3GFCA

Crystal structure of histone-binding protein rbbp4
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
387
structure length
339
Chain Sequence
b'WKKNTPFLYDLVMTHALEWPSLTAQWLPDVTDFSIHRLVLGTHTQNHLVIASVQLPNKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDCNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Histone-binding protein RBBP4
publication title Structure and function of WD40 domain proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 80
structure length 339
sequence length 387
ec nomenclature
pdb deposition date 2009-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
A PF12265 CAF1C_H4-bd Histone-binding protein RBBP4 or subunit C of CAF1 complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3gfcA00
2H6NA 4AEZA 3MMYA 5C2WB 3EG6A 3SJLD 2OVQB 4CZXA 4JSNC 3SLED 2P9KC 2OJYA 3CFVA 3L4MD 4A7JA 4ZOYA 4CY5A 4CI3A 1N6DA 1JOFA 1K32A 4GQ1A 3NVXA 1U4CA 4PSWB 3MXXA 5EAPA 4OWRA 3SXTD 3KRWB 4ERQA 4IMMA 4L3HD 4BUJC 3GFCA 1U2VC 3UR4A 3SCYA 2CN3A 2XU7A 2J56H 5EM2B 4R7AB 3B7FA 2AGZA 2UZYB 4PBZA 3VH0A 2O9KA 4J77A 4X3EA 3BG0A 5EM2A 4GQ2P 2HJ4A 2YNNA 4JSVC 5FKSA 3CIKB 5CXCB 4A2LA 4IA9A 4XEIC 3VA6A 4JT5C 2IWKA 2I3TA 4GGDA 4L3GD 3PXWD 5AFU3 5EMMB 4O3TB 1TYQC 4FHLA 2I3SA 5A2Qg 5AJAA 5THAA 4A0BB 3ODTA 1NR0A 5H17A 2H6QA 4D0KA 1SQJA 3EWEA 1Q47A 4A0BA 2B5NA 5HE2B 2AGLA 4CZVA 2IURA 4E54B 4MK0B 3RSEC 4ZN4A 5HYNB 2H68A 4XYIA 2H47A 4E54A 3FM0A 4AOWA 3I7PA 2H9MA 3IJ1A 3AL9A 2B4EA 5H1MA 3JZGA 5EMLB 1PEVA 4ZOZA 2PM6B 4JD2C 2OK4A 2AH1A 4LG9A 3JZNA 4ESGA 2GC4A 2HKMA 3I7HA 3OKYA 5K1CC 1A0RB 1JMZB 1PI6A 1RI6A 2H14A 3C99A 5TEEA 3JZHA 3JB9L 4A09B 2YB8B 2P9LC 4X60B 2XL3A 2Z2PA 3UVOA 3ULEC 4J84A 5JWZA 3IIWA 3VGZA 3DSMA 1L0QA 5HE0B 5TF2A 2MTAH 3OL2A 4JT6C 3RMZD 4H5JA 2P9UC 4I79A 3DWLC 2HYEA 2OVRB 3JRPA 3I7KA 3I7OA 3MZKA 4JXMA 4GM9A 3KRXB 4KFMB 1JMXB 3FRXA 3ZWLB 3PXTD 3MKQA 1SHYB 2GNQA 2QXVA 4FA5D 2IUPA 2YNPA 3BG1A 3C75H 2HJBA 5EALA 4J81A 5H14A 4BH6A 5IGQA 5HE1B 3JAMg 4CY3A 5I5IA 4A08B 3SBQA 4GM3A 4GGCA 3NVQA 1XHMA 4ZOVA 1NEXB 2IUVA 1ERJA 3RLMD 3L4OD 2I0SA 3V9FA 2PM9B 2B5LA 4A2MA 3RN1D 1XKSA 3JPXA 2H9PA 4E5ZB 5CXCA 4JSXC 3N0EA 4QT8A 3K26A 2H6KA 4NSXA 2H3XA 3A0FA 2XYIA 3UKRC 4X61B 1YFQA 4CI8A 3SFZA 3V7DB 3SMRA 5FKTA 4U1EI 3DXKC 4CY2A 4X63B 4D6VA 4ERYA 3I7LA 2I0RA 3AFCA 3W15A 2AH0A 2YNOA 5EAMA 5EMKB 4ZOXA 3IJCA 2CN2A 1SQ9A 3DM0A 2AGYA 5TDHB 4JSPC 3RFGA 1GG2B 3PVWB 4L1QD 4PNKB 4CZYA 4J87A 3EI2B 3IIYA 2HKRA 4CI1A 5I5MA 4EWRA 4TZ4A 2PBIB 5EARA 3J81g 3RFHA 5SXMA 5CXBB 2CO0A 2UZXB 4PXWA 4GZ8A 5FKRA 5CXBA 4FWWA 1K8KC 3FGBA 3N0DA 2HESX 2Q7QA 4A09A 4L9OA 5TEFA 4PC0A 4LG8A 3J80g 2OVPB 2W18A 1B9XA 1GP2B 2EBSA 2YBAA 4CC9A 5KDOB 2Z2OA 4GQBB 3SBRA 4OZUA 4CY1A 2PM7B 3PXSD 2B5MA 2CE8A 3F3GA 2G9AA 4K3JB 3SHFA 4A11B 2P9PC 3I8CA 3AH8B 3MZLA 4BL0A 4FA9D 3F3FA 1N6FA 4J0XA 4A11A 3EU7A 4A0AB 1XIPA 2YMUA 1GOTB 3RRMC 3OW8A 4J82A 4A0AA 1PBYB 5AMSA 4PSXB 4FAVD 4O1QD 4GM8A 3I7NA 3SVWD 2AQ5A 3OKWA 4N14A 2BCJB 1PGUA 4J79A 4H5IA 5IGOA 4J8GA 3SN6B 5FLXg 2XL2A 2H13A 3SWSD 1MG3A 5HQGA 3EI1B 3OKTA 2CNXA 2HXCA 5B4WA 4K3ID 3PSCB 3K27A 3MKSB 5HE3B 4FB1D 4O3UB 5IT9g 4XYHA 4J73A 5GXIA 3EI1A 4A08A 3UVNA 5I5JA 4GMBA 3IKOA 3HFQA 2TRCB 5GSAA 2CE9A 4HDJA 5FKQA 4O9DA 3AL8B 2PM9A 3PSLA 5EMJB 4E5ZA 1MDAH 3UVLA 3AL8A 3ORVD 5FXYA 4QQEA 2IAAA 4J8BA 3SBPA 3UKUC 2I0TA 1GXRA 1MG2A 1N6EA 4UI9R 3PE7A 4ERZA 5CYKB 2GC7A 2AGWA 3DXMC 5GXHA 3OTTA 2OIZA 2P9NC 2CO0C 5CYKA 