A;  3ODT A;  2Z2O A;  3JPX A;  4NSX A;  3J81 g;  4L1Q D;  2BCJ B;  3SN6 B;  1XHM A;  5EML B;  2QC5 A;  1N6E A;  1PGU A;  4QQE A;  4FA5 D;  2G9A A;  2CO0 A;  2IUR A;  4LG8 A;  3CIK B;  2CO0 C;  4ZOY A;  3JB9 L;  5C9Z B;  1PBY B;  3RMZ D;  4N14 A;  3MMY A;  2OK4 A;  4ERZ A;  1OMW B;  2G99 A;  1U4C A;  4U7A A;  2H13 A;  2YNO A;  2OVR B;  4A0B B;  1YFQ A;  4A09 A;  1GOT B;  4PSX B;  2PBI B;  4J81 A;  4L3G D;  4JSP C;  2Z2N A;  3UVL A;  4A08 B;  2QXV A;  3AL8 A;  5GSA A;  5GXH A;  3K27 A;  1L0Q A;  2AH0 A;  5FLX g;  1P22 A;  3EI2 B;  4J73 A;  3L4M D;  2H9P A;  4FHL A;  3RFG A;  1RI6 A;  2B5L A;  4J0W A;  4X3E A;  4LGN A;  4HDJ A;  3OTT A;  5C2V B;  4A0A B;  4O3T B;  2IUP A;  4E5Z B;  2H6K A;  3MXX A;  2HKM A;  3MZK A;  3SBP A;  5A2Q g;  1JMX B;  4H5I A;  4PNK B;  3VH0 A;  2GC7 A;  3DWL C;  5AJA A;  4PXW A;  5I5I A;  5JWZ A;  4BH6 A;  2O9K A;  1FWX A;  4A11 A;  3AFC A;  2AGW A;  4JXM A;  2HES X;  3SXT D;  4Z8L A;  3GFC A;  3J80 g;  4AEZ A;  1A0R B;  3OKW A;  2CN2 A; 
#chains in the Genus database with same CATH topology
 3ZDX A;  1PI6 A;  3IUJ A;  3P4F A;  4J77 A;  3VGZ A;  3RFH A;  1ERJ A;  4E54 A;  3EU7 A;  2IUQ A;  3OKY B;  5CYK A;  4CC9 A;  2BKL A;  4RE5 A;  2IUV A;  3V4V A;  3UVM A;  2P9U C;  5HQG A;  2HJB A;  2H47 A;  4ZOX A;  3OF7 A;  4ESG A;  3JZN A;  2CNX A;  3MUO A;  5TDH B;  3ZDY A;  2YNP A;  3SMR A;  4NC4 A;  2CE9 A;  1L5G A;  2OK6 A;  5TEF A;  5EMM B;  4O02 A;  3OL2 A;  1TBG A;  3T3P A;  2GNQ A;  1SHY B;  3MUN A;  3IKO A;  5IGO A;  3BWS A;  4CI2 A;  3I7O A;  5EAM A;  4FWW A;  4I79 A;  2Q7Q A;  4H5J A;  3I7K A;  4QT8 A;  2VDM A;  3PSL A;  4XEI C;  3IJ0 A;  3MVD K;  2P9K C;  1MG3 A;  4J8G A;  3IUQ A;  2I0R A;  2H9L A;  3C75 H;  3SBQ A;  4GQ1 A;  4FA1 D;  4L3H D;  5FKS A;  3VI3 A;  1T2X A;  4UM9 A;  1R5M A;  1MDA H;  1OLZ A;  2PM7 B;  4EWR A;  2P9N C;  3RLM D;  2CN3 A;  3O4J A;  2XL3 A;  4J8B A;  4J79 A;  4FAV D;  2XYI A;  3I7N A;  5EAP A;  1I2M B;  4BCD A;  4CZX A;  1K3I A;  1VYH C;  1UOQ A;  3AH8 