3GFCA

Crystal structure of histone-binding protein rbbp4
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
387
structure length
339
Chain Sequence
WKKNTPFLYDLVMTHALEWPSLTAQWLPDVTDFSIHRLVLGTHTQNHLVIASVQLPNKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDCNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone-binding protein RBBP4
publication title Structure and function of WD40 domain proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 80
structure length 339
sequence length 387
ec nomenclature
pdb deposition date 2009-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
A PF12265 CAF1C_H4-bd Histone-binding protein RBBP4 or subunit C of CAF1 complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3gfcA00
3P4FA 3J81g 4J86A 3K26A 2J56H 3RSEC 1OLZA 2XL2A 2PM7B 2CO0A 3OKYA 4GGAA 4O3TB 5GXIA 3EG6A 5C9ZB 3SWSD 2HKMA 2BCJB 3V7DB 2YNOA 5FKSA 4A0BB 3UKRC 2PM9B 4LG9A 2I0TA 4ZN4A 5TEFA 4A08B 4JSPC 4FAND 2W18A 2I3TA 3SVWD 1GXRA 2HJBA 2IWKA 1VYHC 4FB1D 3RLMD 2P9UC 3EU7A 4GGDA 4BH6A 4D0KA 2P9IC 3PXTD 3C99A 3F3PA 5C2WB 1RI6A 3UVMA 3RN1D 3AFCA 3FRXA 4A11A 5CXCA 3FM0A 2MTAH 2H47A 2H68A 2H9PA 5FKRA 4OZUA 2UZYB 2AGYA 4A0AB 4PXWA 2P9KC 3SN6B 2AGZA 3I7PA 3JPXA 2IUPA 4E5ZA 4A7JA 3GREA 1U4CA 2UZXB 3AL8B 5CYKB 2H3XA 2EBSA 3I8CA 2QC5A 5K1CC 3EI1A 3CIKB 4BL0A 3ODTA 4FA5D 5TEEA 5EMMB 3EI2A 4CI3A 3I7LA 4UI9R 2HKRA 3CFVA 5EM2A 3VH0A 3MMYA 4EWRA 2CN2A 3BG1A 4U1EI 2H6QA 4Z8LA 2B5MA 3MZLA 4XYHA 2G99A 2YBAA 3C5MA 5IGQA 4CY2A 2H6NA 3ZWLB 1R5MA 1XHMA 4FAVD 4GZ8A 1NEXB 3OKWA 4OWRA 3IJ1A 4ZOZA 2TRCB 5FXYA 4LG8A 3PVWB 5TDHB 3I7NA 2GC7A 4JD2C 3IJ0A 1YFQA 1K8KC 1SHYB 4ESGA 3CFSB 5I5JA 2O9KA 5TF2A 4O9DA 2OIZA 3I7OA 2I3SA 1PI6A 4CY5A 5THAA 2P9PC 5IT9g 4GM9A 5HE2B 1N6DA 4CY1A 3RMZD 2HESX 2IUQA 4GMBA 3BWSA 4CC9A 3SXTD 3RRMC 1XKSA 3NVQA 2GNQA 3I89A 2G9AA 2I0RA 3FGBA 5I5MA 3AL9A 3I2NA 4A09A 1SQ9A 4ERZA 5IJ7E 1P22A 4ZOVA 2HJ4A 3SBRA 4J8GA 3IKOA 1OMWB 3U4YA 4LGNA 4A2LA 4A0BA 1A0RB 2H13A 2PM9A 3B7FA 2Z2NA 3E0CA 1GG2B 4A08A 2OK6A 2Q7QA 5IGOA 3SBQA 2XL3A 4FWWA 2CE8A 4H5JA 2IUVA 5IJ8E 4QT8A 2QXVA 5KDOB 1L0QA 1PEVA 4CY3A 2H6KA 3EI3B 4JSXC 4ES0A 1GP2B 3K27A 4J78A 3SLED 3PE7A 3N0EA 3V5WB 3RFHA 2BBKH 2H9LA 4BUJC 1PGUA 2AGXA 3MKSB 4H5IA 3OKTA 4R7AB 1MDAH 2PM6B 4Y5RD 2IWFA 3BG0A 3UVOA 5EMKB 3DSMA 4A0AA 2H9MA 4L3HD 5JWZA 3SCYA 1K32A 4IA9A 4XYIA 4K3ID 4J77A 2OVQB 5FQDA 5EAPA 1N6EA 4J0WA 1TYQC 3ORVD 2YMUA 3F3FA 1ERJA 1MG2A 4D6VA 2P9LC 5CYKA 4I79A 5HE0B 5GSAA 3L4OD 4Y7RA 3JZHA 3RFGA 4CI8A 2XYIA 4GQ1A 2B5NA 4J82A 2CNXA 1JJUB 4L3GD 3HFQA 5FKTA 1MG3A 3OL2B 3NVXA 3SJLD 4PBYA 3NVNA 5H17A 3UVKA 3SMRA 5I5IA 3EI4B 3GFCA 4GGCA 3I7KA 4NSXA 3UKUC 3VA6A 4K3JB 2OJYA 4ERQA 3DM0A 5CXBB 4E54B 5K19A 5HQGA 4CZVA 2IURA 2Z2PA 3UVLA 2HXCA 3A0FA 4JT6C 1JMXB 3KRXB 4PSWB 4ERYA 4FHLA 4O45A 3EMHA 2AGWA 5HE3B 4CZYA 2CN3A 3JRPA 5HE1B 2YNPA 3OKYB 4J87A 4N14A 4L9OA 4JT5C 1B9XA 1N6FA 3DXMC 2YNNA 3JAMg 4XEIC 5H1MA 2OVPB 4U7AA 3JB9L 3OTTA 5EMLB 4J8BA 1U2VC 2IAAA 4PSXB 1B9YA 1JOFA 2I0SA 3IJCA 3IIWA 3SFZA 4FA4D 5SXMA 3JZNA 3RN0D 5HYNB 5FLXg 4J81A 3KRWB 3AH8B 2YB8B 2OK4A 5B4WA 2CO0C 4J0XA 4GQ2P 4QL1A 3I8EA 4J84A 4AOWA 4FA9D 4GM3A 5GXHA 4A11B 5CXCB 3EI3A 3F3GA 3EWEA 1GOTB 3MXXA 4PC0A 4X63B 2P9NC 2AQ5A 4J79A 5EARA 3J80g 5C2VB 4CZXA 2Z2OA 4CI2A 2B5LA 4L1QD 2XU7A 3C75H 4X3EA 5AJAA 4AEZA 5EALA 4MK0B 4E5ZB 2GC4A 3MKQA 2AGLA 2B4EA 4FA1D 4QQEA 5FA5B 4X60B 4GQBB 3EI1B 3I7HA 4JSNC 3AL8A 4KFMB 5IC7A 3VGZA 4O1QD 3ULEC 1S4UX 2H9NA 3EI2B 5EM2B 2OVRB 3PSLA 3L4MD 3PXWD 5AFU3 4HDJA 2J55H 2J57G 4ZOXA 4PNKB 3JZGA 5AMSA 4PBZA 3UVNA 4GM8A 3MZKA 3PSCB 4JSVC 3DWLC 1Q47A 4YVDA 3OL2A 3V9FA 1NR0A 3SHFA 1XIPA 3UR4A 4TZ4A 5EMJB 3IIYA 2H14A 2HYEA 5GMKn 4JXMA 3EI4A 2PBIB 3N0DA 4A2MA 2P9SC 3W15A 2CE9A 3SBPA 4IMMA 1QNIA 4G56B 4QRJA 2AH0A 1TBGA 5EAMA 4O3UB 1PBYB 2AH1A 4CI1A 1JMZB 5CXBA 4E54A 3OW8A 3DXKC 5A2Qg 5H14A 4J73A 3JROA 1FWXA 4ZOYA 4X61B 3PVUB 3PXSD 1SQJA 3C9CA 5FKQA 4A09B
