3GFCA

Crystal structure of histone-binding protein rbbp4
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
387
structure length
339
Chain Sequence
WKKNTPFLYDLVMTHALEWPSLTAQWLPDVTDFSIHRLVLGTHTQNHLVIASVQLPNKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDCNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and function of WD40 domain proteins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Histone-binding protein RBBP4
total genus 80
structure length 339
sequence length 387
ec nomenclature
pdb deposition date 2009-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
A PF12265 CAF1C_H4-bd Histone-binding protein RBBP4 or subunit C of CAF1 complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3gfcA00
4QL1A 5KDOB 3AL8B 3NVXA 4NSXA 1R5MA 1MG3A 3K27A 3UR4A 4LG9A 4I79A 3PXSD 3GREA 3U4YA 3SXTD 4A0BB 4K3ID 1N6FA 2H6QA 2J55H 3DSMA 4D6VA 3V5WB 3FM0A 5FKRA 5TEFA 2Q7QA 1JJUB 3I2NA 5CXBA 1JMZB 3DM0A 5IJ7E 3EG6A 2Z2OA 1PEVA 3JZHA 2P9PC 3P4FA 4Z8LA 3SWSD 4X61B 5C2VB 3VH0A 5FA5B 2AGLA 2H9LA 5IJ8E 4A08A 5FKSA 3OW8A 2OVPB 4LGNA 2B4EA 3E0CA 2H47A 3SBQA 5H14A 5H1MA 4N14A 4OZUA 3SJLD 5B4WA 2B5LA 2BBKH 2I0RA 3SLED 4PXWA 4O3TB 5SXMA 4JSVC 3EU7A 4GM9A 3I8EA 2J57G 3JAMg 3JZNA 3AL8A 3IJCA 2XL3A 4A11B 4J8BA 2AGZA 1SQ9A 3A0FA 2OIZA 4GM8A 4ERYA 4H5IA 2IAAA 4GM3A 4U7AA 2OVRB 3PVWB 3RMZD 1P22A 5CYKA 5EMLB 2CN3A 1JMXB 2OK4A 1XIPA 3MKQA 3OKWA 1N6DA 4XYIA 3PVUB 4FHLA 3MXXA 2PM9B 1MG2A 4QT8A 4A11A 3C9CA 2H68A 3JRPA 2QXVA 4A2LA 5EAMA 4GQ2P 2H6KA 2I0SA 3IJ0A 3RRMC 4ZN4A 3OL2A 5EMKB 2GNQA 4GGDA 2H13A 4CZVA 5EM2B 2G99A 5TEEA 1JOFA 5FXYA 2P9SC 5CXCA 4IA9A 4IMMA 5IGOA 4ESGA 3EI3B 4PBZA 2IURA 3N0EA 5FQDA 1S4UX 5EAPA 3L4MD 2OK6A 3I7PA 4JD2C 4AOWA 4O3UB 3NVQA 3B7FA 2B5NA 3V7DB 2OJYA 1PBYB 3F3PA 4J77A 3SBPA 3OL2B 3I89A 5IGQA 4PBYA 4UI9R 3I7LA 2AGWA 1SQJA 4XYHA 2QC5A 2P9UC 2UZYB 4J0XA 4JT6C 3RSEC 3SBRA 3AFCA 4G56B 3KRXB 4JSNC 3I7HA 1GG2B 3PSCB 1K32A 3C75H 4GQ1A 4JXMA 3FRXA 5GXIA 2CO0C 3ODTA 1XHMA 3CFVA 2HKMA 4A09B 3SFZA 3UVOA 3SN6B 5AMSA 3MZLA 4TZ4A 4JSPC 2TRCB 2P9IC 3JB9L 3BG0A 5FKTA 1OLZA 3I8CA 4J0WA 1XKSA 2YNNA 3DXKC 5CXCB 4A0AB 4U1EI 2G9AA 3J80g 4J78A 4JT5C 2HJ4A 4J86A 4X3EA 4D0KA 3UVNA 4E54A 5GXHA 3EI1B 5H17A 2YBAA 2P9LC 3GFCA 4L3HD 3MZKA 5IC7A 5GSAA 4J8GA 3VGZA 5AJAA 1Q47A 4EWRA 2Z2PA 4MK0B 1ERJA 2HKRA 4YVDA 4L9OA 4A09A 2IUVA 4A0AA 1U2VC 5HYNB 2YB8B 3JROA 2PBIB 5CXBB 1A0RB 3W15A 2H3XA 5K1CC 4ERQA 5I5IA 2PM7B 2W18A 1NR0A 2Z2NA 4Y7RA 4GZ8A 4O1QD 4BL0A 4R7AB 1TBGA 4CY5A 1GOTB 2H14A 4K3JB 2AH1A 5FKQA 2XL2A 2BCJB 5CYKB 5TF2A 2H6NA 2UZXB 3VA6A 4J73A 3MMYA 5GMKn 2I3SA 3UKRC 4PSWB 2IWKA 2P9NC 4J81A 4Y5RD 2PM6B 4L3GD 4QRJA 2PM9A 1RI6A 2P9KC 4E5ZB 4CI8A 3I7NA 4X63B 3ULEC 3JPXA 2MTAH 3OKTA 3PXWD 1GP2B 1SHYB 3N0DA 2J56H 4ZOYA 4CZXA 3I7OA 4E54B 4ZOZA 4O45A 1OMWB 3EI1A 4PC0A 3JZGA 4CC9A 3SHFA 3PE7A 2I3TA 4ZOVA 3EI2B 4FB1D 4GQBB 2I0TA 3RFHA 3EWEA 4CI1A 4E5ZA 5HE2B 5AFU3 3DWLC 1VYHC 4QQEA 3EI2A 4FA4D 2EBSA 2XU7A 2IUQA 2CE9A 5I5MA 4FA9D 5EALA 2B5MA 4J82A 5HE3B 3IJ1A 2H9MA 3CIKB 3EMHA 4PNKB 4GGAA 3MKSB 1U4CA 3UVLA 4J79A 2IWFA 2AGXA 2IUPA 4BUJC 5C2WB 1TYQC 5EMMB 3PSLA 2HJBA 5JWZA 3OKYB 4LG8A 3HFQA 3RN0D 1NEXB 1GXRA 4ERZA 3OTTA 2HXCA 1K8KC 4CI2A 1L0QA 4O9DA 3AL9A 3K26A 2AQ5A 3IIWA 1PI6A 3BG1A 4FA1D 4FAND 1YFQA 4FA5D 4ZOXA 3UVKA 5EM2A 5EMJB 4KFMB 5FLXg 2GC7A 3V9FA 3PXTD 4CI3A 5K19A 3AH8B 3EI3A 4FWWA 3F3FA 4XEIC 2AGYA 4FAVD 3ORVD 4PSXB 1MDAH 4OWRA 5THAA 3J81g 2H9PA 2O9KA 4GGCA 5IT9g 3C99A 2YMUA 3RFGA 5A2Qg 3SVWD 3OKYA 2CN2A 3UKUC 3BWSA 3IKOA 3KRWB 2YNPA 2CNXA 3RLMD 3CFSB 2H9NA 5HE0B 4CY3A 3IIYA 1QNIA 3L4OD 4A7JA 3UVMA 5EARA 4GMBA 2CE8A 3EI4A 3SMRA 4CY1A 3DXMC 2GC4A 5HQGA 4J84A 4A2MA 1B9YA 4CY2A 4L1QD 2CO0A 1FWXA 1PGUA 3EI4B 4ES0A 2HESX 5I5JA 5C9ZB 3F3GA 3FGBA 5HE1B 4X60B 1N6EA 3SCYA 3RN1D 3NVNA 4BH6A 4CZYA 4HDJA 2AH0A 4A0BA 2XYIA 2OVQB 4J87A 3ZWLB 4JSXC 4AEZA 1B9XA 2HYEA 4H5JA 4A08B 3I7KA 2YNOA 5TDHB 3C5MA
