3UVMA

Crystal structure of wdr5 in complex with the wdr5-interacting motif of mll4
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
304
structure length
304
Chain Sequence
VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD repeat-containing protein 5
publication title The plasticity of WDR5 peptide-binding cleft enables the binding of the SET1 family of histone methyltransferases.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 103
structure length 304
sequence length 304
ec nomenclature
pdb deposition date 2011-11-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3uvmA00
3EI3A 1A0RB 3MZLA 1TBGA 3B7FA 3I7PA 1XHMA 2EBSA 3UKRC 2GNQA 1RI6A 5SXMA 3SMRA 3PXTD 4U7AA 3N0DA 4J73A 4PXWA 3MMYA 2AGXA 2BCJB 4XYIA 2GC7A 2B5MA 1XKSA 3EI2A 4J81A 3I7KA 1R5MA 4A11A 3OTTA 3EI4B 4Z8LA 3ZWLB 4L1QD 3F3FA 4JSVC 4R7AB 2CE9A 5IJ7E 2AH0A 3EI1B 3RN0D 3IJCA 5A2Qg 3GFCA 3RMZD 5EM2B 2AGZA 4U1EI 1L0QA 4A0BA 3CFSB 3GREA 1JJUB 4E5ZA 1SHYB 3AL8B 2HESX 4E54A 3IIWA 3OKWA 4A2MA 4A09B 4GM8A 4MK0B 5EMJB 3SFZA 5KDOB 2Z2OA 3IJ1A 4IMMA 4O1QD 2B4EA 4FA5D 3I7LA 4A0AA 4XYHA 3AFCA 4JSXC 2P9IC 4O9DA 1ERJA 3AL9A 3SLED 4PC0A 2AH1A 3SCYA 3IJ0A 3J81g 2CO0A 4GQ2P 1P22A 2XU7A 3UVNA 3V9FA 3SHFA 5C2WB 2B5LA 5HE2B 1SQJA 3FGBA 1PBYB 3CFVA 2I3TA 3RLMD 4CI1A 3VA6A 2P9PC 3J80g 2O9KA 1PI6A 1B9YA 4IA9A 4J79A 5IGOA 2P9KC 3I8EA 4LG9A 3EI4A 4CI8A 3EI1A 2XYIA 5C2VB 2OVPB 5GSAA 2XL2A 3RFGA 4KFMB 2PBIB 4CC9A 5EM2A 1GP2B 3OKTA 4A2LA 3EG6A 4K3JB 4GM3A 2H9LA 2UZXB 2YMUA 3AL8A 1PEVA 2IUPA 3L4MD 1OMWB 5H14A 3OW8A 3BG1A 5EMMB 5CXBB 5CXCB 5FKSA 4FA1D 4A09A 4NSXA 1XIPA 5TDHB 4A08B 3JZNA 4JT5C 3UVKA 2J57G 4X60B 2AGYA 3PSCB 1SQ9A 2CN2A 4PSWB 2CE8A 2IURA 2AQ5A 1NR0A 3NVXA 3E0CA 4H5IA 4CZXA 4GGAA 3SJLD 3K27A 5TF2A 2J55H 2HYEA 5I5IA 4QL1A 3BWSA 3I7NA 3UVLA 5CYKB 4EWRA 5EAMA 4LG8A 4J0XA 4ERZA 4XEIC 4BL0A 2P9LC 5AFU3 1N6DA 3JROA 4BH6A 2OK6A 4ZOXA 5C9ZB 3OL2B 2CNXA 5FA5B 4JSPC 4N14A 4L9OA 5FXYA 3AH8B 3ULEC 4JD2C 3DSMA 3L4OD 3V5WB 3EMHA 2PM7B 3K26A 1YFQA 3JB9L 5EAPA 4K3ID 5GMKn 3C5MA 4ERYA 2QXVA 4Y7RA 3I89A 5FLXg 4QQEA 4CY2A 3KRWB 5CXBA 5FKRA 4AEZA 2H3XA 4A08A 2OVRB 2W18A 1U2VC 5K19A 5FQDA 1MG3A 4LGNA 4X3EA 4FWWA 2MTAH 5IC7A 2PM9B 3OKYB 3I7OA 4GMBA 3SN6B 3UVMA 5HYNB 2YB8B 2H9NA 4ZOZA 2CN3A 2H47A 3VH0A 4CI2A 4GGCA 5THAA 1GXRA 4YVDA 4J87A 4FB1D 4L3GD 1MDAH 3SBQA 1N6FA 3PXSD 5AJAA 4PSXB 1GOTB 3FM0A 2Z2NA 3RN1D 1B9XA 1K8KC 4CY1A 5HQGA 4ZOVA 2HKRA 4A11B 4FA9D 3MKQA 1JMXB 4O45A 4FA4D 1K32A 2QC5A 3OL2A 1N6EA 3HFQA 1GG2B 4X63B 2IUQA 2YNNA 4JT6C 5EMKB 4A0BB 4ZN4A 4FAVD 3C99A 4UI9R 2CO0C 2H68A 4H5JA 4E5ZB 2IWKA 2I0RA 3CIKB 2OJYA 4J0WA 5AMSA 4JXMA 1QNIA 3VGZA 4BUJC 3IKOA 3DM0A 3SBRA 2IAAA 3JZHA 4J86A 1JOFA 2OVQB 3U4YA 4GQBB 4I79A 2PM6B 2PM9A 4GGDA 3OKYA 3ORVD 2P9NC 2I0TA 3UR4A 3JRPA 3ODTA 5TEEA 1OLZA 4TZ4A 2YNOA 3F3PA 5HE1B 5EARA 3PSLA 3UKUC 4J84A 2HXCA 5B4WA 3SVWD 2H6NA 2G99A 1TYQC 1U4CA 1PGUA 5IJ8E 2HJBA 3F3GA 2H9PA 3W15A 4L3HD 2H9MA 4J8BA 5EMLB 2Z2PA 3JPXA 2XL3A 3EU7A 4QRJA 4O3UB 3PXWD 3DXKC 2P9SC 3SBPA 5IT9g 5I5MA 5TEFA 2IUVA 3DWLC 3RFHA 4ZOYA 2H6QA 5GXIA 5CXCA 4CY3A 3BG0A 1FWXA 2Q7QA 3N0EA 4D6VA 4J78A 2OIZA 4HDJA 4FHLA 5GXHA 4OZUA 2OK4A 2G9AA 3UVOA 4CI3A 3SWSD 5HE0B 4GQ1A 2P9UC 4J77A 3EI3B 4CZYA 3JZGA 5IGQA 3NVNA 3P4FA 4OWRA 2TRCB 4A7JA 1JMZB 4ERQA 4PBYA 3V7DB 3PVUB 3SXTD 4D0KA 5CYKA 3EWEA 3PE7A 1Q47A 5K1CC 3EI2B 2HKMA 3DXMC 4Y5RD 2H14A 4AOWA 4O3TB 2J56H 3C9CA 3IIYA 3C75H 4QT8A 3I8CA 4ES0A 4J82A 2YNPA 3JAMg 2H13A 3MKSB 2YBAA 3NVQA 2AGLA 2B5NA 3PVWB 3RSEC 3I7HA 2UZYB 4E54B 5EALA 4ESGA 2GC4A 2I3SA 4PNKB 2BBKH 1VYHC 4GZ8A 4CY5A 5H17A 5I5JA 3A0FA 1MG2A 2AGWA 4PBZA 4J8GA 5H1MA 2H6KA 2HJ4A 3KRXB 4G56B 4A0AB 5JWZA 1NEXB 3FRXA 4FAND 5FKQA 5HE3B 4GM9A 3I2NA 2I0SA 4CZVA 2IWFA 4JSNC 4X61B 1S4UX 5FKTA 3MZKA 3RRMC 3MXXA