B;  1E8N A;  5FKR A;  4A0B A;  2HU8 A;  3EI1 B;  4R7A B;  2JKX A;  5IJ8 E;  3K26 A;  3SCY A;  4A08 A;  3EQ9 A;  2HXC A;  4ZN4 A;  3OW8 A;  3V7D B;  4DNV A;  2J57 G;  3DXK C;  2HJ4 A;  3IJ1 A;  3NVX A;  3EQ8 A;  3GC3 B;  1TYQ C;  3EI2 A;  5CXC A;  5IT9 g;  2VDL A;  5CXC B;  5K19 A;  1O6G A;  3ZWL B;  1YR2 A;  3GRE A;  4GGD A;  1GOH A;  5M5U A;  3HFQ A;  4A0A A;  2OVQ B;  3U4Y A;  4E5Z A;  2AGX A;  3BG0 A;  3EWE A;  4OWR A;  4J87 A;  2EIB A;  1O6F A;  3IVM A;  4CZY A;  5HYN B;  2PM9 B;  5M5S A;  4J78 A;  2Z2P A;  5THA A;  3O4I A;  2H14 A;  3DSM A;  5E6R A;  2EIC A;  5H17 A;  2P9P C;  3JRO A;  3UKR C;  1XKS A;  4G1M A;  2XE4 A;  4JSV C;  4U1E I;  5SXM A;  2AQ5 A;  2AGL A;  3UVN A;  5HE1 B;  1H2W A;  3SBR A;  3EMH A;  3I7P A;  1PEV A;  5AMS A;  4X61 B;  3ULE C;  4J82 A;  4J84 A;  4O3U B;  3EG6 A;  5CXB B;  3PVU B;  5IC7 A;  4IMM A;  2W18 A;  1B9Y A;  1QFM A;  2HU5 A;  2H6N A;  5EAR A;  2I3S A;  1UOP A;  3PXT D;  3OKY A;  5GMK n;  3IIY A;  5HE2 B;  3KRW B;  2PM6 B;  3DM0 A;  1E5T A;  3N0E A;  1JOF A;  1SQ9 A;  4FAN D;  1N6D A;  2YB8 B;  3IJE A;  4Z7O A;  3EI4 B;  3ZDZ A;  4A2M A;  4AMZ A;  2OIZ A;  2IAA A;  3EI3 B;  4JHP C;  4A7J A;  3C99 A;  4CI3 A;  3DDU A;  3NVQ A;  5HE3 B;  3CFV A;  3CFS B;  4L1M A;  3K71 A;  3FCU A;  2UZX B;  2B4E A;  3V5W B;  5IGQ A;  2YBA A;  5FKQ A;  3O4H A;  3F3G A;  2UZY B;  2P9I C;  1B9X A;  3NIF A;  3SVW D;  2VZ3 A;  1K32 A;  2I0S A;  3IIW A;  5E6U A;  5H14 A;  3SFZ A;  4D6V A;  1C9L A;  4IRZ A;  2J55 H;  4BP9 A;  4ERY A;  4CI8 A;  2I3T A;  3IJC A;  3I8C A;  2AGY A;  1Q47 A;  2VDO A;  5M5V A;  3I2N A;  3BG1 A;  4A2L A;  3A0F A;  3PSC B;  3OKT A;  2B5N A;  2OJY A;  3UVK A;  5EM2 B;  4JD2 C;  5EMK B;  5E6S A;  5TF2 A;  2H68 A;  3MKQ A;  5GXI A;  4GQ2 P;  5I5J A;  5KDO B;  2EIE A;  1K8K C;  2H9M A;  4BL0 A;  2GC4 A;  4AMY A;  4CI1 A;  5B4W A;  3ORV D;  1NEX B;  3MZL A;  3I89 A;  4G56 B;  2XZG A;  3JZH A;  4ZOV A;  4OZU A;  5K1C C;  4O1Q D;  3ZE0 A;  5I5M A;  4BP8 A;  2HYE A;  3EI1 A;  