chains in the Genus database with same CATH superfamily
4QL1A 5E6RA 4Z7QA 3AL8B 5KDOB 3NVXA 4NSXA 3FCSA 1R5MA 3NIFA 1MG3A 3K27A 3UR4A 4LG9A 4I79A 5E6SA 1O6FA 3PXSD 3GREA 3U4YA 3SXTD 2EIEA 4A0BB 4K3ID 2VDNA 3K6SA 3OF7A 1N6FA 2H6QA 2J55H 3DSMA 4D6VA 1GOGA 1UTCA 3V5WB 3FM0A 5FKRA 5TEFA 4G1EA 4NENA 2Q7QA 1JJUB 3I2NA 4JHNA 5CXBA 1JMZB 1GOHA 3DM0A 5IJ7E 3EG6A 2Z2OA 1PEVA 3IJEA 3ZDZA 3JZHA 3IURA 4NAAA 2P9PC 3P4FA 4Z8LA 3SWSD 4X61B 5C2VB 3VH0A 3IVMA 5FA5B 2AGLA 2H9LA 4L1MA 5IJ8E 4A08A 5FKSA 3OW8A 2OVPB 4LGNA 2B4EA 3E0CA 2H47A 3SBQA 5H14A 5H1MA 4N14A 4OZUA 3SJLD 5B4WA 2B5LA 3KCIA 2BBKH 2I0RA 3SLED 4PXWA 4O3TB 5SXMA 1L5GA 4JSVC 3EU7A 4RE5A 1T2XA 4GM9A 3I8EA 3O4HA 2J57G 3JAMg 3MVDK 3JZNA 3AL8A 3IJCA 2XL3A 4A11B 4J8BA 2AGZA 1SQ9A 3A0FA 4AX4A 2OIZA 4GM8A 4ERYA 4H5IA 2IAAA 4GM3A 4U7AA 2OVRB 3PVWB 3O4JA 3RMZD 4BCCA 1P22A 5CYKA 5C86A 5EMLB 3K71A 2CN3A 4JHPC 1JMXB 2OK4A 1XIPA 3MKQA 3OKWA 2VDMA 3IUMA 1N6DA 1H2XA 4XYIA 3PVUB 4Z7NA 2VDOA 3MXXA 2PM9B 4FHLA 1MG2A 2JKXA 2VDPA 4QT8A 3C9CA 2H68A 3NIGA 3K72A 4A11A 1UOQA 4DNWA 3JRPA 2QXVA 4A2LA 5EAMA 4GQ2P 2H6KA 1H2WA 5M5SA 2I0SA 3IJ0A 3RRMC 4ZN4A 3VI3A 3OL2A 1TYEA 4WK2A 5EMKB 1H2ZA 2GNQA 4GGDA 2H13A 4CZVA 5EM2B 1K3IA 3IUQA 2G99A 5TEEA 1JOFA 5FXYA 2P9SC 5CXCA 1GOFA 4IA9A 4IMMA 2HU7A 5IGOA 4ESGA 3EI3B 4PBZA 1VE6A 2IURA 3N0EA 5FQDA 1S4UX 5EAPA 3L4MD 2OK6A 3I7PA 4MMZA 4JD2C 4AOWA 2VDLA 4G55A 4O3UB 3NVQA 3B7FA 2B5NA 3V7DB 2OJYA 1PBYB 3F3PA 2XDWA 4J77A 3ZDYA 3SBPA 4BCBA 3OL2B 3IULA 3I89A 5IGQA 1A12A 2VZ1A 4PBYA 4UI9R 3ZE0A 3I7LA 2AGWA 1SQJA 1QFMA 4XYHA 2QC5A 2P9UC 1BPOA 2UZYB 3IUJA 3O4IA 4J0XA 4JT6C 3AFCA 3RSEC 3SBRA 4G56B 3KRXB 4JSNC 3I7HA 1GG2B 5M61A 3PSCB 1K32A 3C75H 1UOOA 4GQ1A 4JXMA 1JV2A 3FRXA 5GXIA 1O6GA 2CO0C 3ODTA 1XHMA 4DNUA 3CFVA 2HKMA 4AMYA 3SFZA 4A09B 1E8NA 3UVOA 3SN6B 5AMSA 3MZLA 3V4PA 4BCDA 4TZ4A 3V4VA 2TRCB 4JSPC 2P9IC 3JB9L 1C9IA 3BG0A 5FKTA 1OLZA 3I8CA 4J0WA 2VDKA 5M5UA 1XKSA 2YNNA 3DXKC 5CXCB 4A0AB 2HU8A 4U1EI 2G9AA 2EIBA 3J80g 2EICA 4J78A 4QAMA 3ZE2A 4JT5C 2HJ4A 4J86A 4X3EA 4D0KA 3UVNA 4E54A 3O4GA 5GXHA 3EI1B 5H17A 2YBAA 2P9LC 3GFCA 4UM8A 4L3HD 3MZKA 4NBMA 1E5TA 5IC7A 5GSAA 4J8GA 3VGZA 5AJAA 1Q47A 1VZ2A 4EWRA 2Z2PA 4MK0B 5HDBA 1ERJA 4AMZA 2HKRA 4YVDA 4L9OA 4MMXA 2IUVA 4A09A 4A0AA 1U2VC 5HYNB 2YB8B 3JROA 2PBIB 5CXBB 1VE7A 1A0RB 4AN1A 3W15A 5C92A 2H3XA 5K1CC 4ERQA 5I5IA 2PM7B 2W18A 2VC2A 1NR0A 3QI0A 2Z2NA 4Y7RA 4GZ8A 4O1QD 4BL0A 3MUOA 4R7AB 1TBGA 4CY5A 1GOTB 2H14A 4K3JB 2AH1A 5FKQA 3VI4A 2XL2A 1U8CA 2BCJB 5CYKB 5TF2A 2H6NA 2UZXB 3VA6A 4J73A 2BKLA 3MMYA 5GMKn 2I3SA 2QR5A 3UKRC 4PSWB 2IWKA 2P9NC 4J81A 4Y5RD 2PM6B 3DDUA 4L3GD 4QRJA 2PM9A 1RI6A 2P9KC 4E5ZB 4CI8A 3I7NA 4BP8A 4X63B 3ULEC 4AN0A 3JPXA 2MTAH 3OKTA 3PXWD 1GP2B 1SHYB 3N0DA 2J56H 4ZOYA 4CZXA 3I7OA 4E54B 4ZOZA 1M1XA 4O45A 1OMWB 3EI1A 4PC0A 3JZGA 4CC9A 3SHFA 3PE7A 3MUNA 2I3TA 4ZOVA 3EI2B 4FB1D 4GQBB 2I0TA 3RFHA 3EWEA 4CI1A 4E5ZA 5HE2B 