3UVMA

Crystal structure of wdr5 in complex with the wdr5-interacting motif of mll4
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
304
structure length
304
Chain Sequence
VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The plasticity of WDR5 peptide-binding cleft enables the binding of the SET1 family of histone methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords WD repeat-containing protein 5
total genus 103
structure length 304
sequence length 304
ec nomenclature
pdb deposition date 2011-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3uvmA00
1JMZB 4J81A 3BG1A 2UZXB 2YNPA 5CYKA 2I0TA 4PNKB 3CIKB 2OVPB 3FM0A 2PBIB 2I3SA 3K27A 5AFU3 3GREA 5EMJB 5I5MA 2CO0C 3PE7A 3UKRC 3OTTA 4Y5RD 4JSPC 2XL2A 3KRXB 4A2MA 5A2Qg 5KDOB 2H13A 5HYNB 2BCJB 3MZLA 4J87A 3CFVA 3DWLC 2UZYB 2IWKA 4TZ4A 4R7AB 5CYKB 1SQ9A 3EI4A 3RN1D 3F3FA 3RMZD 1A0RB 2H9PA 4J0XA 2OK4A 4E54A 5K19A 3P4FA 3EWEA 4O3UB 4QRJA 5EM2A 3MKQA 1NR0A 4U7AA 2XL3A 4MK0B 2GNQA 4BUJC 5C2VB 3BWSA 5B4WA 2CO0A 4CZXA 4K3JB 1JOFA 4E5ZA 2IAAA 2GC4A 3L4MD 3C9CA 2PM6B 2OJYA 3IJ0A 2QC5A 1N6FA 2H6KA 2OIZA 5AMSA 5FKSA 3IJ1A 3PXWD 2P9LC 5IJ7E 3I7HA 1K32A 3E0CA 1OLZA 1PBYB 3AFCA 5GXIA 2BBKH 2CN3A 5C9ZB 3OKYB 2G9AA 4L3HD 5FKQA 3MZKA 3ODTA 2OVRB 4GGAA 3VA6A 2P9NC 2YB8B 4O9DA 4OWRA 2IWFA 4CY3A 1TYQC 5EARA 3EI1A 4J77A 3EI3A 2Q7QA 4JD2C 4ZOZA 2O9KA 3OW8A 5FLXg 3HFQA 3PSLA 3W15A 3UVOA 5GSAA 5FKTA 3FRXA 4CY5A 4A0BA 4ZOXA 4KFMB 3I7OA 2HKMA 5CXCB 3U4YA 4LG9A 2GC7A 4A08A 4BH6A 1FWXA 5H14A 4A2LA 4GM8A 4EWRA 3JRPA 4A09A 3L4OD 4CI8A 2P9IC 4L9OA 3B7FA 4FA1D 2H14A 3RSEC 2H47A 2J56H 2AGWA 4GGCA 4H5JA 2CN2A 2OVQB 2B5MA 5IGQA 5IJ8E 3EI4B 4XEIC 4FB1D 3EI2A 2XYIA 4J0WA 4PSXB 3JPXA 2HXCA 3I7LA 4L3GD 2H9NA 3AL8A 2YNOA 2G99A 4J79A 3MMYA 4JT6C 2P9PC 3PSCB 3RN0D 3I7PA 3I7NA 4A0AB 4JSNC 4LGNA 2B5NA 3FGBA 1GOTB 3UVMA 4PXWA 3SN6B 5I5IA 4FAND 4CZYA 4ERYA 5JWZA 1L0QA 2AH0A 2Z2PA 2Z2NA 4JT5C 4QL1A 1MG2A 4BL0A 3MXXA 5HE3B 3EI1B 3NVXA 3C5MA 3SMRA 3NVQA 3K26A 3C75H 4O3TB 3IJCA 3JAMg 2H9MA 3UVKA 5FQDA 4ESGA 4PSWB 4A08B 4PC0A 3V5WB 4JSVC 4NSXA 1MDAH 4CI2A 4A09B 1PI6A 3UR4A 5C2WB 5EM2B 1JJUB 4X3EA 3JZGA 3SBRA 4UI9R 5EMLB 5IT9g 3J81g 5FA5B 1GXRA 5IC7A 5FXYA 3JB9L 4JXMA 4CZVA 4E5ZB 3NVNA 5HE2B 5HE1B 3ZWLB 2IUPA 2H9LA 2IUQA 1XIPA 2P9KC 3C99A 3JROA 4G56B 5EAMA 2B5LA 2YBAA 3PVWB 3JZNA 3SHFA 2AQ5A 3OL2A 4QQEA 4I79A 1S4UX 2H6QA 3V9FA 3EI2B 2HKRA 3VH0A 2B4EA 4O1QD 4AOWA 4CY1A 4FA4D 1U4CA 4IMMA 4U1EI 2YMUA 3SBPA 5EALA 2I0RA 4J78A 2TRCB 3AH8B 4GMBA 4ZOVA 4GZ8A 4LG8A 5GMKn 3A0FA 1N6EA 1SQJA 5H1MA 4FHLA 4PBYA 4ZN4A 2CNXA 3I8EA 4J82A 3AL9A 3DM0A 1PEVA 3PXTD 4GM9A 4HDJA 3CFSB 3KRWB 2MTAH 2J55H 2J57G 2H3XA 1XHMA 4D0KA 4L1QD 4XYIA 2EBSA 2Z2OA 2AGZA 4FA9D 3RFHA 2QXVA 4FA5D 4OZUA 3ORVD 4ES0A 4X60B 3RFGA 3V7DB 3IKOA 4J73A 4J8BA 4YVDA 2IUVA 4ERZA 1R5MA 4A11B 1SHYB 5HE0B 5EMKB 5GXHA 5TEEA 3I2NA 3DSMA 4GQ1A 5CXCA 5EMMB 4A0AA 3IIYA 5TEFA 3SCYA 5FKRA 3OL2B 3I7KA 1K8KC 2HJ4A 4A7JA 3F3PA 3EU7A 4J86A 1TBGA 4J84A 3BG0A 2CE9A 1OMWB 4N14A 4CI1A 2PM9A 3VGZA 2HJBA 4Y7RA 5CXBB 3RRMC 1MG3A 3J80g 5IGOA 3N0EA 4CI3A 2AGYA 5AJAA 4X63B 4PBZA 2OK6A 4Z8LA 4GM3A 2PM7B 3DXKC 3EG6A 4O45A 1JMXB 1ERJA 5H17A 5I5JA 4GQBB 4FAVD 2PM9B 5TF2A 4GGDA 4ZOYA 3F3GA 3SXTD 2I3TA 3N0DA 2P9SC 3MKSB 4GQ2P 3PXSD 4K3ID 3I89A 3UKUC 3OKTA 3UVNA 3DXMC 5SXMA 4CC9A 4A0BB 2H68A 3SLED 1GG2B 2HESX 3SWSD 4JSXC 1GP2B 3PVUB 1N6DA 4ERQA 5HQGA 1RI6A 3GFCA 5THAA 5TDHB 3SFZA 1QNIA 3UVLA 4E54B 2AGLA 2CE8A 4CY2A 1YFQA 3ULEC 3AL8B 2H6NA 2IURA 2P9UC 2I0SA 1NEXB 3SJLD 1U2VC 2YNNA 2HYEA 1Q47A 1PGUA 4X61B 4H5IA 3OKYA 4D6VA 2AH1A 1B9XA 3OKWA 1VYHC 5K1CC 3SBQA 3SVWD 4J8GA 3I8CA 4XYHA 1XKSA 2XU7A 2AGXA 5CXBA 2W18A 4QT8A 4A11A 3EMHA 3EI3B 4IA9A 1B9YA 4FWWA 3IIWA 3RLMD 5EAPA 1P22A 4AEZA 3JZHA