chains in the Genus database with same CATH superfamily
3EI3A 1A0RB 3MZLA 1TBGA 3B7FA 3I7PA 1XHMA 2EBSA 3UKRC 2GNQA 1UTCA 1UOQA 1RI6A 5SXMA 3SMRA 3PXTD 4U7AA 3N0DA 3O4JA 4J73A 2VZ3A 4PXWA 3MMYA 2AGXA 2BCJB 4G55A 4XYIA 1H2WA 2GC7A 2B5MA 1TYEA 3EQ9A 1XKSA 3EI2A 2EIBA 4J81A 4MMZA 4WK0A 3I7KA 1R5MA 4A11A 3OTTA 3EI4B 4Z8LA 3ZWLB 4L1QD 3F3FA 2VDRA 2EIEA 4JSVC 4R7AB 2CE9A 5IJ7E 2AH0A 3EI1B 3RN0D 3IJCA 4WK2A 5A2Qg 3GFCA 2VDLA 1JTDB 4BP9A 3RMZD 5EM2B 2AGZA 4U1EI 1L0QA 4A0BA 3CFSB 3GREA 1JJUB 1YR2A 3OF7A 4E5ZA 1SHYB 3AL8B 2HESX 4E54A 3IIWA 3OKWA 3MUNA 2XZGA 4A2MA 4A09B 3O4HA 4GM8A 4MK0B 5EMJB 3SFZA 5KDOB 2Z2OA 1I2MB 3IJ1A 4IMMA 4O1QD 1C9LA 2B4EA 3MVDK 4FA5D 3I7LA 4A0AA 4XYHA 3AFCA 4JSXC 2P9IC 4O9DA 2VDKA 1ERJA 3AL9A 3SLED 4PC0A 2AH1A 3SCYA 3K72A 3IJ0A 3J81g 2CO0A 4GQ2P 1P22A 2XU7A 3UVNA 3V9FA 3SHFA 5C2WB 2B5LA 5HE2B 1H2ZA 3IUJA 2VDMA 1SQJA 3FGBA 1PBYB 3CFVA 2I3TA 4BCDA 3RLMD 4CI1A 3VA6A 2P9PC 3J80g 2O9KA 1PI6A 1B9YA 4IA9A 4J79A 3K6SA 2EICA 5IGOA 2P9KC 3I8EA 4LG9A 3EI4A 4CI8A 3EI1A 2XYIA 5C2VB 4G1MA 3VI3A 2OVPB 5GSAA 2XL2A 4O02A 3RFGA 4KFMB 2PBIB 3FCUA 4CC9A 5EM2A 1GP2B 3OKTA 3T3PA 4A2LA 3EG6A 4K3JB 4GM3A 2H9LA 3IJEA 2XE4A 2UZXB 2YMUA 3AL8A 4DNUA 4L1MA 1PEVA 2IUPA 1QFSA 3L4MD 1OMWB 5H14A 3OW8A 3BG1A 5EMMB 5CXBB 5CXCB 5FKSA 4FA1D 4A09A 2QZPA 4NSXA 1XIPA 5TDHB 3IURA 4A08B 3DDUA 3JZNA 4JT5C 3UVKA 2J57G 4X60B 3ZDZA 2AGYA 3FCSA 3PSCB 1SQ9A 2CN2A 2HU8A 4PSWB 2CE8A 2IURA 2AQ5A 1NR0A 4O2WA 2BKLA 3NVXA 3E0CA 4H5IA 2EIDA 4CZXA 4GGAA 1VZ3A 4WJKA 3SJLD 3K27A 5TF2A 4Z7QA 3ZDXA 2J55H 2HYEA 5I5IA 2QR5A 4QL1A 3BWSA 3I7NA 3UVLA 4UM9A 5CYKB 4EWRA 5EAMA 3IUQA 4LG8A 4J0XA 4ERZA 4XEIC 4BL0A 2P9LC 1O6FA 5AFU3 3EQ7A 1N6DA 3JROA 4BH6A 2OK6A 5E6RA 4ZOXA 5C9ZB 3OL2B 2CNXA 5FA5B 4JSPC 4N14A 4L9OA 5FXYA 3AH8B 3ULEC 4JD2C 4JHPC 3DSMA 3L4OD 3V5WB 3EMHA 2PM7B 3K26A 1YFQA 3JB9L 5EAPA 1M1XA 4K3ID 5HDBA 1H2YA 5GMKn 3C5MA 1H2XA 4ERYA 2QXVA 4Y7RA 3I89A 5FLXg 4QQEA 4AN1A 4CY2A 3IUNA 3KRWB 5CXBA 5FKRA 4AEZA 2H3XA 4A08A 2OVRB 2W18A 1U2VC 5K19A 4QAMA 5M5SA 5FQDA 3KCIA 1MG3A 4LGNA 3IULA 4X3EA 4FWWA 2MTAH 5IC7A 2PM9B 3OKYB 3I7OA 4GMBA 3SN6B 3UVMA 3V4VA 5HYNB 2YB8B 5M5UA 2H9NA 4ZOZA 2CN3A 2H47A 3VH0A 4CI2A 4NC4A 4GGCA 1A12A 3IUMA 5THAA 1GXRA 4YVDA 4J87A 4FB1D 4L3GD 1MDAH 3SBQA 1N6FA 1E8MA 3PXSD 5AJAA 4PSXB 1GOTB 3FM0A 2Z2NA 3RN1D 1B9XA 1K8KC 4CY1A 3NIGA 2VDOA 1GOHA 5HQGA 4ZOVA 2HKRA 4A11B 4FA9D 3MKQA 3QHYB 1JMXB 3O4IA 5E6UA 4O45A 4FA4D 1K32A 2QC5A 3OL2A 1N6EA 1U8CA 1O6GA 3HFQA 4D9SA 1GG2B 4X63B 2IUQA 2YNNA 4JT6C 5EMKB 4A0BB 3ZE1A 4ZN4A 4FAVD 1JV2A 3C99A 4UI9R 2CO0C 2H68A 1VE7A 4H5JA 4BP8A 4E5ZB 2IWKA 1K3IA 2I0RA 3CIKB 4MMXA 2OJYA 4J0WA 1T2XA 5AMSA 4JXMA 1QNIA 1GOGA 3VGZA 4BUJC 3IKOA 3DM0A 3SBRA 2IAAA 4MMYA 3JZHA 4J86A 3T3MA 1JOFA 2OVQB 4UM8A 1VE6A 4G1EA 3U4YA 2VZ1A 4GQBB 1QFMA 4I79A 2PM6B 2PM9A 4GGDA 3K71A 3OKYA 3ORVD 2VDQA 2P9NC 2JKXA 1C9IA 2I0TA 5M5RA 3UR4A 1E8NA 3JRPA 3ODTA 5TEEA 1OLZA 4TZ4A 2YNOA 2HU7A 1L5GA 3F3PA 5HE1B 5EARA 3PSLA 3UKUC 1UOPA 3IVMA 4J84A 2HXCA 5B4WA 