5AFU3 4IRZA 3DWLC 1VYHC 4QQEA 3EI2A 4FA4D 2EBSA 2XU7A 2IUQA 2CE9A 1C9LA 4UM9A 5I5MA 4FA9D 2VDQA 5EALA 2B5MA 4J82A 5HE3B 3IJ1A 2H9MA 3CIKB 3EMHA 4PNKB 4GGAA 3MKSB 1U4CA 3QHYB 3UVLA 4J79A 2IWFA 1UOPA 2AGXA 2IUPA 4BUJC 5C2WB 1TYQC 4BP9A 1QFSA 5EMMB 3PSLA 2HJBA 5JWZA 3ZDXA 3OKYB 4LG8A 3HFQA 3RN0D 1NEXB 1GXRA 4G1MA 3OTTA 4ERZA 2HXCA 1K8KC 3IUNA 4CI2A 3ZE1A 2VZ3A 1L0QA 4O9DA 1H2YA 3AL9A 3T3PA 3K26A 4WJKA 2AQ5A 3IIWA 1PI6A 1E8MA 3BG1A 4FA1D 2HU5A 4FAND 1YFQA 4FA5D 4Z7OA 4ZOXA 3UVKA 5EM2A 5EMJB 4KFMB 5FLXg 2VDRA 2GC7A 4NC4A 3EQ7A 5M5RA 3NIDA 3V9FA 3PXTD 4CI3A 5K19A 3AH8B 3EI3A 4FWWA 5FFOA 3F3FA 5FFGA 2EIDA 4XEIC 2AGYA 4FAVD 3ORVD 4PSXB 1MDAH 4OWRA 4WK0A 5THAA 3J81g 2H9PA 2O9KA 4GGCA 5E6UA 1I2MB 5IT9g 3C99A 2YMUA 3RFGA 5A2Qg 3SVWD 3OKYA 2CN2A 3UKUC 3FCUA 4DNVA 3BWSA 3EQ8A 3IKOA 3KRWB 2YNPA 4RE6A 2CNXA 3GD1I 3RLMD 3CFSB 2H9NA 5HE0B 1YR2A 4CY3A 3IIYA 1QNIA 3L4OD 4A7JA 4O02A 3UVMA 5M5TA 5EARA 4GMBA 4O2WA 2CE8A 3EI4A 3SMRA 4CY1A 3DXMC 2WQ8A 2GC4A 5HQGA 4J84A 4A2MA 1B9YA 4CY2A 4L1QD 2CO0A 2QZPA 1FWXA 1PGUA 2XE4A 2XZGA 3EI4B 4D9SA 4ES0A 5M5VA 2HESX 5I5JA 5C9ZB 3F3GA 3FGBA 3T3MA 5HE1B 4X60B 1N6EA 3SCYA 3RN1D 3NVNA 4BH6A 4CZYA 1JTDB 4HDJA 3GC3B 2AH0A 4A0BA 2XYIA 1VZ3A 4WK4A 2OVQB 4J87A 3ZWLB 4JSXC 3EQ9A 4AEZA 1B9XA 2HYEA 4MMYA 4H5JA 4A08B 3I7KA 2YNOA 5TDHB 3C5MA
chains in the Genus database with same CATH topology
4QL1A 5KDOB 3AL8B 3NVXA 4NSXA 1R5MA 1MG3A 3K27A 3UR4A 4LG9A 4I79A 3PXSD 3GREA 3U4YA 3SXTD 4A0BB 4K3ID 1N6FA 2H6QA 2J55H 3DSMA 4D6VA 3V5WB 3FM0A 5FKRA 5TEFA 2Q7QA 1JJUB 3I2NA 5CXBA 1JMZB 3DM0A 5IJ7E 3EG6A 2Z2OA 1PEVA 3JZHA 2P9PC 3P4FA 4Z8LA 3SWSD 4X61B 5C2VB 3VH0A 5FA5B 2AGLA 2H9LA 5IJ8E 4A08A 5FKSA 3OW8A 2OVPB 4LGNA 2B4EA 3E0CA 2H47A 3SBQA 5H14A 5H1MA 4N14A 4OZUA 3SJLD 5B4WA 2B5LA 2BBKH 2I0RA 3SLED 4PXWA 4O3TB 5SXMA 4JSVC 3EU7A 4GM9A 3I8EA 2J57G 3JAMg 3JZNA 3AL8A 3IJCA 2XL3A 4A11B 4J8BA 2AGZA 1SQ9A 3A0FA 2OIZA 4GM8A 4ERYA 4H5IA 2IAAA 4GM3A 4U7AA 2OVRB 3PVWB 3RMZD 1P22A 5CYKA 5EMLB 2CN3A 1JMXB 2OK4A 1XIPA 3MKQA 3OKWA 1N6DA 4XYIA 3PVUB 4FHLA 3MXXA 2PM9B 1MG2A 4QT8A 4A11A 3C9CA 2H68A 3JRPA 2QXVA 4A2LA 5EAMA 4GQ2P 2H6KA 2I0SA 3IJ0A 3RRMC 4ZN4A 3OL2A 5EMKB 2GNQA 4GGDA 2H13A 4CZVA 5EM2B 2G99A 5TEEA 1JOFA 5FXYA 2P9SC 5CXCA 4IA9A 4IMMA 5IGOA 4ESGA 3EI3B 4PBZA 2IURA 3N0EA 5FQDA 1S4UX 5EAPA 3L4MD 2OK6A 3I7PA 4JD2C 4AOWA 4O3UB 3NVQA 3B7FA 2B5NA 3V7DB 2OJYA 1PBYB 3F3PA 4J77A 3SBPA 3OL2B 3I89A 5IGQA 4PBYA 4UI9R 3I7LA 2AGWA 1SQJA 4XYHA 2QC5A 2P9UC 2UZYB 4J0XA 4JT6C 3RSEC 3SBRA 3AFCA 4G56B 3KRXB 4JSNC 3I7HA 1GG2B 3PSCB 1K32A 3C75H 4GQ1A 4JXMA 3FRXA 5GXIA 2CO0C 3ODTA 1XHMA 3CFVA 2HKMA 4A09B 3SFZA 3UVOA 3SN6B 5AMSA 3MZLA 4TZ4A 4JSPC 2TRCB 2P9IC 3JB9L 3BG0A 5FKTA 1OLZA 3I8CA 4J0WA 1XKSA 2YNNA 3DXKC 5CXCB 4A0AB 4U1EI 2G9AA 3J80g 4J78A 4JT5C 2HJ4A 4J86A 4X3EA 4D0KA 3UVNA 4E54A 5GXHA 3EI1B 5H17A 2YBAA 2P9LC 3GFCA 4L3HD 3MZKA 5IC7A 5GSAA 4J8GA 3VGZA 5AJAA 1Q47A 4EWRA 2Z2PA 4MK0B 1ERJA 2HKRA 4YVDA 4L9OA 4A09A 2IUVA 4A0AA 1U2VC 5HYNB 2YB8B 3JROA 2PBIB 5CXBB 1A0RB 3W15A 2H3XA 5K1CC 4ERQA 5I5IA 2PM7B 2W18A 1NR0A 2Z2NA 4Y7RA 4GZ8A 4O1QD 4BL0A 4R7AB 1TBGA 4CY5A 1GOTB 2H14A 4K3JB 2AH1A 5FKQA 2XL2A 2BCJB 5CYKB 5TF2A 2H6NA 2UZXB 3VA6A 4J73A 3MMYA 5GMKn 2I3SA 3UKRC 4PSWB 2IWKA 2P9NC 4J81A 4Y5RD 2PM6B 4L3GD 4QRJA 2PM9A 1RI6A 2P9KC 4E5ZB 4CI8A 3I7NA 4X63B 3ULEC 3JPXA 2MTAH 3OKTA 3PXWD 1GP2B 1SHYB 3N0DA 2J56H 4ZOYA 4CZXA 3I7OA 4E54B 4ZOZA 