3GFCA

Crystal structure of histone-binding protein rbbp4
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
387
structure length
339
Chain Sequence
WKKNTPFLYDLVMTHALEWPSLTAQWLPDVTDFSIHRLVLGTHTQNHLVIASVQLPNKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDCNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of WD40 domain proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Histone-binding protein RBBP4
total genus 80
structure length 339
sequence length 387
ec nomenclature
pdb deposition date 2009-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
A PF12265 CAF1C_H4-bd Histone-binding protein RBBP4 or subunit C of CAF1 complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3gfcA00
4FWWA 4ERQA 1NR0A 3JROA 2AGYA 2AGZA 5GXHA 3HFQA 2HXCA 3EI2A 1QNIA 2HJBA 3IIYA 1PGUA 3SMRA 4E54A 3SLED 3GFCA 3ULEC 2YB8B 2IUPA 3IJ1A 5CYKA 1K32A 4K3ID 2OK4A 3EI4B 3PE7A 3N0EA 4ZOZA 3VA6A 2B5NA 3AL8B 3K26A 4ERZA 2H13A 5IJ8E 1GXRA 2H9LA 1VYHC 5I5MA 4FAND 5IC7A 3EU7A 3MMYA 4FA5D 5AJAA 4GQ2P 2YNOA 4OWRA 4OZUA 5FKTA 3IKOA 2B4EA 2PM9B 4J81A 3J80g 4FA4D 4XYIA 4KFMB 5GSAA 3UVOA 5C9ZB 2XU7A 3DSMA 2I0RA 5HYNB 4A0AB 4HDJA 5GXIA 3PSCB 2BBKH 4L9OA 3FRXA 2OVPB 1JMZB 2QXVA 4D0KA 1OLZA 4BL0A 4Y5RD 4EWRA 4JD2C 2AH1A 3AFCA 4D6VA 4GM8A 3EG6A 3EI3B 5K19A 3SBPA 3J81g 4A0AA 4CY3A 3RN0D 3OKYA 4CY1A 2QC5A 4O1QD 3V5WB 2IAAA 3K27A 3PVWB 4QRJA 1OMWB 4L3HD 3RRMC 4H5JA 3JB9L 1XIPA 2AH0A 2P9PC 1MG3A 4BUJC 4ZOXA 2Z2NA 4GQBB 3V7DB 3I8CA 4GQ1A 4A0BA 3F3PA 4L1QD 1P22A 3UVNA 4CY2A 1YFQA 3L4MD 5TEEA 3OKWA 3DM0A 5H17A 5A2Qg 4ZOYA 4N14A 5GMKn 3PXSD 3JZNA 3OW8A 5CXBB 1JOFA 3VH0A 3I7PA 3JZGA 2P9UC 3JAMg 2B5LA 3OL2B 1NEXB 4GM3A 4ES0A 4JXMA 4AEZA 3PXTD 1RI6A 4Z8LA 5THAA 4E5ZB 2Q7QA 2P9LC 4JT6C 4AOWA 3SCYA 3GREA 5AMSA 4QL1A 3VGZA 3A0FA 5KDOB 4A2MA 1A0RB 3N0DA 4FAVD 4E54B 3MXXA 5CYKB 3OL2A 2CN3A 2H6NA 2YBAA 2HYEA 2EBSA 3AL8A 3IJ0A 4A08B 3JZHA 2GC4A 4JSPC 2B5MA 3V9FA 1S4UX 4L3GD 3SJLD 2OK6A 1FWXA 4J84A 3P4FA 3SBQA 4A09A 2I3SA 4JT5C 4A11A 3CFSB 5FKQA 2AGXA 5FXYA 2H47A 3MZLA 4A08A 4NSXA 3I2NA 2PBIB 4JSNC 3NVQA 1U2VC 4BH6A 4J87A 1GP2B 3MKQA 2AGWA 2O9KA 5C2VB 5EM2A 5FQDA 2OIZA 2PM6B 5H1MA 3C5MA 4X61B 3I7OA 4GZ8A 5HE3B 3RMZD 4CI2A 5FLXg 2P9IC 4K3JB 3EI1A 4QQEA 3L4OD 4CZYA 3OTTA 3RSEC 4X63B 2G99A 2H9PA 1U4CA 1N6FA 2H6QA 1GOTB 2GNQA 3IIWA 2HKRA 4ERYA 3E0CA 2AQ5A 3C99A 2OVRB 3C75H 3MZKA 4GMBA 3F3GA 4CZVA 2YNPA 5EMLB 3RN1D 2CO0A 4LG8A 3I7HA 2H14A 3RFHA 4A11B 4U7AA 5HQGA 5CXCA 4FA9D 4A0BB 1N6EA 5HE1B 4CI3A 4FHLA 3ODTA 5JWZA 4GGDA 4O3TB 4IA9A 5EMKB 3PXWD 4R7AB 2IWFA 1Q47A 1ERJA 4O3UB 3SHFA 3I89A 5I5JA 2OVQB 5SXMA 3UR4A 4MK0B 4GGAA 1PI6A 2IUVA 4PSXB 5I5IA 4Y7RA 4JSXC 2H9NA 3UKRC 4I79A 4J0WA 4O45A 3BG0A 3DWLC 3I7KA 3EI1B 3W15A 4CZXA 1B9XA 2H3XA 5FKSA 2TRCB 5TF2A 2PM7B 3I8EA 2Z2PA 4XEIC 5AFU3 4FA1D 1TBGA 4IMMA 3PVUB 3DXKC 1PBYB 3I7NA 4FB1D 4J8GA 4U1EI 3ORVD 4CY5A 3RFGA 1XHMA 3OKYB 4A2LA 2YNNA 1MG2A 2H6KA 2Z2OA 5EALA 4GM9A 2G9AA 4ZN4A 2IURA 1JJUB 2HKMA 4A09B 4J0XA 2UZXB 3JRPA 5EAMA 1JMXB 4ESGA 1K8KC 3U4YA 2HESX 5B4WA 4ZOVA 4YVDA 2IWKA 1SHYB 2XL3A 4PSWB 4JSVC 5IGOA 2GC7A 4PXWA 2OJYA 1XKSA 3CFVA 5IJ7E 2XYIA 4J73A 1SQJA 2PM9A 5CXBA 2YMUA 3SN6B 2H9MA 3NVXA 2P9KC 5EAPA 5IGQA 3UKUC 2MTAH 4QT8A 4GGCA 3RLMD 4E5ZA 4CC9A 3IJCA 4J79A 4UI9R 3BWSA 4PNKB 2I0TA 4X60B 3EWEA 5EMMB 3FGBA 2AGLA 3FM0A 5IT9g 4A7JA 4G56B 3EI3A 2P9NC 3UVLA 2UZYB 3I7LA 5CXCB 4O9DA 3MKSB 3KRWB 4J8BA 3KRXB 4J78A 2H68A 3SFZA 1PEVA 2P9SC 3EI2B 4PBYA 5FKRA 5EARA 2J56H 4XYHA 2CE8A 3EI4A 1MDAH 2CO0C 3B7FA 4LGNA 4TZ4A 1L0QA 3PSLA 3NVNA 2I3TA 2CN2A 5HE0B 2CE9A 4X3EA 1TYQC 5HE2B 4J77A 2W18A 3DXMC 4J86A 5TEFA 4CI1A 3SVWD 3SBRA 5EM2B 1GG2B 4LG9A 3C9CA 4H5IA 5FA5B 2HJ4A 2I0SA 2XL2A 3AL9A 3SWSD 3UVKA 2IUQA 3CIKB 5H14A 5EMJB 5K1CC 2CNXA 3EMHA 1R5MA 3ZWLB 1N6DA 1B9YA 4PBZA 2J55H 4CI8A 3SXTD 3OKTA 1SQ9A 3JPXA 2J57G 5TDHB 4J82A 5C2WB 2BCJB 3AH8B 3F3FA 3BG1A 4PC0A 3UVMA