3ZDYA 3SVWD 2H6NA 1TYQC 2G99A 1U4CA 4NENA 1PGUA 4RE5A 4AMYA 4AN0A 5IJ8E 2HJBA 3F3GA 2H9PA 3W15A 4L3HD 2H9MA 4J8BA 5EMLB 2Z2PA 3JPXA 2XL3A 4RE6A 3EU7A 4QRJA 4O3UB 3PXWD 3DXKC 2P9SC 3SBPA 5IT9g 5I5MA 3EQ8A 3ZE2A 5TEFA 2IUVA 3DWLC 5FFOA 3RFHA 4ZOYA 2H6QA 4Z7OA 5GXIA 5CXCA 4CY3A 4NAAA 3BG0A 1FWXA 2Q7QA 3N0EA 4BCBA 4D6VA 4DNVA 4J78A 2OIZA 4HDJA 4FHLA 5GXHA 4OZUA 2OK4A 1BPOA 2G9AA 3UVOA 4BCCA 4CI3A 3SWSD 5HE0B 5FFGA 3V4PA 1UOOA 3GC3B 4GQ1A 2P9UC 4J77A 3EI3B 1E5TA 3MUOA 3JZGA 4CZYA 5M5VA 5IGQA 3NVNA 3O4GA 3P4FA 3NIFA 4OWRA 5C86A 2TRCB 4A7JA 1JMZB 4ERQA 3GD1I 3VI4A 4PBYA 3V7DB 3PVUB 3SXTD 4D0KA 5CYKA 3EWEA 3PE7A 1Q47A 4AX4A 5K1CC 3EI2B 2HKMA 2VDPA 3DXMC 4Y5RD 2H14A 4AOWA 4O3TB 2J56H 3NIDA 3QI0A 5M5TA 1GOFA 3C9CA 3IIYA 3C75H 4QT8A 3I8CA 4ES0A 4J82A 2YNPA 3JAMg 2H13A 3MKSB 5M61A 2HU5A 4AMZA 2YBAA 3NVQA 2AGLA 2B5NA 3PVWB 3RSEC 3I7HA 2UZYB 4Z7NA 4E54B 5EALA 4ESGA 2GC4A 2I3SA 4PNKB 4DNWA 2BBKH 1VYHC 2WQ8A 4GZ8A 4JHNA 5H17A 2VDNA 4CY5A 2VC2A 5I5JA 3A0FA 1MG2A 2AGWA 1VZ2A 4PBZA 5C92A 4NBMA 4WK4A 5E6SA 4J8GA 5H1MA 2H6KA 2HJ4A 3KRXB 4G56B 4A0AB 5JWZA 1NEXB 3FRXA 4FAND 5FKQA 5HE3B 2XDWA 4IRZA 4GM9A 3I2NA 2I0SA 4CZVA 2IWFA 4JSNC 4X61B 1S4UX 3ZE0A 5FKTA 3MZKA 3RRMC 3MXXA
chains in the Genus database with same CATH topology
3EI3A 1A0RB 3MZLA 1TBGA 3B7FA 3I7PA 1XHMA 2EBSA 3UKRC 2GNQA 1RI6A 5SXMA 3SMRA 3PXTD 4U7AA 3N0DA 4J73A 4PXWA 3MMYA 2AGXA 2BCJB 4XYIA 2GC7A 2B5MA 1XKSA 3EI2A 4J81A 3I7KA 1R5MA 4A11A 3OTTA 3EI4B 4Z8LA 3ZWLB 4L1QD 3F3FA 4JSVC 4R7AB 2CE9A 5IJ7E 2AH0A 3EI1B 3RN0D 3IJCA 5A2Qg 3GFCA 3RMZD 5EM2B 2AGZA 4U1EI 1L0QA 4A0BA 3CFSB 3GREA 1JJUB 4E5ZA 1SHYB 3AL8B 2HESX 4E54A 3IIWA 3OKWA 4A2MA 4A09B 4GM8A 4MK0B 5EMJB 3SFZA 5KDOB 2Z2OA 3IJ1A 4IMMA 4O1QD 2B4EA 4FA5D 3I7LA 4A0AA 4XYHA 3AFCA 4JSXC 2P9IC 4O9DA 1ERJA 3AL9A 3SLED 4PC0A 2AH1A 3SCYA 3IJ0A 3J81g 2CO0A 4GQ2P 1P22A 2XU7A 3UVNA 3V9FA 3SHFA 5C2WB 2B5LA 5HE2B 1SQJA 3FGBA 1PBYB 3CFVA 2I3TA 3RLMD 4CI1A 3VA6A 2P9PC 3J80g 2O9KA 1PI6A 1B9YA 4IA9A 4J79A 5IGOA 2P9KC 3I8EA 4LG9A 3EI4A 4CI8A 3EI1A 2XYIA 5C2VB 2OVPB 5GSAA 2XL2A 3RFGA 4KFMB 2PBIB 4CC9A 5EM2A 1GP2B 3OKTA 4A2LA 3EG6A 4K3JB 4GM3A 2H9LA 2UZXB 2YMUA 3AL8A 1PEVA 2IUPA 3L4MD 1OMWB 5H14A 3OW8A 3BG1A 5EMMB 5CXBB 5CXCB 5FKSA 4FA1D 4A09A 4NSXA 1XIPA 5TDHB 4A08B 3JZNA 4JT5C 3UVKA 2J57G 4X60B 2AGYA 3PSCB 1SQ9A 2CN2A 4PSWB 2CE8A 2IURA 2AQ5A 1NR0A 3NVXA 3E0CA 4H5IA 4CZXA 4GGAA 3SJLD 3K27A 5TF2A 2J55H 2HYEA 5I5IA 4QL1A 3BWSA 3I7NA 3UVLA 5CYKB 4EWRA 5EAMA 4LG8A 4J0XA 4ERZA 4XEIC 4BL0A 2P9LC 5AFU3 1N6DA 3JROA 4BH6A 2OK6A 4ZOXA 5C9ZB 3OL2B 2CNXA 5FA5B 4JSPC 4N14A 4L9OA 5FXYA 3AH8B 3ULEC 4JD2C 3DSMA 3L4OD 3V5WB 3EMHA 2PM7B 3K26A 1YFQA 3JB9L 5EAPA 4K3ID 5GMKn 3C5MA 4ERYA 2QXVA 4Y7RA 3I89A 5FLXg 4QQEA 4CY2A 3KRWB 5CXBA 5FKRA 4AEZA 2H3XA 4A08A 2OVRB 2W18A 1U2VC 5K19A 5FQDA 1MG3A 4LGNA 4X3EA 4FWWA 2MTAH 5IC7A 2PM9B 3OKYB 3I7OA 4GMBA 3SN6B 3UVMA 5HYNB 2YB8B 2H9NA 4ZOZA 2CN3A 2H47A 3VH0A 4CI2A 4GGCA 5THAA 1GXRA 4YVDA 4J87A 4FB1D 4L3GD 1MDAH 3SBQA 1N6FA 3PXSD 5AJAA 4PSXB 1GOTB 3FM0A 2Z2NA 3RN1D 1B9XA 1K8KC 4CY1A 5HQGA 4ZOVA 2HKRA 4A11B 4FA9D 3MKQA 1JMXB 4O45A 4FA4D 1K32A 2QC5A 3OL2A 1N6EA 3HFQA 1GG2B 4X63B 2IUQA 2YNNA 4JT6C 5EMKB 4A0BB 4ZN4A 4FAVD 3C99A 4UI9R 2CO0C 2H68A 4H5JA 4E5ZB 2IWKA 2I0RA 3CIKB 2OJYA 4J0WA 5AMSA 4JXMA 1QNIA 3VGZA 4BUJC 3IKOA 3DM0A 3SBRA 2IAAA 3JZHA 4J86A 1JOFA 2OVQB 3U4YA 4GQBB 4I79A 2PM6B 2PM9A 