1H2Y A;  2HKR A;  4JHN A;  2YMU A;  1H2Z A;  3I7L A;  4TZ4 A;  4J86 A;  4JSX C;  4JT6 C;  3I8E A;  3ZE2 A;  2XDW A;  3B7F A;  2CE8 A;  3DXM C;  3PVW B;  4JSN C;  3SWS D;  4CZV A;  4G55 A;  4K3J B;  4AX4 A;  3N0D A;  4ES0 A;  3NID A;  4CY5 A;  2YNN A;  5FXY A;  4QRJ A;  2VDR A;  3E0C A;  1JJU B;  1NR0 A;  1GOG A;  2P9L C;  4D9S A;  4GM8 A;  4CY1 A;  3FM0 A;  3FCS A;  1S4U X;  4IA9 A;  1VE7 A;  3L4O D;  1VE6 A;  1VZ2 A;  4GM3 A;  3W15 A;  2AH1 A;  1GXR A;  2XL2 A;  4DNW A;  4A09 B;  5EAL A;  4Y5R D;  2H9N A;  3F3F A;  4GGC A;  2PM9 A;  2OVP B;  5TEE A;  3I7H A;  2BBK H;  3UKU C;  1JMZ B;  4MMZ A;  3RRM C;  4QL1 A;  3NVN A;  1N6F A;  4GM9 A;  4PC0 A;  5H1M A;  3AL8 B;  1JTD B;  3IUN A;  4FA4 D;  3RSE C;  4AOW A;  4G1E A;  2IWF A;  5M5R A;  2EID A;  1QFS A;  4GGA A;  4PSW B;  3V4P A;  5CXB A;  4ZOZ A;  5FA5 B;  2EBS A;  5AFU 3;  3K72 A;  4GZ8 A;  3ZE1 A;  1UTC A;  1MG2 A;  2IWK A;  1H2X A;  4Z7Q A;  3JRP A;  3UR4 A;  3EI4 A;  3PXW D;  3UVO A;  3K6S A;  3EI3 A;  3JZG A;  3SJL D;  3VA6 A;  3KRX B;  4AN0 A;  1UOO A;  4Z7N A;  4A11 B;  5FFO A;  3JAM g;  2H3X A;  3C9C A;  4K3I D;  3SLE D;  2VC2 A;  4XYH A;  4CY2 A;  2VDK A;  4KFM B;  3O4G A;  4L9O A;  4LG9 A;  2P9S C;  4GQB B;  4JT5 C;  4QAM A;  3V9F A;  4PBZ A;  4FA9 D;  1SQJ A;  5FQD A;  4X60 B;  4DNU A;  1GP2 B;  1QNI A;  4E54 B;  2MTA H;  4ERQ A;  5CYK B;  3F3P A;  3IUM A;  5HE0 B;  4BUJ C;  3T3M A;  4Y7R A;  5IJ7 E;  3PE7 A;  4D0K A;  2XU7 A;  4GMB A;  1XIP A;  4J0X A;  3RN1 D;  5EM2 A;  3AL9 A;  3FGB A;  4MMX A;  2B5M A;  2VZ1 A;  2VDP A;  3FRX A;  4FB1 D;  2H6Q A;  1GG2 B;  4O45 A;  2J56 H;  1U2V C;  2AGZ A;  3MKS B;  5EMJ B;  3SHF A;  4CY3 A;  4UI9 R;  3C5M A;  4PBY A;  4UM8 A;  4YVD A;  4NBM A;  4XYI A;  5FFG A;  2VDN A;  3OL2 B;  3RN0 D;  2TRC B;  2VDQ A;  4O9D A;  3PXS D;  4X63 B;  2I0T A;  5C86 A;  4MK0 B;  5C2W B;  5FKT A;  3ODT A;  2Z2O A;  3JPX A;  4NSX A;  3J81 g;  1U8C A;  4L1Q D;  4O2W A;  2BCJ B;  3GD1 I;  3SN6 B;  1XHM A;  4WJK A;  5EML B;  