3E0CA 1P22A 3C5MA 5FA5B 3GREA 3F3PA 4Y7RA 5C2VB 3NVNA 2IWFA 3JROA 5K19A 1TBGA 2P9SC 2J55H 3RN0D 5IJ7E 2OK6A 5FQDA 1QNIA 4GGAA 3EI2A 4Y5RD 2J57G 3PVUB 4FA4D 3EMHA 4Z8LA 2H9LA 4CI2A 2IUQA 2QC5A 2BBKH 4O45A 4G56B 4U7AA 5IJ8E 2P9IC 4QRJA 4J86A 3OKYB 4QL1A 4LGNA 5IC7A 3I8EA 4J0WA 3EI3B 1B9YA 1FWXA 1OLZA 5GMKn 2AGXA 3IJ0A 1JJUB 2H9NA 5C9ZB 3EI3A 3I2NA 4ES0A 4FAND 1VYHC 3BWSA 3I89A 4PBYA 3CFSB 3EI4B 3V5WB 3C9CA 4YVDA 4FA1D 2Z2NA 3P4FA 3U4YA 1OMWB 1S4UX 3EI4A 3OL2B 2G99A 1R5MA 3UVMA 3UVKA 4J78A
chains in the Genus database with same CATH superfamily
2H6NA 1VE6A 4AEZA 3MMYA 5C2WB 3EG6A 3SJLD 2OVQB 4CZXA 4JSNC 3SLED 4G1EA 2P9KC 2OJYA 3CFVA 2QZPA 3L4MD 4A7JA 4ZOYA 4CY5A 4CI3A 4Z7QA 1N6DA 1JOFA 1K32A 4GQ1A 3NVXA 1U4CA 4PSWB 3IUQA 3MXXA 5EAPA 4OWRA 3SXTD 1H2WA 3IULA 3KRWB 4ERQA 5M5TA 4IMMA 4L3HD 4NBMA 4BUJC 3GFCA 1U2VC 3UR4A 1I2MB 3SCYA 1UOQA 3T3PA 2CN3A 2XU7A 4QAMA 2J56H 3ZE2A 5EM2B 5FFOA 4R7AB 3B7FA 2AGZA 2UZYB 4PBZA 3VH0A 2O9KA 4J77A 4X3EA 3BG0A 1E5TA 5EM2A 4GQ2P 2HJ4A 2YNNA 4JSVC 5FKSA 3CIKB 4AN1A 2WQ8A 4WK0A 5CXCB 4A2LA 4IA9A 4XEIC 3VA6A 4JT5C 2IWKA 2I3TA 4GGDA 4L3GD 1UOPA 3PXWD 5AFU3 5EMMB 3FCSA 4O3TB 1TYQC 4FHLA 2I3SA 5A2Qg 5C86A 5AJAA 5THAA 4A0BB 3ODTA 1NR0A 5H17A 2H6QA 4D0KA 1SQJA 3EWEA 1Q47A 4A0BA 2B5NA 5HE2B 2AGLA 4CZVA 2IURA 4E54B 4MK0B 2VDLA 1JTDB 3RSEC 4ZN4A 5HYNB 2H68A 4XYIA 2H47A 4E54A 1O6FA 3FM0A 4AOWA 1H2YA 3I7PA 1UOOA 2H9MA 3IJ1A 3AL9A 2B4EA 5H1MA 3JZGA 5EMLB 1PEVA 4ZOZA 2PM6B 4JD2C 2OK4A 3O4JA 2AH1A 4RE6A 1UTCA 4LG9A 2VDMA 3JZNA 2EIBA 5M5RA 4ESGA 2GC4A 2HKMA 3I7HA 4Z7OA 3OKYA 5K1CC 3MUNA 4DNVA 1A0RB 1JMZB 1PI6A 5HDBA 2XZGA 1RI6A 2H14A 3C99A 5TEEA 3JZHA 3JB9L 4A09B 2YB8B 2P9LC 4X60B 2XL3A 2Z2PA 3UVOA 3ULEC 2VC2A 2VDQA 4J84A 5JWZA 2EIDA 3IIWA 3FCUA 4BP9A 3VGZA 3DSMA 1L0QA 5HE0B 5TF2A 2MTAH 3OL2A 4JT6C 3RMZD 4H5JA 2VDRA 2P9UC 3O4GA 3MUOA 4I79A 3DWLC 2HYEA 2OVRB 3VI3A 4JHNA 3JRPA 3I7KA 3I7OA 3MZKA 4JXMA 2VDPA 4GM9A 2VZ1A 3KRXB 3ZDXA 4KFMB 1JMXB 3FRXA 3GD1I 3ZWLB 3PXTD 3MKQA 4NC4A 1SHYB 1TYEA 2GNQA 2QXVA 4FA5D 2IUPA 2YNPA 3BG1A 3C75H 2HJBA 5EALA 4J81A 5H14A 4BH6A 5IGQA 5HE1B 3QI0A 5E6SA 3JAMg 4CY3A 4Z7NA 5I5IA 4A08B 3SBQA 4GM3A 4GGCA 3NVQA 1XHMA 4ZOVA 1GOGA 1NEXB 2IUVA 1ERJA 4AMYA 3RLMD 2VZ3A 3L4OD 2I0SA 3V9FA 2PM9B 4DNWA 2B5LA 4A2MA 3RN1D 1XKSA 3JPXA 2H9PA 4E5ZB 5CXCA 3IUNA 3K71A 4JSXC 3N0EA 4QT8A 3GC3B 3K26A 1H2ZA 2H6KA 2EIEA 4NSXA 2H3XA 5FFGA 3A0FA 2XYIA 4AMZA 3UKRC 4X61B 4G55A 1YFQA 3NIGA 4CI8A 3SFZA 3V4VA 3V7DB 3SMRA 5FKTA 4U1EI 3DXKC 4CY2A 4X63B 4D6VA 4D9SA 4ERYA 3I7LA 2I0RA 3AFCA 3W15A 2AH0A 2YNOA 5EAMA 5EMKB 4ZOXA 1C9IA 3IJCA 2CN2A 1SQ9A 3DM0A 2AGYA 5TDHB 4JSPC 5M61A 3RFGA 4AN0A 1GG2B 3PVWB 4L1QD 4PNKB 1O6GA 4CZYA 4J87A 4NAAA 3ZDZA 3EI2B 3IIYA 4MMYA 2HKRA 4CI1A 5I5MA 3VI4A 4EWRA 4TZ4A 2PBIB 5EARA 3J81g 4AX4A 2HU5A 3RFHA 5SXMA 3O4HA 5CXBB 2CO0A 2UZXB 4PXWA 4GZ8A 3MVDK 4BCBA 3ZE0A 3IUJA 5CXBA 4FWWA 5FKRA 1K8KC 3FGBA 3N0DA 2HESX 2Q7QA 4A09A 3KCIA 4L9OA 5TEFA 4PC0A 4LG8A 3J80g 2OVPB 4WK2A 2W18A 1B9XA 1GP2B 2EBSA 2YBAA 3EQ8A 3NIFA 4CC9A 5KDOB 2Z2OA 4GQBB 3SBRA 4OZUA 4CY1A 2PM7B 3PXSD 2B5MA 2CE8A 3F3GA 2G9AA 4K3JB 3SHFA 4A11B 4BCDA 2P9PC 3I8CA 1QFMA 1U8CA 3AH8B 3MZLA 1C9LA 4BL0A 4FA9D 3F3FA 1N6FA 4J0XA 2XE4A 3EU7A 5E6RA 4A11A 4WK4A 4A0AB 1XIPA 4IRZA 2YMUA 1GOTB 3DDUA 3IUMA 3OW8A 3RRMC 4J82A 4DNUA 4WJKA 4A0AA 1PBYB 1GOFA 5AMSA 3EQ7A 4RE5A 4PSXB 4FAVD 4O1QD 4GM8A 3I7NA 3SVWD 4MMXA 2AQ5A 3OKWA 4N14A 