chains in the Genus database with same CATH superfamily
1I2MB 1JMZB 4J81A 3BG1A 2UZXB 4MMYA 2YNPA 1U8CA 5CYKA 2I0TA 4PNKB 3CIKB 4NAAA 2OVPB 3FM0A 2PBIB 2I3SA 3K27A 5AFU3 3GREA 5EMJB 5I5MA 2CO0C 3PE7A 3UKRC 3OTTA 4Y5RD 4JSPC 2XL2A 1UOOA 3IJEA 3KRXB 4BCCA 4A2MA 1VE6A 5A2Qg 5KDOB 2H13A 5HYNB 3MZLA 2BCJB 4J87A 1GOGA 3CFVA 3DWLC 2UZYB 2IWKA 4NENA 4R7AB 4TZ4A 5CYKB 3VI4A 4AX4A 1SQ9A 3EI4A 3RN1D 3F3FA 3RMZD 1A0RB 2H9PA 4J0XA 2OK4A 4E54A 5K19A 4RE6A 3O4GA 3P4FA 3EWEA 4O3UB 4QRJA 5EM2A 3MKQA 4AMZA 1NR0A 4U7AA 2XL3A 4MK0B 2GNQA 4BUJC 5C2VB 3BWSA 5B4WA 1JTDB 2CO0A 3T3MA 4CZXA 3NIDA 3EQ9A 2VDOA 4K3JB 1JOFA 5HDBA 4E5ZA 2IAAA 2GC4A 3ZDZA 3L4MD 3C9CA 2PM6B 2OJYA 2VDKA 3IJ0A 2QC5A 1N6FA 2H6KA 3ZDYA 3IULA 3OF7A 2OIZA 5AMSA 5FKSA 3IJ1A 3PXWD 2P9LC 5IJ7E 3I7HA 1K32A 3E0CA 1OLZA 1PBYB 3AFCA 1M1XA 5GXIA 4G1EA 4BP8A 2BBKH 2CN3A 4IRZA 5C9ZB 3OKYB 1QFMA 2G9AA 2VDNA 4L3HD 5FKQA 3MZKA 4O02A 3ODTA 2OVRB 4GGAA 3VA6A 2P9NC 2YB8B 4O9DA 4OWRA 2IWFA 4CY3A 1H2YA 1TYQC 5EARA 3EI1A 4J77A 3EI3A 2Q7QA 4JD2C 4ZOZA 2O9KA 3OW8A 5FLXg 3HFQA 3PSLA 3W15A 3UVOA 5GSAA 5FKTA 4BCDA 3FRXA 4CY5A 4A0BA 4ZOXA 4KFMB 3I7OA 1TYEA 2HKMA 5CXCB 3U4YA 4LG9A 2GC7A 4NC4A 4A08A 1C9IA 4BH6A 1FWXA 5H14A 4A2LA 3IUJA 4GM8A 5M61A 4EWRA 2VZ1A 3T3PA 3JRPA 3GC3B 4A09A 3L4OD 4CI8A 1A12A 2P9IC 4L9OA 3B7FA 4FA1D 1UOPA 2H14A 3RSEC 2HU8A 2H47A 4RE5A 2J56H 2AGWA 4GGCA 4H5JA 2CN2A 4MMZA 2OVQB 2B5MA 1YR2A 5IGQA 5IJ8E 3EI4B 4XEIC 4FB1D 2WQ8A 3EI2A 2XYIA 4J0WA 2BKLA 4PSXB 3JPXA 2HXCA 4MMXA 3I7LA 4L3GD 5FFGA 2H9NA 3V4VA 5M5VA 3AL8A 2YNOA 4JHPC 3NIGA 2G99A 4J79A 3MMYA 4JT6C 2P9PC 3PSCB 3RN0D 5E6SA 2VZ3A 3I7PA 3I7NA 4A0AB 4JSNC 4LGNA 2B5NA 3FGBA 5E6UA 1GOTB 3UVMA 4PXWA 3SN6B 5I5IA 3IURA 4FAND 4CZYA 4ERYA 5JWZA 1L0QA 2AH0A 2Z2PA 3O4JA 2Z2NA 3O4HA 4JT5C 4QL1A 1MG2A 4BL0A 3MXXA 4WJKA 5HE3B 3EI1B 3NVXA 3C5MA 5C86A 3SMRA 3NVQA 3K26A 3K71A 3C75H 4O3TB 3IJCA 3JAMg 2H9MA 3IUNA 3UVKA 1GOHA 5FQDA 4ESGA 3IUQA 4Z7QA 4PSWB 4A08B 4PC0A 3V5WB 4JSVC 4NSXA 1MDAH 3GD1I 4CI2A 4WK0A 3K72A 1C9LA 4A09B 1PI6A 3UR4A 5C2WB 5EM2B 1JJUB 4X3EA 5C92A 3JZGA 3SBRA 4UI9R 5EMLB 5IT9g 3J81g 5FA5B 1GXRA 5IC7A 5FXYA 4AN0A 1E5TA 3JB9L 4JXMA 2VDPA 2QZPA 4CZVA 4E5ZB 3NVNA 5HE2B 5HE1B 3ZWLB 1GOFA 3VI3A 2XDWA 3EQ7A 2IUPA 2H9LA 2IUQA 1XIPA 2P9KC 3C99A 3JROA 4G56B 5EAMA 4JHNA 2B5LA 2YBAA 3PVWB 3JZNA 5E6RA 3FCUA 3SHFA 2AQ5A 3OL2A 4QQEA 4I79A 1BPOA 1S4UX 2H6QA 2VDLA 3V9FA 3EI2B 4NBMA 2HKRA 3VH0A 4AN1A 2B4EA 4O1QD 5M5SA 4AOWA 4CY1A 4FA4D 1U4CA 3MUOA 4IMMA 1VZ2A 4U1EI 2YMUA 3SBPA 3ZDXA 3O4IA 2VC2A 2I0RA 4J78A 5EALA 2TRCB 3AH8B 4GMBA 4GZ8A 4LG8A 4ZOVA 3ZE0A 3DDUA 5GMKn 3A0FA 1N6EA 1SQJA 5H1MA 2JKXA 4FHLA 4PBYA 4ZN4A 2CNXA 3I8EA 4O2WA 4J82A 3AL9A 3DM0A 1PEVA 3PXTD 4GM9A 4HDJA 3CFSB 3KRWB 2MTAH 3ZE2A 4WK2A 2J55H 2J57G 2H3XA 1XHMA 4D0KA 4L1QD 4XYIA 2EBSA 2Z2OA 3IUMA 4G1MA 2AGZA 1VZ3A 4FA9D 1O6GA 3RFHA 2EIDA 3EQ8A 2QXVA 4FA5D 1QFSA 4OZUA 2HU7A 3ORVD 4ES0A 4X60B 3RFGA 3V7DB 3IKOA 4J73A 4J8BA 4YVDA 2IUVA 4ERZA 1R5MA 4A11B 2XE4A 1SHYB 5HE0B 5EMKB 3MVDK 4DNUA 5GXHA 5TEEA 