2QC5 A;  4WK4 A;  1N6E A;  1PGU A;  4QQE A;  4FA5 D;  2QZP A;  2G9A A;  1A12 A;  2CO0 A;  2IUR A;  4LG8 A;  3CIK B;  1TYE A;  2CO0 C;  4ZOY A;  2HU7 A;  3JB9 L;  5C9Z B;  1PBY B;  3RMZ D;  4N14 A;  3MMY A;  4NEN A;  2OK4 A;  4ERZ A;  1OMW B;  2G99 A;  1U4C A;  4U7A A;  2H13 A;  3VI4 A;  2YNO A;  2OVR B;  3KCI A;  4A0B B;  3NIG A;  1BPO A;  1YFQ A;  4A09 A;  1GOT B;  3EQ7 A;  2PBI B;  4PSX B;  4J81 A;  4L3G D;  4JSP C;  2Z2N A;  1E8M A;  3UVL A;  4A08 B;  2QR5 A;  4NAA A;  4RE6 A;  2QXV A;  3AL8 A;  5GSA A;  5GXH A;  3K27 A;  1L0Q A;  2AH0 A;  1M1X A;  5FLX g;  1P22 A;  3EI2 B;  1GOF A;  4J73 A;  3IUR A;  1JV2 A;  3L4M D;  2H9P A;  5M61 A;  5HDB A;  4FHL A;  3RFG A;  4BCC A;  3IUL A;  1RI6 A;  2B5L A;  4J0W A;  4X3E A;  4AN1 A;  4LGN A;  4HDJ A;  3OTT A;  5C2V B;  4A0A B;  1C9I A;  4WK2 A;  4O3T B;  2IUP A;  4E5Z B;  3QHY B;  2WQ8 A;  2H6K A;  3MXX A;  1VZ3 A;  4MMY A;  4BCB A;  2HKM A;  3MZK A;  5C92 A;  4WK0 A;  3SBP A;  5A2Q g;  1JMX B;  4H5I A;  4PNK B;  3VH0 A;  2GC7 A;  3DWL C;  5AJA A;  4PXW A;  5I5I A;  5JWZ A;  4BH6 A;  2O9K A;  1FWX A;  4A11 A;  3AFC A;  2AGW A;  4JXM A;  5M5T A;  2HES X;  3SXT D;  4Z8L A;  3GFC A;  3J80 g;  3QI0 A;  4AEZ A;  1A0R B;  3OKW A;  2CN2 A; 
#chains in the Genus database with same CATH homology
 1PI6 A;  4J77 A;  3P4F A;  3VGZ A;  3RFH A;  1ERJ A;  4E54 A;  3EU7 A;  2IUQ A;  3OKY B;  5CYK A;  4CC9 A;  2IUV A;  3UVM A;  2P9U C;  5HQG A;  2HJB A;  2H47 A;  4ZOX A;  4ESG A;  3JZN A;  2CNX A;  5TDH B;  2YNP A;  3SMR A;  2CE9 A;  2OK6 A;  5TEF A;  5EMM B;  3OL2 A;  1TBG A;  2GNQ A;  1SHY B;  3IKO A;  5IGO A;  3BWS A;  4CI2 A;  3I7O A;  5EAM A;  4FWW A;  4I79 A;  2Q7Q A;  4H5J A;  3I7K A;  4QT8 A;  3PSL A;  4XEI C;  3IJ0 A;  2P9K C;  1MG3 A;  4J8G A;  2I0R A;  2H9L A;  3C75 H;  3SBQ A;  4GQ1 A;  4FA1 D;  4L3H D;  5FKS A;  1R5M A;  1MDA H;  1OLZ A;  2PM7 B;  4EWR A;  2P9N C;  3RLM D;  2CN3 A;  2XL3 A;  4J8B A;  4J79 A;  4FAV D;  2XYI A;  3I7N A;  5EAP A;  4CZX A;  1VYH C;  