2VDKA 2BCJB 4BP8A 1YR2A 1PGUA 4J79A 4H5IA 5IGOA 4J8GA 3SN6B 5FLXg 2XL2A 2H13A 3SWSD 3OF7A 1MG3A 5HQGA 3EI1B 3OKTA 2CNXA 2HXCA 4L1MA 5B4WA 4K3ID 2HU7A 5C92A 3PSCB 3K27A 3MKSB 2EICA 5HE3B 4FB1D 4O3UB 5IT9g 4XYHA 4J73A 5GXIA 3EI1A 4A08A 1T2XA 3UVNA 4G1MA 5I5JA 4GMBA 3IKOA 3HFQA 2TRCB 2XDWA 4O02A 1JV2A 5GSAA 3T3MA 2CE9A 4HDJA 5FKQA 4NENA 4O9DA 3AL8B 2PM9A 3PSLA 1GOHA 5EMJB 1VZ2A 2BKLA 4E5ZA 1K3IA 1MDAH 3UVLA 3AL8A 3ORVD 5FXYA 3QHYB 4QQEA 2IAAA 4J8BA 3SBPA 3UKUC 2I0TA 3IURA 1GXRA 1MG2A 2QR5A 1N6EA 4UI9R 3PE7A 4ERZA 5CYKB 2GC7A 2AGWA 3DXMC 5GXHA 3OTTA 2OIZA 2P9NC 3V4PA 4UM9A 2CO0C 5CYKA 3E0CA 1P22A 2JKXA 3C5MA 5FA5B 3GREA 3F3PA 3IJEA 4Y7RA 5C2VB 3NVNA 2IWFA 1BPOA 3K72A 5E6UA 3IVMA 3JROA 2HU8A 5K19A 1TBGA 2P9SC 1E8NA 2J55H 3RN0D 5IJ7E 1VE7A 2OK6A 5FQDA 1QNIA 4GGAA 3EI2A 4Y5RD 2J57G 3PVUB 4FA4D 3EMHA 4Z8LA 4BCCA 2H9LA 4CI2A 2IUQA 2QC5A 5M5UA 3O4IA 1A12A 1H2XA 2BBKH 4O45A 4G56B 4U7AA 5IJ8E 4UM8A 2P9IC 1M1XA 1L5GA 4J86A 4QRJA 3OKYB 4QL1A 2VDOA 4JHPC 4LGNA 1QFSA 5M5SA 5IC7A 3I8EA 4J0WA 3EI3B 1B9YA 1FWXA 1OLZA 5GMKn 2AGXA 3IJ0A 1JJUB 2H9NA 5C9ZB 3EI3A 3I2NA 4ES0A 4FAND 1VYHC 4MMZA 3BWSA 3K6SA 3I89A 4PBYA 3CFSB 3EI4B 3EQ9A 1E8MA 3C9CA 4YVDA 3V5WB 3ZDYA 3ZE1A 4FA1D 2Z2NA 3P4FA 2VDNA 3U4YA 1VZ3A 1OMWB 4O2WA 1S4UX 3EI4A 3OL2B 2G99A 3NIDA 5M5VA 1R5MA 3UVMA 3UVKA 4J78A
chains in the Genus database with same CATH topology
2H6NA 4AEZA 3MMYA 5C2WB 3EG6A 3SJLD 2OVQB 4CZXA 4JSNC 3SLED 2P9KC 2OJYA 3CFVA 3L4MD 4A7JA 4ZOYA 4CY5A 4CI3A 1N6DA 1JOFA 1K32A 4GQ1A 3NVXA 1U4CA 4PSWB 3MXXA 5EAPA 4OWRA 3SXTD 3KRWB 4ERQA 4IMMA 4L3HD 4BUJC 3GFCA 1U2VC 3UR4A 3SCYA 2CN3A 2XU7A 2J56H 5EM2B 4R7AB 3B7FA 2AGZA 2UZYB 4PBZA 3VH0A 2O9KA 4J77A 4X3EA 3BG0A 5EM2A 4GQ2P 2HJ4A 2YNNA 4JSVC 5FKSA 3CIKB 5CXCB 4A2LA 4IA9A 4XEIC 3VA6A 4JT5C 2IWKA 2I3TA 4GGDA 4L3GD 3PXWD 5AFU3 5EMMB 4O3TB 1TYQC 4FHLA 2I3SA 5A2Qg 5AJAA 5THAA 4A0BB 3ODTA 1NR0A 5H17A 2H6QA 4D0KA 1SQJA 3EWEA 1Q47A 4A0BA 2B5NA 5HE2B 2AGLA 4CZVA 2IURA 4E54B 4MK0B 3RSEC 4ZN4A 5HYNB 2H68A 4XYIA 2H47A 4E54A 3FM0A 4AOWA 3I7PA 2H9MA 3IJ1A 3AL9A 2B4EA 5H1MA 3JZGA 5EMLB 1PEVA 4ZOZA 2PM6B 4JD2C 2OK4A 2AH1A 4LG9A 3JZNA 4ESGA 2GC4A 2HKMA 3I7HA 3OKYA 5K1CC 1A0RB 1JMZB 1PI6A 1RI6A 2H14A 3C99A 5TEEA 3JZHA 3JB9L 4A09B 2YB8B 2P9LC 4X60B 2XL3A 2Z2PA 3UVOA 3ULEC 4J84A 5JWZA 3IIWA 3VGZA 3DSMA 1L0QA 5HE0B 5TF2A 2MTAH 3OL2A 4JT6C 3RMZD 4H5JA 2P9UC 4I79A 3DWLC 2HYEA 2OVRB 3JRPA 3I7KA 3I7OA 3MZKA 4JXMA 4GM9A 3KRXB 4KFMB 1JMXB 3FRXA 3ZWLB 3PXTD 3MKQA 1SHYB 2GNQA 2QXVA 4FA5D 2IUPA 2YNPA 3BG1A 3C75H 2HJBA 5EALA 4J81A 5H14A 4BH6A 5IGQA 5HE1B 3JAMg 4CY3A 5I5IA 4A08B 3SBQA 4GM3A 4GGCA 3NVQA 1XHMA 4ZOVA 1NEXB 2IUVA 1ERJA 3RLMD 3L4OD 2I0SA 3V9FA 2PM9B 2B5LA 4A2MA 3RN1D 1XKSA 3JPXA 2H9PA 4E5ZB 5CXCA 4JSXC 3N0EA 4QT8A 3K26A 2H6KA 4NSXA 2H3XA 3A0FA 2XYIA 3UKRC 4X61B 1YFQA 4CI8A 3SFZA 3V7DB 3SMRA 5FKTA 4U1EI 3DXKC 4CY2A 4X63B 4D6VA 4ERYA 3I7LA 2I0RA 3AFCA 3W15A 2AH0A 2YNOA 5EAMA 5EMKB 4ZOXA 3IJCA 2CN2A 1SQ9A 3DM0A 2AGYA 5TDHB 4JSPC 3RFGA 1GG2B 3PVWB 4L1QD 4PNKB 4CZYA 4J87A 3EI2B 3IIYA 2HKRA 4CI1A 5I5MA 4EWRA 4TZ4A 2PBIB 5EARA 3J81g 3RFHA 5SXMA 5CXBB 2CO0A 2UZXB 4PXWA 4GZ8A 5FKRA 5CXBA 4FWWA 1K8KC 3FGBA 3N0DA 2HESX 2Q7QA 4A09A 4L9OA 5TEFA 4PC0A 4LG8A 3J80g 2OVPB 2W18A 1B9XA 1GP2B 2EBSA 2YBAA 4CC9A 5KDOB 2Z2OA 4GQBB 3SBRA 4OZUA 4CY1A 2PM7B 3PXSD 2B5MA 2CE8A 3F3GA 2G9AA 4K3JB 3SHFA 4A11B 2P9PC 3I8CA 3AH8B 3MZLA 4BL0A 4FA9D 3F3FA 