4O45A 1OMWB 3EI1A 4PC0A 3JZGA 4CC9A 3SHFA 3PE7A 2I3TA 4ZOVA 3EI2B 4FB1D 4GQBB 2I0TA 3RFHA 3EWEA 4CI1A 4E5ZA 5HE2B 5AFU3 3DWLC 1VYHC 4QQEA 3EI2A 4FA4D 2EBSA 2XU7A 2IUQA 2CE9A 5I5MA 4FA9D 5EALA 2B5MA 4J82A 5HE3B 3IJ1A 2H9MA 3CIKB 3EMHA 4PNKB 4GGAA 3MKSB 1U4CA 3UVLA 4J79A 2IWFA 2AGXA 2IUPA 4BUJC 5C2WB 1TYQC 5EMMB 3PSLA 2HJBA 5JWZA 3OKYB 4LG8A 3HFQA 3RN0D 1NEXB 1GXRA 4ERZA 3OTTA 2HXCA 1K8KC 4CI2A 1L0QA 4O9DA 3AL9A 3K26A 2AQ5A 3IIWA 1PI6A 3BG1A 4FA1D 4FAND 1YFQA 4FA5D 4ZOXA 3UVKA 5EM2A 5EMJB 4KFMB 5FLXg 2GC7A 3V9FA 3PXTD 4CI3A 5K19A 3AH8B 3EI3A 4FWWA 3F3FA 4XEIC 2AGYA 4FAVD 3ORVD 4PSXB 1MDAH 4OWRA 5THAA 3J81g 2H9PA 2O9KA 4GGCA 5IT9g 3C99A 2YMUA 3RFGA 5A2Qg 3SVWD 3OKYA 2CN2A 3UKUC 3BWSA 3IKOA 3KRWB 2YNPA 2CNXA 3RLMD 3CFSB 2H9NA 5HE0B 4CY3A 3IIYA 1QNIA 3L4OD 4A7JA 3UVMA 5EARA 4GMBA 2CE8A 3EI4A 3SMRA 4CY1A 3DXMC 2GC4A 5HQGA 4J84A 4A2MA 1B9YA 4CY2A 4L1QD 2CO0A 1FWXA 1PGUA 3EI4B 4ES0A 2HESX 5I5JA 5C9ZB 3F3GA 3FGBA 5HE1B 4X60B 1N6EA 3SCYA 3RN1D 3NVNA 4BH6A 4CZYA 4HDJA 2AH0A 4A0BA 2XYIA 2OVQB 4J87A 3ZWLB 4JSXC 4AEZA 1B9XA 2HYEA 4H5JA 4A08B 3I7KA 2YNOA 5TDHB 3C5MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QL1 A;  5KDO B;  3AL8 B;  3NVX A;  4NSX A;  1R5M A;  1MG3 A;  3K27 A;  3UR4 A;  4LG9 A;  4I79 A;  3PXS D;  3GRE A;  3U4Y A;  3SXT D;  4A0B B;  4K3I D;  1N6F A;  2H6Q A;  2J55 H;  3DSM A;  4D6V A;  3V5W B;  3FM0 A;  5FKR A;  5TEF A;  2Q7Q A;  1JJU B;  3I2N A;  5CXB A;  1JMZ B;  3DM0 A;  5IJ7 E;  3EG6 A;  2Z2O A;  1PEV A;  3JZH A;  2P9P C;  3P4F A;  4Z8L A;  3SWS D;  4X61 B;  5C2V B;  3VH0 A;  5FA5 B;  2AGL A;  2H9L A;  5IJ8 E;  4A08 A;  5FKS A;  3OW8 A;  2OVP B;  4LGN A;  2B4E A;  3E0C A;  2H47 A;  3SBQ A;  5H14 A;  5H1M A;  4N14 A;  4OZU A;  3SJL D;  5B4W A;  2B5L A;  2BBK H;  2I0R A;  3SLE D;  4PXW A;  4O3T B;  5SXM A;  4JSV C;  3EU7 A;  4GM9 A;  3I8E A;  2J57 G;  3JAM g;  3JZN A;  3AL8 A;  3IJC A;  2XL3 A;  4A11 B;  4J8B A;  2AGZ A;  1SQ9 A;  3A0F A;  2OIZ A;  4GM8 A;  4ERY A;  4H5I A;  2IAA A;  4GM3 A;  4U7A A;  2OVR B;  3PVW B;  3RMZ D;  1P22 A;  5CYK A;  5EML B;  2CN3 A;  1JMX B;  2OK4 A;  1XIP A;  3MKQ A;  3OKW A;  1N6D A;  4XYI A;  3PVU B;  4FHL A;  3MXX A;  2PM9 B;  1MG2 A;  4QT8 A;  4A11 A;  3C9C A;  2H68 A;  3JRP A;  2QXV A;  4A2L A;  5EAM A;  4GQ2 P;  2H6K A;  2I0S A;  3IJ0 A;  3RRM C;  4ZN4 A;  3OL2 A;  5EMK B;  2GNQ A;  4GGD A;  2H13 A;  4CZV A;  5EM2 B;  2G99 A;  5TEE A;  1JOF A;  5FXY A;  2P9S C;  5CXC A;  4IA9 A;  4IMM A;  5IGO A;  4ESG A;  3EI3 B;  4PBZ A;  2IUR A;  3N0E A;  5FQD A;  1S4U X;  5EAP A;  3L4M D;  2OK6 A;  3I7P A;  4JD2 C;  4AOW A;  4O3U B;  3NVQ A;  3B7F A;  2B5N A;  3V7D B;  2OJY A;  1PBY B;  3F3P A;  4J77 A;  3SBP A;  3OL2 B;  3I89 A;  5IGQ A;  4PBY A;  4UI9 R;  3I7L A;  2AGW A;  1SQJ A;  4XYH A;  2QC5 A;  2P9U C;  2UZY B;  4J0X A;  4JT6 C;  3RSE C;  3SBR A;  3AFC A;  4G56 B;  3KRX B;  4JSN C;  3I7H A;  1GG2 B;  3PSC B;  1K32 A;  3C75 H;  4GQ1 A;  4JXM A;  3FRX A;  5GXI A;  2CO0 C;  3ODT A;  1XHM A;  3CFV A;  2HKM A;  4A09 B;  3SFZ A;  3UVO A;  3SN6 B;  5AMS A;  3MZL A;  4TZ4 A;  4JSP C;  2TRC B;  2P9I C;  3JB9 L;  3BG0 A;  5FKT A;  1OLZ A;  3I8C A;  4J0W A;  1XKS A;  2YNN A;  3DXK C;  5CXC B;  4A0A B;  4U1E I;  2G9A A;  3J80 g;  4J78 A;  4JT5 C;  2HJ4 A;  4J86 A;  4X3E A;  4D0K A;  3UVN A;  4E54 A;  5GXH A;  3EI1 B;  5H17 A;  2YBA A;  2P9L C;  3GFC A;  4L3H D;  3MZK