chains in the Genus database with same CATH superfamily
3P4FA 3J81g 4J86A 1BPOA 3K26A 2J56H 3RSEC 1OLZA 2XL2A 3NIGA 2PM7B 2CO0A 3OKYA 4GGAA 4O3TB 5GXIA 3EG6A 5C9ZB 5E6RA 3SWSD 2HKMA 4AN0A 2VDLA 2BCJB 3V7DB 2YNOA 5FKSA 4A0BB 3UKRC 2PM9B 4LG9A 2I0TA 4ZN4A 5TEFA 4A08B 4JSPC 4FAND 2W18A 2I3TA 4G1EA 4MMXA 3SVWD 1GXRA 2HJBA 2IWKA 1VYHC 4FB1D 3RLMD 3VI4A 1E5TA 2HU5A 2P9UC 3EU7A 4GGDA 2VZ3A 4BH6A 4D0KA 2P9IC 3PXTD 3C99A 5FFOA 3F3PA 5C2WB 1RI6A 3OF7A 3UVMA 5C86A 3RN1D 3FCUA 3AFCA 3FRXA 3ZE2A 4A11A 5CXCA 4MMYA 3FM0A 2MTAH 3IUMA 2H47A 2H68A 1E8NA 3GD1I 3QI0A 4WK2A 4UM9A 2EIDA 2H9PA 5FKRA 2EIBA 4NAAA 4O02A 4OZUA 2UZYB 2AGYA 4A0AB 3ZDXA 4PXWA 2P9KC 3SN6B 2AGZA 3I7PA 4IRZA 3JPXA 2IUPA 4E5ZA 2VDRA 4A7JA 4WK4A 4DNUA 4DNWA 3GREA 1U4CA 2UZXB 3AL8B 5CYKB 2H3XA 2EBSA 3I8CA 2QC5A 5K1CC 3EI1A 3CIKB 4BL0A 3ODTA 4FA5D 4NC4A 5TEEA 1UTCA 5EMMB 2HU7A 3EI2A 4CI3A 3I7LA 4UI9R 2HKRA 3CFVA 5EM2A 3VH0A 3MMYA 4EWRA 2CN2A 3BG1A 4U1EI 2H6QA 1JV2A 3IUJA 4Z8LA 2B5MA 3MZLA 1YR2A 4XYHA 2G99A 2YBAA 3VI3A 1VZ2A 3C5MA 5IGQA 4CY2A 2H6NA 3ZWLB 1R5MA 1XHMA 4BP8A 4FAVD 4GZ8A 1NEXB 3OKWA 4OWRA 3IJ1A 3IUNA 4ZOZA 2TRCB 1E8MA 5FXYA 4LG8A 1M1XA 3PVWB 2QR5A 5TDHB 3ZE1A 3I7NA 2GC7A 4JD2C 4BP9A 3IJ0A 1YFQA 1K8KC 1SHYB 4ESGA 1T2XA 3CFSB 5I5JA 2O9KA 5TF2A 4O9DA 2BKLA 2OIZA 3IUQA 3GC3B 4RE5A 1H2ZA 3I7OA 2I3SA 4JHPC 1PI6A 4CY5A 1A12A 5THAA 2VDOA 1UOPA 2P9PC 1UOOA 5IT9g 4GM9A 5HE2B 1N6DA 4CY1A 3RMZD 3K72A 3K71A 1U8CA 2HESX 2IUQA 4GMBA 3BWSA 4CC9A 3SXTD 3O4HA 1XKSA 3NVQA 2GNQA 3RRMC 3I89A 2G9AA 2I0RA 1C9IA 3FGBA 2JKXA 2XDWA 5I5MA 3AL9A 3I2NA 4A09A 1SQ9A 1UOQA 4ERZA 5IJ7E 2VC2A 1P22A 4ZOVA 4WJKA 2HJ4A 3SBRA 4J8GA 3IKOA 1OMWB 1I2MB 3U4YA 4LGNA 4A2LA 4A0BA 1A0RB 2H13A 2PM9A 3B7FA 2Z2NA 3E0CA 1GG2B 4A08A 1TYEA 2OK6A 2Q7QA 5IGOA 3SBQA 3NIFA 2XL3A 4FWWA 2CE8A 3EQ9A 4H5JA 2IUVA 5IJ8E 4QT8A 2QXVA 5KDOB 3O4GA 1L0QA 1PEVA 4CY3A 2H6KA 3EI3B 4JSXC 4ES0A 2VDKA 1GP2B 3K27A 1QFSA 4J78A 3SLED 3PE7A 2VDPA 3N0EA 1H2YA 3V5WB 3RFHA 2BBKH 2H9LA 3MUOA 4Z7OA 4BUJC 1PGUA 2AGXA 3MKSB 5M61A 4G1MA 3OKTA 4H5IA 4R7AB 1MDAH 2PM6B 4Y5RD 2IWFA 3BG0A 2QZPA 3UVOA 5EMKB 3DSMA 4A0AA 2H9MA 3FCSA 4L3HD 5JWZA 3SCYA 1K32A 4IA9A 4XYIA 4K3ID 4J77A 2OVQB 3IULA 5FQDA 2VDQA 5EAPA 1N6EA 4J0WA 5M5SA 4L1MA 2VDMA 1TYQC 3ORVD 1QFMA 2YMUA 3F3FA 1ERJA 1MG2A 4D6VA 2P9LC 5CYKA 5M5UA 4I79A 5HE0B 5GSAA 3L4OD 4WK0A 4Y7RA 3JZHA 3RFGA 3IJEA 1O6FA 4CI8A 2XYIA 3T3PA 4GQ1A 2B5NA 4J82A 2CNXA 1JJUB 1VE6A 2EIEA 4L3GD 3HFQA 1H2XA 5FKTA 1MG3A 3O4IA 3OL2B 3NVXA 3SJLD 5M5VA 4PBYA 3NVNA 4UM8A 5H17A 4RE6A 1GOHA 3UVKA 3SMRA 5I5IA 3EI4B 2XZGA 3GFCA 4GGCA 3I7KA 5M5TA 4NSXA 3DDUA 3UKUC 4NBMA 3VA6A 4BCCA 4K3JB 3O4JA 2OJYA 4ERQA 3DM0A 5CXBB 4E54B 3MVDK 1O6GA 5HQGA 5K19A 4CZVA 2IURA 2WQ8A 3EQ7A 2Z2PA 1H2WA 3UVLA 2HXCA 3A0FA 4JT6C 1JMXB 3KRXB 4PSWB 4ERYA 4FHLA 4O45A 3EMHA 2AGWA 4AX4A 5HE3B 4D9SA 1VE7A 4CZYA 2CN3A 3JRPA 5HE1B 2YNPA 3OKYB 4J87A 4N14A 4L9OA 