4GGDA 3OKYA 3ORVD 2P9NC 2I0TA 3UR4A 3JRPA 3ODTA 5TEEA 1OLZA 4TZ4A 2YNOA 3F3PA 5HE1B 5EARA 3PSLA 3UKUC 4J84A 2HXCA 5B4WA 3SVWD 2H6NA 2G99A 1TYQC 1U4CA 1PGUA 5IJ8E 2HJBA 3F3GA 2H9PA 3W15A 4L3HD 2H9MA 4J8BA 5EMLB 2Z2PA 3JPXA 2XL3A 3EU7A 4QRJA 4O3UB 3PXWD 3DXKC 2P9SC 3SBPA 5IT9g 5I5MA 5TEFA 2IUVA 3DWLC 3RFHA 4ZOYA 2H6QA 5GXIA 5CXCA 4CY3A 3BG0A 1FWXA 2Q7QA 3N0EA 4D6VA 4J78A 2OIZA 4HDJA 4FHLA 5GXHA 4OZUA 2OK4A 2G9AA 3UVOA 4CI3A 3SWSD 5HE0B 4GQ1A 2P9UC 4J77A 3EI3B 4CZYA 3JZGA 5IGQA 3NVNA 3P4FA 4OWRA 2TRCB 4A7JA 1JMZB 4ERQA 4PBYA 3V7DB 3PVUB 3SXTD 4D0KA 5CYKA 3EWEA 3PE7A 1Q47A 5K1CC 3EI2B 2HKMA 3DXMC 4Y5RD 2H14A 4AOWA 4O3TB 2J56H 3C9CA 3IIYA 3C75H 4QT8A 3I8CA 4ES0A 4J82A 2YNPA 3JAMg 2H13A 3MKSB 2YBAA 3NVQA 2AGLA 2B5NA 3PVWB 3RSEC 3I7HA 2UZYB 4E54B 5EALA 4ESGA 2GC4A 2I3SA 4PNKB 2BBKH 1VYHC 4GZ8A 4CY5A 5H17A 5I5JA 3A0FA 1MG2A 2AGWA 4PBZA 4J8GA 5H1MA 2H6KA 2HJ4A 3KRXB 4G56B 4A0AB 5JWZA 1NEXB 3FRXA 4FAND 5FKQA 5HE3B 4GM9A 3I2NA 2I0SA 4CZVA 2IWFA 4JSNC 4X61B 1S4UX 5FKTA 3MZKA 3RRMC 3MXXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EI3 A;  1A0R B;  3MZL A;  1TBG A;  3B7F A;  3I7P A;  1XHM A;  2EBS A;  3UKR C;  2GNQ A;  1RI6 A;  5SXM A;  3SMR A;  3PXT D;  4U7A A;  3N0D A;  4J73 A;  4PXW A;  3MMY A;  2AGX A;  2BCJ B;  4XYI A;  2GC7 A;  2B5M A;  1XKS A;  3EI2 A;  4J81 A;  3I7K A;  1R5M A;  4A11 A;  3OTT A;  3EI4 B;  4Z8L A;  3ZWL B;  4L1Q D;  3F3F A;  4JSV C;  4R7A B;  2CE9 A;  5IJ7 E;  2AH0 A;  3EI1 B;  3RN0 D;  3IJC A;  5A2Q g;  3GFC A;  3RMZ D;  5EM2 B;  2AGZ A;  4U1E I;  1L0Q A;  4A0B A;  3CFS B;  3GRE A;  1JJU B;  4E5Z A;  1SHY B;  3AL8 B;  2HES X;  4E54 A;  3IIW A;  3OKW A;  4A2M A;  4A09 B;  4GM8 A;  4MK0 B;  5EMJ B;  3SFZ A;  5KDO B;  2Z2O A;  3IJ1 A;  4IMM A;  4O1Q D;  2B4E A;  4FA5 D;  3I7L A;  4A0A A;  4XYH A;  3AFC A;  4JSX C;  2P9I C;  4O9D A;  1ERJ A;  3AL9 A;  3SLE D;  4PC0 A;  2AH1 A;  3SCY A;  3IJ0 A;  3J81 g;  2CO0 A;  4GQ2 P;  1P22 A;  2XU7 A;  3UVN A;  3V9F A;  3SHF A;  5C2W B;  2B5L A;  5HE2 B;  1SQJ A;  3FGB A;  1PBY B;  3CFV A;  2I3T A;  3RLM D;  4CI1 A;  3VA6 A;  2P9P C;  3J80 g;  2O9K A;  1PI6 A;  1B9Y A;  4IA9 A;  4J79 A;  5IGO A;  2P9K C;  3I8E A;  4LG9 A;  3EI4 A;  4CI8 A;  3EI1 A;  2XYI A;  5C2V B;  2OVP B;  5GSA A;  2XL2 A;  3RFG A;  4KFM B;  2PBI B;  4CC9 A;  5EM2 A;  1GP2 B;  3OKT A;  4A2L A;  3EG6 A;  4K3J B;  4GM3 A;  2H9L A;  2UZX B;  2YMU A;  3AL8 A;  1PEV A;  2IUP A;  3L4M D;  1OMW B;  5H14 A;  3OW8 A;  3BG1 A;  5EMM B;  5CXB B;  5CXC B;  5FKS A;  4FA1 D;  4A09 A;  4NSX A;  1XIP A;  5TDH B;  4A08 B;  3JZN A;  4JT5 C;  3UVK A;  2J57 G;  4X60 B;  2AGY A;  3PSC B;  1SQ9 A;  2CN2 A;  4PSW B;  2CE8 A;  2IUR A;  2AQ5 A;  1NR0 A;  3NVX A;  3E0C A;  4H5I A;  4CZX A;  4GGA A;  3SJL D;  3K27 A;  5TF2 A;  2J55 H;  2HYE A;  5I5I A;  4QL1 A;  3BWS A;  3I7N A;  3UVL A;  5CYK B;  4EWR A;  5EAM A;  4LG8 A;  4J0X A;  4ERZ A;  4XEI C;  4BL0 A;  2P9L C;  5AFU 3;  1N6D A;  3JRO A;  4BH6 A;  2OK6 A;  4ZOX A;  5C9Z B;  3OL2 B;  2CNX A;  5FA5 B;  4JSP C;  4N14 A;  4L9O A;  5FXY A;  3AH8 B;  3ULE C;  4JD2 C;  3DSM A;  3L4O D;  3V5W B;  3EMH A;  2PM7 B;  3K26 A;  1YFQ A;  3JB9 L;  5EAP A;  4K3I D;  5GMK n;  3C5M A;  4ERY A;  2QXV A;  4Y7R A;  3I89 A;  5FLX g;  4QQE A;  4CY2 A;  3KRW B;  5CXB A;  5FKR A;  4AEZ A;  2H3X A;  4A08 A;  2OVR B;  2W18 A;  1U2V C;  5K19 A;  5FQD A;  1MG3 