2CO0C

Wdr5 and unmodified histone h3 complex at 2.25 angstrom
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
304
structure length
304
Chain Sequence
VKPNYALMFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGMCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Histone H3 Recognition and Presentation by the Wdr5 Module of the Mll1 Complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords WD-REPEAT PROTEIN 5
total genus 94
structure length 304
sequence length 304
ec nomenclature
pdb deposition date 2006-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2co0C00
2CNXA 3EU7A 4PSWB 5TDHB 4L3GD 2YNNA 4A2LA 3JZGA 2H9PA 4J8GA 2EBSA 3B7FA 5HE3B 5FKTA 2IAAA 3BG0A 4ZOXA 2P9IC 3SBRA 3I7HA 3RRMC 4CY5A 5IT9g 2XYIA 3VH0A 2O9KA 3PSCB 4OZUA 5FA5B 2B5NA 3I8CA 4O9DA 1PGUA 2CE8A 2G99A 2H13A 3UVMA 1SQJA 4U7AA 3FRXA 2J56H 5C2WB 2B5LA 2UZYB 1B9YA 2I0RA 5K19A 4ZN4A 3I2NA 3IIYA 1XHMA 4FA1D 1JMXB 2AH0A 2OIZA 5HE1B 4J87A 4CZVA 4QL1A 5CXBA 1JJUB 1GXRA 3SJLD 1QNIA 4X3EA 2YBAA 5EAPA 2GC4A 3F3PA 2XL2A 4PBZA 3IJ0A 4JSXC 1PBYB 2PM9B 5IGOA 4FAVD 5I5IA 4H5IA 3JROA 4CY2A 3CFVA 5TEFA 5TF2A 4J79A 5H17A 5CXBB 3MKQA 2P9PC 4J78A 2P9SC 4L1QD 1PEVA 5H14A 5FKQA 2CN3A 4GQ2P 1L0QA 2AGZA 3JRPA 3EI3B 2P9LC 5EAMA 2H14A 5EMMB 4GZ8A 1MG2A 2IUPA 3JZNA 3V7DB 3NVNA 4HDJA 5C9ZB 5GMKn 4N14A 4JT5C 3C5MA 3JAMg 4JSVC 2BBKH 4CI8A 3MKSB 3CFSB 3UVOA 3SMRA 3IJ1A 3PVWB 4A11B 1R5MA 3N0EA 5FLXg 3EI2A 2AGXA 2QXVA 3A0FA 2J55H 5SXMA 4LG9A 2H68A 2HKMA 3V5WB 4A0AA 3VA6A 4JSPC 1OMWB 5TEEA 5AFU3 2QC5A 3EI1B 3K27A 4JXMA 2YMUA 3IIWA 4A09B 1GOTB 4J8BA 4Z8LA 3KRXB 3OW8A 4FAND 1OLZA 1FWXA 4CY1A 5A2Qg 2AGYA 3UVNA 1ERJA 3L4MD 4IA9A 3FM0A 4OWRA 3DSMA 2CO0C 4GQBB 4UI9R 4MK0B 1PI6A 3F3FA 3MZKA 2H9LA 4XEIC 3EI1A 2HXCA 3RN1D 5THAA 4CI1A 3ZWLB 4EWRA 5CXCB 1K8KC 4D0KA 1SQ9A 3EG6A 5EM2A 5EALA 5GXIA 3I89A 3BG1A 3HFQA 2IUQA 3I7PA 2H6QA 3OL2A 2OJYA 4CC9A 2HESX 3EWEA 