3I2NA 4BCBA 3DSMA 3KCIA 4GQ1A 5CXCA 2EICA 5EMMB 4A0AA 3IIYA 5TEFA 3SCYA 5FKRA 3OL2B 4Z7NA 3I7KA 1K8KC 2HJ4A 3ZE1A 4A7JA 3F3PA 3EU7A 4J86A 1TBGA 2QR5A 4J84A 3BG0A 2CE9A 1K3IA 1OMWB 4N14A 4CI1A 3IVMA 2PM9A 3VGZA 2HJBA 4Y7RA 5CXBB 5M5RA 3RRMC 1MG3A 3J80g 3QI0A 1VE7A 1JV2A 3NIFA 3N0EA 5IGOA 4CI3A 2AGYA 5M5TA 5AJAA 2VDQA 4X63B 4PBZA 2OK6A 4WK4A 4Z8LA 4GM3A 2PM7B 4QAMA 3DXKC 2VDMA 3EG6A 4O45A 1JMXB 1ERJA 5H17A 5I5JA 4Z7OA 4GQBB 4FAVD 2PM9B 5TF2A 2VDRA 4GGDA 4ZOYA 3F3GA 3SXTD 1E8MA 3QHYB 2I3TA 3N0DA 5FFOA 2EIBA 2P9SC 3MKSB 4GQ2P 3PXSD 4K3ID 3I89A 1E8NA 3V4PA 3UKUC 3OKTA 3UVNA 4UM9A 3DXMC 5SXMA 4CC9A 4A0BB 2H68A 3MUNA 1UOQA 3SLED 1GG2B 2HESX 3SWSD 2EIEA 4UM8A 4JSXC 1GP2B 3K6SA 3PVUB 1N6DA 4ERQA 5HQGA 4BP9A 1RI6A 3GFCA 5THAA 5TDHB 3SFZA 1QNIA 3UVLA 4E54B 2AGLA 4DNVA 2CE8A 4CY2A 1YFQA 1O6FA 3ULEC 3AL8B 2H6NA 2IURA 2P9UC 2I0SA 1NEXB 3SJLD 3FCSA 4DNWA 1U2VC 1H2ZA 2YNNA 2HYEA 1Q47A 1PGUA 4X61B 1L5GA 4H5IA 3OKYA 4D6VA 2AH1A 1H2XA 1B9XA 3OKWA 1VYHC 5K1CC 3SBQA 3SVWD 4J8GA 2XZGA 3I8CA 4G55A 4XYHA 1T2XA 1XKSA 2XU7A 2AGXA 4D9SA 5CXBA 2W18A 4QT8A 4A11A 3EMHA 1H2WA 3EI3B 4AMYA 5M5UA 4L1MA 4IA9A 1UTCA 1B9YA 4FWWA 3IIWA 3RLMD 5EAPA 1P22A 4AEZA 3JZHA 2HU5A
chains in the Genus database with same CATH topology
1JMZB 4J81A 3BG1A 2UZXB 2YNPA 5CYKA 2I0TA 4PNKB 3CIKB 2OVPB 3FM0A 2PBIB 2I3SA 3K27A 5AFU3 3GREA 5EMJB 5I5MA 2CO0C 3PE7A 3UKRC 3OTTA 4Y5RD 4JSPC 2XL2A 3KRXB 4A2MA 5A2Qg 5KDOB 2H13A 5HYNB 2BCJB 3MZLA 4J87A 3CFVA 3DWLC 2UZYB 2IWKA 4TZ4A 4R7AB 5CYKB 1SQ9A 3EI4A 3RN1D 3F3FA 3RMZD 1A0RB 2H9PA 4J0XA 2OK4A 4E54A 5K19A 3P4FA 3EWEA 4O3UB 4QRJA 5EM2A 3MKQA 1NR0A 4U7AA 2XL3A 4MK0B 2GNQA 4BUJC 5C2VB 3BWSA 5B4WA 2CO0A 4CZXA 4K3JB 1JOFA 4E5ZA 2IAAA 2GC4A 3L4MD 3C9CA 2PM6B 2OJYA 3IJ0A 2QC5A 1N6FA 2H6KA 2OIZA 5AMSA 5FKSA 3IJ1A 3PXWD 2P9LC 5IJ7E 3I7HA 1K32A 3E0CA 1OLZA 1PBYB 3AFCA 5GXIA 2BBKH 2CN3A 5C9ZB 3OKYB 2G9AA 4L3HD 5FKQA 3MZKA 3ODTA 2OVRB 4GGAA 3VA6A 2P9NC 2YB8B 4O9DA 4OWRA 2IWFA 4CY3A 1TYQC 5EARA 3EI1A 4J77A 3EI3A 2Q7QA 4JD2C 4ZOZA 2O9KA 3OW8A 5FLXg 3HFQA 3PSLA 3W15A 3UVOA 5GSAA 5FKTA 3FRXA 4CY5A 4A0BA 4ZOXA 4KFMB 3I7OA 2HKMA 5CXCB 3U4YA 4LG9A 2GC7A 4A08A 4BH6A 1FWXA 5H14A 4A2LA 4GM8A 4EWRA 3JRPA 4A09A 3L4OD 4CI8A 2P9IC 4L9OA 3B7FA 4FA1D 2H14A 3RSEC 2H47A 2J56H 2AGWA 4GGCA 4H5JA 2CN2A 2OVQB 2B5MA 5IGQA 5IJ8E 3EI4B 4XEIC 4FB1D 3EI2A 2XYIA 4J0WA 4PSXB 3JPXA 2HXCA 3I7LA 4L3GD 2H9NA 3AL8A 2YNOA 2G99A 4J79A 3MMYA 4JT6C 2P9PC 3PSCB 3RN0D 3I7PA 3I7NA 4A0AB 4JSNC 4LGNA 2B5NA 3FGBA 1GOTB 3UVMA 4PXWA 3SN6B 5I5IA 4FAND 4CZYA 4ERYA 5JWZA 1L0QA 2AH0A 2Z2PA 2Z2NA 4JT5C 4QL1A 1MG2A 4BL0A 3MXXA 5HE3B 3EI1B 3NVXA 3C5MA 3SMRA 3NVQA 3K26A 3C75H 4O3TB 3IJCA 3JAMg 2H9MA 3UVKA 5FQDA 4ESGA 4PSWB 4A08B 4PC0A 3V5WB 4JSVC 4NSXA 1MDAH 4CI2A 4A09B 1PI6A 3UR4A 5C2WB 5EM2B 1JJUB 4X3EA 3JZGA 3SBRA 4UI9R 5EMLB 5IT9g 3J81g 5FA5B 1GXRA 5IC7A 5FXYA 3JB9L 4JXMA 4CZVA 4E5ZB 3NVNA 5HE2B 5HE1B 3ZWLB 2IUPA 2H9LA 2IUQA 1XIPA 2P9KC 3C99A 3JROA 4G56B 5EAMA 2B5LA 2YBAA 3PVWB 3JZNA 3SHFA 2AQ5A 3OL2A 4QQEA 4I79A 1S4UX 2H6QA 3V9FA 3EI2B 2HKRA 3VH0A 2B4EA 4O1QD 4AOWA 4CY1A 4FA4D 1U4CA 4IMMA 4U1EI 2YMUA 3SBPA 5EALA 2I0RA 4J78A 2TRCB 3AH8B 4GMBA 4ZOVA 4GZ8A 4LG8A 5GMKn 3A0FA 1N6EA 1SQJA 5H1MA 4FHLA 4PBYA 4ZN4A 2CNXA 3I8EA 4J82A 3AL9A 3DM0A 1PEVA 3PXTD 4GM9A 4HDJA 3CFSB 3KRWB 2MTAH 2J55H 2J57G 2H3XA 1XHMA 4D0KA 4L1QD 4XYIA 2EBSA 2Z2OA 2AGZA 4FA9D 3RFHA 