3GFCA

Crystal structure of histone-binding protein rbbp4
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
387
structure length
339
Chain Sequence
WKKNTPFLYDLVMTHALEWPSLTAQWLPDVTDFSIHRLVLGTHTQNHLVIASVQLPNKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDCNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Histone-binding protein RBBP4
publication title Structure and function of WD40 domain proteins.
pubmed doi rcsb
source organism Homo sapiens
total genus 80
structure length 339
sequence length 387
ec nomenclature
pdb deposition date 2009-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
A PF12265 CAF1C_H4-bd Histone-binding protein RBBP4 or subunit C of CAF1 complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3gfcA00
1B9XA 4XYHA 4A0BA 3EI3B 3OL2A 3I8EA 1A0RB 4CZVA 2YNOA 4PBYA 3SLED 5CXCB 4G56B 4CZXA 4E5ZB 4L1QD 4Y7RA 3F3PA 4FB1D 4ZN4A 2MTAH 2P9NC 4J79A 3FGBA 4CY3A 4BL0A 5FKQA 3K27A 4FWWA 2AGLA 2PBIB 3JPXA 2IWKA 3UVMA 3ZWLB 5C9ZB 3L4MD 2GNQA 4K3ID 2P9KC 3NVNA 3UKRC 2QC5A 1OMWB 3E0CA 3RFHA 3JAMg 3IKOA 2HJ4A 4A0AB 3EG6A 4LGNA 3EU7A 5EMJB 4A09A 3PVWB 2I0RA 4CI1A 2IUPA 4A08A 4PNKB 2J56H 2UZYB 2PM9A 5IJ8E 3SN6B 4CI2A 3W15A 4IMMA 2OIZA 2H47A 2B4EA 2HKRA 4ZOVA 3VGZA 5IT9g 1PBYB 5EARA 2IUQA 4JSNC 3BWSA 3SBPA 3V7DB 5GSAA 2IUVA 5AFU3 2B5LA 3FRXA 5K19A 3I89A 4FA5D 3DXMC 4R7AB 5FXYA 3OL2B 3JROA 3B7FA 4J8GA 3RFGA 2H9PA 1ERJA 3F3GA 5THAA 2XL2A 5TDHB 4E54A 5A2Qg 3V5WB 4OWRA 3I8CA 4L3GD 3MKSB 4FHLA 4NSXA 4CY5A 2XYIA 3DM0A 4GQBB 1YFQA 2B5MA 3I7PA 5AMSA 4ES0A 3JZGA 3I7NA 5HE3B 3UKUC 4J0XA 5EMLB 4LG9A 5HE1B 5H14A 3I2NA 3L4OD 4A09B 1B9YA 1JMXB 5FLXg 3BG0A 4JT6C 4Z8LA 4X3EA 3RLMD 3PSLA 5CXBB 4FA1D 5C2VB 3P4FA 4YVDA 4CC9A 3I7LA 2PM9B 3JZNA 4MK0B 1MG3A 4AEZA 5H17A 2O9KA 2GC7A 3DXKC 3EI4A 1P22A 4XYIA 1GP2B 3K26A 3C9CA 2Z2OA 5FA5B 4H5JA 4GGDA 2J57G 4O1QD 4PSWB 2CO0C 2XL3A 2PM6B 2I3SA 3IIYA 3VH0A 3N0EA 2CE8A 4O3UB 4E54B 2J55H 2OVRB 1XKSA 2BCJB 2EBSA 2QXVA 3GREA 3DSMA 2P9IC 5TEFA 5HQGA 4CY2A 2YMUA 3RMZD 3AH8B 2CN2A 4J82A 2H14A 5TF2A 5FKTA 3AL8B 5B4WA 3KRXB 1SHYB 2YBAA 3KRWB 2P9LC 4ERYA 3ODTA 4EWRA 3U4YA 2H6QA 5C2WB 4JSXC 4OZUA 2H3XA 4A7JA 4O3TB 2YNNA 3JRPA 2P9PC 4QQEA 4FAVD 4A11A 4ZOZA 4BH6A 1N6DA 4IA9A 5CYKA 2BBKH 4GZ8A 4A0BB 4A2LA 1PI6A 3EI4B 4ERZA 5EMKB 1RI6A 3MMYA 3VA6A 3MZKA 5IJ7E 5GMKn 1JJUB 3C75H 4CI8A 4D0KA 4X63B 3CIKB 5EMMB 5GXHA 3SBQA 4X60B 3DWLC 4UI9R 2HESX 2OVQB 5HE0B 2G9AA 5FQDA 4Y5RD 1NR0A 2IWFA 4TZ4A 4JSPC 3OKWA 2I0SA 4L3HD 3SHFA 1U4CA 4PSXB 3SFZA 4HDJA 3ULEC 4PXWA 4J81A 5IC7A 3MXXA 3CFSB 4J78A 2AGZA 4I79A 4ZOYA 4GQ1A 2XU7A 4D6VA 2W18A 3PXSD 4QT8A 3SJLD 1XHMA 5KDOB 3RN0D 2HYEA 4ZOXA 3UVKA 4A08B 4J0WA 3A0FA 1GG2B 3PXWD 4ESGA 3GFCA 2IAAA 3PE7A 3C99A 2CO0A 2IURA 3EWEA 3F3FA 2Z2NA 4A11B 3EI2A 1U2VC 4QRJA 4N14A 2OJYA 4ERQA 3AL9A 3N0DA 1SQ9A 2AGWA 4GM9A 3OTTA 1MDAH 3SXTD 5TEEA 3OW8A 3SMRA 2AH0A 4JT5C 4FA4D 2G99A 3CFVA 3UR4A 5EM2A 3EMHA 3SBRA 5AJAA 1GOTB 4GGCA 3JZHA 5HE2B 3SCYA 3I7HA 3C5MA 2P9UC 2Q7QA 3OKTA 3RN1D 2P9SC 4O9DA 5SXMA 1Q47A 5I5MA 3OKYA 3AFCA 3BG1A 3V9FA 4AOWA 2H13A 5I5JA 5EALA 2I0TA 4J77A 3IJCA 4O45A 4LG8A 3RRMC 2AGXA 4J73A 4BUJC 4JSVC 4JXMA 3MKQA 4J86A 4FAND 4GM8A 2H9LA 1MG2A 1PGUA 5FKRA 3NVXA 4GGAA 4GM3A 1TBGA 1N6FA 4FA9D 4K3JB 1L0QA 5IGOA 3FM0A 4GQ2P 1GXRA 4H5IA 1S4UX 5CXBA 2YB8B 2AGYA 4GMBA 2UZXB 4L9OA 1JMZB 2B5NA 1NEXB 2OVPB 3EI2B 2HXCA 1K8KC 1FWXA 2H6NA 1R5MA 4KFMB 3IIWA 3UVNA 