4GM8A 4L3HD 3SFZA 4J73A 3U4YA 4E54A 2PM6B 1JOFA 3SBPA 2AGWA 4PNKB 3K26A 3W15A 4GGAA 4A08B 4K3ID 5EARA 3DXMC 5I5MA 1MG3A 3PVUB 3EI3A 4FA5D 3JB9L 1MDAH 4J0XA 1A0RB 4PSXB 4AEZA 3MZLA 4LGNA 1XIPA 4A08A 3PXTD 5HE0B 5EMKB 2P9NC 1YFQA 3RFHA 3I7OA 4ZOVA 4G56B 4H5JA 3FGBA 5IJ8E 3JPXA 5FXYA 2Z2OA 4ERZA 4A7JA 3L4OD 3MMYA 3SVWD 5CXCA 3RLMD 4CZYA 4FWWA 1U2VC 3AL8B 4YVDA 2PBIB 3OKWA 4GQ1A 5HYNB 2BCJB 5I5JA 4A11A 1B9XA 4GGCA 3UR4A 3EMHA 4E54B 5JWZA 3RSEC 3UVKA 4J86A 4I79A 3BWSA 2Z2PA 3F3GA 4L9OA 1N6FA 4R7AB 4XYIA 3KRWB 2IWKA 3EI4A 4K3JB 3PE7A 3IKOA 1TBGA 2I0TA 1S4UX 4X60B 3AL8A 2OVPB 5IC7A 3J80g 3PXSD 4E5ZB 1GP2B 2OK6A 3SXTD 3V9FA 3RFGA 3JZHA 2H6KA 3RMZD 2W18A 3EI4B 3E0CA 4PBYA 2PM9A 2AGLA 4J81A 4O3TB 4D6VA 4O3UB 5EM2B 1NEXB 2P9KC 4X63B 2B4EA 2OVQB 5FKSA 3N0DA 4FB1D 3AL9A 4O45A 5EMLB 2P9UC 4LG8A 4A0BA 1TYQC 1N6DA 3I7NA 2CE9A 2HJBA 4JT6C 2H3XA 2IUVA 4ZOZA 3VGZA 2I3SA 3OKYB 3AH8B 3I7KA 1N6EA 2AH1A 2GNQA 4A09A 2CN2A 4ERQA 4FHLA 4PC0A 4AOWA 2HYEA 3PXWD 5KDOB 4ERYA 4TZ4A 4E5ZA 3RN0D 4A0AB 1SHYB 4GM3A 5EMJB 5CYKA 4XYHA 5B4WA 2HKRA 1RI6A 3C75H 4JD2C 2G9AA 2UZXB 4A2MA 4Y7RA 1NR0A 3DM0A 4IMMA 5HE2B 3OKYA 3MXXA 1U4CA 2MTAH 2AQ5A 5K1CC 4BL0A 1K32A 4GMBA 2YNPA 4GGDA 3UKUC 2YB8B 3NVQA 3ODTA 2TRCB 4ES0A 1VYHC 5HQGA 3GFCA 2H6NA 4J77A 2OK4A 3CIKB 4JSNC 3UVLA 1XKSA 2IWFA 3SHFA 5CYKB 4J84A 3ULEC 5IJ7E 3OL2B 2YNOA 3SN6B 4ZOYA 4Y5RD 2I0SA 2H47A 4J0WA 3I8EA 2XU7A 3J81g 5FQDA 4ESGA 3SLED 2H9NA 4QQEA 4BH6A 4NSXA 2PM7B 4J82A 4BUJC 4FA4D 2IURA 2Z2NA 2H9MA 5H1MA 4O1QD 5GSAA 4PXWA 3C9CA 5GXHA 4KFMB 5FKRA 3EI2B 5C2VB 3I7LA 2I3TA 4A0BB 2HJ4A 4QT8A 3UKRC 1JMZB 4X61B 3IJCA 3DXKC 2OVRB 2XL3A 3NVXA 3ORVD 1GG2B 4QRJA 4CY3A 2Q7QA 4GM9A 5IGQA 3GREA 3SWSD 5AJAA 3AFCA 5AMSA 4CZXA 4CI3A 4FA9D 2GC7A 3PSLA 2J57G 3DWLC 3C99A 1Q47A 3SBQA 3OTTA 3OKTA 1P22A 4CI2A 3P4FA 3SCYA 4U1EI 2B5MA 2CO0A
chains in the Genus database with same CATH superfamily