2QXVA 4FA5D 4OZUA 3ORVD 4ES0A 4X60B 3RFGA 3V7DB 3IKOA 4J73A 4J8BA 4YVDA 2IUVA 4ERZA 1R5MA 4A11B 1SHYB 5HE0B 5EMKB 5GXHA 5TEEA 3I2NA 3DSMA 4GQ1A 5CXCA 5EMMB 4A0AA 3IIYA 5TEFA 3SCYA 5FKRA 3OL2B 3I7KA 1K8KC 2HJ4A 4A7JA 3F3PA 3EU7A 4J86A 1TBGA 4J84A 3BG0A 2CE9A 1OMWB 4N14A 4CI1A 2PM9A 3VGZA 2HJBA 4Y7RA 5CXBB 3RRMC 1MG3A 3J80g 5IGOA 3N0EA 4CI3A 2AGYA 5AJAA 4X63B 4PBZA 2OK6A 4Z8LA 4GM3A 2PM7B 3DXKC 3EG6A 4O45A 1JMXB 1ERJA 5H17A 5I5JA 4GQBB 4FAVD 2PM9B 5TF2A 4GGDA 4ZOYA 3F3GA 3SXTD 2I3TA 3N0DA 2P9SC 3MKSB 4GQ2P 3PXSD 4K3ID 3I89A 3UKUC 3OKTA 3UVNA 3DXMC 5SXMA 4CC9A 4A0BB 2H68A 3SLED 1GG2B 2HESX 3SWSD 4JSXC 1GP2B 3PVUB 1N6DA 4ERQA 5HQGA 1RI6A 3GFCA 5THAA 5TDHB 3SFZA 1QNIA 3UVLA 4E54B 2AGLA 2CE8A 4CY2A 1YFQA 3ULEC 3AL8B 2H6NA 2IURA 2P9UC 2I0SA 1NEXB 3SJLD 1U2VC 2YNNA 2HYEA 1Q47A 1PGUA 4X61B 4H5IA 3OKYA 4D6VA 2AH1A 1B9XA 3OKWA 1VYHC 5K1CC 3SBQA 3SVWD 4J8GA 3I8CA 4XYHA 1XKSA 2XU7A 2AGXA 5CXBA 2W18A 4QT8A 4A11A 3EMHA 3EI3B 4IA9A 1B9YA 4FWWA 3IIWA 3RLMD 5EAPA 1P22A 4AEZA 3JZHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JMZ B;  4J81 A;  3BG1 A;  2UZX B;  2YNP A;  5CYK A;  2I0T A;  4PNK B;  3CIK B;  2OVP B;  3FM0 A;  2PBI B;  2I3S A;  3K27 A;  5AFU 3;  3GRE A;  5EMJ B;  5I5M A;  2CO0 C;  3PE7 A;  3UKR C;  3OTT A;  4Y5R D;  4JSP C;  2XL2 A;  3KRX B;  4A2M A;  5A2Q g;  5KDO B;  2H13 A;  5HYN B;  2BCJ B;  3MZL A;  4J87 A;  3CFV A;  3DWL C;  2UZY B;  2IWK A;  4TZ4 A;  4R7A B;  5CYK B;  1SQ9 A;  3EI4 A;  3RN1 D;  3F3F A;  3RMZ D;  1A0R B;  2H9P A;  4J0X A;  2OK4 A;  4E54 A;  5K19 A;  3P4F A;  3EWE A;  4O3U B;  4QRJ A;  5EM2 A;  3MKQ A;  1NR0 A;  4U7A A;  2XL3 A;  4MK0 B;  2GNQ A;  4BUJ C;  5C2V B;  3BWS A;  5B4W A;  2CO0 A;  4CZX A;  4K3J B;  1JOF A;  4E5Z A;  2IAA A;  2GC4 A;  3L4M D;  3C9C A;  2PM6 B;  2OJY A;  3IJ0 A;  2QC5 A;  1N6F A;  2H6K A;  2OIZ A;  5AMS A;  5FKS A;  3IJ1 A;  3PXW D;  2P9L C;  5IJ7 E;  3I7H A;  1K32 A;  3E0C A;  1OLZ A;  1PBY B;  3AFC A;  5GXI A;  2BBK H;  2CN3 A;  5C9Z B;  3OKY B;  2G9A A;  4L3H D;  5FKQ A;  3MZK A;  3ODT A;  2OVR B;  4GGA A;  3VA6 A;  2P9N C;  2YB8 B;  4O9D A;  4OWR A;  2IWF A;  4CY3 A;  1TYQ C;  5EAR A;  3EI1 A;  4J77 A;  3EI3 A;  2Q7Q A;  4JD2 C;  4ZOZ A;  2O9K A;  3OW8 A;  5FLX g;  3HFQ A;  3PSL A;  3W15 A;  3UVO A;  5GSA A;  5FKT A;  3FRX A;  4CY5 A;  4A0B A;  4ZOX A;  4KFM B;  3I7O A;  2HKM A;  5CXC B;  3U4Y A;  4LG9 A;  2GC7 A;  4A08 A;  4BH6 A;  1FWX A;  5H14 A;  4A2L A;  4GM8 A;  4EWR A;  3JRP A;  4A09 A;  3L4O D;  4CI8 A;  2P9I C;  4L9O A;  3B7F A;  4FA1 D;  2H14 A;  3RSE C;  2H47 A;  2J56 H;  2AGW A;  4GGC A;  4H5J A;  2CN2 A;  2OVQ B;  2B5M A;  5IGQ A;  5IJ8 E;  3EI4 B;  4XEI C;  4FB1 D;  3EI2 A;  2XYI A;  4J0W A;  4PSX B;  3JPX A;  2HXC A;  3I7L A;  4L3G D;  2H9N A;  3AL8 A;  2YNO A;  2G99 A;  4J79 A;  3MMY A;  4JT6 C;  2P9P C;  3PSC B;  3RN0 D;  3I7P A;  3I7N A;  4A0A B;  4JSN C;  4LGN A;  2B5N A;  3FGB A;  1GOT B;  3UVM A;  4PXW A;  3SN6 B;  5I5I A;  4FAN D;  4CZY A;  4ERY A;  5JWZ A;  1L0Q A;  2AH0 A;  2Z2P A;  2Z2N A;  4JT5 C;  4QL1 A;  1MG2 A;  4BL0 A;  3MXX A;  5HE3 B;  3EI1 B;  3NVX A;  3C5M A;  3SMR A;  3NVQ A;  3K26 A;  3C75 H;  4O3T B;  3IJC A;  3JAM g;  2H9M A;  3UVK A;  5FQD A;  4ESG A;  4PSW B;  4A08 B;  4PC0 A;  3V5W B;  4JSV C;  4NSX A;  1MDA H;  4CI2 A;  4A09 B;  1PI6 A;  3UR4 A;  5C2W B;  5EM2 B;  1JJU B;  4X3E A;  3JZG