A;  5IC7 A;  5GSA A;  4J8G A;  3VGZ A;  5AJA A;  1Q47 A;  4EWR A;  2Z2P A;  4MK0 B;  1ERJ A;  2HKR A;  4YVD A;  4L9O A;  4A09 A;  2IUV A;  4A0A A;  1U2V C;  5HYN B;  2YB8 B;  3JRO A;  2PBI B;  5CXB B;  1A0R B;  3W15 A;  2H3X A;  5K1C C;  4ERQ A;  5I5I A;  2PM7 B;  2W18 A;  1NR0 A;  2Z2N A;  4Y7R A;  4GZ8 A;  4O1Q D;  4BL0 A;  4R7A B;  1TBG A;  4CY5 A;  1GOT B;  2H14 A;  4K3J B;  2AH1 A;  5FKQ A;  2XL2 A;  2BCJ B;  5CYK B;  5TF2 A;  2H6N A;  2UZX B;  3VA6 A;  4J73 A;  3MMY A;  5GMK n;  2I3S A;  3UKR C;  4PSW B;  2IWK A;  2P9N C;  4J81 A;  4Y5R D;  2PM6 B;  4L3G D;  4QRJ A;  2PM9 A;  1RI6 A;  2P9K C;  4E5Z B;  4CI8 A;  3I7N A;  4X63 B;  3ULE C;  3JPX A;  2MTA H;  3OKT A;  3PXW D;  1GP2 B;  1SHY B;  3N0D A;  2J56 H;  4ZOY A;  4CZX A;  3I7O A;  4E54 B;  4ZOZ A;  4O45 A;  1OMW B;  3EI1 A;  4PC0 A;  3JZG A;  4CC9 A;  3SHF A;  3PE7 A;  2I3T A;  4ZOV A;  3EI2 B;  4FB1 D;  4GQB B;  2I0T A;  3RFH A;  3EWE A;  4CI1 A;  4E5Z A;  5HE2 B;  5AFU 3;  3DWL C;  1VYH C;  4QQE A;  3EI2 A;  4FA4 D;  2EBS A;  2XU7 A;  2IUQ A;  2CE9 A;  5I5M A;  4FA9 D;  5EAL A;  2B5M A;  4J82 A;  5HE3 B;  3IJ1 A;  2H9M A;  3CIK B;  3EMH A;  4PNK B;  4GGA A;  3MKS B;  1U4C A;  3UVL A;  4J79 A;  2IWF A;  2AGX A;  2IUP A;  4BUJ C;  5C2W B;  1TYQ C;  5EMM B;  3PSL A;  2HJB A;  5JWZ A;  3OKY B;  4LG8 A;  3HFQ A;  3RN0 D;  1NEX B;  1GXR A;  4ERZ A;  3OTT A;  2HXC A;  1K8K C;  4CI2 A;  1L0Q A;  4O9D A;  3AL9 A;  3K26 A;  2AQ5 A;  3IIW A;  1PI6 A;  3BG1 A;  4FA1 D;  4FAN D;  1YFQ A;  4FA5 D;  4ZOX A;  3UVK A;  5EM2 A;  5EMJ B;  4KFM B;  5FLX g;  2GC7 A;  3V9F A;  3PXT D;  4CI3 A;  5K19 A;  3AH8 B;  3EI3 A;  4FWW A;  3F3F A;  4XEI C;  2AGY A;  4FAV D;  3ORV D;  4PSX B;  1MDA H;  4OWR A;  5THA A;  3J81 g;  2H9P A;  2O9K A;  4GGC A;  5IT9 g;  3C99 A;  2YMU A;  3RFG A;  5A2Q g;  3SVW D;  3OKY A;  2CN2 A;  3UKU C;  3BWS A;  3IKO A;  3KRW B;  2YNP A;  2CNX A;  3RLM D;  3CFS B;  2H9N A;  5HE0 B;  4CY3 A;  3IIY A;  1QNI A;  3L4O D;  4A7J A;  3UVM A;  5EAR A;  4GMB A;  2CE8 A;  3EI4 A;  3SMR A;  4CY1 A;  3DXM C;  2GC4 A;  5HQG A;  4J84 A;  4A2M A;  1B9Y A;  4CY2 A;  4L1Q D;  2CO0 A;  1FWX A;  1PGU A;  3EI4 B;  4ES0 A;  2HES X;  5I5J A;  5C9Z B;  3F3G A;  3FGB A;  5HE1 B;  4X60 B;  1N6E A;  3SCY A;  3RN1 D;  3NVN A;  4BH6 A;  4CZY A;  4HDJ A;  2AH0 A;  4A0B A;  2XYI A;  2OVQ B;  4J87 A;  3ZWL B;  4JSX C;  4AEZ A;  1B9X A;  2HYE A;  4H5J A;  4A08 B;  3I7K A;  2YNO A;  5TDH B;  3C5M A; 
#chains in the Genus database with same CATH topology
 4QL1 A;  5E6R A;  4Z7Q A;  3AL8 B;  5KDO B;  3NVX A;  4NSX A;  3FCS A;  1R5M A;  3NIF A;  1MG3 A;  3K27 A;  3UR4 A;  4LG9 A;  4I79 A;  5E6S A;  1O6F A;  3PXS D;  3GRE A;  3U4Y A;  3SXT D;  2EIE A;  4A0B B;  4K3I D;  2VDN A;  3K6S A;  3OF7 A;  1N6F A;  2H6Q A;  2J55 H;  3DSM A;  4D6V A;  1GOG A;  1UTC A;  3V5W B;  3FM0 A;  5FKR A;  5TEF A;  4G1E A;  4NEN A;  2Q7Q A;  1JJU B;  3I2N A;  4JHN A;  5CXB A;  1JMZ B;  1GOH A;  3DM0 A;  5IJ7 E;  3EG6 A;  2Z2O A;  1PEV A;  3IJE A;  3ZDZ A;  3JZH A;  3IUR A;  4NAA A;  2P9P C;  3P4F A;  4Z8L A;  3SWS D;  4X61 B;  5C2V B;  3VH0 A;  3IVM A;  5FA5 B;  2AGL A;  2H9L A;  4L1M A;  5IJ8 E;  4A08 A;  5FKS A;  3OW8 A;  2OVP B;  4LGN A;  2B4E A;  3E0C A;  2H47 A;  3SBQ A;  5H14 A;  5H1M A;  4N14 A;  4OZU A;  3SJL D;  5B4W A;  2B5L A;  3KCI A;  2BBK H;  2I0R A;  3SLE D;  4PXW A;  4O3T B;  