5JWZA 3PXTD 4JD2C 2OK4A 3EI1A 1N6EA 2H9NA 3I7KA 3UVLA 2AH1A 3I7OA 5IGQA 4CZYA 3EI3A 3J81g 2GC4A 4PBZA 5GXIA 2TRCB 5CXCA 2AQ5A 3ORVD 4E5ZA 3SWSD 2CNXA 3SVWD 1VYHC 5EAPA 1JOFA 3IJ0A 4CY1A 5EM2B 3JB9L 5I5IA 2HKMA 4J84A 3NVQA 4U1EI 3PSCB 1TYQC 3OKYB 5EAMA 1XIPA 5FKSA 4A2MA 2H68A 5K1CC 2CE9A 4PC0A 3PVUB 1SQJA 2PM7B 3RSEC 1K32A 1OLZA 2OK6A 2H6KA 3IJ1A 3J80g 4A0AA 4U7AA 3AL8A 2H9MA 4XEIC 5HYNB 3HFQA 3MZLA 4X61B 2Z2PA 4CI3A 4J87A 3UVOA 4QL1A 2I3TA 5CYKB 1PEVA 1QNIA 2HJBA 5H1MA 2CN3A 4J8BA 2YNPA 3EI1B
chains in the Genus database with same CATH superfamily
1B9XA 4XYHA 4A0BA 3EI3B 3OL2A 3I8EA 1A0RB 4CZVA 2YNOA 4MMXA 4PBYA 3SLED 1O6FA 5CXCB 4G56B 4CZXA 4E5ZB 4L1QD 4Y7RA 1K3IA 3F3PA 1VE6A 2BKLA 4FB1D 4ZN4A 2MTAH 2P9NC 4J79A 3FGBA 4CY3A 3QHYB 4BL0A 3IUQA 5FKQA 3IUJA 3K27A 4FWWA 3K6SA 2AGLA 2PBIB 2XDWA 3JPXA 2IWKA 4L1MA 3UVMA 3ZWLB 5C9ZB 3L4MD 2GNQA 4K3ID 2P9KC 3NVNA 3UKRC 2QC5A 1OMWB 3E0CA 5M5RA 3RFHA 3JAMg 3IKOA 2HJ4A 4A0AB 3EG6A 4LGNA 3EU7A 5EMJB 4A09A 2VC2A 1GOFA 4Z7OA 5C92A 3PVWB 2I0RA 4CI1A 4O02A 2IUPA 1BPOA 4A08A 5HDBA 4PNKB 2J56H 2UZYB 2PM9A 1TYEA 5IJ8E 3SN6B 4CI2A 3W15A 4IMMA 2OIZA 2H47A 4Z7NA 2B4EA 2HKRA 4ZOVA 3O4IA 3VGZA 5IT9g 1PBYB 4G1MA 5EARA 2IUQA 4JSNC 3BWSA 3SBPA 3V7DB 5GSAA 2IUVA 5AFU3 2B5LA 3FCUA 3FRXA 5K19A 3I89A 4FA5D 3DXMC 2VDKA 2VDRA 4R7AB 2XZGA 5FXYA 3OL2B 3JROA 3O4HA 3B7FA 4J8GA 3RFGA 2H9PA 1T2XA 1ERJA 3F3GA 5THAA 2XL2A 5TDHB 4E54A 5A2Qg 3ZDZA 3V5WB 4OWRA 3I8CA 4L3GD 3MKSB 3IULA 4FHLA 2VDMA 4NSXA 4CY5A 2VDOA 2XYIA 4NAAA 3DM0A 4GQBB 4D9SA 1YFQA 2B5MA 3I7PA 5AMSA 4ES0A 3JZGA 3I7NA 5HE3B 3UKUC 4J0XA 5EMLB 4LG9A 3KCIA 5HE1B 5H14A 2JKXA 3I2NA 3L4OD 4A09B 1B9YA 2QR5A 1JMXB 5FLXg 3BG0A 4JT6C 3K71A 4Z8LA 4X3EA 4DNWA 3RLMD 3PSLA 5CXBB 4FA1D 5C2VB 3P4FA 4YVDA 4CC9A 3I7LA 3NIFA 2PM9B 3JZNA 2VDNA 4MK0B 1MG3A 4AEZA 5H17A 2O9KA 2GC7A 3DXKC 3EI4A 4NC4A 1P22A 4XYIA 1L5GA 1GP2B 3K26A 3C9CA 2Z2OA 5FA5B 5C86A 4H5JA 4GGDA 2J57G 3ZDYA 4AX4A 4O1QD 4PSWB 2CO0C 2XL3A 2PM6B 2I3SA 1M1XA 3IIYA 3VH0A 3N0EA 2CE8A 3EQ9A 4O3UB 4E54B 5FFOA 1U8CA 2J55H 1H2ZA 2OVRB 1XKSA 2BCJB 1VZ2A 2EBSA 2QXVA 3GREA 1E8NA 3O4JA 3DSMA 2P9IC 3NIGA 5HQGA 1I2MB 1VE7A 5TEFA 4CY2A 2YMUA 3RMZD 3AH8B 2CN2A 4J82A 3VI3A 2H14A 5TF2A 5FKTA 3AL8B 5M61A 3GD1I 3ZDXA 3ZE1A 5B4WA 3KRXB 1SHYB 2YBAA 3KRWB 2P9LC 4ERYA 3ODTA 4EWRA 3U4YA 4WK4A 2H6QA 4BCBA 4UM9A 5C2WB 4JSXC 4OZUA 4AN0A 2H3XA 4A7JA 4O3TB 1YR2A 2YNNA 3JRPA 2P9PC 4QQEA 4FAVD 4A11A 4ZOZA 4BH6A 1N6DA 4IA9A 5CYKA 3IUNA 2BBKH 4GZ8A 5E6UA 4A0BB 2EIBA 4A2LA 4O2WA 1PI6A 3EI4B 4ERZA 1UTCA 5EMKB 1RI6A 3MMYA 3VA6A 3MZKA 5IJ7E 5GMKn 1QFMA 1JJUB 4UM8A 3C75H 4CI8A 4QAMA 4WJKA 4X63B 4D0KA 3CIKB 2VZ3A 5EMMB 3ZE2A 5GXHA 1JV2A 3SBQA 4X60B 3V4PA 3DWLC 4MMZA 4UI9R 2HESX 2OVQB 5HE0B 1GOHA 3EQ8A 2G9AA 1QFSA 5FQDA 4Y5RD 1NR0A 2IWFA 1UOQA 4TZ4A 5M5SA 4NENA 4JSPC 3OKWA 2I0SA 4L3HD 4AMYA 3SHFA 1U4CA 3GC3B 4PSXB 3SFZA 4HDJA 3ULEC 4PXWA 4BCCA 4J81A 1H2WA 5IC7A 3MXXA 3CFSB 4J78A 2AGZA 4I79A 2VDLA 4ZOYA 4GQ1A 4DNVA 2XU7A 1VZ3A 4D6VA 5E6RA 2W18A 3PXSD 4QT8A 3SJLD 1XHMA 4BP9A 5KDOB 3RN0D 2HYEA 4ZOXA 3UVKA 1C9LA 4A08B 2VDPA 4J0WA 3QI0A 4AN1A 3A0FA 2VDQA 1GG2B 3PXWD 4ESGA 3GFCA 2IAAA 3VI4A 3PE7A 3C99A 2CO0A 2IURA 4BCDA 3EWEA 3F3FA 2Z2NA 2QZPA 4A11B 4Z7QA 3EI2A 1U2VC 4QRJA 4JHNA 4N14A 2OJYA 4RE6A 4ERQA 3AL9A 3N0DA 1SQ9A 2AGWA 4GM9A 3OTTA 1MDAH 3SXTD 5TEEA 3OW8A 3SMRA 2AH0A 5E6SA 4JT5C 4FA4D 3IVMA 2G99A 3CFVA 3UR4A 5EM2A 3EMHA 3SBRA 