chains in the Genus database with same CATH superfamily
1JTDB 4FWWA 4ERQA 1NR0A 4BCDA 3JROA 2AGYA 2AGZA 5GXHA 2VZ3A 2BKLA 2HXCA 3HFQA 3O4HA 3ZE2A 3EI2A 1QNIA 2HJBA 3IIYA 1PGUA 3SMRA 4E54A 2QZPA 3SLED 3GFCA 3ULEC 2YB8B 2IUPA 3IJ1A 5CYKA 1K32A 4K3ID 2OK4A 3EI4B 3PE7A 3N0EA 4ZOZA 3VA6A 1H2XA 2B5NA 3AL8B 3K26A 4ERZA 2H13A 2HU7A 1GXRA 1VE7A 2H9LA 2JKXA 1VYHC 5IJ8E 3VI4A 3IULA 5I5MA 4JHNA 4FAND 2VDKA 5IC7A 4NBMA 4BP8A 3EU7A 3MMYA 4FA5D 5AJAA 4GQ2P 2YNOA 1T2XA 4OWRA 3O4JA 3FCSA 3V4VA 4OZUA 3OF7A 5FKTA 3IKOA 2B4EA 2PM9B 4J81A 4BP9A 3J80g 4FA4D 4UM8A 4XYIA 4KFMB 5GSAA 3UVOA 5C9ZB 2XU7A 4DNWA 3DSMA 2I0RA 5HYNB 4A0AB 4HDJA 5GXIA 4MMXA 1M1XA 3PSCB 2BBKH 1VZ2A 4L9OA 3FRXA 2VDLA 2OVPB 1JMZB 2QXVA 4D0KA 3IUMA 1OLZA 2XDWA 4NENA 4BL0A 4Y5RD 4EWRA 4JD2C 2AH1A 5C86A 3AFCA 4DNUA 4D6VA 1VE6A 4GM8A 4O2WA 3EG6A 3EI3B 5K19A 3SBPA 3J81g 3MUNA 4A0AA 3ZDZA 4CY3A 3RN0D 1UOQA 3K72A 3OKYA 4CY1A 2QC5A 1A12A 4O1QD 3V5WB 2IAAA 4WK0A 3K27A 3PVWB 4QRJA 1OMWB 4L3HD 3RRMC 2EIEA 4H5JA 3JB9L 1XIPA 1GOHA 1QFMA 2AH0A 1I2MB 2P9PC 4IRZA 1MG3A 4BUJC 4ZOXA 2Z2NA 4GQBB 5FFGA 3V7DB 3I8CA 4GQ1A 4A0BA 3F3PA 4L1QD 2XE4A 1P22A 3UVNA 4CY2A 1YFQA 3L4MD 3O4GA 5TEEA 3OKWA 3VI3A 3DM0A 5H17A 3T3MA 5A2Qg 4ZOYA 4G55A 1E8NA 4N14A 5GMKn 3PXSD 3JZNA 3OW8A 5CXBB 1JOFA 3VH0A 1K3IA 3I7PA 3JZGA 2P9UC 5M5TA 3JAMg 2B5LA 3OL2B 1NEXB 4GM3A 4ES0A 4JXMA 4AEZA 3PXTD 1RI6A 4Z8LA 5THAA 4E5ZB 2Q7QA 1JV2A 4NC4A 4JHPC 4NAAA 2P9LC 4JT6C 3DDUA 3SCYA 4AOWA 3GREA 5AMSA 4QL1A 3VGZA 3A0FA 3MUOA 5KDOB 4A2MA 1A0RB 3N0DA 4FAVD 4E54B 3MXXA 1UOOA 2VZ1A 5CYKB 3OL2A 5E6UA 2CN3A 2H6NA 2YBAA 1L5GA 2HYEA 2EBSA 4RE6A 3MVDK 3AL8A 3IJ0A 4A08B 3JZHA 4AX4A 2GC4A 4JSPC 2B5MA 3V9FA 1S4UX 4L3GD 3SJLD 2OK6A 1FWXA 4J84A 4Z7OA 3P4FA 3SBQA 4A09A 2I3SA 4JT5C 4Z7QA 4A11A 3CFSB 5FKQA 2AGXA 5FXYA 3ZDYA 2H47A 3MZLA 4A08A 4L1MA 4NSXA 3I2NA 2PBIB 4JSNC 3T3PA 3NVQA 1U2VC 4AN1A 4BH6A 4J87A 1GP2B 3MKQA 1BPOA 2VDRA 2AGWA 3ZE0A 5E6RA 2O9KA 5C2VB 5EM2A 5FQDA 2OIZA 2PM6B 4UM9A 5M5VA 5H1MA 5E6SA 3C5MA 4X61B 5M61A 3I7OA 4GZ8A 4BCBA 5HE3B 3RMZD 4CI2A 5FLXg 2P9IC 4K3JB 3EI1A 4QQEA 3L4OD 4CZYA 3OTTA 4AN0A 3RSEC 4X63B 2G99A 2H9PA 1U4CA 3IUNA 1N6FA 2H6QA 1GOTB 4RE5A 2GNQA 3IIWA 2HKRA 4AMZA 4ERYA 2QR5A 3E0CA 4D9SA 2AQ5A 3C99A 2OVRB 3C75H 3MZKA 4GMBA 3F3GA 2HU8A 4CZVA 2YNPA 1H2WA 5EMLB 3RN1D 2CO0A 3IURA 4LG8A 3I7HA 2H14A 2VDMA 3IJEA 3RFHA 4A11B 1VZ3A 4U7AA 5HQGA 5CXCA 4FA9D 4A0BB 2EICA 1H2YA 1N6EA 5HE1B 4CI3A 3K6SA 4FHLA 3ODTA 5M5UA 5JWZA 3QI0A 4GGDA 4O3TB 4IA9A 3EQ8A 3PXWD 5EMKB 4R7AB 2IWFA 1Q47A 1ERJA 4O3UB 3SHFA 3I89A 5I5JA 2OVQB 4WJKA 5SXMA 3UR4A 2VDNA 4MK0B 4GGAA 1PI6A 2IUVA 4PSXB 5I5IA 4Y7RA 2XZGA 1TYEA 4JSXC 2H9NA 3UKRC 4I79A 4J0WA 4O45A 1E8MA 3BG0A 3DWLC 3I7KA 3EI1B 3W15A 1GOFA 3EQ7A 3ZDXA 4CZXA 1U8CA 1B9XA 2H3XA 5FKSA 2TRCB 5TF2A 2PM7B 1UOPA 3I8EA 2Z2PA 4XEIC 5AFU3 4FA1D 3NIDA 3NIFA 1TBGA 4IMMA 3PVUB 3DXKC 1PBYB 3I7NA 4MMYA 4FB1D 4J8GA 2VDPA 3ORVD 4U1EI 