1N6FA 4J0XA 4A11A 3EU7A 4A0AB 1XIPA 2YMUA 1GOTB 3RRMC 3OW8A 4J82A 4A0AA 1PBYB 5AMSA 4PSXB 4FAVD 4O1QD 4GM8A 3I7NA 3SVWD 2AQ5A 3OKWA 4N14A 2BCJB 1PGUA 4J79A 4H5IA 5IGOA 4J8GA 3SN6B 5FLXg 2XL2A 2H13A 3SWSD 1MG3A 5HQGA 3EI1B 3OKTA 2CNXA 2HXCA 5B4WA 4K3ID 3PSCB 3K27A 3MKSB 5HE3B 4FB1D 4O3UB 5IT9g 4XYHA 4J73A 5GXIA 3EI1A 4A08A 3UVNA 5I5JA 4GMBA 3IKOA 3HFQA 2TRCB 5GSAA 2CE9A 4HDJA 5FKQA 4O9DA 3AL8B 2PM9A 3PSLA 5EMJB 4E5ZA 1MDAH 3UVLA 3AL8A 3ORVD 5FXYA 4QQEA 2IAAA 4J8BA 3SBPA 3UKUC 2I0TA 1GXRA 1MG2A 1N6EA 4UI9R 3PE7A 4ERZA 5CYKB 2GC7A 2AGWA 3DXMC 5GXHA 3OTTA 2OIZA 2P9NC 2CO0C 5CYKA 3E0CA 1P22A 3C5MA 5FA5B 3GREA 3F3PA 4Y7RA 5C2VB 3NVNA 2IWFA 3JROA 5K19A 1TBGA 2P9SC 2J55H 3RN0D 5IJ7E 2OK6A 5FQDA 1QNIA 4GGAA 3EI2A 4Y5RD 2J57G 3PVUB 4FA4D 3EMHA 4Z8LA 2H9LA 4CI2A 2IUQA 2QC5A 2BBKH 4O45A 4G56B 4U7AA 5IJ8E 2P9IC 4QRJA 4J86A 3OKYB 4QL1A 4LGNA 5IC7A 3I8EA 4J0WA 3EI3B 1B9YA 1FWXA 1OLZA 5GMKn 2AGXA 3IJ0A 1JJUB 2H9NA 5C9ZB 3EI3A 3I2NA 4ES0A 4FAND 1VYHC 3BWSA 3I89A 4PBYA 3CFSB 3EI4B 3V5WB 3C9CA 4YVDA 4FA1D 2Z2NA 3P4FA 3U4YA 1OMWB 1S4UX 3EI4A 3OL2B 2G99A 1R5MA 3UVMA 3UVKA 4J78A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H6N A;  4AEZ A;  3MMY A;  5C2W B;  3EG6 A;  3SJL D;  2OVQ B;  4CZX A;  4JSN C;  3SLE D;  2P9K C;  2OJY A;  3CFV A;  3L4M D;  4A7J A;  4ZOY A;  4CY5 A;  4CI3 A;  1N6D A;  1JOF A;  1K32 A;  4GQ1 A;  3NVX A;  1U4C A;  4PSW B;  3MXX A;  5EAP A;  4OWR A;  3SXT D;  3KRW B;  4ERQ A;  4IMM A;  4L3H D;  4BUJ C;  3GFC A;  1U2V C;  3UR4 A;  3SCY A;  2CN3 A;  2XU7 A;  2J56 H;  5EM2 B;  4R7A B;  3B7F A;  2AGZ A;  2UZY B;  4PBZ A;  3VH0 A;  2O9K A;  4J77 A;  4X3E A;  3BG0 A;  5EM2 A;  4GQ2 P;  2HJ4 A;  2YNN A;  4JSV C;  5FKS A;  3CIK B;  5CXC B;  4A2L A;  4IA9 A;  4XEI C;  3VA6 A;  4JT5 C;  2IWK A;  2I3T A;  4GGD A;  4L3G D;  3PXW D;  5AFU 3;  5EMM B;  4O3T B;  1TYQ C;  4FHL A;  2I3S A;  5A2Q g;  5AJA A;  5THA A;  4A0B B;  3ODT A;  1NR0 A;  5H17 A;  2H6Q A;  4D0K A;  1SQJ A;  3EWE A;  1Q47 A;  4A0B A;  2B5N A;  5HE2 B;  2AGL A;  4CZV A;  2IUR A;  4E54 B;  4MK0 B;  3RSE C;  4ZN4 A;  5HYN B;  2H68 A;  4XYI A;  2H47 A;  4E54 A;  3FM0 A;  4AOW A;  3I7P A;  2H9M A;  3IJ1 A;  3AL9 A;  2B4E A;  5H1M A;  3JZG A;  5EML B;  1PEV A;  4ZOZ A;  2PM6 B;  4JD2 C;  2OK4 A;  2AH1 A;  4LG9 A;  3JZN A;  4ESG A;  2GC4 A;  2HKM A;  3I7H A;  3OKY A;  5K1C C;  1A0R B;  1JMZ B;  1PI6 A;  1RI6 A;  2H14 A;  3C99 A;  5TEE A;  3JZH A;  3JB9 L;  4A09 B;  2YB8 B;  2P9L C;  4X60 B;  2XL3 A;  2Z2P A;  3UVO A;  3ULE C;  4J84 A;  5JWZ A;  3IIW A;  3VGZ A;  3DSM A;  1L0Q A;  5HE0 B;  5TF2 A;  2MTA H;  3OL2 A;  4JT6 C;  3RMZ D;  4H5J A;  2P9U C;  4I79 A;  3DWL C;  2HYE A;  2OVR B;  3JRP A;  3I7K A;  3I7O A;  3MZK A;  4JXM A;  4GM9 A;  3KRX B;  4KFM B;  1JMX B;  3FRX A;  3ZWL B;  3PXT D;  3MKQ A;  1SHY B;  2GNQ A;  2QXV A;  4FA5 D;  2IUP A;  2YNP A;  3BG1 A;  3C75 H;  2HJB A;  5EAL A;  4J81 A;  5H14 A;  4BH6 A;  5IGQ A;  5HE1 B;  3JAM g;  4CY3 A;  5I5I A;  4A08 B;  3SBQ A;  4GM3 A;  4GGC A;  3NVQ A;  1XHM A;  4ZOV A;  1NEX B;  2IUV A;  1ERJ A;  3RLM D;  3L4O D;  2I0S A;  3V9F A;  2PM9 B;  2B5L A;  4A2M A;  3RN1 D;  1XKS A;  3JPX A;  2H9P A;  4E5Z B;  5CXC A;  4JSX C;  3N0E A;  4QT8 A;  3K26 A;  2H6K A;  4NSX A;  2H3X A;  3A0F A;  2XYI A;  3UKR C;  4X61 B;  1YFQ A;  4CI8 A;  3SFZ A;  3V7D B;  3SMR A;  5FKT A;  4U1E I;  3DXK C;  4CY2 A;  4X63 