5AJAA 1JTDB 1GOTB 4GGCA 3JZHA 5HE2B 3SCYA 5M5UA 3I7HA 3V4VA 3C5MA 2P9UC 2Q7QA 3OKTA 3RN1D 2P9SC 4O9DA 5SXMA 1Q47A 2EIDA 5I5MA 3OKYA 3AFCA 3BG1A 2HU5A 3K72A 3V9FA 4AOWA 2H13A 5I5JA 3FCSA 5EALA 2I0TA 5FFGA 4J77A 3IJCA 4O45A 4LG8A 1H2XA 3MUOA 3O4GA 4G55A 3RRMC 2AGXA 4J73A 2EIEA 4BUJC 4WK2A 3IJEA 4JSVC 4JXMA 3MVDK 3MKQA 4J86A 4FAND 4GM8A 2H9LA 1MG2A 1PGUA 5FKRA 3MUNA 3NVXA 4GGAA 4GM3A 1TBGA 1N6FA 4FA9D 4IRZA 4MMYA 4K3JB 1L0QA 4WK0A 5IGOA 2XE4A 1A12A 3FM0A 4GQ2P 1GXRA 4H5IA 2VZ1A 1E8MA 1S4UX 4BP8A 5CXBA 2YB8B 2AGYA 4GMBA 2UZXB 4L9OA 1JMZB 1H2YA 2B5NA 1NEXB 2OVPB 3EI2B 2HXCA 1K8KC 1FWXA 2H6NA 1R5MA 4AMZA 4KFMB 3IIWA 3UVNA 5JWZA 3PXTD 4JD2C 2OK4A 3EI1A 1UOPA 2HU7A 1N6EA 2H9NA 3I7KA 3UVLA 2AH1A 3I7OA 5IGQA 3EQ7A 4CZYA 3EI3A 1E5TA 3J81g 2GC4A 4PBZA 4DNUA 1UOOA 5GXIA 2TRCB 5CXCA 2AQ5A 3ORVD 4E5ZA 3OF7A 3SWSD 2CNXA 3SVWD 4NBMA 1VYHC 5EAPA 1JOFA 3IJ0A 4CY1A 5EM2B 3JB9L 5I5IA 2HKMA 4J84A 3T3PA 3NVQA 4U1EI 5M5VA 3PSCB 1TYQC 3OKYB 3IUMA 5EAMA 1O6GA 1XIPA 4RE5A 5FKSA 4A2MA 2H68A 5K1CC 2CE9A 4PC0A 3PVUB 1SQJA 1C9IA 2PM7B 3RSEC 1K32A 1OLZA 2OK6A 2H6KA 3IJ1A 3J80g 4A0AA 4U7AA 5M5TA 3AL8A 2H9MA 4XEIC 3DDUA 5HYNB 3HFQA 3MZLA 4X61B 2Z2PA 1GOGA 4CI3A 4JHPC 4J87A 3NIDA 3UVOA 4QL1A 2I3TA 3ZE0A 3IURA 5CYKB 1PEVA 1QNIA 2HJBA 5H1MA 3T3MA 2CN3A 4J8BA 2YNPA 2HU8A 3EI1B 2WQ8A 2EICA 4G1EA
chains in the Genus database with same CATH topology
1B9XA 4XYHA 4A0BA 3EI3B 3OL2A 3I8EA 1A0RB 4CZVA 2YNOA 4PBYA 3SLED 5CXCB 4G56B 4CZXA 4E5ZB 4L1QD 4Y7RA 3F3PA 4FB1D 4ZN4A 2MTAH 2P9NC 4J79A 3FGBA 4CY3A 4BL0A 5FKQA 3K27A 4FWWA 2AGLA 2PBIB 3JPXA 2IWKA 3UVMA 3ZWLB 5C9ZB 3L4MD 2GNQA 4K3ID 2P9KC 3NVNA 3UKRC 2QC5A 1OMWB 3E0CA 3RFHA 3JAMg 3IKOA 2HJ4A 4A0AB 3EG6A 4LGNA 3EU7A 5EMJB 4A09A 3PVWB 2I0RA 4CI1A 2IUPA 4A08A 4PNKB 2J56H 2UZYB 2PM9A 5IJ8E 3SN6B 4CI2A 3W15A 4IMMA 2OIZA 2H47A 2B4EA 2HKRA 4ZOVA 3VGZA 5IT9g 1PBYB 5EARA 2IUQA 4JSNC 3BWSA 3SBPA 3V7DB 5GSAA 2IUVA 5AFU3 2B5LA 3FRXA 5K19A 3I89A 4FA5D 3DXMC 4R7AB 5FXYA 3OL2B 3JROA 3B7FA 4J8GA 3RFGA 2H9PA 1ERJA 3F3GA 5THAA 2XL2A 5TDHB 4E54A 5A2Qg 3V5WB 4OWRA 3I8CA 4L3GD 3MKSB 4FHLA 4NSXA 4CY5A 2XYIA 3DM0A 4GQBB 1YFQA 2B5MA 3I7PA 5AMSA 4ES0A 3JZGA 3I7NA 5HE3B 3UKUC 4J0XA 5EMLB 4LG9A 5HE1B 5H14A 3I2NA 3L4OD 4A09B 1B9YA 1JMXB 5FLXg 3BG0A 4JT6C 4Z8LA 4X3EA 3RLMD 3PSLA 5CXBB 4FA1D 5C2VB 3P4FA 4YVDA 4CC9A 3I7LA 2PM9B 3JZNA 4MK0B 1MG3A 4AEZA 5H17A 2O9KA 2GC7A 3DXKC 3EI4A 1P22A 4XYIA 1GP2B 3K26A 3C9CA 2Z2OA 5FA5B 4H5JA 4GGDA 2J57G 4O1QD 4PSWB 2CO0C 2XL3A 2PM6B 2I3SA 3IIYA 3VH0A 3N0EA 2CE8A 4O3UB 4E54B 2J55H 2OVRB 1XKSA 2BCJB 2EBSA 2QXVA 3GREA 3DSMA 2P9IC 5TEFA 5HQGA 4CY2A 2YMUA 3RMZD 3AH8B 2CN2A 4J82A 2H14A 5TF2A 5FKTA 3AL8B 5B4WA 3KRXB 1SHYB 2YBAA 3KRWB 2P9LC 4ERYA 3ODTA 4EWRA 3U4YA 2H6QA 5C2WB 4JSXC 4OZUA 2H3XA 4A7JA 4O3TB 2YNNA 3JRPA 2P9PC 4QQEA 4FAVD 4A11A 4ZOZA 4BH6A 1N6DA 4IA9A 5CYKA 2BBKH 4GZ8A 4A0BB 4A2LA 1PI6A 3EI4B 4ERZA 5EMKB 1RI6A 3MMYA 3VA6A 3MZKA 5IJ7E 5GMKn 1JJUB 3C75H 4CI8A 4D0KA 4X63B 3CIKB 5EMMB 5GXHA 3SBQA 4X60B 3DWLC 4UI9R 2HESX 2OVQB 5HE0B 2G9AA 5FQDA 4Y5RD 1NR0A 2IWFA 4TZ4A 4JSPC 3OKWA 2I0SA 4L3HD 3SHFA 1U4CA 4PSXB 3SFZA 4HDJA 3ULEC 4PXWA 4J81A 5IC7A 3MXXA 3CFSB 4J78A 2AGZA 4I79A 4ZOYA 4GQ1A 2XU7A 4D6VA 2W18A 3PXSD 4QT8A 3SJLD 1XHMA 5KDOB 3RN0D 2HYEA 4ZOXA 3UVKA 4A08B 4J0WA 3A0FA 1GG2B 3PXWD 4ESGA 3GFCA 2IAAA 3PE7A 3C99A 2CO0A 2IURA 3EWEA 3F3FA 2Z2NA 4A11B 3EI2A 1U2VC 4QRJA 4N14A 2OJYA 4ERQA 