4JT5C 1B9XA 3MUNA 1N6FA 3DXMC 2YNNA 3JAMg 4XEIC 5H1MA 2OVPB 4U7AA 3JB9L 3OTTA 5EMLB 4J8BA 1U2VC 2IAAA 4PSXB 4MMZA 1B9YA 1JOFA 2I0SA 3IJCA 4Z7NA 3IIWA 3IVMA 3SFZA 4FA4D 5M5RA 5SXMA 3JZNA 3RN0D 5HYNB 3ZDYA 5FLXg 4J81A 3KRWB 3AH8B 4DNVA 2YB8B 2OK4A 5B4WA 2CO0C 4J0XA 4GQ2P 4QL1A 3I8EA 4J84A 4AOWA 4FA9D 4GM3A 5GXHA 5C92A 3ZE0A 4A11B 5CXCB 3EI3A 4AMYA 3F3GA 3EWEA 2EICA 2XE4A 1GOTB 3MXXA 4PC0A 4X63B 2P9NC 2AQ5A 1L5GA 4J79A 5EARA 4Z7QA 3J80g 5C2VB 4BCDA 4CZXA 2Z2OA 4NENA 4CI2A 2B5LA 4L1QD 2XU7A 2VZ1A 3C75H 4X3EA 5AJAA 4AEZA 5HDBA 5EALA 4MK0B 4E5ZB 2GC4A 3MKQA 2AGLA 2B4EA 1JTDB 4FA1D 4QQEA 5FA5B 4X60B 4GQBB 2HU8A 3EI1B 3I7HA 4JSNC 3AL8A 4O2WA 4KFMB 5E6UA 5IC7A 4QAMA 3VGZA 4O1QD 3ULEC 1GOGA 1S4UX 4AN1A 2H9NA 3EI2B 5EM2B 2OVRB 3PSLA 3QHYB 3L4MD 3PXWD 5AFU3 3V4PA 3IURA 4HDJA 3K6SA 2J55H 3ZDZA 3NIDA 2J57G 4ZOXA 4AMZA 4PNKB 3JZGA 5AMSA 4PBZA 3UVNA 4GM8A 3MZKA 3PSCB 3V4VA 4JSVC 3KCIA 3DWLC 1Q47A 4YVDA 3OL2A 3V9FA 1NR0A 3SHFA 1XIPA 3UR4A 4TZ4A 4G55A 4BCBA 5EMJB 2VDNA 3IIYA 5FFGA 1C9LA 1VZ3A 2H14A 2HYEA 3EQ8A 5GMKn 4JXMA 3EI4A 2PBIB 3N0DA 4A2MA 2P9SC 3W15A 2CE9A 3SBPA 4IMMA 1QNIA 4G56B 4QRJA 2AH0A 1TBGA 5EAMA 4O3UB 1PBYB 2AH1A 4CI1A 4JHNA 1JMZB 1K3IA 5CXBA 4E54A 3OW8A 3DXKC 5A2Qg 5H14A 4J73A 3JROA 5E6SA 1FWXA 4ZOYA 4X61B 3PVUB 3PXSD 1SQJA 3C9CA 3T3MA 1GOFA 5FKQA 4A09B
chains in the Genus database with same CATH topology
3P4FA 3J81g 4J86A 3K26A 2J56H 3RSEC 1OLZA 2XL2A 2PM7B 2CO0A 3OKYA 4GGAA 4O3TB 5GXIA 3EG6A 5C9ZB 3SWSD 2HKMA 2BCJB 3V7DB 2YNOA 5FKSA 4A0BB 3UKRC 2PM9B 4LG9A 2I0TA 4ZN4A 5TEFA 4A08B 4JSPC 4FAND 2W18A 2I3TA 3SVWD 1GXRA 2HJBA 2IWKA 1VYHC 4FB1D 3RLMD 2P9UC 3EU7A 4GGDA 4BH6A 4D0KA 2P9IC 3PXTD 3C99A 3F3PA 5C2WB 1RI6A 3UVMA 3RN1D 3AFCA 3FRXA 4A11A 5CXCA 3FM0A 2MTAH 2H47A 2H68A 2H9PA 5FKRA 4OZUA 2UZYB 2AGYA 4A0AB 4PXWA 2P9KC 3SN6B 2AGZA 3I7PA 3JPXA 2IUPA 4E5ZA 4A7JA 3GREA 1U4CA 2UZXB 3AL8B 5CYKB 2H3XA 2EBSA 3I8CA 2QC5A 5K1CC 3EI1A 3CIKB 4BL0A 3ODTA 4FA5D 5TEEA 5EMMB 3EI2A 4CI3A 3I7LA 4UI9R 2HKRA 3CFVA 5EM2A 3VH0A 3MMYA 4EWRA 2CN2A 3BG1A 4U1EI 2H6QA 4Z8LA 2B5MA 3MZLA 4XYHA 2G99A 2YBAA 3C5MA 5IGQA 4CY2A 2H6NA 3ZWLB 1R5MA 1XHMA 4FAVD 4GZ8A 1NEXB 3OKWA 4OWRA 3IJ1A 4ZOZA 2TRCB 5FXYA 4LG8A 3PVWB 5TDHB 3I7NA 2GC7A 4JD2C 3IJ0A 1YFQA 1K8KC 1SHYB 4ESGA 3CFSB 5I5JA 2O9KA 5TF2A 4O9DA 2OIZA 3I7OA 2I3SA 1PI6A 4CY5A 5THAA 2P9PC 5IT9g 4GM9A 5HE2B 1N6DA 4CY1A 3RMZD 2HESX 2IUQA 4GMBA 3BWSA 4CC9A 3SXTD 3RRMC 1XKSA 3NVQA 2GNQA 3I89A 2G9AA 2I0RA 3FGBA 5I5MA 3AL9A 3I2NA 4A09A 1SQ9A 4ERZA 5IJ7E 1P22A 4ZOVA 2HJ4A 3SBRA 4J8GA 3IKOA 1OMWB 3U4YA 4LGNA 4A2LA 4A0BA 1A0RB 2H13A 2PM9A 3B7FA 2Z2NA 3E0CA 1GG2B 4A08A 2OK6A 2Q7QA 5IGOA 3SBQA 2XL3A 4FWWA 2CE8A 4H5JA 2IUVA 5IJ8E 4QT8A 2QXVA 5KDOB 1L0QA 1PEVA 4CY3A 2H6KA 3EI3B 4JSXC 4ES0A 1GP2B 3K27A 4J78A 3SLED 3PE7A 3N0EA 3V5WB 3RFHA 2BBKH 2H9LA 4BUJC 1PGUA 2AGXA 3MKSB 4H5IA 3OKTA 4R7AB 1MDAH 2PM6B 4Y5RD 2IWFA 3BG0A 3UVOA 5EMKB 3DSMA 4A0AA 2H9MA 4L3HD 5JWZA 3SCYA 1K32A 4IA9A 4XYIA 4K3ID 4J77A 2OVQB 5FQDA 5EAPA 1N6EA 4J0WA 1TYQC 3ORVD 2YMUA 3F3FA 1ERJA 1MG2A 4D6VA 2P9LC 5CYKA 4I79A 5HE0B 5GSAA 3L4OD 4Y7RA 3JZHA 3RFGA 4CI8A 2XYIA 4GQ1A 2B5NA 4J82A 2CNXA 1JJUB 4L3GD 3HFQA 5FKTA 1MG3A 3OL2B 3NVXA 3SJLD 4PBYA 3NVNA 5H17A 3UVKA 3SMRA 5I5IA 3EI4B 3GFCA 4GGCA 3I7KA 4NSXA 3UKUC 3VA6A 4K3JB 2OJYA 4ERQA 3DM0A 5CXBB 4E54B 5K19A 5HQGA 4CZVA 2IURA 2Z2PA 3UVLA 2HXCA 3A0FA 4JT6C 1JMXB 3KRXB 4PSWB 4ERYA 4FHLA 