4CY5A 3RFGA 1XHMA 5M5SA 3OKYB 5M5RA 3IVMA 4A2LA 2YNNA 4G1EA 1MG2A 2H6KA 3GD1I 2Z2OA 5EALA 2WQ8A 4GM9A 2EIDA 2G9AA 1E5TA 4BCCA 4ZN4A 2IURA 1JJUB 2HKMA 4A09B 4J0XA 1GOGA 3V4PA 3ZE1A 4Z7NA 2UZXB 3JRPA 5EAMA 1JMXB 4ESGA 1K8KC 3U4YA 2HESX 5B4WA 4ZOVA 4G1MA 2IWKA 4YVDA 3QHYB 4WK2A 1H2ZA 1SHYB 2XL3A 3GC3B 4PSWB 4JSVC 5IGOA 2GC7A 4PXWA 2OJYA 1C9IA 1XKSA 3CFVA 5IJ7E 2XYIA 4J73A 4WK4A 1SQJA 2PM9A 5CXBA 2YMUA 3SN6B 2H9MA 3NVXA 2P9KC 4O02A 3NIGA 5EAPA 5IGQA 3UKUC 2VDQA 2MTAH 2HU5A 3O4IA 4QT8A 4GGCA 3IUQA 3RLMD 4E5ZA 4CC9A 3IJCA 4J79A 4UI9R 3BWSA 4PNKB 3KCIA 2I0TA 4X60B 3EWEA 5EMMB 3FGBA 2AGLA 3FM0A 5C92A 5IT9g 1UTCA 4A7JA 4G56B 3EI3A 2P9NC 3UVLA 2UZYB 3I7LA 5CXCB 4O9DA 3MKSB 1O6GA 3KRWB 4J8BA 3KRXB 4J78A 2H68A 4AMYA 3FCUA 3SFZA 1PEVA 2P9SC 3EI2B 4PBYA 5FKRA 5EARA 2J56H 4DNVA 4XYHA 2CE8A 3EI4A 1MDAH 2CO0C 3B7FA 3K71A 4LGNA 4TZ4A 1L0QA 5FFOA 3PSLA 1O6FA 2EIBA 3NVNA 4MMZA 2I3TA 2CN2A 5HE0B 2CE9A 4X3EA 2VC2A 1TYQC 5HE2B 4J77A 2W18A 3DXMC 4J86A 5TEFA 1YR2A 4CI1A 3SVWD 3SBRA 5EM2B 1GG2B 4LG9A 3C9CA 4H5IA 5HDBA 5FA5B 2HJ4A 2I0SA 2XL2A 3AL9A 3SWSD 3UVKA 2IUQA 3CIKB 4QAMA 5H14A 5EMJB 5K1CC 2CNXA 3EMHA 1R5MA 3ZWLB 1N6DA 1B9YA 4PBZA 2J55H 4CI8A 3SXTD 1C9LA 3OKTA 1SQ9A 3EQ9A 3IUJA 3JPXA 2J57G 5TDHB 4J82A 5C2WB 2VDOA 1QFSA 2BCJB 3AH8B 3F3FA 3BG1A 4PC0A 3UVMA
chains in the Genus database with same CATH topology
4FWWA 4ERQA 1NR0A 3JROA 2AGYA 2AGZA 5GXHA 3HFQA 2HXCA 3EI2A 1QNIA 2HJBA 3IIYA 1PGUA 3SMRA 4E54A 3SLED 3GFCA 3ULEC 2YB8B 2IUPA 3IJ1A 5CYKA 1K32A 4K3ID 2OK4A 3EI4B 3PE7A 3N0EA 4ZOZA 3VA6A 2B5NA 3AL8B 3K26A 4ERZA 2H13A 5IJ8E 1GXRA 2H9LA 1VYHC 5I5MA 4FAND 5IC7A 3EU7A 3MMYA 4FA5D 5AJAA 4GQ2P 2YNOA 4OWRA 4OZUA 5FKTA 3IKOA 2B4EA 2PM9B 4J81A 3J80g 4FA4D 4XYIA 4KFMB 5GSAA 3UVOA 5C9ZB 2XU7A 3DSMA 2I0RA 5HYNB 4A0AB 4HDJA 5GXIA 3PSCB 2BBKH 4L9OA 3FRXA 2OVPB 1JMZB 2QXVA 4D0KA 1OLZA 4BL0A 4Y5RD 4EWRA 4JD2C 2AH1A 3AFCA 4D6VA 4GM8A 3EG6A 3EI3B 5K19A 3SBPA 3J81g 4A0AA 4CY3A 3RN0D 3OKYA 4CY1A 2QC5A 4O1QD 3V5WB 2IAAA 3K27A 3PVWB 4QRJA 1OMWB 4L3HD 3RRMC 4H5JA 3JB9L 1XIPA 2AH0A 2P9PC 1MG3A 4BUJC 4ZOXA 2Z2NA 4GQBB 3V7DB 3I8CA 4GQ1A 4A0BA 3F3PA 4L1QD 1P22A 3UVNA 4CY2A 1YFQA 3L4MD 5TEEA 3OKWA 3DM0A 5H17A 5A2Qg 4ZOYA 4N14A 5GMKn 3PXSD 3JZNA 3OW8A 5CXBB 1JOFA 3VH0A 3I7PA 3JZGA 2P9UC 3JAMg 2B5LA 3OL2B 1NEXB 4GM3A 4ES0A 4JXMA 4AEZA 3PXTD 1RI6A 4Z8LA 5THAA 4E5ZB 2Q7QA 2P9LC 4JT6C 4AOWA 3SCYA 3GREA 5AMSA 4QL1A 3VGZA 3A0FA 5KDOB 4A2MA 1A0RB 3N0DA 4FAVD 4E54B 3MXXA 5CYKB 3OL2A 2CN3A 2H6NA 2YBAA 2HYEA 2EBSA 3AL8A 3IJ0A 4A08B 3JZHA 2GC4A 4JSPC 2B5MA 3V9FA 1S4UX 4L3GD 3SJLD 2OK6A 1FWXA 4J84A 3P4FA 3SBQA 4A09A 2I3SA 4JT5C 4A11A 3CFSB 5FKQA 2AGXA 5FXYA 2H47A 3MZLA 4A08A 4NSXA 3I2NA 2PBIB 4JSNC 3NVQA 1U2VC 4BH6A 4J87A 1GP2B 3MKQA 2AGWA 2O9KA 5C2VB 5EM2A 5FQDA 2OIZA 2PM6B 5H1MA 3C5MA 4X61B 3I7OA 4GZ8A 5HE3B 3RMZD 4CI2A 5FLXg 2P9IC 4K3JB 3EI1A 4QQEA 3L4OD 4CZYA 3OTTA 3RSEC 4X63B 2G99A 2H9PA 1U4CA 1N6FA 2H6QA 1GOTB 2GNQA 3IIWA 2HKRA 4ERYA 3E0CA 2AQ5A 3C99A 2OVRB 3C75H 3MZKA 4GMBA 3F3GA 4CZVA 2YNPA 5EMLB 3RN1D 2CO0A 4LG8A 3I7HA 2H14A 3RFHA 4A11B 4U7AA 5HQGA 5CXCA 4FA9D 4A0BB 1N6EA 5HE1B 4CI3A 4FHLA 3ODTA 5JWZA 4GGDA 4O3TB 4IA9A 5EMKB 3PXWD 4R7AB 2IWFA 1Q47A 1ERJA 4O3UB 3SHFA 3I89A 5I5JA 2OVQB 5SXMA 3UR4A 4MK0B 4GGAA 1PI6A 2IUVA 4PSXB 5I5IA 4Y7RA 4JSXC 2H9NA 3UKRC 4I79A 4J0WA 4O45A 3BG0A 3DWLC 3I7KA 3EI1B 3W15A 4CZXA 1B9XA 2H3XA 5FKSA 2TRCB 5TF2A 2PM7B 3I8EA 