3AL9A 3N0DA 1SQ9A 2AGWA 4GM9A 3OTTA 1MDAH 3SXTD 5TEEA 3OW8A 3SMRA 2AH0A 4JT5C 4FA4D 2G99A 3CFVA 3UR4A 5EM2A 3EMHA 3SBRA 5AJAA 1GOTB 4GGCA 3JZHA 5HE2B 3SCYA 3I7HA 3C5MA 2P9UC 2Q7QA 3OKTA 3RN1D 2P9SC 4O9DA 5SXMA 1Q47A 5I5MA 3OKYA 3AFCA 3BG1A 3V9FA 4AOWA 2H13A 5I5JA 5EALA 2I0TA 4J77A 3IJCA 4O45A 4LG8A 3RRMC 2AGXA 4J73A 4BUJC 4JSVC 4JXMA 3MKQA 4J86A 4FAND 4GM8A 2H9LA 1MG2A 1PGUA 5FKRA 3NVXA 4GGAA 4GM3A 1TBGA 1N6FA 4FA9D 4K3JB 1L0QA 5IGOA 3FM0A 4GQ2P 1GXRA 4H5IA 1S4UX 5CXBA 2YB8B 2AGYA 4GMBA 2UZXB 4L9OA 1JMZB 2B5NA 1NEXB 2OVPB 3EI2B 2HXCA 1K8KC 1FWXA 2H6NA 1R5MA 4KFMB 3IIWA 3UVNA 5JWZA 3PXTD 4JD2C 2OK4A 3EI1A 1N6EA 2H9NA 3I7KA 3UVLA 2AH1A 3I7OA 5IGQA 4CZYA 3EI3A 3J81g 2GC4A 4PBZA 5GXIA 2TRCB 5CXCA 2AQ5A 3ORVD 4E5ZA 3SWSD 2CNXA 3SVWD 1VYHC 5EAPA 1JOFA 3IJ0A 4CY1A 5EM2B 3JB9L 5I5IA 2HKMA 4J84A 3NVQA 4U1EI 3PSCB 1TYQC 3OKYB 5EAMA 1XIPA 5FKSA 4A2MA 2H68A 5K1CC 2CE9A 4PC0A 3PVUB 1SQJA 2PM7B 3RSEC 1K32A 1OLZA 2OK6A 2H6KA 3IJ1A 3J80g 4A0AA 4U7AA 3AL8A 2H9MA 4XEIC 5HYNB 3HFQA 3MZLA 4X61B 2Z2PA 4CI3A 4J87A 3UVOA 4QL1A 2I3TA 5CYKB 1PEVA 1QNIA 2HJBA 5H1MA 2CN3A 4J8BA 2YNPA 3EI1B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B9X A;  4XYH A;  4A0B A;  3EI3 B;  3OL2 A;  3I8E A;  1A0R B;  4CZV A;  2YNO A;  4PBY A;  3SLE D;  5CXC B;  4G56 B;  4CZX A;  4E5Z B;  4L1Q D;  4Y7R A;  3F3P A;  4FB1 D;  4ZN4 A;  2MTA H;  2P9N C;  4J79 A;  3FGB A;  4CY3 A;  4BL0 A;  5FKQ A;  3K27 A;  4FWW A;  2AGL A;  2PBI B;  3JPX A;  2IWK A;  3UVM A;  3ZWL B;  5C9Z B;  3L4M D;  2GNQ A;  4K3I D;  2P9K C;  3NVN A;  3UKR C;  2QC5 A;  1OMW B;  3E0C A;  3RFH A;  3JAM g;  3IKO A;  2HJ4 A;  4A0A B;  3EG6 A;  4LGN A;  3EU7 A;  5EMJ B;  4A09 A;  3PVW B;  2I0R A;  4CI1 A;  2IUP A;  4A08 A;  4PNK B;  2J56 H;  2UZY B;  2PM9 A;  5IJ8 E;  3SN6 B;  4CI2 A;  3W15 A;  4IMM A;  2OIZ A;  2H47 A;  2B4E A;  2HKR A;  4ZOV A;  3VGZ A;  5IT9 g;  1PBY B;  5EAR A;  2IUQ A;  4JSN C;  3BWS A;  3SBP A;  3V7D B;  5GSA A;  2IUV A;  5AFU 3;  2B5L A;  3FRX A;  5K19 A;  3I89 A;  4FA5 D;  3DXM C;  4R7A B;  5FXY A;  3OL2 B;  3JRO A;  3B7F A;  4J8G A;  3RFG A;  2H9P A;  1ERJ A;  3F3G A;  5THA A;  2XL2 A;  5TDH B;  4E54 A;  5A2Q g;  3V5W B;  4OWR A;  3I8C A;  4L3G D;  3MKS B;  4FHL A;  4NSX A;  4CY5 A;  2XYI A;  3DM0 A;  4GQB B;  1YFQ A;  2B5M A;  3I7P A;  5AMS A;  4ES0 A;  3JZG A;  3I7N A;  5HE3 B;  3UKU C;  4J0X A;  5EML B;  4LG9 A;  5HE1 B;  5H14 A;  3I2N A;  3L4O D;  4A09 B;  1B9Y A;  1JMX B;  5FLX g;  3BG0 A;  4JT6 C;  4Z8L A;  4X3E A;  3RLM D;  3PSL A;  5CXB B;  4FA1 D;  5C2V B;  3P4F A;  4YVD A;  4CC9 A;  3I7L A;  2PM9 B;  3JZN A;  4MK0 B;  1MG3 A;  4AEZ A;  5H17 A;  2O9K A;  2GC7 A;  3DXK C;  3EI4 A;  1P22 A;  4XYI A;  1GP2 B;  3K26 A;  3C9C A;  2Z2O A;  5FA5 B;  4H5J A;  4GGD A;  2J57 G;  4O1Q D;  4PSW B;  2CO0 C;  2XL3 A;  2PM6 B;  2I3S A;  3IIY A;  3VH0 A;  3N0E A;  2CE8 A;  4O3U B;  4E54 B;  2J55 H;  2OVR B;  1XKS A;  2BCJ B;  2EBS A;  2QXV A;  3GRE A;  3DSM A;  2P9I C;  5TEF A;  5HQG A;  4CY2 A;  2YMU A;  3RMZ D;  3AH8 B;  2CN2 A;  4J82 A;  2H14 A;  5TF2 A;  5FKT A;  3AL8 B;  5B4W A;  3KRX B;  1SHY B;  2YBA A;  3KRW B;  2P9L C;  4ERY A;  3ODT A;  4EWR A;  3U4Y A;  2H6Q A;  5C2W B;  4JSX C;  4OZU A;  2H3X A;  4A7J A;  4O3T B;  2YNN A;  3JRP A;  2P9P C;  4QQE A;  4FAV D;  4A11 A;  4ZOZ A;  4BH6 A;  1N6D A;  4IA9 A;  5CYK A;  2BBK H;  4GZ8 A;  4A0B B;  4A2L A;  