A;  4LGN A;  4X3E A;  4FWW A;  2MTA H;  5IC7 A;  2PM9 B;  3OKY B;  3I7O A;  4GMB A;  3SN6 B;  3UVM A;  5HYN B;  2YB8 B;  2H9N A;  4ZOZ A;  2CN3 A;  2H47 A;  3VH0 A;  4CI2 A;  4GGC A;  5THA A;  1GXR A;  4YVD A;  4J87 A;  4FB1 D;  4L3G D;  1MDA H;  3SBQ A;  1N6F A;  3PXS D;  5AJA A;  4PSX B;  1GOT B;  3FM0 A;  2Z2N A;  3RN1 D;  1B9X A;  1K8K C;  4CY1 A;  5HQG A;  4ZOV A;  2HKR A;  4A11 B;  4FA9 D;  3MKQ A;  1JMX B;  4O45 A;  4FA4 D;  1K32 A;  2QC5 A;  3OL2 A;  1N6E A;  3HFQ A;  1GG2 B;  4X63 B;  2IUQ A;  2YNN A;  4JT6 C;  5EMK B;  4A0B B;  4ZN4 A;  4FAV D;  3C99 A;  4UI9 R;  2CO0 C;  2H68 A;  4H5J A;  4E5Z B;  2IWK A;  2I0R A;  3CIK B;  2OJY A;  4J0W A;  5AMS A;  4JXM A;  1QNI A;  3VGZ A;  4BUJ C;  3IKO A;  3DM0 A;  3SBR A;  2IAA A;  3JZH A;  4J86 A;  1JOF A;  2OVQ B;  3U4Y A;  4GQB B;  4I79 A;  2PM6 B;  2PM9 A;  4GGD A;  3OKY A;  3ORV D;  2P9N C;  2I0T A;  3UR4 A;  3JRP A;  3ODT A;  5TEE A;  1OLZ A;  4TZ4 A;  2YNO A;  3F3P A;  5HE1 B;  5EAR A;  3PSL A;  3UKU C;  4J84 A;  2HXC A;  5B4W A;  3SVW D;  2H6N A;  2G99 A;  1TYQ C;  1U4C A;  1PGU A;  5IJ8 E;  2HJB A;  3F3G A;  2H9P A;  3W15 A;  4L3H D;  2H9M A;  4J8B A;  5EML B;  2Z2P A;  3JPX A;  2XL3 A;  3EU7 A;  4QRJ A;  4O3U B;  3PXW D;  3DXK C;  2P9S C;  3SBP A;  5IT9 g;  5I5M A;  5TEF A;  2IUV A;  3DWL C;  3RFH A;  4ZOY A;  2H6Q A;  5GXI A;  5CXC A;  4CY3 A;  3BG0 A;  1FWX A;  2Q7Q A;  3N0E A;  4D6V A;  4J78 A;  2OIZ A;  4HDJ A;  4FHL A;  5GXH A;  4OZU A;  2OK4 A;  2G9A A;  3UVO A;  4CI3 A;  3SWS D;  5HE0 B;  4GQ1 A;  2P9U C;  4J77 A;  3EI3 B;  4CZY A;  3JZG A;  5IGQ A;  3NVN A;  3P4F A;  4OWR A;  2TRC B;  4A7J A;  1JMZ B;  4ERQ A;  4PBY A;  3V7D B;  3PVU B;  3SXT D;  4D0K A;  5CYK A;  3EWE A;  3PE7 A;  1Q47 A;  5K1C C;  3EI2 B;  2HKM A;  3DXM C;  4Y5R D;  2H14 A;  4AOW A;  4O3T B;  2J56 H;  3C9C A;  3IIY A;  3C75 H;  4QT8 A;  3I8C A;  4ES0 A;  4J82 A;  2YNP A;  3JAM g;  2H13 A;  3MKS B;  2YBA A;  3NVQ A;  2AGL A;  2B5N A;  3PVW B;  3RSE C;  3I7H A;  2UZY B;  4E54 B;  5EAL A;  4ESG A;  2GC4 A;  2I3S A;  4PNK B;  2BBK H;  1VYH C;  4GZ8 A;  4CY5 A;  5H17 A;  5I5J A;  3A0F A;  1MG2 A;  2AGW A;  4PBZ A;  4J8G A;  5H1M A;  2H6K A;  2HJ4 A;  3KRX B;  4G56 B;  4A0A B;  5JWZ A;  1NEX B;  3FRX A;  4FAN D;  5FKQ A;  5HE3 B;  4GM9 A;  3I2N A;  2I0S A;  4CZV A;  2IWF A;  4JSN C;  4X61 B;  1S4U X;  5FKT A;  3MZK A;  3RRM C;  3MXX A; 
#chains in the Genus database with same CATH topology
 3EI3 A;  1A0R B;  3MZL A;  1TBG A;  3B7F A;  3I7P A;  1XHM A;  2EBS A;  3UKR C;  2GNQ A;  1UTC A;  1UOQ A;  1RI6 A;  5SXM A;  3SMR A;  3PXT D;  4U7A A;  3N0D A;  3O4J A;  4J73 A;  2VZ3 A;  4PXW A;  3MMY A;  2AGX A;  2BCJ B;  4G55 A;  4XYI A;  1H2W A;  2GC7 A;  2B5M A;  1TYE A;  3EQ9 A;  1XKS A;  3EI2 A;  2EIB A;  4J81 A;  4MMZ A;  4WK0 A;  3I7K A;  1R5M A;  4A11 A;  3OTT A;  3EI4 B;  4Z8L A;  3ZWL B;  4L1Q D;  3F3F A;  2VDR A;  2EIE A;  4JSV C;  4R7A B;  2CE9 A;  5IJ7 E;  2AH0 A;  3EI1 B;  3RN0 D;  3IJC A;  4WK2 A;  5A2Q g;  3GFC A;  2VDL A;  1JTD B;  4BP9 A;  3RMZ D;  5EM2 B;  2AGZ A;  4U1E I;  1L0Q A;  4A0B A;  3CFS B;  3GRE A;  1JJU B;  1YR2 A;  3OF7 A;  4E5Z A;  1SHY B;  3AL8 B;  2HES X;  4E54 A;  3IIW A;  3OKW A;  3MUN A;  2XZG A;  4A2M A;  4A09 B;  3O4H A;  4GM8 A;  4MK0 B;  5EMJ B;  3SFZ A;  5KDO B;  2Z2O A;  1I2M B;  3IJ1 A;  4IMM A;  4O1Q D;  1C9L A;  