B;  4D6V A;  4ERY A;  3I7L A;  2I0R A;  3AFC A;  3W15 A;  2AH0 A;  2YNO A;  5EAM A;  5EMK B;  4ZOX A;  3IJC A;  2CN2 A;  1SQ9 A;  3DM0 A;  2AGY A;  5TDH B;  4JSP C;  3RFG A;  1GG2 B;  3PVW B;  4L1Q D;  4PNK B;  4CZY A;  4J87 A;  3EI2 B;  3IIY A;  2HKR A;  4CI1 A;  5I5M A;  4EWR A;  4TZ4 A;  2PBI B;  5EAR A;  3J81 g;  3RFH A;  5SXM A;  5CXB B;  2CO0 A;  2UZX B;  4PXW A;  4GZ8 A;  5FKR A;  5CXB A;  4FWW A;  1K8K C;  3FGB A;  3N0D A;  2HES X;  2Q7Q A;  4A09 A;  4L9O A;  5TEF A;  4PC0 A;  4LG8 A;  3J80 g;  2OVP B;  2W18 A;  1B9X A;  1GP2 B;  2EBS A;  2YBA A;  4CC9 A;  5KDO B;  2Z2O A;  4GQB B;  3SBR A;  4OZU A;  4CY1 A;  2PM7 B;  3PXS D;  2B5M A;  2CE8 A;  3F3G A;  2G9A A;  4K3J B;  3SHF A;  4A11 B;  2P9P C;  3I8C A;  3AH8 B;  3MZL A;  4BL0 A;  4FA9 D;  3F3F A;  1N6F A;  4J0X A;  4A11 A;  3EU7 A;  4A0A B;  1XIP A;  2YMU A;  1GOT B;  3RRM C;  3OW8 A;  4J82 A;  4A0A A;  1PBY B;  5AMS A;  4PSX B;  4FAV D;  4O1Q D;  4GM8 A;  3I7N A;  3SVW D;  2AQ5 A;  3OKW A;  4N14 A;  2BCJ B;  1PGU A;  4J79 A;  4H5I A;  5IGO A;  4J8G A;  3SN6 B;  5FLX g;  2XL2 A;  2H13 A;  3SWS D;  1MG3 A;  5HQG A;  3EI1 B;  3OKT A;  2CNX A;  2HXC A;  5B4W A;  4K3I D;  3PSC B;  3K27 A;  3MKS B;  5HE3 B;  4FB1 D;  4O3U B;  5IT9 g;  4XYH A;  4J73 A;  5GXI A;  3EI1 A;  4A08 A;  3UVN A;  5I5J A;  4GMB A;  3IKO A;  3HFQ A;  2TRC B;  5GSA A;  2CE9 A;  4HDJ A;  5FKQ A;  4O9D A;  3AL8 B;  2PM9 A;  3PSL A;  5EMJ B;  4E5Z A;  1MDA H;  3UVL A;  3AL8 A;  3ORV D;  5FXY A;  4QQE A;  2IAA A;  4J8B A;  3SBP A;  3UKU C;  2I0T A;  1GXR A;  1MG2 A;  1N6E A;  4UI9 R;  3PE7 A;  4ERZ A;  5CYK B;  2GC7 A;  2AGW A;  3DXM C;  5GXH A;  3OTT A;  2OIZ A;  2P9N C;  2CO0 C;  5CYK A;  3E0C A;  1P22 A;  3C5M A;  5FA5 B;  3GRE A;  3F3P A;  4Y7R A;  5C2V B;  3NVN A;  2IWF A;  3JRO A;  5K19 A;  1TBG A;  2P9S C;  2J55 H;  3RN0 D;  5IJ7 E;  2OK6 A;  5FQD A;  1QNI A;  4GGA A;  3EI2 A;  4Y5R D;  2J57 G;  3PVU B;  4FA4 D;  3EMH A;  4Z8L A;  2H9L A;  4CI2 A;  2IUQ A;  2QC5 A;  2BBK H;  4O45 A;  4G56 B;  4U7A A;  5IJ8 E;  2P9I C;  4QRJ A;  4J86 A;  3OKY B;  4QL1 A;  4LGN A;  5IC7 A;  3I8E A;  4J0W A;  3EI3 B;  1B9Y A;  1FWX A;  1OLZ A;  5GMK n;  2AGX A;  3IJ0 A;  1JJU B;  2H9N A;  5C9Z B;  3EI3 A;  3I2N A;  4ES0 A;  4FAN D;  1VYH C;  3BWS A;  3I89 A;  4PBY A;  3CFS B;  3EI4 B;  3V5W B;  3C9C A;  4YVD A;  4FA1 D;  2Z2N A;  3P4F A;  3U4Y A;  1OMW B;  1S4U X;  3EI4 A;  3OL2 B;  2G99 A;  1R5M A;  3UVM A;  3UVK A;  4J78 A; 
#chains in the Genus database with same CATH topology
 2H6N A;  1VE6 A;  4AEZ A;  3MMY A;  5C2W B;  3EG6 A;  3SJL D;  2OVQ B;  4CZX A;  4JSN C;  3SLE D;  4G1E A;  2P9K C;  2OJY A;  3CFV A;  2QZP A;  3L4M D;  4A7J A;  4ZOY A;  4CY5 A;  4CI3 A;  4Z7Q A;  1N6D A;  1JOF A;  1K32 A;  4GQ1 A;  3NVX A;  1U4C A;  4PSW B;  3IUQ A;  3MXX A;  5EAP A;  4OWR A;  3SXT D;  1H2W A;  3IUL A;  3KRW B;  4ERQ A;  5M5T A;  4IMM A;  4L3H D;  4NBM A;  4BUJ C;  3GFC A;  1U2V C;  3UR4 A;  1I2M B;  3SCY A;  1UOQ A;  3T3P A;  2CN3 A;  2XU7 A;  4QAM A;  2J56 H;  3ZE2 A;  5EM2 B;  5FFO A;  4R7A B;  3B7F A;  2AGZ A;  2UZY B;  4PBZ A;  3VH0 A;  2O9K A;  4J77 A;  4X3E A;  3BG0 A;  1E5T A;  5EM2 A;  4GQ2 P;  2HJ4 A;  2YNN A;  4JSV C;  5FKS A;  3CIK B;  4AN1 A;  2WQ8 A;  4WK0 A;  5CXC B;  4A2L A;  4IA9 A;  4XEI C;  3VA6 A;  4JT5 C;  2IWK A;  2I3T A;  4GGD A;  4L3G D;  1UOP A;  3PXW D;  5AFU 3;  5EMM