1PI6 A;  3EI4 B;  4ERZ A;  5EMK B;  1RI6 A;  3MMY A;  3VA6 A;  3MZK A;  5IJ7 E;  5GMK n;  1JJU B;  3C75 H;  4CI8 A;  4D0K A;  4X63 B;  3CIK B;  5EMM B;  5GXH A;  3SBQ A;  4X60 B;  3DWL C;  4UI9 R;  2HES X;  2OVQ B;  5HE0 B;  2G9A A;  5FQD A;  4Y5R D;  1NR0 A;  2IWF A;  4TZ4 A;  4JSP C;  3OKW A;  2I0S A;  4L3H D;  3SHF A;  1U4C A;  4PSX B;  3SFZ A;  4HDJ A;  3ULE C;  4PXW A;  4J81 A;  5IC7 A;  3MXX A;  3CFS B;  4J78 A;  2AGZ A;  4I79 A;  4ZOY A;  4GQ1 A;  2XU7 A;  4D6V A;  2W18 A;  3PXS D;  4QT8 A;  3SJL D;  1XHM A;  5KDO B;  3RN0 D;  2HYE A;  4ZOX A;  3UVK A;  4A08 B;  4J0W A;  3A0F A;  1GG2 B;  3PXW D;  4ESG A;  3GFC A;  2IAA A;  3PE7 A;  3C99 A;  2CO0 A;  2IUR A;  3EWE A;  3F3F A;  2Z2N A;  4A11 B;  3EI2 A;  1U2V C;  4QRJ A;  4N14 A;  2OJY A;  4ERQ A;  3AL9 A;  3N0D A;  1SQ9 A;  2AGW A;  4GM9 A;  3OTT A;  1MDA H;  3SXT D;  5TEE A;  3OW8 A;  3SMR A;  2AH0 A;  4JT5 C;  4FA4 D;  2G99 A;  3CFV A;  3UR4 A;  5EM2 A;  3EMH A;  3SBR A;  5AJA A;  1GOT B;  4GGC A;  3JZH A;  5HE2 B;  3SCY A;  3I7H A;  3C5M A;  2P9U C;  2Q7Q A;  3OKT A;  3RN1 D;  2P9S C;  4O9D A;  5SXM A;  1Q47 A;  5I5M A;  3OKY A;  3AFC A;  3BG1 A;  3V9F A;  4AOW A;  2H13 A;  5I5J A;  5EAL A;  2I0T A;  4J77 A;  3IJC A;  4O45 A;  4LG8 A;  3RRM C;  2AGX A;  4J73 A;  4BUJ C;  4JSV C;  4JXM A;  3MKQ A;  4J86 A;  4FAN D;  4GM8 A;  2H9L A;  1MG2 A;  1PGU A;  5FKR A;  3NVX A;  4GGA A;  4GM3 A;  1TBG A;  1N6F A;  4FA9 D;  4K3J B;  1L0Q A;  5IGO A;  3FM0 A;  4GQ2 P;  1GXR A;  4H5I A;  1S4U X;  5CXB A;  2YB8 B;  2AGY A;  4GMB A;  2UZX B;  4L9O A;  1JMZ B;  2B5N A;  1NEX B;  2OVP B;  3EI2 B;  2HXC A;  1K8K C;  1FWX A;  2H6N A;  1R5M A;  4KFM B;  3IIW A;  3UVN A;  5JWZ A;  3PXT D;  4JD2 C;  2OK4 A;  3EI1 A;  1N6E A;  2H9N A;  3I7K A;  3UVL A;  2AH1 A;  3I7O A;  5IGQ A;  4CZY A;  3EI3 A;  3J81 g;  2GC4 A;  4PBZ A;  5GXI A;  2TRC B;  5CXC A;  2AQ5 A;  3ORV D;  4E5Z A;  3SWS D;  2CNX A;  3SVW D;  1VYH C;  5EAP A;  1JOF A;  3IJ0 A;  4CY1 A;  5EM2 B;  3JB9 L;  5I5I A;  2HKM A;  4J84 A;  3NVQ A;  4U1E I;  3PSC B;  1TYQ C;  3OKY B;  5EAM A;  1XIP A;  5FKS A;  4A2M A;  2H68 A;  5K1C C;  2CE9 A;  4PC0 A;  3PVU B;  1SQJ A;  2PM7 B;  3RSE C;  1K32 A;  1OLZ A;  2OK6 A;  2H6K A;  3IJ1 A;  3J80 g;  4A0A A;  4U7A A;  3AL8 A;  2H9M A;  4XEI C;  5HYN B;  3HFQ A;  3MZL A;  4X61 B;  2Z2P A;  4CI3 A;  4J87 A;  3UVO A;  4QL1 A;  2I3T A;  5CYK B;  1PEV A;  1QNI A;  2HJB A;  5H1M A;  2CN3 A;  4J8B A;  2YNP A;  3EI1 B; 
#chains in the Genus database with same CATH topology
 1B9X A;  4XYH A;  4A0B A;  3EI3 B;  3OL2 A;  3I8E A;  1A0R B;  4CZV A;  2YNO A;  4MMX A;  4PBY A;  3SLE D;  1O6F A;  5CXC B;  4G56 B;  4CZX A;  4E5Z B;  4L1Q D;  4Y7R A;  1K3I A;  3F3P A;  1VE6 A;  2BKL A;  4FB1 D;  4ZN4 A;  2MTA H;  2P9N C;  4J79 A;  3FGB A;  4CY3 A;  3QHY B;  4BL0 A;  3IUQ A;  5FKQ A;  3IUJ A;  3K27 A;  4FWW A;  3K6S A;  2AGL A;  2PBI B;  2XDW A;  3JPX A;  2IWK A;  4L1M A;  3UVM A;  3ZWL B;  5C9Z B;  3L4M D;  2GNQ A;  4K3I D;  2P9K C;  3NVN A;  3UKR C;  2QC5 A;  1OMW B;  3E0C A;  5M5R A;  3RFH A;  3JAM g;  3IKO A;  2HJ4 A;  4A0A B;  3EG6 A;  4LGN A;  3EU7 A;  5EMJ B;  4A09 A;  2VC2 A;  1GOF A;  4Z7O A;  5C92 A;  3PVW B;  2I0R A;  4CI1 A;  4O02 A;  2IUP A;  1BPO A;  4A08 A;  5HDB A;  4PNK B;  2J56 H;  2UZY B;  2PM9 A;  1TYE A;  5IJ8 E;  3SN6 B;  4CI2 A;  3W15 A;  4IMM A;  2OIZ A;  2H47 A;  