5SXM A;  1L5G A;  4JSV C;  3EU7 A;  4RE5 A;  1T2X A;  4GM9 A;  3I8E A;  3O4H A;  2J57 G;  3JAM g;  3MVD K;  3JZN A;  3AL8 A;  3IJC A;  2XL3 A;  4A11 B;  4J8B A;  2AGZ A;  1SQ9 A;  3A0F A;  4AX4 A;  2OIZ A;  4GM8 A;  4ERY A;  4H5I A;  2IAA A;  4GM3 A;  4U7A A;  2OVR B;  3PVW B;  3O4J A;  3RMZ D;  4BCC A;  1P22 A;  5CYK A;  5C86 A;  5EML B;  3K71 A;  2CN3 A;  4JHP C;  1JMX B;  2OK4 A;  1XIP A;  3MKQ A;  3OKW A;  2VDM A;  3IUM A;  1N6D A;  1H2X A;  4XYI A;  3PVU B;  4Z7N A;  2VDO A;  3MXX A;  2PM9 B;  4FHL A;  1MG2 A;  2JKX A;  2VDP A;  4QT8 A;  3C9C A;  2H68 A;  3NIG A;  3K72 A;  4A11 A;  1UOQ A;  4DNW A;  3JRP A;  2QXV A;  4A2L A;  5EAM A;  4GQ2 P;  2H6K A;  1H2W A;  5M5S A;  2I0S A;  3IJ0 A;  3RRM C;  4ZN4 A;  3VI3 A;  3OL2 A;  1TYE A;  4WK2 A;  5EMK B;  1H2Z A;  2GNQ A;  4GGD A;  2H13 A;  4CZV A;  5EM2 B;  1K3I A;  3IUQ A;  2G99 A;  5TEE A;  1JOF A;  5FXY A;  2P9S C;  5CXC A;  1GOF A;  4IA9 A;  4IMM A;  2HU7 A;  5IGO A;  4ESG A;  3EI3 B;  4PBZ A;  1VE6 A;  2IUR A;  3N0E A;  5FQD A;  1S4U X;  5EAP A;  3L4M D;  2OK6 A;  3I7P A;  4MMZ A;  4JD2 C;  4AOW A;  2VDL A;  4G55 A;  4O3U B;  3NVQ A;  3B7F A;  2B5N A;  3V7D B;  2OJY A;  1PBY B;  3F3P A;  2XDW A;  4J77 A;  3ZDY A;  3SBP A;  4BCB A;  3OL2 B;  3IUL A;  3I89 A;  5IGQ A;  1A12 A;  2VZ1 A;  4PBY A;  4UI9 R;  3ZE0 A;  3I7L A;  2AGW A;  1SQJ A;  1QFM A;  4XYH A;  2QC5 A;  2P9U C;  1BPO A;  2UZY B;  3IUJ A;  3O4I A;  4J0X A;  4JT6 C;  3AFC A;  3RSE C;  3SBR A;  4G56 B;  3KRX B;  4JSN C;  3I7H A;  1GG2 B;  5M61 A;  3PSC B;  1K32 A;  3C75 H;  1UOO A;  4GQ1 A;  4JXM A;  1JV2 A;  3FRX A;  5GXI A;  1O6G A;  2CO0 C;  3ODT A;  1XHM A;  4DNU A;  3CFV A;  2HKM A;  4AMY A;  3SFZ A;  4A09 B;  1E8N A;  3UVO A;  3SN6 B;  5AMS A;  3MZL A;  3V4P A;  4BCD A;  4TZ4 A;  3V4V A;  2TRC B;  4JSP C;  2P9I C;  3JB9 L;  1C9I A;  3BG0 A;  5FKT A;  1OLZ A;  3I8C A;  4J0W A;  2VDK A;  5M5U A;  1XKS A;  2YNN A;  3DXK C;  5CXC B;  4A0A B;  2HU8 A;  4U1E I;  2G9A A;  2EIB A;  3J80 g;  2EIC A;  4J78 A;  4QAM A;  3ZE2 A;  4JT5 C;  2HJ4 A;  4J86 A;  4X3E A;  4D0K A;  3UVN A;  4E54 A;  3O4G A;  5GXH A;  3EI1 B;  5H17 A;  2YBA A;  2P9L C;  3GFC A;  4UM8 A;  4L3H D;  3MZK A;  4NBM A;  1E5T A;  5IC7 A;  5GSA A;  4J8G A;  3VGZ A;  5AJA A;  1Q47 A;  1VZ2 A;  4EWR A;  2Z2P A;  4MK0 B;  5HDB A;  1ERJ A;  4AMZ A;  2HKR A;  4YVD A;  4L9O A;  4MMX A;  2IUV A;  4A09 A;  4A0A A;  1U2V C;  5HYN B;  2YB8 B;  3JRO A;  2PBI B;  5CXB B;  1VE7 A;  1A0R B;  4AN1 A;  3W15 A;  5C92 A;  2H3X A;  5K1C C;  4ERQ A;  5I5I A;  2PM7 B;  2W18 A;  2VC2 A;  1NR0 A;  3QI0 A;  2Z2N A;  4Y7R A;  4GZ8 A;  4O1Q D;  4BL0 A;  3MUO A;  4R7A B;  1TBG A;  4CY5 A;  1GOT B;  2H14 A;  4K3J B;  2AH1 A;  5FKQ A;  3VI4 A;  2XL2 A;  1U8C A;  2BCJ B;  5CYK B;  5TF2 A;  2H6N A;  2UZX B;  3VA6 A;  4J73 A;  2BKL A;  3MMY A;  5GMK n;  2I3S A;  2QR5 A;  3UKR C;  4PSW B;  2IWK A;  2P9N C;  4J81 A;  4Y5R D;  2PM6 B;  3DDU A;  4L3G D;  4QRJ A;  2PM9 A;  1RI6 A;  2P9K C;  4E5Z B;  4CI8 A;  3I7N A;  4BP8 A;  4X63 B;  3ULE C;  4AN0 A;  3JPX A;  2MTA H;  3OKT A;  3PXW D;  1GP2 B;  1SHY B;  3N0D A;  2J56 H;  4ZOY A;  4CZX A;  3I7O A;  4E54 B;  4ZOZ A;  1M1X A;  4O45 A;  1OMW B;  3EI1 A;  4PC0 A;  3JZG A;  4CC9 A;  3SHF A;  3PE7 A;  3MUN A;  2I3T A;  4ZOV A;  3EI2 B;  4FB1 D;  4GQB B;  2I0T A;  3RFH A;  3EWE A;  4CI1 A;  4E5Z A;  5HE2 B;  5AFU 