2B4E A;  3MVD K;  4FA5 D;  3I7L A;  4A0A A;  4XYH A;  3AFC A;  4JSX C;  2P9I C;  4O9D A;  2VDK A;  1ERJ A;  3AL9 A;  3SLE D;  4PC0 A;  2AH1 A;  3SCY A;  3K72 A;  3IJ0 A;  3J81 g;  2CO0 A;  4GQ2 P;  1P22 A;  2XU7 A;  3UVN A;  3V9F A;  3SHF A;  5C2W B;  2B5L A;  5HE2 B;  1H2Z A;  3IUJ A;  2VDM A;  1SQJ A;  3FGB A;  1PBY B;  3CFV A;  2I3T A;  4BCD A;  3RLM D;  4CI1 A;  3VA6 A;  2P9P C;  3J80 g;  2O9K A;  1PI6 A;  1B9Y A;  4IA9 A;  4J79 A;  3K6S A;  2EIC A;  5IGO A;  2P9K C;  3I8E A;  4LG9 A;  3EI4 A;  4CI8 A;  3EI1 A;  2XYI A;  5C2V B;  4G1M A;  3VI3 A;  2OVP B;  5GSA A;  2XL2 A;  4O02 A;  3RFG A;  4KFM B;  2PBI B;  3FCU A;  4CC9 A;  5EM2 A;  1GP2 B;  3OKT A;  3T3P A;  4A2L A;  3EG6 A;  4K3J B;  4GM3 A;  2H9L A;  3IJE A;  2XE4 A;  2UZX B;  2YMU A;  3AL8 A;  4DNU A;  4L1M A;  1PEV A;  2IUP A;  1QFS A;  3L4M D;  1OMW B;  5H14 A;  3OW8 A;  3BG1 A;  5EMM B;  5CXB B;  5CXC B;  5FKS A;  4FA1 D;  4A09 A;  2QZP A;  4NSX A;  1XIP A;  5TDH B;  3IUR A;  4A08 B;  3DDU A;  3JZN A;  4JT5 C;  3UVK A;  2J57 G;  4X60 B;  3ZDZ A;  2AGY A;  3FCS A;  3PSC B;  1SQ9 A;  2CN2 A;  2HU8 A;  4PSW B;  2CE8 A;  2IUR A;  2AQ5 A;  1NR0 A;  4O2W A;  2BKL A;  3NVX A;  3E0C A;  4H5I A;  2EID A;  4CZX A;  4GGA A;  1VZ3 A;  4WJK A;  3SJL D;  3K27 A;  5TF2 A;  4Z7Q A;  3ZDX A;  2J55 H;  2HYE A;  5I5I A;  2QR5 A;  4QL1 A;  3BWS A;  3I7N A;  3UVL A;  4UM9 A;  5CYK B;  4EWR A;  5EAM A;  3IUQ A;  4LG8 A;  4J0X A;  4ERZ A;  4XEI C;  4BL0 A;  2P9L C;  1O6F A;  5AFU 3;  3EQ7 A;  1N6D A;  3JRO A;  4BH6 A;  2OK6 A;  5E6R A;  4ZOX A;  5C9Z B;  3OL2 B;  2CNX A;  5FA5 B;  4JSP C;  4N14 A;  4L9O A;  5FXY A;  3AH8 B;  3ULE C;  4JD2 C;  4JHP C;  3DSM A;  3L4O D;  3V5W B;  3EMH A;  2PM7 B;  3K26 A;  1YFQ A;  3JB9 L;  5EAP A;  1M1X A;  4K3I D;  5HDB A;  1H2Y A;  5GMK n;  3C5M A;  1H2X A;  4ERY A;  2QXV A;  4Y7R A;  3I89 A;  5FLX g;  4QQE A;  4AN1 A;  4CY2 A;  3IUN A;  3KRW B;  5CXB A;  5FKR A;  4AEZ A;  2H3X A;  4A08 A;  2OVR B;  2W18 A;  1U2V C;  5K19 A;  4QAM A;  5M5S A;  5FQD A;  3KCI A;  1MG3 A;  4LGN A;  3IUL A;  4X3E A;  4FWW A;  2MTA H;  5IC7 A;  2PM9 B;  3OKY B;  3I7O A;  4GMB A;  3SN6 B;  3UVM A;  3V4V A;  5HYN B;  2YB8 B;  5M5U A;  2H9N A;  4ZOZ A;  2CN3 A;  2H47 A;  3VH0 A;  4CI2 A;  4NC4 A;  4GGC A;  1A12 A;  3IUM A;  5THA A;  1GXR A;  4YVD A;  4J87 A;  4FB1 D;  4L3G D;  1MDA H;  3SBQ A;  1N6F A;  1E8M A;  3PXS D;  5AJA A;  4PSX B;  1GOT B;  3FM0 A;  2Z2N A;  3RN1 D;  1B9X A;  1K8K C;  4CY1 A;  3NIG A;  2VDO A;  1GOH A;  5HQG A;  4ZOV A;  2HKR A;  4A11 B;  4FA9 D;  3MKQ A;  3QHY B;  1JMX B;  3O4I A;  5E6U A;  4O45 A;  4FA4 D;  1K32 A;  2QC5 A;  3OL2 A;  1N6E A;  1U8C A;  1O6G A;  3HFQ A;  4D9S A;  1GG2 B;  4X63 B;  2IUQ A;  2YNN A;  4JT6 C;  5EMK B;  4A0B B;  3ZE1 A;  4ZN4 A;  4FAV D;  1JV2 A;  3C99 A;  4UI9 R;  2CO0 C;  2H68 A;  1VE7 A;  4H5J A;  4BP8 A;  4E5Z B;  2IWK A;  1K3I A;  2I0R A;  3CIK B;  4MMX A;  2OJY A;  4J0W A;  1T2X A;  5AMS A;  4JXM A;  1QNI A;  1GOG A;  3VGZ A;  4BUJ C;  3IKO A;  3DM0 A;  3SBR A;  2IAA A;  4MMY A;  3JZH A;  4J86 A;  3T3M A;  1JOF A;  2OVQ B;  4UM8 A;  1VE6 A;  4G1E A;  3U4Y A;  2VZ1 A;  4GQB B;  1QFM A;  4I79 A;  2PM6 B;  2PM9 A;  4GGD A;  3K71 A;  3OKY A;  3ORV D;  2VDQ A;  2P9N C;  2JKX A;  1C9I A;  2I0T A;  5M5R A;  3UR4 A;  1E8N A;  3JRP A;  3ODT A;  5TEE A;  1OLZ A;  4TZ4 A;  2YNO A;  