4O45A 3EMHA 2AGWA 5HE3B 4CZYA 2CN3A 3JRPA 5HE1B 2YNPA 3OKYB 4J87A 4N14A 4L9OA 4JT5C 1B9XA 1N6FA 3DXMC 2YNNA 3JAMg 4XEIC 5H1MA 2OVPB 4U7AA 3JB9L 3OTTA 5EMLB 4J8BA 1U2VC 2IAAA 4PSXB 1B9YA 1JOFA 2I0SA 3IJCA 3IIWA 3SFZA 4FA4D 5SXMA 3JZNA 3RN0D 5HYNB 5FLXg 4J81A 3KRWB 3AH8B 2YB8B 2OK4A 5B4WA 2CO0C 4J0XA 4GQ2P 4QL1A 3I8EA 4J84A 4AOWA 4FA9D 4GM3A 5GXHA 4A11B 5CXCB 3EI3A 3F3GA 3EWEA 1GOTB 3MXXA 4PC0A 4X63B 2P9NC 2AQ5A 4J79A 5EARA 3J80g 5C2VB 4CZXA 2Z2OA 4CI2A 2B5LA 4L1QD 2XU7A 3C75H 4X3EA 5AJAA 4AEZA 5EALA 4MK0B 4E5ZB 2GC4A 3MKQA 2AGLA 2B4EA 4FA1D 4QQEA 5FA5B 4X60B 4GQBB 3EI1B 3I7HA 4JSNC 3AL8A 4KFMB 5IC7A 3VGZA 4O1QD 3ULEC 1S4UX 2H9NA 3EI2B 5EM2B 2OVRB 3PSLA 3L4MD 3PXWD 5AFU3 4HDJA 2J55H 2J57G 4ZOXA 4PNKB 3JZGA 5AMSA 4PBZA 3UVNA 4GM8A 3MZKA 3PSCB 4JSVC 3DWLC 1Q47A 4YVDA 3OL2A 3V9FA 1NR0A 3SHFA 1XIPA 3UR4A 4TZ4A 5EMJB 3IIYA 2H14A 2HYEA 5GMKn 4JXMA 3EI4A 2PBIB 3N0DA 4A2MA 2P9SC 3W15A 2CE9A 3SBPA 4IMMA 1QNIA 4G56B 4QRJA 2AH0A 1TBGA 5EAMA 4O3UB 1PBYB 2AH1A 4CI1A 1JMZB 5CXBA 4E54A 3OW8A 3DXKC 5A2Qg 5H14A 4J73A 3JROA 1FWXA 4ZOYA 4X61B 3PVUB 3PXSD 1SQJA 3C9CA 5FKQA 4A09B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P4F A;  3J81 g;  4J86 A;  3K26 A;  2J56 H;  3RSE C;  1OLZ A;  2XL2 A;  2PM7 B;  2CO0 A;  3OKY A;  4GGA A;  4O3T B;  5GXI A;  3EG6 A;  5C9Z B;  3SWS D;  2HKM A;  2BCJ B;  3V7D B;  2YNO A;  5FKS A;  4A0B B;  3UKR C;  2PM9 B;  4LG9 A;  2I0T A;  4ZN4 A;  5TEF A;  4A08 B;  4JSP C;  4FAN D;  2W18 A;  2I3T A;  3SVW D;  1GXR A;  2HJB A;  2IWK A;  1VYH C;  4FB1 D;  3RLM D;  2P9U C;  3EU7 A;  4GGD A;  4BH6 A;  4D0K A;  2P9I C;  3PXT D;  3C99 A;  3F3P A;  5C2W B;  1RI6 A;  3UVM A;  3RN1 D;  3AFC A;  3FRX A;  4A11 A;  5CXC A;  3FM0 A;  2MTA H;  2H47 A;  2H68 A;  2H9P A;  5FKR A;  4OZU A;  2UZY B;  2AGY A;  4A0A B;  4PXW A;  2P9K C;  3SN6 B;  2AGZ A;  3I7P A;  3JPX A;  2IUP A;  4E5Z A;  4A7J A;  3GRE A;  1U4C A;  2UZX B;  3AL8 B;  5CYK B;  2H3X A;  2EBS A;  3I8C A;  2QC5 A;  5K1C C;  3EI1 A;  3CIK B;  4BL0 A;  3ODT A;  4FA5 D;  5TEE A;  5EMM B;  3EI2 A;  4CI3 A;  3I7L A;  4UI9 R;  2HKR A;  3CFV A;  5EM2 A;  3VH0 A;  3MMY A;  4EWR A;  2CN2 A;  3BG1 A;  4U1E I;  2H6Q A;  4Z8L A;  2B5M A;  3MZL A;  4XYH A;  2G99 A;  2YBA A;  3C5M A;  5IGQ A;  4CY2 A;  2H6N A;  3ZWL B;  1R5M A;  1XHM A;  4FAV D;  4GZ8 A;  1NEX B;  3OKW A;  4OWR A;  3IJ1 A;  4ZOZ A;  2TRC B;  5FXY A;  4LG8 A;  3PVW B;  5TDH B;  3I7N A;  2GC7 A;  4JD2 C;  3IJ0 A;  1YFQ A;  1K8K C;  1SHY B;  4ESG A;  3CFS B;  5I5J A;  2O9K A;  5TF2 A;  4O9D A;  2OIZ A;  3I7O A;  2I3S A;  1PI6 A;  4CY5 A;  5THA A;  2P9P C;  5IT9 g;  4GM9 A;  5HE2 B;  1N6D A;  4CY1 A;  3RMZ D;  2HES X;  2IUQ A;  4GMB A;  3BWS A;  4CC9 A;  3SXT D;  3RRM C;  1XKS A;  3NVQ A;  2GNQ A;  3I89 A;  2G9A A;  2I0R A;  3FGB A;  5I5M A;  3AL9 A;  3I2N A;  4A09 A;  1SQ9 A;  4ERZ A;  5IJ7 E;  1P22 A;  4ZOV A;  2HJ4 A;  3SBR A;  4J8G A;  3IKO A;  1OMW B;  3U4Y A;  4LGN A;  4A2L A;  4A0B A;  1A0R B;  2H13 A;  2PM9 A;  3B7F A;  2Z2N A;  3E0C A;  1GG2 B;  4A08 A;  2OK6 A;  2Q7Q A;  5IGO A;  3SBQ A;  2XL3 A;  4FWW A;  2CE8 A;  4H5J A;  2IUV A;  5IJ8 E;  4QT8 A;  2QXV A;  5KDO B;  1L0Q A;  1PEV A;  4CY3 A;  2H6K A;  3EI3 B;  4JSX C;  4ES0 A;  1GP2 B;  3K27 A;  4J78 A;  3SLE D;  3PE7 A;  3N0E A;  3V5W B;  3RFH A;  2BBK H;  2H9L A;  4BUJ C;  1PGU A;  2AGX A;  3MKS B;  4H5I A;  3OKT A;  4R7A B;  1MDA H;  