2Z2PA 4XEIC 5AFU3 4FA1D 1TBGA 4IMMA 3PVUB 3DXKC 1PBYB 3I7NA 4FB1D 4J8GA 4U1EI 3ORVD 4CY5A 3RFGA 1XHMA 3OKYB 4A2LA 2YNNA 1MG2A 2H6KA 2Z2OA 5EALA 4GM9A 2G9AA 4ZN4A 2IURA 1JJUB 2HKMA 4A09B 4J0XA 2UZXB 3JRPA 5EAMA 1JMXB 4ESGA 1K8KC 3U4YA 2HESX 5B4WA 4ZOVA 4YVDA 2IWKA 1SHYB 2XL3A 4PSWB 4JSVC 5IGOA 2GC7A 4PXWA 2OJYA 1XKSA 3CFVA 5IJ7E 2XYIA 4J73A 1SQJA 2PM9A 5CXBA 2YMUA 3SN6B 2H9MA 3NVXA 2P9KC 5EAPA 5IGQA 3UKUC 2MTAH 4QT8A 4GGCA 3RLMD 4E5ZA 4CC9A 3IJCA 4J79A 4UI9R 3BWSA 4PNKB 2I0TA 4X60B 3EWEA 5EMMB 3FGBA 2AGLA 3FM0A 5IT9g 4A7JA 4G56B 3EI3A 2P9NC 3UVLA 2UZYB 3I7LA 5CXCB 4O9DA 3MKSB 3KRWB 4J8BA 3KRXB 4J78A 2H68A 3SFZA 1PEVA 2P9SC 3EI2B 4PBYA 5FKRA 5EARA 2J56H 4XYHA 2CE8A 3EI4A 1MDAH 2CO0C 3B7FA 4LGNA 4TZ4A 1L0QA 3PSLA 3NVNA 2I3TA 2CN2A 5HE0B 2CE9A 4X3EA 1TYQC 5HE2B 4J77A 2W18A 3DXMC 4J86A 5TEFA 4CI1A 3SVWD 3SBRA 5EM2B 1GG2B 4LG9A 3C9CA 4H5IA 5FA5B 2HJ4A 2I0SA 2XL2A 3AL9A 3SWSD 3UVKA 2IUQA 3CIKB 5H14A 5EMJB 5K1CC 2CNXA 3EMHA 1R5MA 3ZWLB 1N6DA 1B9YA 4PBZA 2J55H 4CI8A 3SXTD 3OKTA 1SQ9A 3JPXA 2J57G 5TDHB 4J82A 5C2WB 2BCJB 3AH8B 3F3FA 3BG1A 4PC0A 3UVMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FWW A;  4ERQ A;  1NR0 A;  3JRO A;  2AGY A;  2AGZ A;  5GXH A;  3HFQ A;  2HXC A;  3EI2 A;  1QNI A;  2HJB A;  3IIY A;  1PGU A;  3SMR A;  4E54 A;  3SLE D;  3GFC A;  3ULE C;  2YB8 B;  2IUP A;  3IJ1 A;  5CYK A;  1K32 A;  4K3I D;  2OK4 A;  3EI4 B;  3PE7 A;  3N0E A;  4ZOZ A;  3VA6 A;  2B5N A;  3AL8 B;  3K26 A;  4ERZ A;  2H13 A;  5IJ8 E;  1GXR A;  2H9L A;  1VYH C;  5I5M A;  4FAN D;  5IC7 A;  3EU7 A;  3MMY A;  4FA5 D;  5AJA A;  4GQ2 P;  2YNO A;  4OWR A;  4OZU A;  5FKT A;  3IKO A;  2B4E A;  2PM9 B;  4J81 A;  3J80 g;  4FA4 D;  4XYI A;  4KFM B;  5GSA A;  3UVO A;  5C9Z B;  2XU7 A;  3DSM A;  2I0R A;  5HYN B;  4A0A B;  4HDJ A;  5GXI A;  3PSC B;  2BBK H;  4L9O A;  3FRX A;  2OVP B;  1JMZ B;  2QXV A;  4D0K A;  1OLZ A;  4BL0 A;  4Y5R D;  4EWR A;  4JD2 C;  2AH1 A;  3AFC A;  4D6V A;  4GM8 A;  3EG6 A;  3EI3 B;  5K19 A;  3SBP A;  3J81 g;  4A0A A;  4CY3 A;  3RN0 D;  3OKY A;  4CY1 A;  2QC5 A;  4O1Q D;  3V5W B;  2IAA A;  3K27 A;  3PVW B;  4QRJ A;  1OMW B;  4L3H D;  3RRM C;  4H5J A;  3JB9 L;  1XIP A;  2AH0 A;  2P9P C;  1MG3 A;  4BUJ C;  4ZOX A;  2Z2N A;  4GQB B;  3V7D B;  3I8C A;  4GQ1 A;  4A0B A;  3F3P A;  4L1Q D;  1P22 A;  3UVN A;  4CY2 A;  1YFQ A;  3L4M D;  5TEE A;  3OKW A;  3DM0 A;  5H17 A;  5A2Q g;  4ZOY A;  4N14 A;  5GMK n;  3PXS D;  3JZN A;  3OW8 A;  5CXB B;  1JOF A;  3VH0 A;  3I7P A;  3JZG A;  2P9U C;  3JAM g;  2B5L A;  3OL2 B;  1NEX B;  4GM3 A;  4ES0 A;  4JXM A;  4AEZ A;  3PXT D;  1RI6 A;  4Z8L A;  5THA A;  4E5Z B;  2Q7Q A;  2P9L C;  4JT6 C;  4AOW A;  3SCY A;  3GRE A;  5AMS A;  4QL1 A;  3VGZ A;  3A0F A;  5KDO B;  4A2M A;  1A0R B;  3N0D A;  4FAV D;  4E54 B;  3MXX A;  5CYK B;  3OL2 A;  2CN3 A;  2H6N A;  2YBA A;  2HYE A;  2EBS A;  3AL8 A;  3IJ0 A;  4A08 B;  3JZH A;  2GC4 A;  4JSP C;  2B5M A;  3V9F A;  1S4U X;  4L3G D;  3SJL D;  2OK6 A;  1FWX A;  4J84 A;  3P4F A;  3SBQ A;  4A09 A;  2I3S A;  4JT5 C;  4A11 A;  3CFS B;  5FKQ A;  2AGX A;  5FXY A;  2H47 A;  3MZL A;  4A08 A;  4NSX A;  3I2N A;  2PBI B;  4JSN C;  3NVQ A;  1U2V C;  4BH6 A;  4J87 A;  1GP2 B;  3MKQ A;  2AGW A;  2O9K A;  5C2V B;  5EM2 A;  5FQD A;  2OIZ A;  2PM6 B;  5H1M A;  3C5M A;  4X61 B;  3I7O A;  4GZ8 A;  5HE3 B;  3RMZ D;  4CI2 A;  5FLX g;  2P9I C;  4K3J B;  3EI1 A;  4QQE