A;  3SBR A;  4UI9 R;  5EML B;  5IT9 g;  3J81 g;  5FA5 B;  1GXR A;  5IC7 A;  5FXY A;  3JB9 L;  4JXM A;  4CZV A;  4E5Z B;  3NVN A;  5HE2 B;  5HE1 B;  3ZWL B;  2IUP A;  2H9L A;  2IUQ A;  1XIP A;  2P9K C;  3C99 A;  3JRO A;  4G56 B;  5EAM A;  2B5L A;  2YBA A;  3PVW B;  3JZN A;  3SHF A;  2AQ5 A;  3OL2 A;  4QQE A;  4I79 A;  1S4U X;  2H6Q A;  3V9F A;  3EI2 B;  2HKR A;  3VH0 A;  2B4E A;  4O1Q D;  4AOW A;  4CY1 A;  4FA4 D;  1U4C A;  4IMM A;  4U1E I;  2YMU A;  3SBP A;  5EAL A;  2I0R A;  4J78 A;  2TRC B;  3AH8 B;  4GMB A;  4ZOV A;  4GZ8 A;  4LG8 A;  5GMK n;  3A0F A;  1N6E A;  1SQJ A;  5H1M A;  4FHL A;  4PBY A;  4ZN4 A;  2CNX A;  3I8E A;  4J82 A;  3AL9 A;  3DM0 A;  1PEV A;  3PXT D;  4GM9 A;  4HDJ A;  3CFS B;  3KRW B;  2MTA H;  2J55 H;  2J57 G;  2H3X A;  1XHM A;  4D0K A;  4L1Q D;  4XYI A;  2EBS A;  2Z2O A;  2AGZ A;  4FA9 D;  3RFH A;  2QXV A;  4FA5 D;  4OZU A;  3ORV D;  4ES0 A;  4X60 B;  3RFG A;  3V7D B;  3IKO A;  4J73 A;  4J8B A;  4YVD A;  2IUV A;  4ERZ A;  1R5M A;  4A11 B;  1SHY B;  5HE0 B;  5EMK B;  5GXH A;  5TEE A;  3I2N A;  3DSM A;  4GQ1 A;  5CXC A;  5EMM B;  4A0A A;  3IIY A;  5TEF A;  3SCY A;  5FKR A;  3OL2 B;  3I7K A;  1K8K C;  2HJ4 A;  4A7J A;  3F3P A;  3EU7 A;  4J86 A;  1TBG A;  4J84 A;  3BG0 A;  2CE9 A;  1OMW B;  4N14 A;  4CI1 A;  2PM9 A;  3VGZ A;  2HJB A;  4Y7R A;  5CXB B;  3RRM C;  1MG3 A;  3J80 g;  5IGO A;  3N0E A;  4CI3 A;  2AGY A;  5AJA A;  4X63 B;  4PBZ A;  2OK6 A;  4Z8L A;  4GM3 A;  2PM7 B;  3DXK C;  3EG6 A;  4O45 A;  1JMX B;  1ERJ A;  5H17 A;  5I5J A;  4GQB B;  4FAV D;  2PM9 B;  5TF2 A;  4GGD A;  4ZOY A;  3F3G A;  3SXT D;  2I3T A;  3N0D A;  2P9S C;  3MKS B;  4GQ2 P;  3PXS D;  4K3I D;  3I89 A;  3UKU C;  3OKT A;  3UVN A;  3DXM C;  5SXM A;  4CC9 A;  4A0B B;  2H68 A;  3SLE D;  1GG2 B;  2HES X;  3SWS D;  4JSX C;  1GP2 B;  3PVU B;  1N6D A;  4ERQ A;  5HQG A;  1RI6 A;  3GFC A;  5THA A;  5TDH B;  3SFZ A;  1QNI A;  3UVL A;  4E54 B;  2AGL A;  2CE8 A;  4CY2 A;  1YFQ A;  3ULE C;  3AL8 B;  2H6N A;  2IUR A;  2P9U C;  2I0S A;  1NEX B;  3SJL D;  1U2V C;  2YNN A;  2HYE A;  1Q47 A;  1PGU A;  4X61 B;  4H5I A;  3OKY A;  4D6V A;  2AH1 A;  1B9X A;  3OKW A;  1VYH C;  5K1C C;  3SBQ A;  3SVW D;  4J8G A;  3I8C A;  4XYH A;  1XKS A;  2XU7 A;  2AGX A;  5CXB A;  2W18 A;  4QT8 A;  4A11 A;  3EMH A;  3EI3 B;  4IA9 A;  1B9Y A;  4FWW A;  3IIW A;  3RLM D;  5EAP A;  1P22 A;  4AEZ A;  3JZH A; 
#chains in the Genus database with same CATH topology
 1I2M B;  1JMZ B;  4J81 A;  3BG1 A;  2UZX B;  4MMY A;  2YNP A;  1U8C A;  5CYK A;  2I0T A;  4PNK B;  3CIK B;  4NAA A;  2OVP B;  3FM0 A;  2PBI B;  2I3S A;  3K27 A;  5AFU 3;  3GRE A;  5EMJ B;  5I5M A;  2CO0 C;  3PE7 A;  3UKR C;  3OTT A;  4Y5R D;  4JSP C;  2XL2 A;  1UOO A;  3IJE A;  3KRX B;  4BCC A;  4A2M A;  1VE6 A;  5A2Q g;  5KDO B;  2H13 A;  5HYN B;  3MZL A;  2BCJ B;  4J87 A;  1GOG A;  3CFV A;  3DWL C;  2UZY B;  2IWK A;  4NEN A;  4R7A B;  4TZ4 A;  5CYK B;  3VI4 A;  4AX4 A;  1SQ9 A;  3EI4 A;  3RN1 D;  3F3F A;  3RMZ D;  1A0R B;  2H9P A;  4J0X A;  2OK4 A;  4E54 A;  5K19 A;  4RE6 A;  3O4G A;  3P4F A;  3EWE A;  4O3U B;  4QRJ A;  5EM2 A;  3MKQ A;  4AMZ A;  1NR0 A;  4U7A A;  2XL3 A;  4MK0 B;  2GNQ A;  4BUJ C;  5C2V B;  3BWS A;  5B4W A;  1JTD B;  2CO0 A;  3T3M A;  4CZX A;  3NID A;  3EQ9 A;  2VDO A;  4K3J B;  1JOF A;  5HDB A;  4E5Z A;  2IAA A;  2GC4 A;  3ZDZ A;  3L4M D;  3C9C A;  