2PM6 B;  4Y5R D;  2IWF A;  3BG0 A;  3UVO A;  5EMK B;  3DSM A;  4A0A A;  2H9M A;  4L3H D;  5JWZ A;  3SCY A;  1K32 A;  4IA9 A;  4XYI A;  4K3I D;  4J77 A;  2OVQ B;  5FQD A;  5EAP A;  1N6E A;  4J0W A;  1TYQ C;  3ORV D;  2YMU A;  3F3F A;  1ERJ A;  1MG2 A;  4D6V A;  2P9L C;  5CYK A;  4I79 A;  5HE0 B;  5GSA A;  3L4O D;  4Y7R A;  3JZH A;  3RFG A;  4CI8 A;  2XYI A;  4GQ1 A;  2B5N A;  4J82 A;  2CNX A;  1JJU B;  4L3G D;  3HFQ A;  5FKT A;  1MG3 A;  3OL2 B;  3NVX A;  3SJL D;  4PBY A;  3NVN A;  5H17 A;  3UVK A;  3SMR A;  5I5I A;  3EI4 B;  3GFC A;  4GGC A;  3I7K A;  4NSX A;  3UKU C;  3VA6 A;  4K3J B;  2OJY A;  4ERQ A;  3DM0 A;  5CXB B;  4E54 B;  5K19 A;  5HQG A;  4CZV A;  2IUR A;  2Z2P A;  3UVL A;  2HXC A;  3A0F A;  4JT6 C;  1JMX B;  3KRX B;  4PSW B;  4ERY A;  4FHL A;  4O45 A;  3EMH A;  2AGW A;  5HE3 B;  4CZY A;  2CN3 A;  3JRP A;  5HE1 B;  2YNP A;  3OKY B;  4J87 A;  4N14 A;  4L9O A;  4JT5 C;  1B9X A;  1N6F A;  3DXM C;  2YNN A;  3JAM g;  4XEI C;  5H1M A;  2OVP B;  4U7A A;  3JB9 L;  3OTT A;  5EML B;  4J8B A;  1U2V C;  2IAA A;  4PSX B;  1B9Y A;  1JOF A;  2I0S A;  3IJC A;  3IIW A;  3SFZ A;  4FA4 D;  5SXM A;  3JZN A;  3RN0 D;  5HYN B;  5FLX g;  4J81 A;  3KRW B;  3AH8 B;  2YB8 B;  2OK4 A;  5B4W A;  2CO0 C;  4J0X A;  4GQ2 P;  4QL1 A;  3I8E A;  4J84 A;  4AOW A;  4FA9 D;  4GM3 A;  5GXH A;  4A11 B;  5CXC B;  3EI3 A;  3F3G A;  3EWE A;  1GOT B;  3MXX A;  4PC0 A;  4X63 B;  2P9N C;  2AQ5 A;  4J79 A;  5EAR A;  3J80 g;  5C2V B;  4CZX A;  2Z2O A;  4CI2 A;  2B5L A;  4L1Q D;  2XU7 A;  3C75 H;  4X3E A;  5AJA A;  4AEZ A;  5EAL A;  4MK0 B;  4E5Z B;  2GC4 A;  3MKQ A;  2AGL A;  2B4E A;  4FA1 D;  4QQE A;  5FA5 B;  4X60 B;  4GQB B;  3EI1 B;  3I7H A;  4JSN C;  3AL8 A;  4KFM B;  5IC7 A;  3VGZ A;  4O1Q D;  3ULE C;  1S4U X;  2H9N A;  3EI2 B;  5EM2 B;  2OVR B;  3PSL A;  3L4M D;  3PXW D;  5AFU 3;  4HDJ A;  2J55 H;  2J57 G;  4ZOX A;  4PNK B;  3JZG A;  5AMS A;  4PBZ A;  3UVN A;  4GM8 A;  3MZK A;  3PSC B;  4JSV C;  3DWL C;  1Q47 A;  4YVD A;  3OL2 A;  3V9F A;  1NR0 A;  3SHF A;  1XIP A;  3UR4 A;  4TZ4 A;  5EMJ B;  3IIY A;  2H14 A;  2HYE A;  5GMK n;  4JXM A;  3EI4 A;  2PBI B;  3N0D A;  4A2M A;  2P9S C;  3W15 A;  2CE9 A;  3SBP A;  4IMM A;  1QNI A;  4G56 B;  4QRJ A;  2AH0 A;  1TBG A;  5EAM A;  4O3U B;  1PBY B;  2AH1 A;  4CI1 A;  1JMZ B;  5CXB A;  4E54 A;  3OW8 A;  3DXK C;  5A2Q g;  5H14 A;  4J73 A;  3JRO A;  1FWX A;  4ZOY A;  4X61 B;  3PVU B;  3PXS D;  1SQJ A;  3C9C A;  5FKQ A;  4A09 B; 
#chains in the Genus database with same CATH topology
 3P4F A;  3J81 g;  4J86 A;  1BPO A;  3K26 A;  2J56 H;  3RSE C;  1OLZ A;  2XL2 A;  3NIG A;  2PM7 B;  2CO0 A;  3OKY A;  4GGA A;  4O3T B;  5GXI A;  3EG6 A;  5C9Z B;  5E6R A;  3SWS D;  2HKM A;  4AN0 A;  2VDL A;  2BCJ B;  3V7D B;  2YNO A;  5FKS A;  4A0B B;  3UKR C;  2PM9 B;  4LG9 A;  2I0T A;  4ZN4 A;  5TEF A;  4A08 B;  4JSP C;  4FAN D;  2W18 A;  2I3T A;  4G1E A;  4MMX A;  3SVW D;  1GXR A;  2HJB A;  2IWK A;  1VYH C;  4FB1 D;  3RLM D;  3VI4 A;  1E5T A;  2HU5 A;  2P9U C;  3EU7 A;  4GGD A;  2VZ3 A;  4BH6 A;  4D0K A;  2P9I C;  3PXT D;  3C99 A;  5FFO A;  3F3P A;  5C2W B;  1RI6 A;  3OF7 A;  3UVM A;  5C86 A;  3RN1 D;  3FCU A;  3AFC A;  3FRX A;  3ZE2 A;  4A11 A;  5CXC A;  4MMY A;  3FM0 A;  2MTA H;  3IUM A;  2H47 A;  2H68 A;  1E8N A;  3GD1 I;  3QI0 A;  4WK2 A;  4UM9 A;  2EID A;  2H9P A;  5FKR A;  2EIB A;  4NAA A;  4O02 A;  4OZU A;  2UZY B;  2AGY A;  4A0A B;  3ZDX A;  4PXW A;  2P9K C;  3SN6 B;  2AGZ A;  3I7P A;  4IRZ A;  3JPX A;  2IUP A;  4E5Z A;  2VDR A;  4A7J A;  4WK4 A;  4DNU A;  4DNW A;  3GRE A;  1U4C A;  2UZX B;  3AL8 B;  5CYK B;  2H3X A;  2EBS A;  3I8C A;  2QC5 A;  5K1C C;  3EI1 A;  3CIK B;  4BL0 A;  3ODT A;  4FA5 D;  4NC4 A;  5TEE A;  1UTC A;  5EMM B;  2HU7 A;  3EI2 A;  4CI3 A;  3I7L A;  4UI9 R;  2HKR A;  3CFV A;  5EM2 A;  3VH0 A;  3MMY A;  4EWR A;  2CN2 A;  3BG1 A;  4U1E I;  2H6Q A;  1JV2 A;  3IUJ A;  4Z8L A;  2B5M A;  3MZL A;  1YR2 A;  4XYH A;  2G99 A;  2YBA A;  3VI3 A;  1VZ2 A;  3C5M A;  5IGQ A;  4CY2 A;  2H6N A;  3ZWL B;  1R5M A;  1XHM A;  4BP8 A;  4FAV D;  4GZ8 A;  1NEX B;  3OKW A;  4OWR A;  3IJ1 A;  3IUN A;  4ZOZ A;  2TRC B;  1E8M A;  5FXY A;  4LG8 A;  1M1X A;  3PVW B;  2QR5 A;  5TDH B;  3ZE1 A;  3I7N A;  2GC7 A;  4JD2 C;  4BP9 A;  3IJ0 A;  1YFQ A;  1K8K C;  1SHY B;  4ESG A;  1T2X A;  3CFS B;  5I5J A;  2O9K A;  5TF2 A;  4O9D A;  2BKL A;  2OIZ A;  3IUQ A;  3GC3 B;  4RE5 A;  1H2Z A;  3I7O A;  2I3S A;  4JHP C;  1PI6 A;  4CY5 A;  1A12 A;  5THA A;  2VDO A;  1UOP A;  2P9P C;  1UOO A;  5IT9 g;  4GM9 A;  5HE2 B;  1N6D A;  4CY1 A;  3RMZ D;  3K72 A;  3K71 A;  1U8C A;  2HES X;  2IUQ A;  4GMB A;  3BWS A;  4CC9 A;  3SXT D;  3O4H A;  1XKS A;  3NVQ A;  2GNQ A;  3RRM C;  3I89 A;  2G9A A;  2I0R A;  1C9I A;  3FGB A;  2JKX A;  2XDW A;  5I5M A;  3AL9 A;  3I2N A;  4A09 A;  1SQ9 A;  1UOQ A;  4ERZ A;  5IJ7 E;  2VC2 A;  1P22 A;  4ZOV A;  4WJK A;  2HJ4 A;  3SBR A;  4J8G A;  3IKO A;  1OMW B;  1I2M B;  3U4Y A;  4LGN A;  4A2L A;  4A0B A;  1A0R B;  2H13 A;  2PM9 A;  3B7F A;  2Z2N A;  3E0C A;  1GG2 B;  4A08 A;  1TYE A;  2OK6 A;  2Q7Q A;  5IGO A;  3SBQ A;  3NIF A;  2XL3 A;  4FWW A;  2CE8 A;  3EQ9 A;  4H5J A;  2IUV A;  5IJ8 E;  4QT8 A;  2QXV A;  5KDO B;  3O4G A;  1L0Q A;  1PEV A;  4CY3 A;  2H6K A;  3EI3 B;  4JSX C;  4ES0 A;  2VDK A;  1GP2 B;  3K27 A;  1QFS A;  4J78 A;  3SLE D;  3PE7 A;  2VDP A;  3N0E A;  1H2Y A;  3V5W B;  3RFH A;  2BBK H;  2H9L A;  3MUO A;  4Z7O A;  4BUJ C;  1PGU A;  2AGX A;  3MKS B;  5M61 A;  4G1M A;  3OKT A;  4H5I A;  4R7A B;  1MDA H;  2PM6 B;  4Y5R D;  2IWF A;  3BG0 A;  2QZP A;  3UVO A;  5EMK B;  3DSM A;  4A0A A;  2H9M A;  3FCS A;  4L3H D;  5JWZ A;  3SCY A;  1K32 A;  4IA9 A;  4XYI A;  4K3I D;  4J77 A;  2OVQ B;  3IUL A;  5FQD A;  2VDQ A;  5EAP A;  1N6E A;  4J0W A;  5M5S A;  4L1M A;  2VDM A;  1TYQ C;  3ORV D;  1QFM A;  2YMU A;  3F3F A;  1ERJ A;  1MG2 A;  4D6V A;  2P9L C;  5CYK A;  5M5U A;  4I79 A;  5HE0 B;  5GSA A;  3L4O D;  4WK0 A;  4Y7R A;  3JZH A;  3RFG A;  3IJE A;  1O6F A;  4CI8 A;  2XYI A;  3T3P A;  4GQ1 A;  2B5N A;  4J82 A;  2CNX A;  1JJU B;  1VE6 A;  2EIE A;  4L3G D;  3HFQ A;  1H2X A;  5FKT A;  1MG3 A;  3O4I A;  3OL2 B;  3NVX A;  3SJL D;  5M5V A;  4PBY A;  3NVN A;  4UM8 A;  5H17 A;  4RE6 A;  1GOH A;  3UVK A;  3SMR A;  5I5I A;  3EI4 B;  2XZG A;  3GFC A;  4GGC A;  3I7K A;  5M5T A;  4NSX A;  3DDU A;  3UKU C;  4NBM A;  3VA6 A;  4BCC A;  4K3J B;  3O4J A;  2OJY A;  4ERQ A;  3DM0 A;  5CXB B;  4E54 B;  3MVD K;  1O6G A;  5HQG A;  5K19 A;  4CZV A;  2IUR A;  2WQ8 A;  3EQ7 A;  2Z2P A;  1H2W A;  3UVL A;  2HXC A;  3A0F A;  4JT6 C;  1JMX B;  3KRX B;  4PSW B;  4ERY A;  4FHL A;  4O45 A;  3EMH A;  2AGW A;  4AX4 A;  5HE3 B;  4D9S A;  1VE7 A;  4CZY A;  2CN3 A;  3JRP A;  5HE1 B;  2YNP A;  3OKY B;  4J87 A;  4N14 A;  4L9O A;  4JT5 C;  1B9X