3;  4IRZ A;  3DWL C;  1VYH C;  4QQE A;  3EI2 A;  4FA4 D;  2EBS A;  2XU7 A;  2IUQ A;  2CE9 A;  1C9L A;  4UM9 A;  5I5M A;  4FA9 D;  2VDQ A;  5EAL A;  2B5M A;  4J82 A;  5HE3 B;  3IJ1 A;  2H9M A;  3CIK B;  3EMH A;  4PNK B;  4GGA A;  3MKS B;  1U4C A;  3QHY B;  3UVL A;  4J79 A;  2IWF A;  1UOP A;  2AGX A;  2IUP A;  4BUJ C;  5C2W B;  1TYQ C;  4BP9 A;  1QFS A;  5EMM B;  3PSL A;  2HJB A;  5JWZ A;  3ZDX A;  3OKY B;  4LG8 A;  3HFQ A;  3RN0 D;  1NEX B;  1GXR A;  4G1M A;  3OTT A;  4ERZ A;  2HXC A;  1K8K C;  3IUN A;  4CI2 A;  3ZE1 A;  2VZ3 A;  1L0Q A;  4O9D A;  1H2Y A;  3AL9 A;  3T3P A;  3K26 A;  4WJK A;  2AQ5 A;  3IIW A;  1PI6 A;  1E8M A;  3BG1 A;  4FA1 D;  2HU5 A;  4FAN D;  1YFQ A;  4FA5 D;  4Z7O A;  4ZOX A;  3UVK A;  5EM2 A;  5EMJ B;  4KFM B;  5FLX g;  2VDR A;  2GC7 A;  4NC4 A;  3EQ7 A;  5M5R A;  3NID A;  3V9F A;  3PXT D;  4CI3 A;  5K19 A;  3AH8 B;  3EI3 A;  4FWW A;  5FFO A;  3F3F A;  5FFG A;  2EID A;  4XEI C;  2AGY A;  4FAV D;  3ORV D;  4PSX B;  1MDA H;  4OWR A;  4WK0 A;  5THA A;  3J81 g;  2H9P A;  2O9K A;  4GGC A;  5E6U A;  1I2M B;  5IT9 g;  3C99 A;  2YMU A;  3RFG A;  5A2Q g;  3SVW D;  3OKY A;  2CN2 A;  3UKU C;  3FCU A;  4DNV A;  3BWS A;  3EQ8 A;  3IKO A;  3KRW B;  2YNP A;  4RE6 A;  2CNX A;  3GD1 I;  3RLM D;  3CFS B;  2H9N A;  5HE0 B;  1YR2 A;  4CY3 A;  3IIY A;  1QNI A;  3L4O D;  4A7J A;  4O02 A;  3UVM A;  5M5T A;  5EAR A;  4GMB A;  4O2W A;  2CE8 A;  3EI4 A;  3SMR A;  4CY1 A;  3DXM C;  2WQ8 A;  2GC4 A;  5HQG A;  4J84 A;  4A2M A;  1B9Y A;  4CY2 A;  4L1Q D;  2CO0 A;  2QZP A;  1FWX A;  1PGU A;  2XE4 A;  2XZG A;  3EI4 B;  4D9S A;  4ES0 A;  5M5V A;  2HES X;  5I5J A;  5C9Z B;  3F3G A;  3FGB A;  3T3M A;  5HE1 B;  4X60 B;  1N6E A;  3SCY A;  3RN1 D;  3NVN A;  4BH6 A;  4CZY A;  1JTD B;  4HDJ A;  3GC3 B;  2AH0 A;  4A0B A;  2XYI A;  1VZ3 A;  4WK4 A;  2OVQ B;  4J87 A;  3ZWL B;  4JSX C;  3EQ9 A;  4AEZ A;  1B9X A;  2HYE A;  4MMY A;  4H5J A;  4A08 B;  3I7K A;  2YNO A;  5TDH B;  3C5M A; 
#chains in the Genus database with same CATH homology
 4QL1 A;  5KDO B;  3AL8 B;  3NVX A;  4NSX A;  1R5M A;  1MG3 A;  3K27 A;  3UR4 A;  4LG9 A;  4I79 A;  3PXS D;  3GRE A;  3U4Y A;  3SXT D;  4A0B B;  4K3I D;  1N6F A;  2H6Q A;  2J55 H;  3DSM A;  4D6V A;  3V5W B;  3FM0 A;  5FKR A;  5TEF A;  2Q7Q A;  1JJU B;  3I2N A;  5CXB A;  1JMZ B;  3DM0 A;  5IJ7 E;  3EG6 A;  2Z2O A;  1PEV A;  3JZH A;  2P9P C;  3P4F A;  4Z8L A;  3SWS D;  4X61 B;  5C2V B;  3VH0 A;  5FA5 B;  2AGL A;  2H9L A;  5IJ8 E;  4A08 A;  5FKS A;  3OW8 A;  2OVP B;  4LGN A;  2B4E A;  3E0C A;  2H47 A;  3SBQ A;  5H14 A;  5H1M A;  4N14 A;  4OZU A;  3SJL D;  5B4W A;  2B5L A;  2BBK H;  2I0R A;  3SLE D;  4PXW A;  4O3T B;  5SXM A;  4JSV C;  3EU7 A;  4GM9 A;  3I8E A;  2J57 G;  3JAM g;  3JZN A;  3AL8 A;  3IJC A;  2XL3 A;  4A11 B;  4J8B A;  2AGZ A;  1SQ9 A;  3A0F A;  2OIZ A;  4GM8 A;  4ERY A;  4H5I A;  2IAA A;  4GM3 A;  4U7A A;  2OVR B;  3PVW B;  3RMZ D;  1P22 A;  5CYK A;  5EML B;  2CN3 A;  1JMX B;  2OK4 A;  1XIP A;  3MKQ A;  3OKW A;  1N6D A;  4XYI A;  3PVU B;  4FHL A;  3MXX A;  2PM9 B;  1MG2 A;  4QT8 A;  4A11 A;  3C9C A;  2H68 A;  3JRP A;  2QXV A;  4A2L A;  5EAM A;  4GQ2 P;  2H6K A;  2I0S A;  3IJ0 A;  3RRM C;  4ZN4 A;  3OL2 A;  5EMK B;  2GNQ A;  4GGD A;  2H13 A;  4CZV A;  5EM2 B;  2G99 A;  5TEE A;  1JOF A;  5FXY A;  2P9S C;  5CXC A;  4IA9 A;  4IMM A;  5IGO A;  4ESG A;  3EI3 B;  4PBZ A;  2IUR A;  