2PM6 B;  2OJY A;  2VDK A;  3IJ0 A;  2QC5 A;  1N6F A;  2H6K A;  3ZDY A;  3IUL A;  3OF7 A;  2OIZ A;  5AMS A;  5FKS A;  3IJ1 A;  3PXW D;  2P9L C;  5IJ7 E;  3I7H A;  1K32 A;  3E0C A;  1OLZ A;  1PBY B;  3AFC A;  1M1X A;  5GXI A;  4G1E A;  4BP8 A;  2BBK H;  2CN3 A;  4IRZ A;  5C9Z B;  3OKY B;  1QFM A;  2G9A A;  2VDN A;  4L3H D;  5FKQ A;  3MZK A;  4O02 A;  3ODT A;  2OVR B;  4GGA A;  3VA6 A;  2P9N C;  2YB8 B;  4O9D A;  4OWR A;  2IWF A;  4CY3 A;  1H2Y A;  1TYQ C;  5EAR A;  3EI1 A;  4J77 A;  3EI3 A;  2Q7Q A;  4JD2 C;  4ZOZ A;  2O9K A;  3OW8 A;  5FLX g;  3HFQ A;  3PSL A;  3W15 A;  3UVO A;  5GSA A;  5FKT A;  4BCD A;  3FRX A;  4CY5 A;  4A0B A;  4ZOX A;  4KFM B;  3I7O A;  1TYE A;  2HKM A;  5CXC B;  3U4Y A;  4LG9 A;  2GC7 A;  4NC4 A;  4A08 A;  1C9I A;  4BH6 A;  1FWX A;  5H14 A;  4A2L A;  3IUJ A;  4GM8 A;  5M61 A;  4EWR A;  2VZ1 A;  3T3P A;  3JRP A;  3GC3 B;  4A09 A;  3L4O D;  4CI8 A;  1A12 A;  2P9I C;  4L9O A;  3B7F A;  4FA1 D;  1UOP A;  2H14 A;  3RSE C;  2HU8 A;  2H47 A;  4RE5 A;  2J56 H;  2AGW A;  4GGC A;  4H5J A;  2CN2 A;  4MMZ A;  2OVQ B;  2B5M A;  1YR2 A;  5IGQ A;  5IJ8 E;  3EI4 B;  4XEI C;  4FB1 D;  2WQ8 A;  3EI2 A;  2XYI A;  4J0W A;  2BKL A;  4PSX B;  3JPX A;  2HXC A;  4MMX A;  3I7L A;  4L3G D;  5FFG A;  2H9N A;  3V4V A;  5M5V A;  3AL8 A;  2YNO A;  4JHP C;  3NIG A;  2G99 A;  4J79 A;  3MMY A;  4JT6 C;  2P9P C;  3PSC B;  3RN0 D;  5E6S A;  2VZ3 A;  3I7P A;  3I7N A;  4A0A B;  4JSN C;  4LGN A;  2B5N A;  3FGB A;  5E6U A;  1GOT B;  3UVM A;  4PXW A;  3SN6 B;  5I5I A;  3IUR A;  4FAN D;  4CZY A;  4ERY A;  5JWZ A;  1L0Q A;  2AH0 A;  2Z2P A;  3O4J A;  2Z2N A;  3O4H A;  4JT5 C;  4QL1 A;  1MG2 A;  4BL0 A;  3MXX A;  4WJK A;  5HE3 B;  3EI1 B;  3NVX A;  3C5M A;  5C86 A;  3SMR A;  3NVQ A;  3K26 A;  3K71 A;  3C75 H;  4O3T B;  3IJC A;  3JAM g;  2H9M A;  3IUN A;  3UVK A;  1GOH A;  5FQD A;  4ESG A;  3IUQ A;  4Z7Q A;  4PSW B;  4A08 B;  4PC0 A;  3V5W B;  4JSV C;  4NSX A;  1MDA H;  3GD1 I;  4CI2 A;  4WK0 A;  3K72 A;  1C9L A;  4A09 B;  1PI6 A;  3UR4 A;  5C2W B;  5EM2 B;  1JJU B;  4X3E A;  5C92 A;  3JZG A;  3SBR A;  4UI9 R;  5EML B;  5IT9 g;  3J81 g;  5FA5 B;  1GXR A;  5IC7 A;  5FXY A;  4AN0 A;  1E5T A;  3JB9 L;  4JXM A;  2VDP A;  2QZP A;  4CZV A;  4E5Z B;  3NVN A;  5HE2 B;  5HE1 B;  3ZWL B;  1GOF A;  3VI3 A;  2XDW A;  3EQ7 A;  2IUP A;  2H9L A;  2IUQ A;  1XIP A;  2P9K C;  3C99 A;  3JRO A;  4G56 B;  5EAM A;  4JHN A;  2B5L A;  2YBA A;  3PVW B;  3JZN A;  5E6R A;  3FCU A;  3SHF A;  2AQ5 A;  3OL2 A;  4QQE A;  4I79 A;  1BPO A;  1S4U X;  2H6Q A;  2VDL A;  3V9F A;  3EI2 B;  4NBM A;  2HKR A;  3VH0 A;  4AN1 A;  2B4E A;  4O1Q D;  5M5S A;  4AOW A;  4CY1 A;  4FA4 D;  1U4C A;  3MUO A;  4IMM A;  1VZ2 A;  4U1E I;  2YMU A;  3SBP A;  3ZDX A;  3O4I A;  2VC2 A;  2I0R A;  4J78 A;  5EAL A;  2TRC B;  3AH8 B;  4GMB A;  4GZ8 A;  4LG8 A;  4ZOV A;  3ZE0 A;  3DDU A;  5GMK n;  3A0F A;  1N6E A;  1SQJ A;  5H1M A;  2JKX A;  4FHL A;  4PBY A;  4ZN4 A;  2CNX A;  3I8E A;  4O2W A;  4J82 A;  3AL9 A;  3DM0 A;  1PEV A;  3PXT D;  4GM9 A;  4HDJ A;  3CFS B;  3KRW B;  2MTA H;  3ZE2 A;  4WK2 A;  2J55 H;  2J57 G;  2H3X A;  1XHM A;  4D0K A;  4L1Q D;  4XYI A;  2EBS A;  2Z2O A;  3IUM A;  4G1M A;  2AGZ A;  1VZ3 A;  4FA9 D;  1O6G A;  3RFH A;  2EID A;  3EQ8 A;  2QXV A;  4FA5 D;  1QFS A;  4OZU A;  2HU7 A;  3ORV D;  4ES0 A;  4X60 B;  3RFG A;  3V7D B;  3IKO A;  4J73 