A;  3MUN A;  1N6F A;  3DXM C;  2YNN A;  3JAM g;  4XEI C;  5H1M A;  2OVP B;  4U7A A;  3JB9 L;  3OTT A;  5EML B;  4J8B A;  1U2V C;  2IAA A;  4PSX B;  4MMZ A;  1B9Y A;  1JOF A;  2I0S A;  3IJC A;  4Z7N A;  3IIW A;  3IVM A;  3SFZ A;  4FA4 D;  5M5R A;  5SXM A;  3JZN A;  3RN0 D;  5HYN B;  3ZDY A;  5FLX g;  4J81 A;  3KRW B;  3AH8 B;  4DNV A;  2YB8 B;  2OK4 A;  5B4W A;  2CO0 C;  4J0X A;  4GQ2 P;  4QL1 A;  3I8E A;  4J84 A;  4AOW A;  4FA9 D;  4GM3 A;  5GXH A;  5C92 A;  3ZE0 A;  4A11 B;  5CXC B;  3EI3 A;  4AMY A;  3F3G A;  3EWE A;  2EIC A;  2XE4 A;  1GOT B;  3MXX A;  4PC0 A;  4X63 B;  2P9N C;  2AQ5 A;  1L5G A;  4J79 A;  5EAR A;  4Z7Q A;  3J80 g;  5C2V B;  4BCD A;  4CZX A;  2Z2O A;  4NEN A;  4CI2 A;  2B5L A;  4L1Q D;  2XU7 A;  2VZ1 A;  3C75 H;  4X3E A;  5AJA A;  4AEZ A;  5HDB A;  5EAL A;  4MK0 B;  4E5Z B;  2GC4 A;  3MKQ A;  2AGL A;  2B4E A;  1JTD B;  4FA1 D;  4QQE A;  5FA5 B;  4X60 B;  4GQB B;  2HU8 A;  3EI1 B;  3I7H A;  4JSN C;  3AL8 A;  4O2W A;  4KFM B;  5E6U A;  5IC7 A;  4QAM A;  3VGZ A;  4O1Q D;  3ULE C;  1GOG A;  1S4U X;  4AN1 A;  2H9N A;  3EI2 B;  5EM2 B;  2OVR B;  3PSL A;  3QHY B;  3L4M D;  3PXW D;  5AFU 3;  3V4P A;  3IUR A;  4HDJ A;  3K6S A;  2J55 H;  3ZDZ A;  3NID A;  2J57 G;  4ZOX A;  4AMZ A;  4PNK B;  3JZG A;  5AMS A;  4PBZ A;  3UVN A;  4GM8 A;  3MZK A;  3PSC B;  3V4V A;  4JSV C;  3KCI A;  3DWL C;  1Q47 A;  4YVD A;  3OL2 A;  3V9F A;  1NR0 A;  3SHF A;  1XIP A;  3UR4 A;  4TZ4 A;  4G55 A;  4BCB A;  5EMJ B;  2VDN A;  3IIY A;  5FFG A;  1C9L A;  1VZ3 A;  2H14 A;  2HYE A;  3EQ8 A;  5GMK n;  4JXM A;  3EI4 A;  2PBI B;  3N0D A;  4A2M A;  2P9S C;  3W15 A;  2CE9 A;  3SBP A;  4IMM A;  1QNI A;  4G56 B;  4QRJ A;  2AH0 A;  1TBG A;  5EAM A;  4O3U B;  1PBY B;  2AH1 A;  4CI1 A;  4JHN A;  1JMZ B;  1K3I A;  5CXB A;  4E54 A;  3OW8 A;  3DXK C;  5A2Q g;  5H14 A;  4J73 A;  3JRO A;  5E6S A;  1FWX A;  4ZOY A;  4X61 B;  3PVU B;  3PXS D;  1SQJ A;  3C9C A;  3T3M A;  1GOF A;  5FKQ A;  4A09 B; 
#chains in the Genus database with same CATH homology
 3P4F A;  3J81 g;  4J86 A;  3K26 A;  2J56 H;  3RSE C;  1OLZ A;  2XL2 A;  2PM7 B;  2CO0 A;  3OKY A;  4GGA A;  4O3T B;  5GXI A;  3EG6 A;  5C9Z B;  3SWS D;  2HKM A;  2BCJ B;  3V7D B;  2YNO A;  5FKS A;  4A0B B;  3UKR C;  2PM9 B;  4LG9 A;  2I0T A;  4ZN4 A;  5TEF A;  4A08 B;  4JSP C;  4FAN D;  2W18 A;  2I3T A;  3SVW D;  1GXR A;  2HJB A;  2IWK A;  1VYH C;  4FB1 D;  3RLM D;  2P9U C;  3EU7 A;  4GGD A;  4BH6 A;  4D0K A;  2P9I C;  3PXT D;  3C99 A;  3F3P A;  5C2W B;  1RI6 A;  3UVM A;  3RN1 D;  3AFC A;  3FRX A;  4A11 A;  5CXC A;  3FM0 A;  2MTA H;  2H47 A;  2H68 A;  2H9P A;  5FKR A;  4OZU A;  2UZY B;  2AGY A;  4A0A B;  4PXW A;  2P9K C;  3SN6 B;  2AGZ A;  3I7P A;  3JPX A;  2IUP A;  4E5Z A;  4A7J A;  3GRE A;  1U4C A;  2UZX B;  3AL8 B;  5CYK B;  2H3X A;  2EBS A;  3I8C A;  2QC5 A;  5K1C C;  3EI1 A;  3CIK B;  4BL0 A;  3ODT A;  4FA5 D;  5TEE A;  5EMM B;  3EI2 A;  4CI3 A;  3I7L A;  4UI9 R;  2HKR A;  3CFV A;  5EM2 A;  3VH0 A;  3MMY A;  4EWR A;  2CN2 A;  3BG1 A;  4U1E I;  2H6Q A;  4Z8L A;  2B5M A;  3MZL A;  4XYH A;  2G99 A;  2YBA A;  3C5M A;  5IGQ A;  4CY2 A;  2H6N A;  3ZWL B;  1R5M A;  1XHM A;  4FAV D;  4GZ8 A;  1NEX B;  3OKW A;  4OWR A;  3IJ1 A;  4ZOZ A;  2TRC B;  5FXY A;  4LG8 A;  3PVW B;  5TDH B;  3I7N A;  2GC7 A;  4JD2 C;  3IJ0 A;  1YFQ A;  1K8K C;  1SHY B;  4ESG A;  3CFS B;  5I5J A;  2O9K A;  5TF2 A;  