4Z7N A;  2B4E A;  2HKR A;  4ZOV A;  3O4I A;  3VGZ A;  5IT9 g;  1PBY B;  4G1M A;  5EAR A;  2IUQ A;  4JSN C;  3BWS A;  3SBP A;  3V7D B;  5GSA A;  2IUV A;  5AFU 3;  2B5L A;  3FCU A;  3FRX A;  5K19 A;  3I89 A;  4FA5 D;  3DXM C;  2VDK A;  2VDR A;  4R7A B;  2XZG A;  5FXY A;  3OL2 B;  3JRO A;  3O4H A;  3B7F A;  4J8G A;  3RFG A;  2H9P A;  1T2X A;  1ERJ A;  3F3G A;  5THA A;  2XL2 A;  5TDH B;  4E54 A;  5A2Q g;  3ZDZ A;  3V5W B;  4OWR A;  3I8C A;  4L3G D;  3MKS B;  3IUL A;  4FHL A;  2VDM A;  4NSX A;  4CY5 A;  2VDO A;  2XYI A;  4NAA A;  3DM0 A;  4GQB B;  4D9S A;  1YFQ A;  2B5M A;  3I7P A;  5AMS A;  4ES0 A;  3JZG A;  3I7N A;  5HE3 B;  3UKU C;  4J0X A;  5EML B;  4LG9 A;  3KCI A;  5HE1 B;  5H14 A;  2JKX A;  3I2N A;  3L4O D;  4A09 B;  1B9Y A;  2QR5 A;  1JMX B;  5FLX g;  3BG0 A;  4JT6 C;  3K71 A;  4Z8L A;  4X3E A;  4DNW A;  3RLM D;  3PSL A;  5CXB B;  4FA1 D;  5C2V B;  3P4F A;  4YVD A;  4CC9 A;  3I7L A;  3NIF A;  2PM9 B;  3JZN A;  2VDN A;  4MK0 B;  1MG3 A;  4AEZ A;  5H17 A;  2O9K A;  2GC7 A;  3DXK C;  3EI4 A;  4NC4 A;  1P22 A;  4XYI A;  1L5G A;  1GP2 B;  3K26 A;  3C9C A;  2Z2O A;  5FA5 B;  5C86 A;  4H5J A;  4GGD A;  2J57 G;  3ZDY A;  4AX4 A;  4O1Q D;  4PSW B;  2CO0 C;  2XL3 A;  2PM6 B;  2I3S A;  1M1X A;  3IIY A;  3VH0 A;  3N0E A;  2CE8 A;  3EQ9 A;  4O3U B;  4E54 B;  5FFO A;  1U8C A;  2J55 H;  1H2Z A;  2OVR B;  1XKS A;  2BCJ B;  1VZ2 A;  2EBS A;  2QXV A;  3GRE A;  1E8N A;  3O4J A;  3DSM A;  2P9I C;  3NIG A;  5HQG A;  1I2M B;  1VE7 A;  5TEF A;  4CY2 A;  2YMU A;  3RMZ D;  3AH8 B;  2CN2 A;  4J82 A;  3VI3 A;  2H14 A;  5TF2 A;  5FKT A;  3AL8 B;  5M61 A;  3GD1 I;  3ZDX A;  3ZE1 A;  5B4W A;  3KRX B;  1SHY B;  2YBA A;  3KRW B;  2P9L C;  4ERY A;  3ODT A;  4EWR A;  3U4Y A;  4WK4 A;  2H6Q A;  4BCB A;  4UM9 A;  5C2W B;  4JSX C;  4OZU A;  4AN0 A;  2H3X A;  4A7J A;  4O3T B;  1YR2 A;  2YNN A;  3JRP A;  2P9P C;  4QQE A;  4FAV D;  4A11 A;  4ZOZ A;  4BH6 A;  1N6D A;  4IA9 A;  5CYK A;  3IUN A;  2BBK H;  4GZ8 A;  5E6U A;  4A0B B;  2EIB A;  4A2L A;  4O2W A;  1PI6 A;  3EI4 B;  4ERZ A;  1UTC A;  5EMK B;  1RI6 A;  3MMY A;  3VA6 A;  3MZK A;  5IJ7 E;  5GMK n;  1QFM A;  1JJU B;  4UM8 A;  3C75 H;  4CI8 A;  4QAM A;  4WJK A;  4X63 B;  4D0K A;  3CIK B;  2VZ3 A;  5EMM B;  3ZE2 A;  5GXH A;  1JV2 A;  3SBQ A;  4X60 B;  3V4P A;  3DWL C;  4MMZ A;  4UI9 R;  2HES X;  2OVQ B;  5HE0 B;  1GOH A;  3EQ8 A;  2G9A A;  1QFS A;  5FQD A;  4Y5R D;  1NR0 A;  2IWF A;  1UOQ A;  4TZ4 A;  5M5S A;  4NEN A;  4JSP C;  3OKW A;  2I0S A;  4L3H D;  4AMY A;  3SHF A;  1U4C A;  3GC3 B;  4PSX B;  3SFZ A;  4HDJ A;  3ULE C;  4PXW A;  4BCC A;  4J81 A;  1H2W A;  5IC7 A;  3MXX A;  3CFS B;  4J78 A;  2AGZ A;  4I79 A;  2VDL A;  4ZOY A;  4GQ1 A;  4DNV A;  2XU7 A;  1VZ3 A;  4D6V A;  5E6R A;  2W18 A;  3PXS D;  4QT8 A;  3SJL D;  1XHM A;  4BP9 A;  5KDO B;  3RN0 D;  2HYE A;  4ZOX A;  3UVK A;  1C9L A;  4A08 B;  2VDP A;  4J0W A;  3QI0 A;  4AN1 A;  3A0F A;  2VDQ A;  1GG2 B;  3PXW D;  4ESG A;  3GFC A;  2IAA A;  3VI4 A;  3PE7 A;  3C99 A;  2CO0 A;  2IUR A;  4BCD A;  3EWE A;  3F3F A;  2Z2N A;  2QZP A;  4A11 B;  4Z7Q A;  3EI2 A;  1U2V C;  4QRJ A;  4JHN A;  4N14 A;  2OJY A;  4RE6 A;  4ERQ A;  3AL9 A;  3N0D A;  1SQ9 A;  2AGW A;  4GM9 A;  3OTT A;  1MDA H;  3SXT D;  5TEE A;  3OW8 A;  3SMR A;  2AH0 A;  5E6S A;  4JT5 C;  4FA4 D;  3IVM A;  2G99 A;  3CFV A;  3UR4 A;  5EM2 A;  3EMH A;  3SBR A;  5AJA A;  1JTD B;  