A;  3L4O D;  4CZY A;  3OTT A;  3RSE C;  4X63 B;  2G99 A;  2H9P A;  1U4C A;  1N6F A;  2H6Q A;  1GOT B;  2GNQ A;  3IIW A;  2HKR A;  4ERY A;  3E0C A;  2AQ5 A;  3C99 A;  2OVR B;  3C75 H;  3MZK A;  4GMB A;  3F3G A;  4CZV A;  2YNP A;  5EML B;  3RN1 D;  2CO0 A;  4LG8 A;  3I7H A;  2H14 A;  3RFH A;  4A11 B;  4U7A A;  5HQG A;  5CXC A;  4FA9 D;  4A0B B;  1N6E A;  5HE1 B;  4CI3 A;  4FHL A;  3ODT A;  5JWZ A;  4GGD A;  4O3T B;  4IA9 A;  5EMK B;  3PXW D;  4R7A B;  2IWF A;  1Q47 A;  1ERJ A;  4O3U B;  3SHF A;  3I89 A;  5I5J A;  2OVQ B;  5SXM A;  3UR4 A;  4MK0 B;  4GGA A;  1PI6 A;  2IUV A;  4PSX B;  5I5I A;  4Y7R A;  4JSX C;  2H9N A;  3UKR C;  4I79 A;  4J0W A;  4O45 A;  3BG0 A;  3DWL C;  3I7K A;  3EI1 B;  3W15 A;  4CZX A;  1B9X A;  2H3X A;  5FKS A;  2TRC B;  5TF2 A;  2PM7 B;  3I8E A;  2Z2P A;  4XEI C;  5AFU 3;  4FA1 D;  1TBG A;  4IMM A;  3PVU B;  3DXK C;  1PBY B;  3I7N A;  4FB1 D;  4J8G A;  4U1E I;  3ORV D;  4CY5 A;  3RFG A;  1XHM A;  3OKY B;  4A2L A;  2YNN A;  1MG2 A;  2H6K A;  2Z2O A;  5EAL A;  4GM9 A;  2G9A A;  4ZN4 A;  2IUR A;  1JJU B;  2HKM A;  4A09 B;  4J0X A;  2UZX B;  3JRP A;  5EAM A;  1JMX B;  4ESG A;  1K8K C;  3U4Y A;  2HES X;  5B4W A;  4ZOV A;  4YVD A;  2IWK A;  1SHY B;  2XL3 A;  4PSW B;  4JSV C;  5IGO A;  2GC7 A;  4PXW A;  2OJY A;  1XKS A;  3CFV A;  5IJ7 E;  2XYI A;  4J73 A;  1SQJ A;  2PM9 A;  5CXB A;  2YMU A;  3SN6 B;  2H9M A;  3NVX A;  2P9K C;  5EAP A;  5IGQ A;  3UKU C;  2MTA H;  4QT8 A;  4GGC A;  3RLM D;  4E5Z A;  4CC9 A;  3IJC A;  4J79 A;  4UI9 R;  3BWS A;  4PNK B;  2I0T A;  4X60 B;  3EWE A;  5EMM B;  3FGB A;  2AGL A;  3FM0 A;  5IT9 g;  4A7J A;  4G56 B;  3EI3 A;  2P9N C;  3UVL A;  2UZY B;  3I7L A;  5CXC B;  4O9D A;  3MKS B;  3KRW B;  4J8B A;  3KRX B;  4J78 A;  2H68 A;  3SFZ A;  1PEV A;  2P9S C;  3EI2 B;  4PBY A;  5FKR A;  5EAR A;  2J56 H;  4XYH A;  2CE8 A;  3EI4 A;  1MDA H;  2CO0 C;  3B7F A;  4LGN A;  4TZ4 A;  1L0Q A;  3PSL A;  3NVN A;  2I3T A;  2CN2 A;  5HE0 B;  2CE9 A;  4X3E A;  1TYQ C;  5HE2 B;  4J77 A;  2W18 A;  3DXM C;  4J86 A;  5TEF A;  4CI1 A;  3SVW D;  3SBR A;  5EM2 B;  1GG2 B;  4LG9 A;  3C9C A;  4H5I A;  5FA5 B;  2HJ4 A;  2I0S A;  2XL2 A;  3AL9 A;  3SWS D;  3UVK A;  2IUQ A;  3CIK B;  5H14 A;  5EMJ B;  5K1C C;  2CNX A;  3EMH A;  1R5M A;  3ZWL B;  1N6D A;  1B9Y A;  4PBZ A;  2J55 H;  4CI8 A;  3SXT D;  3OKT A;  1SQ9 A;  3JPX A;  2J57 G;  5TDH B;  4J82 A;  5C2W B;  2BCJ B;  3AH8 B;  3F3F A;  3BG1 A;  4PC0 A;  3UVM A; 
#chains in the Genus database with same CATH topology
 1JTD B;  4FWW A;  4ERQ A;  1NR0 A;  4BCD A;  3JRO A;  2AGY A;  2AGZ A;  5GXH A;  2VZ3 A;  2BKL A;  2HXC A;  3HFQ A;  3O4H A;  3ZE2 A;  3EI2 A;  1QNI A;  2HJB A;  3IIY A;  1PGU A;  3SMR A;  4E54 A;  2QZP A;  3SLE D;  3GFC A;  3ULE C;  2YB8 B;  2IUP A;  3IJ1 A;  5CYK A;  1K32 A;  4K3I D;  2OK4 A;  3EI4 B;  3PE7 A;  3N0E A;  4ZOZ A;  3VA6 A;  1H2X A;  2B5N A;  3AL8 B;  3K26 A;  4ERZ A;  2H13 A;  2HU7 A;  1GXR A;  1VE7 A;  2H9L A;  2JKX A;  1VYH C;  5IJ8 E;  3VI4 A;  3IUL A;  5I5M A;  4JHN A;  4FAN D;  2VDK A;  5IC7 A;  4NBM A;  4BP8 A;  3EU7 A;  3MMY A;  4FA5 D;  5AJA A;  4GQ2 P;  2YNO A;  1T2X A;  4OWR A;  3O4J A;  3FCS A;  3V4V A;  4OZU A;  3OF7 A;  5FKT A;  3IKO A;  2B4E A;  2PM9 B;  4J81 A;  4BP9 A;  3J80 g;  4FA4 D;  4UM8 A;  4XYI A;  4KFM B;  5GSA A;  3UVO A;  5C9Z B;  2XU7 A;  4DNW A;  3DSM A;  2I0R A;  5HYN B;  4A0A