3N0E A;  5FQD A;  1S4U X;  5EAP A;  3L4M D;  2OK6 A;  3I7P A;  4JD2 C;  4AOW A;  4O3U B;  3NVQ A;  3B7F A;  2B5N A;  3V7D B;  2OJY A;  1PBY B;  3F3P A;  4J77 A;  3SBP A;  3OL2 B;  3I89 A;  5IGQ A;  4PBY A;  4UI9 R;  3I7L A;  2AGW A;  1SQJ A;  4XYH A;  2QC5 A;  2P9U C;  2UZY B;  4J0X A;  4JT6 C;  3RSE C;  3SBR A;  3AFC A;  4G56 B;  3KRX B;  4JSN C;  3I7H A;  1GG2 B;  3PSC B;  1K32 A;  3C75 H;  4GQ1 A;  4JXM A;  3FRX A;  5GXI A;  2CO0 C;  3ODT A;  1XHM A;  3CFV A;  2HKM A;  4A09 B;  3SFZ A;  3UVO A;  3SN6 B;  5AMS A;  3MZL A;  4TZ4 A;  4JSP C;  2TRC B;  2P9I C;  3JB9 L;  3BG0 A;  5FKT A;  1OLZ A;  3I8C A;  4J0W A;  1XKS A;  2YNN A;  3DXK C;  5CXC B;  4A0A B;  4U1E I;  2G9A A;  3J80 g;  4J78 A;  4JT5 C;  2HJ4 A;  4J86 A;  4X3E A;  4D0K A;  3UVN A;  4E54 A;  5GXH A;  3EI1 B;  5H17 A;  2YBA A;  2P9L C;  3GFC A;  4L3H D;  3MZK A;  5IC7 A;  5GSA A;  4J8G A;  3VGZ A;  5AJA A;  1Q47 A;  4EWR A;  2Z2P A;  4MK0 B;  1ERJ A;  2HKR A;  4YVD A;  4L9O A;  4A09 A;  2IUV A;  4A0A A;  1U2V C;  5HYN B;  2YB8 B;  3JRO A;  2PBI B;  5CXB B;  1A0R B;  3W15 A;  2H3X A;  5K1C C;  4ERQ A;  5I5I A;  2PM7 B;  2W18 A;  1NR0 A;  2Z2N A;  4Y7R A;  4GZ8 A;  4O1Q D;  4BL0 A;  4R7A B;  1TBG A;  4CY5 A;  1GOT B;  2H14 A;  4K3J B;  2AH1 A;  5FKQ A;  2XL2 A;  2BCJ B;  5CYK B;  5TF2 A;  2H6N A;  2UZX B;  3VA6 A;  4J73 A;  3MMY A;  5GMK n;  2I3S A;  3UKR C;  4PSW B;  2IWK A;  2P9N C;  4J81 A;  4Y5R D;  2PM6 B;  4L3G D;  4QRJ A;  2PM9 A;  1RI6 A;  2P9K C;  4E5Z B;  4CI8 A;  3I7N A;  4X63 B;  3ULE C;  3JPX A;  2MTA H;  3OKT A;  3PXW D;  1GP2 B;  1SHY B;  3N0D A;  2J56 H;  4ZOY A;  4CZX A;  3I7O A;  4E54 B;  4ZOZ A;  4O45 A;  1OMW B;  3EI1 A;  4PC0 A;  3JZG A;  4CC9 A;  3SHF A;  3PE7 A;  2I3T A;  4ZOV A;  3EI2 B;  4FB1 D;  4GQB B;  2I0T A;  3RFH A;  3EWE A;  4CI1 A;  4E5Z A;  5HE2 B;  5AFU 3;  3DWL C;  1VYH C;  4QQE A;  3EI2 A;  4FA4 D;  2EBS A;  2XU7 A;  2IUQ A;  2CE9 A;  5I5M A;  4FA9 D;  5EAL A;  2B5M A;  4J82 A;  5HE3 B;  3IJ1 A;  2H9M A;  3CIK B;  3EMH A;  4PNK B;  4GGA A;  3MKS B;  1U4C A;  3UVL A;  4J79 A;  2IWF A;  2AGX A;  2IUP A;  4BUJ C;  5C2W B;  1TYQ C;  5EMM B;  3PSL A;  2HJB A;  5JWZ A;  3OKY B;  4LG8 A;  3HFQ A;  3RN0 D;  1NEX B;  1GXR A;  4ERZ A;  3OTT A;  2HXC A;  1K8K C;  4CI2 A;  1L0Q A;  4O9D A;  3AL9 A;  3K26 A;  2AQ5 A;  3IIW A;  1PI6 A;  3BG1 A;  4FA1 D;  4FAN D;  1YFQ A;  4FA5 D;  4ZOX A;  3UVK A;  5EM2 A;  5EMJ B;  4KFM B;  5FLX g;  2GC7 A;  3V9F A;  3PXT D;  4CI3 A;  5K19 A;  3AH8 B;  3EI3 A;  4FWW A;  3F3F A;  4XEI C;  2AGY A;  4FAV D;  3ORV D;  4PSX B;  1MDA H;  4OWR A;  5THA A;  3J81 g;  2H9P A;  2O9K A;  4GGC A;  5IT9 g;  3C99 A;  2YMU A;  3RFG A;  5A2Q g;  3SVW D;  3OKY A;  2CN2 A;  3UKU C;  3BWS A;  3IKO A;  3KRW B;  2YNP A;  2CNX A;  3RLM D;  3CFS B;  2H9N A;  5HE0 B;  4CY3 A;  3IIY A;  1QNI A;  3L4O D;  4A7J A;  3UVM A;  5EAR A;  4GMB A;  2CE8 A;  3EI4 A;  3SMR A;  4CY1 A;  3DXM C;  2GC4 A;  5HQG A;  4J84 A;  4A2M A;  1B9Y A;  4CY2 A;  4L1Q D;  2CO0 A;  1FWX A;  1PGU A;  3EI4 B;  4ES0 A;  2HES X;  5I5J A;  5C9Z B;  3F3G A;  3FGB A;  5HE1 B;  4X60 B;  1N6E A;  3SCY A;  3RN1 D;  3NVN A;  4BH6 A;  4CZY A;  4HDJ A;  2AH0 A;  4A0B A;  2XYI A;  2OVQ B;  4J87 A;  3ZWL B;  4JSX C;  4AEZ A;  1B9X A;  2HYE A;  4H5J A;  4A08 B;  3I7K A;  2YNO A;  5TDH B;  3C5M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...