B;  3FCS A;  4O3T B;  1TYQ C;  4FHL A;  2I3S A;  5A2Q g;  5C86 A;  5AJA A;  5THA A;  4A0B B;  3ODT A;  1NR0 A;  5H17 A;  2H6Q A;  4D0K A;  1SQJ A;  3EWE A;  1Q47 A;  4A0B A;  2B5N A;  5HE2 B;  2AGL A;  4CZV A;  2IUR A;  4E54 B;  4MK0 B;  2VDL A;  1JTD B;  3RSE C;  4ZN4 A;  5HYN B;  2H68 A;  4XYI A;  2H47 A;  4E54 A;  1O6F A;  3FM0 A;  4AOW A;  1H2Y A;  3I7P A;  1UOO A;  2H9M A;  3IJ1 A;  3AL9 A;  2B4E A;  5H1M A;  3JZG A;  5EML B;  1PEV A;  4ZOZ A;  2PM6 B;  4JD2 C;  2OK4 A;  3O4J A;  2AH1 A;  4RE6 A;  1UTC A;  4LG9 A;  2VDM A;  3JZN A;  2EIB A;  5M5R A;  4ESG A;  2GC4 A;  2HKM A;  3I7H A;  4Z7O A;  3OKY A;  5K1C C;  3MUN A;  4DNV A;  1A0R B;  1JMZ B;  1PI6 A;  5HDB A;  2XZG A;  1RI6 A;  2H14 A;  3C99 A;  5TEE A;  3JZH A;  3JB9 L;  4A09 B;  2YB8 B;  2P9L C;  4X60 B;  2XL3 A;  2Z2P A;  3UVO A;  3ULE C;  2VC2 A;  2VDQ A;  4J84 A;  5JWZ A;  2EID A;  3IIW A;  3FCU A;  4BP9 A;  3VGZ A;  3DSM A;  1L0Q A;  5HE0 B;  5TF2 A;  2MTA H;  3OL2 A;  4JT6 C;  3RMZ D;  4H5J A;  2VDR A;  2P9U C;  3O4G A;  3MUO A;  4I79 A;  3DWL C;  2HYE A;  2OVR B;  3VI3 A;  4JHN A;  3JRP A;  3I7K A;  3I7O A;  3MZK A;  4JXM A;  2VDP A;  4GM9 A;  2VZ1 A;  3KRX B;  3ZDX A;  4KFM B;  1JMX B;  3FRX A;  3GD1 I;  3ZWL B;  3PXT D;  3MKQ A;  4NC4 A;  1SHY B;  1TYE A;  2GNQ A;  2QXV A;  4FA5 D;  2IUP A;  2YNP A;  3BG1 A;  3C75 H;  2HJB A;  5EAL A;  4J81 A;  5H14 A;  4BH6 A;  5IGQ A;  5HE1 B;  3QI0 A;  5E6S A;  3JAM g;  4CY3 A;  4Z7N A;  5I5I A;  4A08 B;  3SBQ A;  4GM3 A;  4GGC A;  3NVQ A;  1XHM A;  4ZOV A;  1GOG A;  1NEX B;  2IUV A;  1ERJ A;  4AMY A;  3RLM D;  2VZ3 A;  3L4O D;  2I0S A;  3V9F A;  2PM9 B;  4DNW A;  2B5L A;  4A2M A;  3RN1 D;  1XKS A;  3JPX A;  2H9P A;  4E5Z B;  5CXC A;  3IUN A;  3K71 A;  4JSX C;  3N0E A;  4QT8 A;  3GC3 B;  3K26 A;  1H2Z A;  2H6K A;  2EIE A;  4NSX A;  2H3X A;  5FFG A;  3A0F A;  2XYI A;  4AMZ A;  3UKR C;  4X61 B;  4G55 A;  1YFQ A;  3NIG A;  4CI8 A;  3SFZ A;  3V4V A;  3V7D B;  3SMR A;  5FKT A;  4U1E I;  3DXK C;  4CY2 A;  4X63 B;  4D6V A;  4D9S A;  4ERY A;  3I7L A;  2I0R A;  3AFC A;  3W15 A;  2AH0 A;  2YNO A;  5EAM A;  5EMK B;  4ZOX A;  1C9I A;  3IJC A;  2CN2 A;  1SQ9 A;  3DM0 A;  2AGY A;  5TDH B;  4JSP C;  5M61 A;  3RFG A;  4AN0 A;  1GG2 B;  3PVW B;  4L1Q D;  4PNK B;  1O6G A;  4CZY A;  4J87 A;  4NAA A;  3ZDZ A;  3EI2 B;  3IIY A;  4MMY A;  2HKR A;  4CI1 A;  5I5M A;  3VI4 A;  4EWR A;  4TZ4 A;  2PBI B;  5EAR A;  3J81 g;  4AX4 A;  2HU5 A;  3RFH A;  5SXM A;  3O4H A;  5CXB B;  2CO0 A;  2UZX B;  4PXW A;  4GZ8 A;  3MVD K;  4BCB A;  3ZE0 A;  3IUJ A;  5CXB A;  4FWW A;  5FKR A;  1K8K C;  3FGB A;  3N0D A;  2HES X;  2Q7Q A;  4A09 A;  3KCI A;  4L9O A;  5TEF A;  4PC0 A;  4LG8 A;  3J80 g;  2OVP B;  4WK2 A;  2W18 A;  1B9X A;  1GP2 B;  2EBS A;  2YBA A;  3EQ8 A;  3NIF A;  4CC9 A;  5KDO B;  2Z2O A;  4GQB B;  3SBR A;  4OZU A;  4CY1 A;  2PM7 B;  3PXS D;  2B5M A;  2CE8 A;  3F3G A;  2G9A A;  4K3J B;  3SHF A;  4A11 B;  4BCD A;  2P9P C;  3I8C A;  1QFM A;  1U8C A;  3AH8 B;  3MZL A;  1C9L A;  4BL0 A;  4FA9 D;  3F3F A;  1N6F A;  4J0X A;  2XE4 A;  3EU7 A;  5E6R A;  4A11 A;  4WK4 A;  4A0A B;  1XIP A;  4IRZ A;  2YMU A;  1GOT B;  3DDU A;  3IUM A;  3OW8 A;  3RRM C;  4J82 A;  4DNU A;  4WJK A;  4A0A A;  1PBY B;  1GOF A;  5AMS A;  3EQ7 A;  4RE5 A;  4PSX B;  4FAV D;  4O1Q D;  4GM8 A;  3I7N A;  3SVW D;  4MMX A;  2AQ5 A;  3OKW A;  4N14 A;  2VDK A;  