1GOT B;  4GGC A;  3JZH A;  5HE2 B;  3SCY A;  5M5U A;  3I7H A;  3V4V A;  3C5M A;  2P9U C;  2Q7Q A;  3OKT A;  3RN1 D;  2P9S C;  4O9D A;  5SXM A;  1Q47 A;  2EID A;  5I5M A;  3OKY A;  3AFC A;  3BG1 A;  2HU5 A;  3K72 A;  3V9F A;  4AOW A;  2H13 A;  5I5J A;  3FCS A;  5EAL A;  2I0T A;  5FFG A;  4J77 A;  3IJC A;  4O45 A;  4LG8 A;  1H2X A;  3MUO A;  3O4G A;  4G55 A;  3RRM C;  2AGX A;  4J73 A;  2EIE A;  4BUJ C;  4WK2 A;  3IJE A;  4JSV C;  4JXM A;  3MVD K;  3MKQ A;  4J86 A;  4FAN D;  4GM8 A;  2H9L A;  1MG2 A;  1PGU A;  5FKR A;  3MUN A;  3NVX A;  4GGA A;  4GM3 A;  1TBG A;  1N6F A;  4FA9 D;  4IRZ A;  4MMY A;  4K3J B;  1L0Q A;  4WK0 A;  5IGO A;  2XE4 A;  1A12 A;  3FM0 A;  4GQ2 P;  1GXR A;  4H5I A;  2VZ1 A;  1E8M A;  1S4U X;  4BP8 A;  5CXB A;  2YB8 B;  2AGY A;  4GMB A;  2UZX B;  4L9O A;  1JMZ B;  1H2Y A;  2B5N A;  1NEX B;  2OVP B;  3EI2 B;  2HXC A;  1K8K C;  1FWX A;  2H6N A;  1R5M A;  4AMZ A;  4KFM B;  3IIW A;  3UVN A;  5JWZ A;  3PXT D;  4JD2 C;  2OK4 A;  3EI1 A;  1UOP A;  2HU7 A;  1N6E A;  2H9N A;  3I7K A;  3UVL A;  2AH1 A;  3I7O A;  5IGQ A;  3EQ7 A;  4CZY A;  3EI3 A;  1E5T A;  3J81 g;  2GC4 A;  4PBZ A;  4DNU A;  1UOO A;  5GXI A;  2TRC B;  5CXC A;  2AQ5 A;  3ORV D;  4E5Z A;  3OF7 A;  3SWS D;  2CNX A;  3SVW D;  4NBM A;  1VYH C;  5EAP A;  1JOF A;  3IJ0 A;  4CY1 A;  5EM2 B;  3JB9 L;  5I5I A;  2HKM A;  4J84 A;  3T3P A;  3NVQ A;  4U1E I;  5M5V A;  3PSC B;  1TYQ C;  3OKY B;  3IUM A;  5EAM A;  1O6G A;  1XIP A;  4RE5 A;  5FKS A;  4A2M A;  2H68 A;  5K1C C;  2CE9 A;  4PC0 A;  3PVU B;  1SQJ A;  1C9I A;  2PM7 B;  3RSE C;  1K32 A;  1OLZ A;  2OK6 A;  2H6K A;  3IJ1 A;  3J80 g;  4A0A A;  4U7A A;  5M5T A;  3AL8 A;  2H9M A;  4XEI C;  3DDU A;  5HYN B;  3HFQ A;  3MZL A;  4X61 B;  2Z2P A;  1GOG A;  4CI3 A;  4JHP C;  4J87 A;  3NID A;  3UVO A;  4QL1 A;  2I3T A;  3ZE0 A;  3IUR A;  5CYK B;  1PEV A;  1QNI A;  2HJB A;  5H1M A;  3T3M A;  2CN3 A;  4J8B A;  2YNP A;  2HU8 A;  3EI1 B;  2WQ8 A;  2EIC A;  4G1E A; 
#chains in the Genus database with same CATH homology
 1B9X A;  4XYH A;  4A0B A;  3EI3 B;  3OL2 A;  3I8E A;  1A0R B;  4CZV A;  2YNO A;  4PBY A;  3SLE D;  5CXC B;  4G56 B;  4CZX A;  4E5Z B;  4L1Q D;  4Y7R A;  3F3P A;  4FB1 D;  4ZN4 A;  2MTA H;  2P9N C;  4J79 A;  3FGB A;  4CY3 A;  4BL0 A;  5FKQ A;  3K27 A;  4FWW A;  2AGL A;  2PBI B;  3JPX A;  2IWK A;  3UVM A;  3ZWL B;  5C9Z B;  3L4M D;  2GNQ A;  4K3I D;  2P9K C;  3NVN A;  3UKR C;  2QC5 A;  1OMW B;  3E0C A;  3RFH A;  3JAM g;  3IKO A;  2HJ4 A;  4A0A B;  3EG6 A;  4LGN A;  3EU7 A;  5EMJ B;  4A09 A;  3PVW B;  2I0R A;  4CI1 A;  2IUP A;  4A08 A;  4PNK B;  2J56 H;  2UZY B;  2PM9 A;  5IJ8 E;  3SN6 B;  4CI2 A;  3W15 A;  4IMM A;  2OIZ A;  2H47 A;  2B4E A;  2HKR A;  4ZOV A;  3VGZ A;  5IT9 g;  1PBY B;  5EAR A;  2IUQ A;  4JSN C;  3BWS A;  3SBP A;  3V7D B;  5GSA A;  2IUV A;  5AFU 3;  2B5L A;  3FRX A;  5K19 A;  3I89 A;  4FA5 D;  3DXM C;  4R7A B;  5FXY A;  3OL2 B;  3JRO A;  3B7F A;  4J8G A;  3RFG A;  2H9P A;  1ERJ A;  3F3G A;  5THA A;  2XL2 A;  5TDH B;  4E54 A;  5A2Q g;  3V5W B;  4OWR A;  3I8C A;  4L3G D;  3MKS B;  4FHL A;  4NSX A;  4CY5 A;  2XYI A;  3DM0 A;  4GQB B;  1YFQ A;  2B5M A;  3I7P A;  5AMS A;  4ES0 A;  3JZG A;  3I7N A;  5HE3 B;  3UKU C;  4J0X A;  5EML B;  4LG9 A;  5HE1 B;  5H14 A;  3I2N A;  3L4O D;  4A09 B;  1B9Y A;  1JMX B;  5FLX g;  3BG0 A;  4JT6 C;  4Z8L A;  4X3E A;  3RLM D;  3PSL A;  5CXB B;  