A;  4J8B A;  4YVD A;  2IUV A;  4ERZ A;  1R5M A;  4A11 B;  2XE4 A;  1SHY B;  5HE0 B;  5EMK B;  3MVD K;  4DNU A;  5GXH A;  5TEE A;  3I2N A;  4BCB A;  3DSM A;  3KCI A;  4GQ1 A;  5CXC A;  2EIC A;  5EMM B;  4A0A A;  3IIY A;  5TEF A;  3SCY A;  5FKR A;  3OL2 B;  4Z7N A;  3I7K A;  1K8K C;  2HJ4 A;  3ZE1 A;  4A7J A;  3F3P A;  3EU7 A;  4J86 A;  1TBG A;  2QR5 A;  4J84 A;  3BG0 A;  2CE9 A;  1K3I A;  1OMW B;  4N14 A;  4CI1 A;  3IVM A;  2PM9 A;  3VGZ A;  2HJB A;  4Y7R A;  5CXB B;  5M5R A;  3RRM C;  1MG3 A;  3J80 g;  3QI0 A;  1VE7 A;  1JV2 A;  3NIF A;  3N0E A;  5IGO A;  4CI3 A;  2AGY A;  5M5T A;  5AJA A;  2VDQ A;  4X63 B;  4PBZ A;  2OK6 A;  4WK4 A;  4Z8L A;  4GM3 A;  2PM7 B;  4QAM A;  3DXK C;  2VDM A;  3EG6 A;  4O45 A;  1JMX B;  1ERJ A;  5H17 A;  5I5J A;  4Z7O A;  4GQB B;  4FAV D;  2PM9 B;  5TF2 A;  2VDR A;  4GGD A;  4ZOY A;  3F3G A;  3SXT D;  1E8M A;  3QHY B;  2I3T A;  3N0D A;  5FFO A;  2EIB A;  2P9S C;  3MKS B;  4GQ2 P;  3PXS D;  4K3I D;  3I89 A;  1E8N A;  3V4P A;  3UKU C;  3OKT A;  3UVN A;  4UM9 A;  3DXM C;  5SXM A;  4CC9 A;  4A0B B;  2H68 A;  3MUN A;  1UOQ A;  3SLE D;  1GG2 B;  2HES X;  3SWS D;  2EIE A;  4UM8 A;  4JSX C;  1GP2 B;  3K6S A;  3PVU B;  1N6D A;  4ERQ A;  5HQG A;  4BP9 A;  1RI6 A;  3GFC A;  5THA A;  5TDH B;  3SFZ A;  1QNI A;  3UVL A;  4E54 B;  2AGL A;  4DNV A;  2CE8 A;  4CY2 A;  1YFQ A;  1O6F A;  3ULE C;  3AL8 B;  2H6N A;  2IUR A;  2P9U C;  2I0S A;  1NEX B;  3SJL D;  3FCS A;  4DNW A;  1U2V C;  1H2Z A;  2YNN A;  2HYE A;  1Q47 A;  1PGU A;  4X61 B;  1L5G A;  4H5I A;  3OKY A;  4D6V A;  2AH1 A;  1H2X A;  1B9X A;  3OKW A;  1VYH C;  5K1C C;  3SBQ A;  3SVW D;  4J8G A;  2XZG A;  3I8C A;  4G55 A;  4XYH A;  1T2X A;  1XKS A;  2XU7 A;  2AGX A;  4D9S A;  5CXB A;  2W18 A;  4QT8 A;  4A11 A;  3EMH A;  1H2W A;  3EI3 B;  4AMY A;  5M5U A;  4L1M A;  4IA9 A;  1UTC A;  1B9Y A;  4FWW A;  3IIW A;  3RLM D;  5EAP A;  1P22 A;  4AEZ A;  3JZH A;  2HU5 A; 
#chains in the Genus database with same CATH homology
 1JMZ B;  4J81 A;  3BG1 A;  2UZX B;  2YNP A;  5CYK A;  2I0T A;  4PNK B;  3CIK B;  2OVP B;  3FM0 A;  2PBI B;  2I3S A;  3K27 A;  5AFU 3;  3GRE A;  5EMJ B;  5I5M A;  2CO0 C;  3PE7 A;  3UKR C;  3OTT A;  4Y5R D;  4JSP C;  2XL2 A;  3KRX B;  4A2M A;  5A2Q g;  5KDO B;  2H13 A;  5HYN B;  2BCJ B;  3MZL A;  4J87 A;  3CFV A;  3DWL C;  2UZY B;  2IWK A;  4TZ4 A;  4R7A B;  5CYK B;  1SQ9 A;  3EI4 A;  3RN1 D;  3F3F A;  3RMZ D;  1A0R B;  2H9P A;  4J0X A;  2OK4 A;  4E54 A;  5K19 A;  3P4F A;  3EWE A;  4O3U B;  4QRJ A;  5EM2 A;  3MKQ A;  1NR0 A;  4U7A A;  2XL3 A;  4MK0 B;  2GNQ A;  4BUJ C;  5C2V B;  3BWS A;  5B4W A;  2CO0 A;  4CZX A;  4K3J B;  1JOF A;  4E5Z A;  2IAA A;  2GC4 A;  3L4M D;  3C9C A;  2PM6 B;  2OJY A;  3IJ0 A;  2QC5 A;  1N6F A;  2H6K A;  2OIZ A;  5AMS A;  5FKS A;  3IJ1 A;  3PXW D;  2P9L C;  5IJ7 E;  3I7H A;  1K32 A;  3E0C A;  1OLZ A;  1PBY B;  3AFC A;  5GXI A;  2BBK H;  2CN3 A;  5C9Z B;  3OKY B;  2G9A A;  4L3H D;  5FKQ A;  3MZK A;  3ODT A;  2OVR B;  4GGA A;  3VA6 A;  2P9N C;  2YB8 B;  4O9D A;  4OWR A;  2IWF A;  4CY3 A;  1TYQ C;  5EAR A;  3EI1 A;  4J77 A;  3EI3 A;  2Q7Q A;  4JD2 C;  4ZOZ A;  2O9K A;  3OW8 A;  5FLX g;  3HFQ A;  3PSL A;  3W15 A;  3UVO A;  5GSA A;  5FKT A;  3FRX A;  4CY5 A;  4A0B A;  4ZOX A;  4KFM B;  3I7O A;  2HKM A;  5CXC B;  3U4Y A;  4LG9 A;  2GC7 A;  4A08 A;  4BH6 A;  1FWX A;  5H14 A;  4A2L A;  