2HU7 A;  1L5G A;  3F3P A;  5HE1 B;  5EAR A;  3PSL A;  3UKU C;  1UOP A;  3IVM A;  4J84 A;  2HXC A;  5B4W A;  3ZDY A;  3SVW D;  2H6N A;  1TYQ C;  2G99 A;  1U4C A;  4NEN A;  1PGU A;  4RE5 A;  4AMY A;  4AN0 A;  5IJ8 E;  2HJB A;  3F3G A;  2H9P A;  3W15 A;  4L3H D;  2H9M A;  4J8B A;  5EML B;  2Z2P A;  3JPX A;  2XL3 A;  4RE6 A;  3EU7 A;  4QRJ A;  4O3U B;  3PXW D;  3DXK C;  2P9S C;  3SBP A;  5IT9 g;  5I5M A;  3EQ8 A;  3ZE2 A;  5TEF A;  2IUV A;  3DWL C;  5FFO A;  3RFH A;  4ZOY A;  2H6Q A;  4Z7O A;  5GXI A;  5CXC A;  4CY3 A;  4NAA A;  3BG0 A;  1FWX A;  2Q7Q A;  3N0E A;  4BCB A;  4D6V A;  4DNV A;  4J78 A;  2OIZ A;  4HDJ A;  4FHL A;  5GXH A;  4OZU A;  2OK4 A;  1BPO A;  2G9A A;  3UVO A;  4BCC A;  4CI3 A;  3SWS D;  5HE0 B;  5FFG A;  3V4P A;  1UOO A;  3GC3 B;  4GQ1 A;  2P9U C;  4J77 A;  3EI3 B;  1E5T A;  3MUO A;  3JZG A;  4CZY A;  5M5V A;  5IGQ A;  3NVN A;  3O4G A;  3P4F A;  3NIF A;  4OWR A;  5C86 A;  2TRC B;  4A7J A;  1JMZ B;  4ERQ A;  3GD1 I;  3VI4 A;  4PBY A;  3V7D B;  3PVU B;  3SXT D;  4D0K A;  5CYK A;  3EWE A;  3PE7 A;  1Q47 A;  4AX4 A;  5K1C C;  3EI2 B;  2HKM A;  2VDP A;  3DXM C;  4Y5R D;  2H14 A;  4AOW A;  4O3T B;  2J56 H;  3NID A;  3QI0 A;  5M5T A;  1GOF A;  3C9C A;  3IIY A;  3C75 H;  4QT8 A;  3I8C A;  4ES0 A;  4J82 A;  2YNP A;  3JAM g;  2H13 A;  3MKS B;  5M61 A;  2HU5 A;  4AMZ A;  2YBA A;  3NVQ A;  2AGL A;  2B5N A;  3PVW B;  3RSE C;  3I7H A;  2UZY B;  4Z7N A;  4E54 B;  5EAL A;  4ESG A;  2GC4 A;  2I3S A;  4PNK B;  4DNW A;  2BBK H;  1VYH C;  2WQ8 A;  4GZ8 A;  4JHN A;  5H17 A;  2VDN A;  4CY5 A;  2VC2 A;  5I5J A;  3A0F A;  1MG2 A;  2AGW A;  1VZ2 A;  4PBZ A;  5C92 A;  4NBM A;  4WK4 A;  5E6S A;  4J8G A;  5H1M A;  2H6K A;  2HJ4 A;  3KRX B;  4G56 B;  4A0A B;  5JWZ A;  1NEX B;  3FRX A;  4FAN D;  5FKQ A;  5HE3 B;  2XDW A;  4IRZ A;  4GM9 A;  3I2N A;  2I0S A;  4CZV A;  2IWF A;  4JSN C;  4X61 B;  1S4U X;  3ZE0 A;  5FKT A;  3MZK A;  3RRM C;  3MXX A; 
#chains in the Genus database with same CATH homology
 3EI3 A;  1A0R B;  3MZL A;  1TBG A;  3B7F A;  3I7P A;  1XHM A;  2EBS A;  3UKR C;  2GNQ A;  1RI6 A;  5SXM A;  3SMR A;  3PXT D;  4U7A A;  3N0D A;  4J73 A;  4PXW A;  3MMY A;  2AGX A;  2BCJ B;  4XYI A;  2GC7 A;  2B5M A;  1XKS A;  3EI2 A;  4J81 A;  3I7K A;  1R5M A;  4A11 A;  3OTT A;  3EI4 B;  4Z8L A;  3ZWL B;  4L1Q D;  3F3F A;  4JSV C;  4R7A B;  2CE9 A;  5IJ7 E;  2AH0 A;  3EI1 B;  3RN0 D;  3IJC A;  5A2Q g;  3GFC A;  3RMZ D;  5EM2 B;  2AGZ A;  4U1E I;  1L0Q A;  4A0B A;  3CFS B;  3GRE A;  1JJU B;  4E5Z A;  1SHY B;  3AL8 B;  2HES X;  4E54 A;  3IIW A;  3OKW A;  4A2M A;  4A09 B;  4GM8 A;  4MK0 B;  5EMJ B;  3SFZ A;  5KDO B;  2Z2O A;  3IJ1 A;  4IMM A;  4O1Q D;  2B4E A;  4FA5 D;  3I7L A;  4A0A A;  4XYH A;  3AFC A;  4JSX C;  2P9I C;  4O9D A;  1ERJ A;  3AL9 A;  3SLE D;  4PC0 A;  2AH1 A;  3SCY A;  3IJ0 A;  3J81 g;  2CO0 A;  4GQ2 P;  1P22 A;  2XU7 A;  3UVN A;  3V9F A;  3SHF A;  5C2W B;  2B5L A;  5HE2 B;  1SQJ A;  3FGB A;  1PBY B;  3CFV A;  2I3T A;  3RLM D;  4CI1 A;  3VA6 A;  2P9P C;  3J80 g;  2O9K A;  1PI6 A;  1B9Y A;  4IA9 A;  4J79 A;  5IGO A;  2P9K C;  3I8E A;  4LG9 A;  3EI4 A;  4CI8 A;  3EI1 A;  2XYI A;  5C2V B;  2OVP B;  5GSA A;  2XL2 A;  3RFG A;  4KFM B;  2PBI B;  4CC9 A;  5EM2 A;  1GP2 B;  3OKT A;  4A2L A;  3EG6 A;  4K3J B;  4GM3 A;  2H9L A;  2UZX B;  2YMU A;  3AL8 A;  1PEV A;  2IUP A;  3L4M D;  1OMW B;  5H14 A;  