2CNXA 3EU7A 4PSWB 1L5GA 5TDHB 4L3GD 2YNNA 4A2LA 3V4PA 3JZGA 2H9PA 4J8GA 2EICA 2EBSA 2XDWA 3B7FA 5HE3B 5FKTA 2IAAA 3BG0A 4ZOXA 2P9IC 3SBRA 3QI0A 3I7HA 3RRMC 2QZPA 3GC3B 4CY5A 3IULA 5IT9g 2XYIA 3VH0A 2O9KA 3PSCB 4OZUA 5FA5B 2B5NA 3I8CA 4O9DA 1PGUA 2CE8A 3IUMA 2G99A 2H13A 3UVMA 1SQJA 4U7AA 3FRXA 2EIBA 2J56H 4RE6A 5C2WB 1E8NA 1VE6A 2B5LA 2UZYB 1B9YA 2I0RA 5K19A 4ZN4A 5HDBA 4O02A 3I2NA 3IIYA 1XHMA 4WJKA 5M61A 4NENA 4FA1D 3FCSA 1JMXB 3O4IA 3IUJA 2AH0A 2OIZA 5C86A 5HE1B 4J87A 4CZVA 4QL1A 5CXBA 1JJUB 1GXRA 2WQ8A 3SJLD 1QNIA 4X3EA 2YBAA 5EAPA 3MVDK 2GC4A 1T2XA 3F3PA 2XL2A 4MMZA 4PBZA 3NIGA 3IJ0A 4JSXC 1PBYB 2PM9B 5IGOA 4FAVD 5I5IA 4H5IA 3JROA 4CY2A 3CFVA 3K6SA 5TEFA 5TF2A 4J79A 5H17A 5CXBB 3MKQA 4WK0A 2P9PC 4J78A 2P9SC 4L1QD 1PEVA 5H14A 5FKQA 2CN3A 4GQ2P 4AX4A 1L0QA 2VC2A 2AGZA 3JRPA 3EI3B 2P9LC 4Z7QA 5EAMA 2H14A 3MUOA 3K72A 4UM9A 5EMMB 4GZ8A 3NIDA 1MG2A 2IUPA 3JZNA 3V7DB 1JTDB 3NVNA 4HDJA 5C9ZB 5GMKn 3DDUA 3KCIA 2XE4A 4N14A 4JT5C 3C5MA 3JAMg 4JSVC 2BBKH 4CI8A 3MKSB 3EQ8A 3CFSB 3UVOA 3SMRA 3IJ1A 4DNVA 3PVWB 4A11B 1R5MA 3N0EA 5FLXg 3EI2A 2AGXA 3ZE0A 2QXVA 2VDPA 3A0FA 2J55H 5SXMA 4LG9A 2H68A 2HKMA 4G1EA 3V5WB 3IVMA 4A0AA 3VA6A 4JSPC 1OMWB 5TEEA 5AFU3 3O4JA 2QC5A 4DNUA 3K27A 3EI1B 4JXMA 2YMUA 3IIWA 3ZDYA 4A09B 4O2WA 1GOTB 4J8BA 4Z8LA 3KRXB 3OW8A 4FAND 1OLZA 1FWXA 4AN0A 4QAMA 4CY1A 5A2Qg 2AGYA 3UVNA 1ERJA 3L4MD 4IA9A 3FM0A 2EIEA 4OWRA 3DSMA 2CO0C 2VZ1A 4GQBB 4UI9R 4MK0B 1PI6A 3F3FA 3MZKA 2H9LA 4XEIC 3EI1A 2HXCA 3RN1D 5THAA 4CI1A 3ZWLB 4EWRA 5CXCB 5E6RA 1K8KC 4D0KA 1SQ9A 3EG6A 5EM2A 3MUNA 1I2MB 5EALA 5GXIA 3I89A 3BG1A 3HFQA 2IUQA 3I7PA 2H6QA 3OL2A 2OJYA 4AMZA 2HESX 3EWEA 4GM8A 4CC9A 4D9SA 4L3HD 3SFZA 5M5VA 4J73A 3U4YA 4E54A 2PM6B 1JOFA 3SBPA 2AGWA 4PNKB 3K26A 3W15A 4GGAA 4A08B 2EIDA 4K3ID 5EARA 3IJEA 3DXMC 5I5MA 4BCCA 1MG3A 1QFSA 3PVUB 3EI3A 4FA5D 3JB9L 2VDRA 1MDAH 4J0XA 1A0RB 4PSXB 5M5RA 4AEZA 3MZLA 4LGNA 3T3PA 1XIPA 