4GM8 A;  4EWR A;  3JRP A;  4A09 A;  3L4O D;  4CI8 A;  2P9I C;  4L9O A;  3B7F A;  4FA1 D;  2H14 A;  3RSE C;  2H47 A;  2J56 H;  2AGW A;  4GGC A;  4H5J A;  2CN2 A;  2OVQ B;  2B5M A;  5IGQ A;  5IJ8 E;  3EI4 B;  4XEI C;  4FB1 D;  3EI2 A;  2XYI A;  4J0W A;  4PSX B;  3JPX A;  2HXC A;  3I7L A;  4L3G D;  2H9N A;  3AL8 A;  2YNO A;  2G99 A;  4J79 A;  3MMY A;  4JT6 C;  2P9P C;  3PSC B;  3RN0 D;  3I7P A;  3I7N A;  4A0A B;  4JSN C;  4LGN A;  2B5N A;  3FGB A;  1GOT B;  3UVM A;  4PXW A;  3SN6 B;  5I5I A;  4FAN D;  4CZY A;  4ERY A;  5JWZ A;  1L0Q A;  2AH0 A;  2Z2P A;  2Z2N A;  4JT5 C;  4QL1 A;  1MG2 A;  4BL0 A;  3MXX A;  5HE3 B;  3EI1 B;  3NVX A;  3C5M A;  3SMR A;  3NVQ A;  3K26 A;  3C75 H;  4O3T B;  3IJC A;  3JAM g;  2H9M A;  3UVK A;  5FQD A;  4ESG A;  4PSW B;  4A08 B;  4PC0 A;  3V5W B;  4JSV C;  4NSX A;  1MDA H;  4CI2 A;  4A09 B;  1PI6 A;  3UR4 A;  5C2W B;  5EM2 B;  1JJU B;  4X3E A;  3JZG A;  3SBR A;  4UI9 R;  5EML B;  5IT9 g;  3J81 g;  5FA5 B;  1GXR A;  5IC7 A;  5FXY A;  3JB9 L;  4JXM A;  4CZV A;  4E5Z B;  3NVN A;  5HE2 B;  5HE1 B;  3ZWL B;  2IUP A;  2H9L A;  2IUQ A;  1XIP A;  2P9K C;  3C99 A;  3JRO A;  4G56 B;  5EAM A;  2B5L A;  2YBA A;  3PVW B;  3JZN A;  3SHF A;  2AQ5 A;  3OL2 A;  4QQE A;  4I79 A;  1S4U X;  2H6Q A;  3V9F A;  3EI2 B;  2HKR A;  3VH0 A;  2B4E A;  4O1Q D;  4AOW A;  4CY1 A;  4FA4 D;  1U4C A;  4IMM A;  4U1E I;  2YMU A;  3SBP A;  5EAL A;  2I0R A;  4J78 A;  2TRC B;  3AH8 B;  4GMB A;  4ZOV A;  4GZ8 A;  4LG8 A;  5GMK n;  3A0F A;  1N6E A;  1SQJ A;  5H1M A;  4FHL A;  4PBY A;  4ZN4 A;  2CNX A;  3I8E A;  4J82 A;  3AL9 A;  3DM0 A;  1PEV A;  3PXT D;  4GM9 A;  4HDJ A;  3CFS B;  3KRW B;  2MTA H;  2J55 H;  2J57 G;  2H3X A;  1XHM A;  4D0K A;  4L1Q D;  4XYI A;  2EBS A;  2Z2O A;  2AGZ A;  4FA9 D;  3RFH A;  2QXV A;  4FA5 D;  4OZU A;  3ORV D;  4ES0 A;  4X60 B;  3RFG A;  3V7D B;  3IKO A;  4J73 A;  4J8B A;  4YVD A;  2IUV A;  4ERZ A;  1R5M A;  4A11 B;  1SHY B;  5HE0 B;  5EMK B;  5GXH A;  5TEE A;  3I2N A;  3DSM A;  4GQ1 A;  5CXC A;  5EMM B;  4A0A A;  3IIY A;  5TEF A;  3SCY A;  5FKR A;  3OL2 B;  3I7K A;  1K8K C;  2HJ4 A;  4A7J A;  3F3P A;  3EU7 A;  4J86 A;  1TBG A;  4J84 A;  3BG0 A;  2CE9 A;  1OMW B;  4N14 A;  4CI1 A;  2PM9 A;  3VGZ A;  2HJB A;  4Y7R A;  5CXB B;  3RRM C;  1MG3 A;  3J80 g;  5IGO A;  3N0E A;  4CI3 A;  2AGY A;  5AJA A;  4X63 B;  4PBZ A;  2OK6 A;  4Z8L A;  4GM3 A;  2PM7 B;  3DXK C;  3EG6 A;  4O45 A;  1JMX B;  1ERJ A;  5H17 A;  5I5J A;  4GQB B;  4FAV D;  2PM9 B;  5TF2 A;  4GGD A;  4ZOY A;  3F3G A;  3SXT D;  2I3T A;  3N0D A;  2P9S C;  3MKS B;  4GQ2 P;  3PXS D;  4K3I D;  3I89 A;  3UKU C;  3OKT A;  3UVN A;  3DXM C;  5SXM A;  4CC9 A;  4A0B B;  2H68 A;  3SLE D;  1GG2 B;  2HES X;  3SWS D;  4JSX C;  1GP2 B;  3PVU B;  1N6D A;  4ERQ A;  5HQG A;  1RI6 A;  3GFC A;  5THA A;  5TDH B;  3SFZ A;  1QNI A;  3UVL A;  4E54 B;  2AGL A;  2CE8 A;  4CY2 A;  1YFQ A;  3ULE C;  3AL8 B;  2H6N A;  2IUR A;  2P9U C;  2I0S A;  1NEX B;  3SJL D;  1U2V C;  2YNN A;  2HYE A;  1Q47 A;  1PGU A;  4X61 B;  4H5I A;  3OKY A;  4D6V A;  2AH1 A;  1B9X A;  3OKW A;  1VYH C;  5K1C C;  3SBQ A;  3SVW D;  4J8G A;  3I8C A;  4XYH A;  1XKS A;  2XU7 A;  2AGX A;  5CXB A;  2W18 A;  4QT8 A;  4A11 A;  3EMH A;  3EI3 B;  4IA9 A;  1B9Y A;  4FWW A;  3IIW A;  3RLM D;  5EAP A;  1P22 A;  4AEZ A;  3JZH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...