4FA1 D;  5C2V B;  3P4F A;  4YVD A;  4CC9 A;  3I7L A;  2PM9 B;  3JZN A;  4MK0 B;  1MG3 A;  4AEZ A;  5H17 A;  2O9K A;  2GC7 A;  3DXK C;  3EI4 A;  1P22 A;  4XYI A;  1GP2 B;  3K26 A;  3C9C A;  2Z2O A;  5FA5 B;  4H5J A;  4GGD A;  2J57 G;  4O1Q D;  4PSW B;  2CO0 C;  2XL3 A;  2PM6 B;  2I3S A;  3IIY A;  3VH0 A;  3N0E A;  2CE8 A;  4O3U B;  4E54 B;  2J55 H;  2OVR B;  1XKS A;  2BCJ B;  2EBS A;  2QXV A;  3GRE A;  3DSM A;  2P9I C;  5TEF A;  5HQG A;  4CY2 A;  2YMU A;  3RMZ D;  3AH8 B;  2CN2 A;  4J82 A;  2H14 A;  5TF2 A;  5FKT A;  3AL8 B;  5B4W A;  3KRX B;  1SHY B;  2YBA A;  3KRW B;  2P9L C;  4ERY A;  3ODT A;  4EWR A;  3U4Y A;  2H6Q A;  5C2W B;  4JSX C;  4OZU A;  2H3X A;  4A7J A;  4O3T B;  2YNN A;  3JRP A;  2P9P C;  4QQE A;  4FAV D;  4A11 A;  4ZOZ A;  4BH6 A;  1N6D A;  4IA9 A;  5CYK A;  2BBK H;  4GZ8 A;  4A0B B;  4A2L A;  1PI6 A;  3EI4 B;  4ERZ A;  5EMK B;  1RI6 A;  3MMY A;  3VA6 A;  3MZK A;  5IJ7 E;  5GMK n;  1JJU B;  3C75 H;  4CI8 A;  4D0K A;  4X63 B;  3CIK B;  5EMM B;  5GXH A;  3SBQ A;  4X60 B;  3DWL C;  4UI9 R;  2HES X;  2OVQ B;  5HE0 B;  2G9A A;  5FQD A;  4Y5R D;  1NR0 A;  2IWF A;  4TZ4 A;  4JSP C;  3OKW A;  2I0S A;  4L3H D;  3SHF A;  1U4C A;  4PSX B;  3SFZ A;  4HDJ A;  3ULE C;  4PXW A;  4J81 A;  5IC7 A;  3MXX A;  3CFS B;  4J78 A;  2AGZ A;  4I79 A;  4ZOY A;  4GQ1 A;  2XU7 A;  4D6V A;  2W18 A;  3PXS D;  4QT8 A;  3SJL D;  1XHM A;  5KDO B;  3RN0 D;  2HYE A;  4ZOX A;  3UVK A;  4A08 B;  4J0W A;  3A0F A;  1GG2 B;  3PXW D;  4ESG A;  3GFC A;  2IAA A;  3PE7 A;  3C99 A;  2CO0 A;  2IUR A;  3EWE A;  3F3F A;  2Z2N A;  4A11 B;  3EI2 A;  1U2V C;  4QRJ A;  4N14 A;  2OJY A;  4ERQ A;  3AL9 A;  3N0D A;  1SQ9 A;  2AGW A;  4GM9 A;  3OTT A;  1MDA H;  3SXT D;  5TEE A;  3OW8 A;  3SMR A;  2AH0 A;  4JT5 C;  4FA4 D;  2G99 A;  3CFV A;  3UR4 A;  5EM2 A;  3EMH A;  3SBR A;  5AJA A;  1GOT B;  4GGC A;  3JZH A;  5HE2 B;  3SCY A;  3I7H A;  3C5M A;  2P9U C;  2Q7Q A;  3OKT A;  3RN1 D;  2P9S C;  4O9D A;  5SXM A;  1Q47 A;  5I5M A;  3OKY A;  3AFC A;  3BG1 A;  3V9F A;  4AOW A;  2H13 A;  5I5J A;  5EAL A;  2I0T A;  4J77 A;  3IJC A;  4O45 A;  4LG8 A;  3RRM C;  2AGX A;  4J73 A;  4BUJ C;  4JSV C;  4JXM A;  3MKQ A;  4J86 A;  4FAN D;  4GM8 A;  2H9L A;  1MG2 A;  1PGU A;  5FKR A;  3NVX A;  4GGA A;  4GM3 A;  1TBG A;  1N6F A;  4FA9 D;  4K3J B;  1L0Q A;  5IGO A;  3FM0 A;  4GQ2 P;  1GXR A;  4H5I A;  1S4U X;  5CXB A;  2YB8 B;  2AGY A;  4GMB A;  2UZX B;  4L9O A;  1JMZ B;  2B5N A;  1NEX B;  2OVP B;  3EI2 B;  2HXC A;  1K8K C;  1FWX A;  2H6N A;  1R5M A;  4KFM B;  3IIW A;  3UVN A;  5JWZ A;  3PXT D;  4JD2 C;  2OK4 A;  3EI1 A;  1N6E A;  2H9N A;  3I7K A;  3UVL A;  2AH1 A;  3I7O A;  5IGQ A;  4CZY A;  3EI3 A;  3J81 g;  2GC4 A;  4PBZ A;  5GXI A;  2TRC B;  5CXC A;  2AQ5 A;  3ORV D;  4E5Z A;  3SWS D;  2CNX A;  3SVW D;  1VYH C;  5EAP A;  1JOF A;  3IJ0 A;  4CY1 A;  5EM2 B;  3JB9 L;  5I5I A;  2HKM A;  4J84 A;  3NVQ A;  4U1E I;  3PSC B;  1TYQ C;  3OKY B;  5EAM A;  1XIP A;  5FKS A;  4A2M A;  2H68 A;  5K1C C;  2CE9 A;  4PC0 A;  3PVU B;  1SQJ A;  2PM7 B;  3RSE C;  1K32 A;  1OLZ A;  2OK6 A;  2H6K A;  3IJ1 A;  3J80 g;  4A0A A;  4U7A A;  3AL8 A;  2H9M A;  4XEI C;  5HYN B;  3HFQ A;  3MZL A;  4X61 B;  2Z2P A;  4CI3 A;  4J87 A;  3UVO A;  4QL1 A;  2I3T A;  5CYK B;  1PEV A;  1QNI A;  2HJB A;  5H1M A;  2CN3 A;  4J8B A;  2YNP A;  3EI1 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...