B;  4HDJ A;  5GXI A;  4MMX A;  1M1X A;  3PSC B;  2BBK H;  1VZ2 A;  4L9O A;  3FRX A;  2VDL A;  2OVP B;  1JMZ B;  2QXV A;  4D0K A;  3IUM A;  1OLZ A;  2XDW A;  4NEN A;  4BL0 A;  4Y5R D;  4EWR A;  4JD2 C;  2AH1 A;  5C86 A;  3AFC A;  4DNU A;  4D6V A;  1VE6 A;  4GM8 A;  4O2W A;  3EG6 A;  3EI3 B;  5K19 A;  3SBP A;  3J81 g;  3MUN A;  4A0A A;  3ZDZ A;  4CY3 A;  3RN0 D;  1UOQ A;  3K72 A;  3OKY A;  4CY1 A;  2QC5 A;  1A12 A;  4O1Q D;  3V5W B;  2IAA A;  4WK0 A;  3K27 A;  3PVW B;  4QRJ A;  1OMW B;  4L3H D;  3RRM C;  2EIE A;  4H5J A;  3JB9 L;  1XIP A;  1GOH A;  1QFM A;  2AH0 A;  1I2M B;  2P9P C;  4IRZ A;  1MG3 A;  4BUJ C;  4ZOX A;  2Z2N A;  4GQB B;  5FFG A;  3V7D B;  3I8C A;  4GQ1 A;  4A0B A;  3F3P A;  4L1Q D;  2XE4 A;  1P22 A;  3UVN A;  4CY2 A;  1YFQ A;  3L4M D;  3O4G A;  5TEE A;  3OKW A;  3VI3 A;  3DM0 A;  5H17 A;  3T3M A;  5A2Q g;  4ZOY A;  4G55 A;  1E8N A;  4N14 A;  5GMK n;  3PXS D;  3JZN A;  3OW8 A;  5CXB B;  1JOF A;  3VH0 A;  1K3I A;  3I7P A;  3JZG A;  2P9U C;  5M5T A;  3JAM g;  2B5L A;  3OL2 B;  1NEX B;  4GM3 A;  4ES0 A;  4JXM A;  4AEZ A;  3PXT D;  1RI6 A;  4Z8L A;  5THA A;  4E5Z B;  2Q7Q A;  1JV2 A;  4NC4 A;  4JHP C;  4NAA A;  2P9L C;  4JT6 C;  3DDU A;  3SCY A;  4AOW A;  3GRE A;  5AMS A;  4QL1 A;  3VGZ A;  3A0F A;  3MUO A;  5KDO B;  4A2M A;  1A0R B;  3N0D A;  4FAV D;  4E54 B;  3MXX A;  1UOO A;  2VZ1 A;  5CYK B;  3OL2 A;  5E6U A;  2CN3 A;  2H6N A;  2YBA A;  1L5G A;  2HYE A;  2EBS A;  4RE6 A;  3MVD K;  3AL8 A;  3IJ0 A;  4A08 B;  3JZH A;  4AX4 A;  2GC4 A;  4JSP C;  2B5M A;  3V9F A;  1S4U X;  4L3G D;  3SJL D;  2OK6 A;  1FWX A;  4J84 A;  4Z7O A;  3P4F A;  3SBQ A;  4A09 A;  2I3S A;  4JT5 C;  4Z7Q A;  4A11 A;  3CFS B;  5FKQ A;  2AGX A;  5FXY A;  3ZDY A;  2H47 A;  3MZL A;  4A08 A;  4L1M A;  4NSX A;  3I2N A;  2PBI B;  4JSN C;  3T3P A;  3NVQ A;  1U2V C;  4AN1 A;  4BH6 A;  4J87 A;  1GP2 B;  3MKQ A;  1BPO A;  2VDR A;  2AGW A;  3ZE0 A;  5E6R A;  2O9K A;  5C2V B;  5EM2 A;  5FQD A;  2OIZ A;  2PM6 B;  4UM9 A;  5M5V A;  5H1M A;  5E6S A;  3C5M A;  4X61 B;  5M61 A;  3I7O A;  4GZ8 A;  4BCB A;  5HE3 B;  3RMZ D;  4CI2 A;  5FLX g;  2P9I C;  4K3J B;  3EI1 A;  4QQE A;  3L4O D;  4CZY A;  3OTT A;  4AN0 A;  3RSE C;  4X63 B;  2G99 A;  2H9P A;  1U4C A;  3IUN A;  1N6F A;  2H6Q A;  1GOT B;  4RE5 A;  2GNQ A;  3IIW A;  2HKR A;  4AMZ A;  4ERY A;  2QR5 A;  3E0C A;  4D9S A;  2AQ5 A;  3C99 A;  2OVR B;  3C75 H;  3MZK A;  4GMB A;  3F3G A;  2HU8 A;  4CZV A;  2YNP A;  1H2W A;  5EML B;  3RN1 D;  2CO0 A;  3IUR A;  4LG8 A;  3I7H A;  2H14 A;  2VDM A;  3IJE A;  3RFH A;  4A11 B;  1VZ3 A;  4U7A A;  5HQG A;  5CXC A;  4FA9 D;  4A0B B;  2EIC A;  1H2Y A;  1N6E A;  5HE1 B;  4CI3 A;  3K6S A;  4FHL A;  3ODT A;  5M5U A;  5JWZ A;  3QI0 A;  4GGD A;  4O3T B;  4IA9 A;  3EQ8 A;  3PXW D;  5EMK B;  4R7A B;  2IWF A;  1Q47 A;  1ERJ A;  4O3U B;  3SHF A;  3I89 A;  5I5J A;  2OVQ B;  4WJK A;  5SXM A;  3UR4 A;  2VDN A;  4MK0 B;  4GGA A;  1PI6 A;  2IUV A;  4PSX B;  5I5I A;  4Y7R A;  2XZG A;  1TYE A;  4JSX C;  2H9N A;  3UKR C;  4I79 A;  4J0W A;  4O45 A;  1E8M A;  3BG0 A;  3DWL C;  3I7K A;  3EI1 B;  3W15 A;  1GOF A;  3EQ7 A;  3ZDX A;  4CZX A;  1U8C A;  1B9X A;  2H3X A;  5FKS A;  2TRC B;  5TF2 A;  2PM7 B;  1UOP A;  3I8E A;  2Z2P A;  4XEI C;  5AFU 3;  4FA1 D;  3NID A;  3NIF A;  1TBG A;  4IMM A;  3PVU B;  3DXK C;  1PBY B;  3I7N A;  4MMY A;  4FB1 D;  4J8G A;  2VDP A;  3ORV D;  