3OW8 A;  3BG1 A;  5EMM B;  5CXB B;  5CXC B;  5FKS A;  4FA1 D;  4A09 A;  4NSX A;  1XIP A;  5TDH B;  4A08 B;  3JZN A;  4JT5 C;  3UVK A;  2J57 G;  4X60 B;  2AGY A;  3PSC B;  1SQ9 A;  2CN2 A;  4PSW B;  2CE8 A;  2IUR A;  2AQ5 A;  1NR0 A;  3NVX A;  3E0C A;  4H5I A;  4CZX A;  4GGA A;  3SJL D;  3K27 A;  5TF2 A;  2J55 H;  2HYE A;  5I5I A;  4QL1 A;  3BWS A;  3I7N A;  3UVL A;  5CYK B;  4EWR A;  5EAM A;  4LG8 A;  4J0X A;  4ERZ A;  4XEI C;  4BL0 A;  2P9L C;  5AFU 3;  1N6D A;  3JRO A;  4BH6 A;  2OK6 A;  4ZOX A;  5C9Z B;  3OL2 B;  2CNX A;  5FA5 B;  4JSP C;  4N14 A;  4L9O A;  5FXY A;  3AH8 B;  3ULE C;  4JD2 C;  3DSM A;  3L4O D;  3V5W B;  3EMH A;  2PM7 B;  3K26 A;  1YFQ A;  3JB9 L;  5EAP A;  4K3I D;  5GMK n;  3C5M A;  4ERY A;  2QXV A;  4Y7R A;  3I89 A;  5FLX g;  4QQE A;  4CY2 A;  3KRW B;  5CXB A;  5FKR A;  4AEZ A;  2H3X A;  4A08 A;  2OVR B;  2W18 A;  1U2V C;  5K19 A;  5FQD A;  1MG3 A;  4LGN A;  4X3E A;  4FWW A;  2MTA H;  5IC7 A;  2PM9 B;  3OKY B;  3I7O A;  4GMB A;  3SN6 B;  3UVM A;  5HYN B;  2YB8 B;  2H9N A;  4ZOZ A;  2CN3 A;  2H47 A;  3VH0 A;  4CI2 A;  4GGC A;  5THA A;  1GXR A;  4YVD A;  4J87 A;  4FB1 D;  4L3G D;  1MDA H;  3SBQ A;  1N6F A;  3PXS D;  5AJA A;  4PSX B;  1GOT B;  3FM0 A;  2Z2N A;  3RN1 D;  1B9X A;  1K8K C;  4CY1 A;  5HQG A;  4ZOV A;  2HKR A;  4A11 B;  4FA9 D;  3MKQ A;  1JMX B;  4O45 A;  4FA4 D;  1K32 A;  2QC5 A;  3OL2 A;  1N6E A;  3HFQ A;  1GG2 B;  4X63 B;  2IUQ A;  2YNN A;  4JT6 C;  5EMK B;  4A0B B;  4ZN4 A;  4FAV D;  3C99 A;  4UI9 R;  2CO0 C;  2H68 A;  4H5J A;  4E5Z B;  2IWK A;  2I0R A;  3CIK B;  2OJY A;  4J0W A;  5AMS A;  4JXM A;  1QNI A;  3VGZ A;  4BUJ C;  3IKO A;  3DM0 A;  3SBR A;  2IAA A;  3JZH A;  4J86 A;  1JOF A;  2OVQ B;  3U4Y A;  4GQB B;  4I79 A;  2PM6 B;  2PM9 A;  4GGD A;  3OKY A;  3ORV D;  2P9N C;  2I0T A;  3UR4 A;  3JRP A;  3ODT A;  5TEE A;  1OLZ A;  4TZ4 A;  2YNO A;  3F3P A;  5HE1 B;  5EAR A;  3PSL A;  3UKU C;  4J84 A;  2HXC A;  5B4W A;  3SVW D;  2H6N A;  2G99 A;  1TYQ C;  1U4C A;  1PGU A;  5IJ8 E;  2HJB A;  3F3G A;  2H9P A;  3W15 A;  4L3H D;  2H9M A;  4J8B A;  5EML B;  2Z2P A;  3JPX A;  2XL3 A;  3EU7 A;  4QRJ A;  4O3U B;  3PXW D;  3DXK C;  2P9S C;  3SBP A;  5IT9 g;  5I5M A;  5TEF A;  2IUV A;  3DWL C;  3RFH A;  4ZOY A;  2H6Q A;  5GXI A;  5CXC A;  4CY3 A;  3BG0 A;  1FWX A;  2Q7Q A;  3N0E A;  4D6V A;  4J78 A;  2OIZ A;  4HDJ A;  4FHL A;  5GXH A;  4OZU A;  2OK4 A;  2G9A A;  3UVO A;  4CI3 A;  3SWS D;  5HE0 B;  4GQ1 A;  2P9U C;  4J77 A;  3EI3 B;  4CZY A;  3JZG A;  5IGQ A;  3NVN A;  3P4F A;  4OWR A;  2TRC B;  4A7J A;  1JMZ B;  4ERQ A;  4PBY A;  3V7D B;  3PVU B;  3SXT D;  4D0K A;  5CYK A;  3EWE A;  3PE7 A;  1Q47 A;  5K1C C;  3EI2 B;  2HKM A;  3DXM C;  4Y5R D;  2H14 A;  4AOW A;  4O3T B;  2J56 H;  3C9C A;  3IIY A;  3C75 H;  4QT8 A;  3I8C A;  4ES0 A;  4J82 A;  2YNP A;  3JAM g;  2H13 A;  3MKS B;  2YBA A;  3NVQ A;  2AGL A;  2B5N A;  3PVW B;  3RSE C;  3I7H A;  2UZY B;  4E54 B;  5EAL A;  4ESG A;  2GC4 A;  2I3S A;  4PNK B;  2BBK H;  1VYH C;  4GZ8 A;  4CY5 A;  5H17 A;  5I5J A;  3A0F A;  1MG2 A;  2AGW A;  4PBZ A;  4J8G A;  5H1M A;  2H6K A;  2HJ4 A;  3KRX B;  4G56 B;  4A0A B;  5JWZ A;  1NEX B;  3FRX A;  4FAN D;  5FKQ A;  5HE3 B;  4GM9 A;  3I2N A;  2I0S A;  4CZV A;  2IWF A;  4JSN C;  4X61 B;  1S4U X;  5FKT A;  3MZK A;  3RRM C;  3MXX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...