4O9D A;  2OIZ A;  3I7O A;  2I3S A;  1PI6 A;  4CY5 A;  5THA A;  2P9P C;  5IT9 g;  4GM9 A;  5HE2 B;  1N6D A;  4CY1 A;  3RMZ D;  2HES X;  2IUQ A;  4GMB A;  3BWS A;  4CC9 A;  3SXT D;  3RRM C;  1XKS A;  3NVQ A;  2GNQ A;  3I89 A;  2G9A A;  2I0R A;  3FGB A;  5I5M A;  3AL9 A;  3I2N A;  4A09 A;  1SQ9 A;  4ERZ A;  5IJ7 E;  1P22 A;  4ZOV A;  2HJ4 A;  3SBR A;  4J8G A;  3IKO A;  1OMW B;  3U4Y A;  4LGN A;  4A2L A;  4A0B A;  1A0R B;  2H13 A;  2PM9 A;  3B7F A;  2Z2N A;  3E0C A;  1GG2 B;  4A08 A;  2OK6 A;  2Q7Q A;  5IGO A;  3SBQ A;  2XL3 A;  4FWW A;  2CE8 A;  4H5J A;  2IUV A;  5IJ8 E;  4QT8 A;  2QXV A;  5KDO B;  1L0Q A;  1PEV A;  4CY3 A;  2H6K A;  3EI3 B;  4JSX C;  4ES0 A;  1GP2 B;  3K27 A;  4J78 A;  3SLE D;  3PE7 A;  3N0E A;  3V5W B;  3RFH A;  2BBK H;  2H9L A;  4BUJ C;  1PGU A;  2AGX A;  3MKS B;  4H5I A;  3OKT A;  4R7A B;  1MDA H;  2PM6 B;  4Y5R D;  2IWF A;  3BG0 A;  3UVO A;  5EMK B;  3DSM A;  4A0A A;  2H9M A;  4L3H D;  5JWZ A;  3SCY A;  1K32 A;  4IA9 A;  4XYI A;  4K3I D;  4J77 A;  2OVQ B;  5FQD A;  5EAP A;  1N6E A;  4J0W A;  1TYQ C;  3ORV D;  2YMU A;  3F3F A;  1ERJ A;  1MG2 A;  4D6V A;  2P9L C;  5CYK A;  4I79 A;  5HE0 B;  5GSA A;  3L4O D;  4Y7R A;  3JZH A;  3RFG A;  4CI8 A;  2XYI A;  4GQ1 A;  2B5N A;  4J82 A;  2CNX A;  1JJU B;  4L3G D;  3HFQ A;  5FKT A;  1MG3 A;  3OL2 B;  3NVX A;  3SJL D;  4PBY A;  3NVN A;  5H17 A;  3UVK A;  3SMR A;  5I5I A;  3EI4 B;  3GFC A;  4GGC A;  3I7K A;  4NSX A;  3UKU C;  3VA6 A;  4K3J B;  2OJY A;  4ERQ A;  3DM0 A;  5CXB B;  4E54 B;  5K19 A;  5HQG A;  4CZV A;  2IUR A;  2Z2P A;  3UVL A;  2HXC A;  3A0F A;  4JT6 C;  1JMX B;  3KRX B;  4PSW B;  4ERY A;  4FHL A;  4O45 A;  3EMH A;  2AGW A;  5HE3 B;  4CZY A;  2CN3 A;  3JRP A;  5HE1 B;  2YNP A;  3OKY B;  4J87 A;  4N14 A;  4L9O A;  4JT5 C;  1B9X A;  1N6F A;  3DXM C;  2YNN A;  3JAM g;  4XEI C;  5H1M A;  2OVP B;  4U7A A;  3JB9 L;  3OTT A;  5EML B;  4J8B A;  1U2V C;  2IAA A;  4PSX B;  1B9Y A;  1JOF A;  2I0S A;  3IJC A;  3IIW A;  3SFZ A;  4FA4 D;  5SXM A;  3JZN A;  3RN0 D;  5HYN B;  5FLX g;  4J81 A;  3KRW B;  3AH8 B;  2YB8 B;  2OK4 A;  5B4W A;  2CO0 C;  4J0X A;  4GQ2 P;  4QL1 A;  3I8E A;  4J84 A;  4AOW A;  4FA9 D;  4GM3 A;  5GXH A;  4A11 B;  5CXC B;  3EI3 A;  3F3G A;  3EWE A;  1GOT B;  3MXX A;  4PC0 A;  4X63 B;  2P9N C;  2AQ5 A;  4J79 A;  5EAR A;  3J80 g;  5C2V B;  4CZX A;  2Z2O A;  4CI2 A;  2B5L A;  4L1Q D;  2XU7 A;  3C75 H;  4X3E A;  5AJA A;  4AEZ A;  5EAL A;  4MK0 B;  4E5Z B;  2GC4 A;  3MKQ A;  2AGL A;  2B4E A;  4FA1 D;  4QQE A;  5FA5 B;  4X60 B;  4GQB B;  3EI1 B;  3I7H A;  4JSN C;  3AL8 A;  4KFM B;  5IC7 A;  3VGZ A;  4O1Q D;  3ULE C;  1S4U X;  2H9N A;  3EI2 B;  5EM2 B;  2OVR B;  3PSL A;  3L4M D;  3PXW D;  5AFU 3;  4HDJ A;  2J55 H;  2J57 G;  4ZOX A;  4PNK B;  3JZG A;  5AMS A;  4PBZ A;  3UVN A;  4GM8 A;  3MZK A;  3PSC B;  4JSV C;  3DWL C;  1Q47 A;  4YVD A;  3OL2 A;  3V9F A;  1NR0 A;  3SHF A;  1XIP A;  3UR4 A;  4TZ4 A;  5EMJ B;  3IIY A;  2H14 A;  2HYE A;  5GMK n;  4JXM A;  3EI4 A;  2PBI B;  3N0D A;  4A2M A;  2P9S C;  3W15 A;  2CE9 A;  3SBP A;  4IMM A;  1QNI A;  4G56 B;  4QRJ A;  2AH0 A;  1TBG A;  5EAM A;  4O3U B;  1PBY B;  2AH1 A;  4CI1 A;  1JMZ B;  5CXB A;  4E54 A;  3OW8 A;  3DXK C;  5A2Q g;  5H14 A;  4J73 A;  3JRO A;  1FWX A;  4ZOY A;  4X61 B;  3PVU B;  3PXS D;  1SQJ A;  3C9C A;  5FKQ A;  4A09 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...