3AH8 B;  5FKR A;  4A0B A;  3EI1 B;  4R7A B;  5IJ8 E;  3K26 A;  3SCY A;  4A08 A;  2HXC A;  4ZN4 A;  3OW8 A;  3V7D B;  2J57 G;  3DXK C;  2HJ4 A;  3IJ1 A;  3NVX A;  1TYQ C;  3EI2 A;  5CXC A;  5IT9 g;  5CXC B;  5K19 A;  3ZWL B;  3GRE A;  4GGD A;  3HFQ A;  4A0A A;  2OVQ B;  3U4Y A;  4E5Z A;  2AGX A;  3BG0 A;  3EWE A;  4OWR A;  4J87 A;  4CZY A;  5HYN B;  2PM9 B;  4J78 A;  2Z2P A;  5THA A;  2H14 A;  3DSM A;  5H17 A;  2P9P C;  3JRO A;  3UKR C;  1XKS A;  4JSV C;  4U1E I;  5SXM A;  2AQ5 A;  2AGL A;  3UVN A;  5HE1 B;  3SBR A;  3EMH A;  3I7P A;  1PEV A;  5AMS A;  4X61 B;  3ULE C;  4J82 A;  4J84 A;  4O3U B;  3EG6 A;  5CXB B;  3PVU B;  5IC7 A;  4IMM A;  2W18 A;  1B9Y A;  5EAR A;  2H6N A;  2I3S A;  3PXT D;  3OKY A;  5GMK n;  3IIY A;  5HE2 B;  3KRW B;  2PM6 B;  3DM0 A;  3N0E A;  1JOF A;  1SQ9 A;  4FAN D;  1N6D A;  2YB8 B;  3EI4 B;  4A2M A;  2OIZ A;  2IAA A;  3EI3 B;  4A7J A;  3C99 A;  4CI3 A;  3NVQ A;  5HE3 B;  3CFV A;  3CFS B;  2UZX B;  2B4E A;  3V5W B;  5IGQ A;  2YBA A;  5FKQ A;  3F3G A;  2UZY B;  2P9I C;  1B9X A;  3SVW D;  1K32 A;  2I0S A;  3IIW A;  5H14 A;  3SFZ A;  4D6V A;  2J55 H;  4ERY A;  4CI8 A;  2I3T A;  3IJC A;  3I8C A;  2AGY A;  1Q47 A;  3I2N A;  3BG1 A;  4A2L A;  3A0F A;  3PSC B;  3OKT A;  2B5N A;  2OJY A;  3UVK A;  5EM2 B;  4JD2 C;  5EMK B;  5TF2 A;  2H68 A;  3MKQ A;  5GXI A;  4GQ2 P;  5I5J A;  5KDO B;  1K8K C;  2H9M A;  4BL0 A;  2GC4 A;  4CI1 A;  5B4W A;  3ORV D;  1NEX B;  3MZL A;  3I89 A;  4G56 B;  3JZH A;  4ZOV A;  4OZU A;  5K1C C;  4O1Q D;  5I5M A;  2HYE A;  3EI1 A;  2HKR A;  2YMU A;  3I7L A;  4TZ4 A;  4J86 A;  4JSX C;  4JT6 C;  3I8E A;  3B7F A;  3DXM C;  2CE8 A;  3PVW B;  4JSN C;  3SWS D;  4CZV A;  4K3J B;  3N0D A;  4ES0 A;  4CY5 A;  2YNN A;  5FXY A;  4QRJ A;  3E0C A;  1JJU B;  1NR0 A;  2P9L C;  4GM8 A;  4CY1 A;  3FM0 A;  1S4U X;  4IA9 A;  3L4O D;  4GM3 A;  3W15 A;  2AH1 A;  1GXR A;  2XL2 A;  4A09 B;  5EAL A;  4Y5R D;  2H9N A;  3F3F A;  4GGC A;  2PM9 A;  2OVP B;  5TEE A;  3I7H A;  2BBK H;  3UKU C;  1JMZ B;  3RRM C;  4QL1 A;  3NVN A;  1N6F A;  4GM9 A;  4PC0 A;  5H1M A;  3AL8 B;  4FA4 D;  3RSE C;  4AOW A;  2IWF A;  4GGA A;  4PSW B;  5CXB A;  4ZOZ A;  5FA5 B;  2EBS A;  5AFU 3;  4GZ8 A;  1MG2 A;  2IWK A;  3JRP A;  3UR4 A;  3EI4 A;  3PXW D;  3UVO A;  3EI3 A;  3JZG A;  3SJL D;  3VA6 A;  3KRX B;  4A11 B;  3JAM g;  2H3X A;  3C9C A;  4K3I D;  3SLE D;  4XYH A;  4CY2 A;  4KFM B;  4L9O A;  4LG9 A;  2P9S C;  4GQB B;  4JT5 C;  3V9F A;  4PBZ A;  4FA9 D;  1SQJ A;  5FQD A;  4X60 B;  1GP2 B;  1QNI A;  4E54 B;  2MTA H;  4ERQ A;  5CYK B;  3F3P A;  5HE0 B;  4BUJ C;  4Y7R A;  5IJ7 E;  3PE7 A;  4D0K A;  2XU7 A;  4GMB A;  1XIP A;  4J0X A;  3RN1 D;  5EM2 A;  3AL9 A;  3FGB A;  2B5M A;  3FRX A;  4FB1 D;  2H6Q A;  1GG2 B;  4O45 A;  2J56 H;  1U2V C;  2AGZ A;  3MKS B;  5EMJ B;  3SHF A;  4CY3 A;  4UI9 R;  3C5M A;  4PBY A;  4YVD A;  4XYI A;  3OL2 B;  3RN0 D;  2TRC B;  4O9D A;  3PXS D;  4X63 B;  2I0T A;  4MK0 B;  5C2W B;  5FKT A;  3ODT A;  2Z2O A;  3JPX A;  4NSX A;  3J81 g;  4L1Q D;  2BCJ B;  3SN6 B;  1XHM A;  5EML B;  2QC5 A;  1N6E A;  1PGU A;  4QQE A;  4FA5 D;  2G9A A;  2CO0 A;  2IUR A;  4LG8 A;  3CIK B;  2CO0 C;  4ZOY A;  3JB9 L;  5C9Z B;  1PBY B;  3RMZ D;  4N14 A;  3MMY A;  2OK4 A;  4ERZ A;  1OMW B;  2G99 A;  1U4C A;  4U7A A;  2H13 A;  2YNO A;  2OVR B;  4A0B B;  1YFQ A;  4A09 A;  1GOT B;  4PSX B;  2PBI B;  4J81 A;  4L3G D;  4JSP C;  2Z2N A;  3UVL A;  4A08 B;  2QXV A;  3AL8 A;  5GSA A;  5GXH A;  3K27 A;  1L0Q A;  2AH0 A;  5FLX g;  1P22 A;  3EI2 B;  4J73 A;  3L4M D;  2H9P A;  4FHL A;  3RFG A;  1RI6 A;  2B5L A;  4J0W A;  4X3E A;  4LGN A;  4HDJ A;  3OTT A;  5C2V B;  4A0A B;  4O3T B;  2IUP A;  4E5Z B;  2H6K A;  3MXX A;  2HKM A;  3MZK A;  3SBP A;  5A2Q g;  1JMX B;  4H5I A;  4PNK B;  3VH0 A;  2GC7 A;  3DWL C;  5AJA A;  4PXW A;  5I5I A;  5JWZ A;  4BH6 A;  2O9K A;  1FWX A;  4A11 A;  3AFC A;  2AGW A;  4JXM A;  2HES X;  3SXT D;  4Z8L A;  3GFC A;  3J80 g;  4AEZ A;  1A0R B;  3OKW A;  2CN2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...