4U1E I;  4CY5 A;  3RFG A;  1XHM A;  5M5S A;  3OKY B;  5M5R A;  3IVM A;  4A2L A;  2YNN A;  4G1E A;  1MG2 A;  2H6K A;  3GD1 I;  2Z2O A;  5EAL A;  2WQ8 A;  4GM9 A;  2EID A;  2G9A A;  1E5T A;  4BCC A;  4ZN4 A;  2IUR A;  1JJU B;  2HKM A;  4A09 B;  4J0X A;  1GOG A;  3V4P A;  3ZE1 A;  4Z7N A;  2UZX B;  3JRP A;  5EAM A;  1JMX B;  4ESG A;  1K8K C;  3U4Y A;  2HES X;  5B4W A;  4ZOV A;  4G1M A;  2IWK A;  4YVD A;  3QHY B;  4WK2 A;  1H2Z A;  1SHY B;  2XL3 A;  3GC3 B;  4PSW B;  4JSV C;  5IGO A;  2GC7 A;  4PXW A;  2OJY A;  1C9I A;  1XKS A;  3CFV A;  5IJ7 E;  2XYI A;  4J73 A;  4WK4 A;  1SQJ A;  2PM9 A;  5CXB A;  2YMU A;  3SN6 B;  2H9M A;  3NVX A;  2P9K C;  4O02 A;  3NIG A;  5EAP A;  5IGQ A;  3UKU C;  2VDQ A;  2MTA H;  2HU5 A;  3O4I A;  4QT8 A;  4GGC A;  3IUQ A;  3RLM D;  4E5Z A;  4CC9 A;  3IJC A;  4J79 A;  4UI9 R;  3BWS A;  4PNK B;  3KCI A;  2I0T A;  4X60 B;  3EWE A;  5EMM B;  3FGB A;  2AGL A;  3FM0 A;  5C92 A;  5IT9 g;  1UTC A;  4A7J A;  4G56 B;  3EI3 A;  2P9N C;  3UVL A;  2UZY B;  3I7L A;  5CXC B;  4O9D A;  3MKS B;  1O6G A;  3KRW B;  4J8B A;  3KRX B;  4J78 A;  2H68 A;  4AMY A;  3FCU A;  3SFZ A;  1PEV A;  2P9S C;  3EI2 B;  4PBY A;  5FKR A;  5EAR A;  2J56 H;  4DNV A;  4XYH A;  2CE8 A;  3EI4 A;  1MDA H;  2CO0 C;  3B7F A;  3K71 A;  4LGN A;  4TZ4 A;  1L0Q A;  5FFO A;  3PSL A;  1O6F A;  2EIB A;  3NVN A;  4MMZ A;  2I3T A;  2CN2 A;  5HE0 B;  2CE9 A;  4X3E A;  2VC2 A;  1TYQ C;  5HE2 B;  4J77 A;  2W18 A;  3DXM C;  4J86 A;  5TEF A;  1YR2 A;  4CI1 A;  3SVW D;  3SBR A;  5EM2 B;  1GG2 B;  4LG9 A;  3C9C A;  4H5I A;  5HDB A;  5FA5 B;  2HJ4 A;  2I0S A;  2XL2 A;  3AL9 A;  3SWS D;  3UVK A;  2IUQ A;  3CIK B;  4QAM A;  5H14 A;  5EMJ B;  5K1C C;  2CNX A;  3EMH A;  1R5M A;  3ZWL B;  1N6D A;  1B9Y A;  4PBZ A;  2J55 H;  4CI8 A;  3SXT D;  1C9L A;  3OKT A;  1SQ9 A;  3EQ9 A;  3IUJ A;  3JPX A;  2J57 G;  5TDH B;  4J82 A;  5C2W B;  2VDO A;  1QFS A;  2BCJ B;  3AH8 B;  3F3F A;  3BG1 A;  4PC0 A;  3UVM A; 
#chains in the Genus database with same CATH homology
 4FWW A;  4ERQ A;  1NR0 A;  3JRO A;  2AGY A;  2AGZ A;  5GXH A;  3HFQ A;  2HXC A;  3EI2 A;  1QNI A;  2HJB A;  3IIY A;  1PGU A;  3SMR A;  4E54 A;  3SLE D;  3GFC A;  3ULE C;  2YB8 B;  2IUP A;  3IJ1 A;  5CYK A;  1K32 A;  4K3I D;  2OK4 A;  3EI4 B;  3PE7 A;  3N0E A;  4ZOZ A;  3VA6 A;  2B5N A;  3AL8 B;  3K26 A;  4ERZ A;  2H13 A;  5IJ8 E;  1GXR A;  2H9L A;  1VYH C;  5I5M A;  4FAN D;  5IC7 A;  3EU7 A;  3MMY A;  4FA5 D;  5AJA A;  4GQ2 P;  2YNO A;  4OWR A;  4OZU A;  5FKT A;  3IKO A;  2B4E A;  2PM9 B;  4J81 A;  3J80 g;  4FA4 D;  4XYI A;  4KFM B;  5GSA A;  3UVO A;  5C9Z B;  2XU7 A;  3DSM A;  2I0R A;  5HYN B;  4A0A B;  4HDJ A;  5GXI A;  3PSC B;  2BBK H;  4L9O A;  3FRX A;  2OVP B;  1JMZ B;  2QXV A;  4D0K A;  1OLZ A;  4BL0 A;  4Y5R D;  4EWR A;  4JD2 C;  2AH1 A;  3AFC A;  4D6V A;  4GM8 A;  3EG6 A;  3EI3 B;  5K19 A;  3SBP A;  3J81 g;  4A0A A;  4CY3 A;  3RN0 D;  3OKY A;  4CY1 A;  2QC5 A;  4O1Q D;  3V5W B;  2IAA A;  3K27 A;  3PVW B;  4QRJ A;  1OMW B;  4L3H D;  3RRM C;  4H5J A;  3JB9 L;  1XIP A;  2AH0 A;  2P9P C;  1MG3 A;  4BUJ C;  4ZOX A;  2Z2N A;  4GQB B;  3V7D B;  3I8C A;  4GQ1 A;  4A0B A;  3F3P A;  4L1Q D;  1P22 A;  3UVN A;  4CY2 A;  1YFQ A;  3L4M D;  5TEE A;  3OKW A;  3DM0 A;  5H17 A;  5A2Q g;  4ZOY A;  4N14 A;  5GMK n;  3PXS D;  3JZN A;  3OW8 A;  5CXB B;  1JOF A;  3VH0 A;  3I7P A;  3JZG A;  2P9U C;  