2BCJ B;  4BP8 A;  1YR2 A;  1PGU A;  4J79 A;  4H5I A;  5IGO A;  4J8G A;  3SN6 B;  5FLX g;  2XL2 A;  2H13 A;  3SWS D;  3OF7 A;  1MG3 A;  5HQG A;  3EI1 B;  3OKT A;  2CNX A;  2HXC A;  4L1M A;  5B4W A;  4K3I D;  2HU7 A;  5C92 A;  3PSC B;  3K27 A;  3MKS B;  2EIC A;  5HE3 B;  4FB1 D;  4O3U B;  5IT9 g;  4XYH A;  4J73 A;  5GXI A;  3EI1 A;  4A08 A;  1T2X A;  3UVN A;  4G1M A;  5I5J A;  4GMB A;  3IKO A;  3HFQ A;  2TRC B;  2XDW A;  4O02 A;  1JV2 A;  5GSA A;  3T3M A;  2CE9 A;  4HDJ A;  5FKQ A;  4NEN A;  4O9D A;  3AL8 B;  2PM9 A;  3PSL A;  1GOH A;  5EMJ B;  1VZ2 A;  2BKL A;  4E5Z A;  1K3I A;  1MDA H;  3UVL A;  3AL8 A;  3ORV D;  5FXY A;  3QHY B;  4QQE A;  2IAA A;  4J8B A;  3SBP A;  3UKU C;  2I0T A;  3IUR A;  1GXR A;  1MG2 A;  2QR5 A;  1N6E A;  4UI9 R;  3PE7 A;  4ERZ A;  5CYK B;  2GC7 A;  2AGW A;  3DXM C;  5GXH A;  3OTT A;  2OIZ A;  2P9N C;  3V4P A;  4UM9 A;  2CO0 C;  5CYK A;  3E0C A;  1P22 A;  2JKX A;  3C5M A;  5FA5 B;  3GRE A;  3F3P A;  3IJE A;  4Y7R A;  5C2V B;  3NVN A;  2IWF A;  1BPO A;  3K72 A;  5E6U A;  3IVM A;  3JRO A;  2HU8 A;  5K19 A;  1TBG A;  2P9S C;  1E8N A;  2J55 H;  3RN0 D;  5IJ7 E;  1VE7 A;  2OK6 A;  5FQD A;  1QNI A;  4GGA A;  3EI2 A;  4Y5R D;  2J57 G;  3PVU B;  4FA4 D;  3EMH A;  4Z8L A;  4BCC A;  2H9L A;  4CI2 A;  2IUQ A;  2QC5 A;  5M5U A;  3O4I A;  1A12 A;  1H2X A;  2BBK H;  4O45 A;  4G56 B;  4U7A A;  5IJ8 E;  4UM8 A;  2P9I C;  1M1X A;  1L5G A;  4J86 A;  4QRJ A;  3OKY B;  4QL1 A;  2VDO A;  4JHP C;  4LGN A;  1QFS A;  5M5S A;  5IC7 A;  3I8E A;  4J0W A;  3EI3 B;  1B9Y A;  1FWX A;  1OLZ A;  5GMK n;  2AGX A;  3IJ0 A;  1JJU B;  2H9N A;  5C9Z B;  3EI3 A;  3I2N A;  4ES0 A;  4FAN D;  1VYH C;  4MMZ A;  3BWS A;  3K6S A;  3I89 A;  4PBY A;  3CFS B;  3EI4 B;  3EQ9 A;  1E8M A;  3C9C A;  4YVD A;  3V5W B;  3ZDY A;  3ZE1 A;  4FA1 D;  2Z2N A;  3P4F A;  2VDN A;  3U4Y A;  1VZ3 A;  1OMW B;  4O2W A;  1S4U X;  3EI4 A;  3OL2 B;  2G99 A;  3NID A;  5M5V A;  1R5M A;  3UVM A;  3UVK A;  4J78 A; 
#chains in the Genus database with same CATH homology
 2H6N A;  4AEZ A;  3MMY A;  5C2W B;  3EG6 A;  3SJL D;  2OVQ B;  4CZX A;  4JSN C;  3SLE D;  2P9K C;  2OJY A;  3CFV A;  3L4M D;  4A7J A;  4ZOY A;  4CY5 A;  4CI3 A;  1N6D A;  1JOF A;  1K32 A;  4GQ1 A;  3NVX A;  1U4C A;  4PSW B;  3MXX A;  5EAP A;  4OWR A;  3SXT D;  3KRW B;  4ERQ A;  4IMM A;  4L3H D;  4BUJ C;  3GFC A;  1U2V C;  3UR4 A;  3SCY A;  2CN3 A;  2XU7 A;  2J56 H;  5EM2 B;  4R7A B;  3B7F A;  2AGZ A;  2UZY B;  4PBZ A;  3VH0 A;  2O9K A;  4J77 A;  4X3E A;  3BG0 A;  5EM2 A;  4GQ2 P;  2HJ4 A;  2YNN A;  4JSV C;  5FKS A;  3CIK B;  5CXC B;  4A2L A;  4IA9 A;  4XEI C;  3VA6 A;  4JT5 C;  2IWK A;  2I3T A;  4GGD A;  4L3G D;  3PXW D;  5AFU 3;  5EMM B;  4O3T B;  1TYQ C;  4FHL A;  2I3S A;  5A2Q g;  5AJA A;  5THA A;  4A0B B;  3ODT A;  1NR0 A;  5H17 A;  2H6Q A;  4D0K A;  1SQJ A;  3EWE A;  1Q47 A;  4A0B A;  2B5N A;  5HE2 B;  2AGL A;  4CZV A;  2IUR A;  4E54 B;  4MK0 B;  3RSE C;  4ZN4 A;  5HYN B;  2H68 A;  4XYI A;  2H47 A;  4E54 A;  3FM0 A;  4AOW A;  3I7P A;  2H9M A;  3IJ1 A;  3AL9 A;  2B4E A;  5H1M A;  3JZG A;  5EML B;  1PEV A;  4ZOZ A;  2PM6 B;  4JD2 C;  2OK4 A;  2AH1 A;  4LG9 A;  3JZN A;  4ESG A;  2GC4 A;  2HKM A;  3I7H A;  3OKY A;  5K1C C;  1A0R B;  1JMZ B;  1PI6 A;  1RI6 A;  2H14 A;  3C99 A;  5TEE A;  3JZH A;  3JB9 L;  4A09 B;  2YB8 B;  2P9L C;  4X60 B;  2XL3 A;  2Z2P A;  3UVO A;  3ULE C;  4J84 A;  