3JAM g;  2B5L A;  3OL2 B;  1NEX B;  4GM3 A;  4ES0 A;  4JXM A;  4AEZ A;  3PXT D;  1RI6 A;  4Z8L A;  5THA A;  4E5Z B;  2Q7Q A;  2P9L C;  4JT6 C;  4AOW A;  3SCY A;  3GRE A;  5AMS A;  4QL1 A;  3VGZ A;  3A0F A;  5KDO B;  4A2M A;  1A0R B;  3N0D A;  4FAV D;  4E54 B;  3MXX A;  5CYK B;  3OL2 A;  2CN3 A;  2H6N A;  2YBA A;  2HYE A;  2EBS A;  3AL8 A;  3IJ0 A;  4A08 B;  3JZH A;  2GC4 A;  4JSP C;  2B5M A;  3V9F A;  1S4U X;  4L3G D;  3SJL D;  2OK6 A;  1FWX A;  4J84 A;  3P4F A;  3SBQ A;  4A09 A;  2I3S A;  4JT5 C;  4A11 A;  3CFS B;  5FKQ A;  2AGX A;  5FXY A;  2H47 A;  3MZL A;  4A08 A;  4NSX A;  3I2N A;  2PBI B;  4JSN C;  3NVQ A;  1U2V C;  4BH6 A;  4J87 A;  1GP2 B;  3MKQ A;  2AGW A;  2O9K A;  5C2V B;  5EM2 A;  5FQD A;  2OIZ A;  2PM6 B;  5H1M A;  3C5M A;  4X61 B;  3I7O A;  4GZ8 A;  5HE3 B;  3RMZ D;  4CI2 A;  5FLX g;  2P9I C;  4K3J B;  3EI1 A;  4QQE A;  3L4O D;  4CZY A;  3OTT A;  3RSE C;  4X63 B;  2G99 A;  2H9P A;  1U4C A;  1N6F A;  2H6Q A;  1GOT B;  2GNQ A;  3IIW A;  2HKR A;  4ERY A;  3E0C A;  2AQ5 A;  3C99 A;  2OVR B;  3C75 H;  3MZK A;  4GMB A;  3F3G A;  4CZV A;  2YNP A;  5EML B;  3RN1 D;  2CO0 A;  4LG8 A;  3I7H A;  2H14 A;  3RFH A;  4A11 B;  4U7A A;  5HQG A;  5CXC A;  4FA9 D;  4A0B B;  1N6E A;  5HE1 B;  4CI3 A;  4FHL A;  3ODT A;  5JWZ A;  4GGD A;  4O3T B;  4IA9 A;  5EMK B;  3PXW D;  4R7A B;  2IWF A;  1Q47 A;  1ERJ A;  4O3U B;  3SHF A;  3I89 A;  5I5J A;  2OVQ B;  5SXM A;  3UR4 A;  4MK0 B;  4GGA A;  1PI6 A;  2IUV A;  4PSX B;  5I5I A;  4Y7R A;  4JSX C;  2H9N A;  3UKR C;  4I79 A;  4J0W A;  4O45 A;  3BG0 A;  3DWL C;  3I7K A;  3EI1 B;  3W15 A;  4CZX A;  1B9X A;  2H3X A;  5FKS A;  2TRC B;  5TF2 A;  2PM7 B;  3I8E A;  2Z2P A;  4XEI C;  5AFU 3;  4FA1 D;  1TBG A;  4IMM A;  3PVU B;  3DXK C;  1PBY B;  3I7N A;  4FB1 D;  4J8G A;  4U1E I;  3ORV D;  4CY5 A;  3RFG A;  1XHM A;  3OKY B;  4A2L A;  2YNN A;  1MG2 A;  2H6K A;  2Z2O A;  5EAL A;  4GM9 A;  2G9A A;  4ZN4 A;  2IUR A;  1JJU B;  2HKM A;  4A09 B;  4J0X A;  2UZX B;  3JRP A;  5EAM A;  1JMX B;  4ESG A;  1K8K C;  3U4Y A;  2HES X;  5B4W A;  4ZOV A;  4YVD A;  2IWK A;  1SHY B;  2XL3 A;  4PSW B;  4JSV C;  5IGO A;  2GC7 A;  4PXW A;  2OJY A;  1XKS A;  3CFV A;  5IJ7 E;  2XYI A;  4J73 A;  1SQJ A;  2PM9 A;  5CXB A;  2YMU A;  3SN6 B;  2H9M A;  3NVX A;  2P9K C;  5EAP A;  5IGQ A;  3UKU C;  2MTA H;  4QT8 A;  4GGC A;  3RLM D;  4E5Z A;  4CC9 A;  3IJC A;  4J79 A;  4UI9 R;  3BWS A;  4PNK B;  2I0T A;  4X60 B;  3EWE A;  5EMM B;  3FGB A;  2AGL A;  3FM0 A;  5IT9 g;  4A7J A;  4G56 B;  3EI3 A;  2P9N C;  3UVL A;  2UZY B;  3I7L A;  5CXC B;  4O9D A;  3MKS B;  3KRW B;  4J8B A;  3KRX B;  4J78 A;  2H68 A;  3SFZ A;  1PEV A;  2P9S C;  3EI2 B;  4PBY A;  5FKR A;  5EAR A;  2J56 H;  4XYH A;  2CE8 A;  3EI4 A;  1MDA H;  2CO0 C;  3B7F A;  4LGN A;  4TZ4 A;  1L0Q A;  3PSL A;  3NVN A;  2I3T A;  2CN2 A;  5HE0 B;  2CE9 A;  4X3E A;  1TYQ C;  5HE2 B;  4J77 A;  2W18 A;  3DXM C;  4J86 A;  5TEF A;  4CI1 A;  3SVW D;  3SBR A;  5EM2 B;  1GG2 B;  4LG9 A;  3C9C A;  4H5I A;  5FA5 B;  2HJ4 A;  2I0S A;  2XL2 A;  3AL9 A;  3SWS D;  3UVK A;  2IUQ A;  3CIK B;  5H14 A;  5EMJ B;  5K1C C;  2CNX A;  3EMH A;  1R5M A;  3ZWL B;  1N6D A;  1B9Y A;  4PBZ A;  2J55 H;  4CI8 A;  3SXT D;  3OKT A;  1SQ9 A;  3JPX A;  2J57 G;  5TDH B;  4J82 A;  5C2W B;  2BCJ B;  3AH8 B;  3F3F A;  3BG1 A;  4PC0 A;  3UVM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...