5JWZ A;  3IIW A;  3VGZ A;  3DSM A;  1L0Q A;  5HE0 B;  5TF2 A;  2MTA H;  3OL2 A;  4JT6 C;  3RMZ D;  4H5J A;  2P9U C;  4I79 A;  3DWL C;  2HYE A;  2OVR B;  3JRP A;  3I7K A;  3I7O A;  3MZK A;  4JXM A;  4GM9 A;  3KRX B;  4KFM B;  1JMX B;  3FRX A;  3ZWL B;  3PXT D;  3MKQ A;  1SHY B;  2GNQ A;  2QXV A;  4FA5 D;  2IUP A;  2YNP A;  3BG1 A;  3C75 H;  2HJB A;  5EAL A;  4J81 A;  5H14 A;  4BH6 A;  5IGQ A;  5HE1 B;  3JAM g;  4CY3 A;  5I5I A;  4A08 B;  3SBQ A;  4GM3 A;  4GGC A;  3NVQ A;  1XHM A;  4ZOV A;  1NEX B;  2IUV A;  1ERJ A;  3RLM D;  3L4O D;  2I0S A;  3V9F A;  2PM9 B;  2B5L A;  4A2M A;  3RN1 D;  1XKS A;  3JPX A;  2H9P A;  4E5Z B;  5CXC A;  4JSX C;  3N0E A;  4QT8 A;  3K26 A;  2H6K A;  4NSX A;  2H3X A;  3A0F A;  2XYI A;  3UKR C;  4X61 B;  1YFQ A;  4CI8 A;  3SFZ A;  3V7D B;  3SMR A;  5FKT A;  4U1E I;  3DXK C;  4CY2 A;  4X63 B;  4D6V A;  4ERY A;  3I7L A;  2I0R A;  3AFC A;  3W15 A;  2AH0 A;  2YNO A;  5EAM A;  5EMK B;  4ZOX A;  3IJC A;  2CN2 A;  1SQ9 A;  3DM0 A;  2AGY A;  5TDH B;  4JSP C;  3RFG A;  1GG2 B;  3PVW B;  4L1Q D;  4PNK B;  4CZY A;  4J87 A;  3EI2 B;  3IIY A;  2HKR A;  4CI1 A;  5I5M A;  4EWR A;  4TZ4 A;  2PBI B;  5EAR A;  3J81 g;  3RFH A;  5SXM A;  5CXB B;  2CO0 A;  2UZX B;  4PXW A;  4GZ8 A;  5FKR A;  5CXB A;  4FWW A;  1K8K C;  3FGB A;  3N0D A;  2HES X;  2Q7Q A;  4A09 A;  4L9O A;  5TEF A;  4PC0 A;  4LG8 A;  3J80 g;  2OVP B;  2W18 A;  1B9X A;  1GP2 B;  2EBS A;  2YBA A;  4CC9 A;  5KDO B;  2Z2O A;  4GQB B;  3SBR A;  4OZU A;  4CY1 A;  2PM7 B;  3PXS D;  2B5M A;  2CE8 A;  3F3G A;  2G9A A;  4K3J B;  3SHF A;  4A11 B;  2P9P C;  3I8C A;  3AH8 B;  3MZL A;  4BL0 A;  4FA9 D;  3F3F A;  1N6F A;  4J0X A;  4A11 A;  3EU7 A;  4A0A B;  1XIP A;  2YMU A;  1GOT B;  3RRM C;  3OW8 A;  4J82 A;  4A0A A;  1PBY B;  5AMS A;  4PSX B;  4FAV D;  4O1Q D;  4GM8 A;  3I7N A;  3SVW D;  2AQ5 A;  3OKW A;  4N14 A;  2BCJ B;  1PGU A;  4J79 A;  4H5I A;  5IGO A;  4J8G A;  3SN6 B;  5FLX g;  2XL2 A;  2H13 A;  3SWS D;  1MG3 A;  5HQG A;  3EI1 B;  3OKT A;  2CNX A;  2HXC A;  5B4W A;  4K3I D;  3PSC B;  3K27 A;  3MKS B;  5HE3 B;  4FB1 D;  4O3U B;  5IT9 g;  4XYH A;  4J73 A;  5GXI A;  3EI1 A;  4A08 A;  3UVN A;  5I5J A;  4GMB A;  3IKO A;  3HFQ A;  2TRC B;  5GSA A;  2CE9 A;  4HDJ A;  5FKQ A;  4O9D A;  3AL8 B;  2PM9 A;  3PSL A;  5EMJ B;  4E5Z A;  1MDA H;  3UVL A;  3AL8 A;  3ORV D;  5FXY A;  4QQE A;  2IAA A;  4J8B A;  3SBP A;  3UKU C;  2I0T A;  1GXR A;  1MG2 A;  1N6E A;  4UI9 R;  3PE7 A;  4ERZ A;  5CYK B;  2GC7 A;  2AGW A;  3DXM C;  5GXH A;  3OTT A;  2OIZ A;  2P9N C;  2CO0 C;  5CYK A;  3E0C A;  1P22 A;  3C5M A;  5FA5 B;  3GRE A;  3F3P A;  4Y7R A;  5C2V B;  3NVN A;  2IWF A;  3JRO A;  5K19 A;  1TBG A;  2P9S C;  2J55 H;  3RN0 D;  5IJ7 E;  2OK6 A;  5FQD A;  1QNI A;  4GGA A;  3EI2 A;  4Y5R D;  2J57 G;  3PVU B;  4FA4 D;  3EMH A;  4Z8L A;  2H9L A;  4CI2 A;  2IUQ A;  2QC5 A;  2BBK H;  4O45 A;  4G56 B;  4U7A A;  5IJ8 E;  2P9I C;  4QRJ A;  4J86 A;  3OKY B;  4QL1 A;  4LGN A;  5IC7 A;  3I8E A;  4J0W A;  3EI3 B;  1B9Y A;  1FWX A;  1OLZ A;  5GMK n;  2AGX A;  3IJ0 A;  1JJU B;  2H9N A;  5C9Z B;  3EI3 A;  3I2N A;  4ES0 A;  4FAN D;  1VYH C;  3BWS A;  3I89 A;  4PBY A;  3CFS B;  3EI4 B;  3V5W B;  3C9C A;  4YVD A;  4FA1 D;  2Z2N A;  3P4F A;  3U4Y A;  1OMW B;  1S4U X;  3EI4 A;  3OL2 B;  2G99 A;  1R5M A;  3UVM A;  3UVK A;  4J78 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...