4A08A 1C9LA 3PXTD 5HE0B 5EMKB 2P9NC 1YFQA 3RFHA 1H2YA 3QHYB 3I7OA 4ZOVA 4G56B 4H5JA 3FGBA 4G55A 5IJ8E 2VDQA 1U8CA 3JPXA 5FXYA 2Z2OA 4ERZA 4A7JA 3L4OD 3MMYA 3SVWD 5CXCA 3RLMD 3ZE2A 4CZYA 4FWWA 1U2VC 4NBMA 3AL8B 1K3IA 4YVDA 2PBIB 3OKWA 4GQ1A 4RE5A 5HYNB 2BCJB 2VDOA 5I5JA 1VZ2A 4A11A 1B9XA 4GGCA 3O4HA 3UR4A 3EMHA 4E54B 5JWZA 1BPOA 3RSEC 3UVKA 3K71A 4J86A 3O4GA 4I79A 3BWSA 4Z7OA 3IUQA 2Z2PA 3F3GA 4L9OA 1N6FA 4R7AB 4XYIA 3KRWB 2IWKA 3EI4A 4K3JB 2HU7A 3PE7A 3IKOA 1TBGA 2VDMA 2I0TA 1S4UX 4X60B 3AL8A 2OVPB 5IC7A 3J80g 3PXSD 4E5ZB 1GP2B 2OK6A 3SXTD 3V9FA 3RFGA 3FCUA 3JZHA 2H6KA 3ZDZA 3V4VA 4BCBA 4L1MA 2BKLA 3RMZD 3EQ7A 2W18A 1UOQA 3VI3A 3EI4B 3E0CA 4PBYA 2PM9A 2AGLA 4J81A 4O3TB 4D6VA 4O3UB 2HU8A 5EM2B 1NEXB 2P9KC 4X63B 2B4EA 2OVQB 1VE7A 5FKSA 3N0DA 4FB1D 1YR2A 3AL9A 4O45A 5EMLB 2P9UC 4LG8A 4A0BA 3IUNA 1TYEA 1TYQC 2VDLA 5M5SA 1O6FA 1E8MA 1N6DA 3I7NA 1VZ3A 1C9IA 2CE9A 2HJBA 2VDNA 4JT6C 5FFGA 2H3XA 4MMXA 2IUVA 4ZOZA 5E6SA 3VGZA 2I3SA 3T3MA 1GOFA 3OKYB 1A12A 4WK4A 2VDKA 3AH8B 3ZE1A 3I7KA 1N6EA 2AH1A 3ZDXA 2GNQA 4A09A 1UOPA 2CN2A 4WK2A 4ERQA 4FHLA 4PC0A 4AOWA 2HYEA 3PXWD 5KDOB 4ERYA 4TZ4A 4E5ZA 3RN0D 4A0AB 1SHYB 4GM3A 5EMJB 5CYKA 4XYHA 4BCDA 5B4WA 2HKRA 5M5UA 1RI6A 3C75H 4JD2C 4MMYA 2G9AA 2UZXB 4A2MA 4Y7RA 1NR0A 3DM0A 3EQ9A 1UOOA 4IMMA 5HE2B 3OKYA 3MXXA 1U4CA 2MTAH 2AQ5A 5K1CC 4BL0A 4NC4A 1H2ZA 1K32A 4GMBA 2YNPA 4GGDA 3UKUC 2YB8B 3NVQA 3ODTA 2TRCB 4ES0A 1VYHC 2HU5A 5HQGA 3GD1I 3OF7A 3GFCA 2H6NA 4AMYA 4J77A 2OK4A 3CIKB 4JSNC 3UVLA 1XKSA 2IWFA 3SHFA 5CYKB 4BP8A 5M5TA 1E5TA 4G1MA 4J84A 3ULEC 3VI4A 5IJ7E 3OL2B 1H2WA 2YNOA 3SN6B 4ZOYA 4Y5RD 4Z7NA 2I0SA 2H47A 4J0WA 3I8EA 2XU7A 3J81g 5FQDA 4UM8A 1JV2A 3SLED 4ESGA 2H9NA 4QQEA 4BH6A 4NSXA 2PM7B 4J82A 2VZ3A 4BUJC 4FA4D 2IURA 2Z2NA 2H9MA 5H1MA 4O1QD 5GSAA 4PXWA 3C9CA 5C92A 1M1XA 5GXHA 1UTCA 4KFMB 5FKRA 3EI2B 4IRZA 1GOHA 5C2VB 3I7LA 2I3TA 4AN1A 4A0BB 1GOGA 2QR5A 2HJ4A 4QT8A 1O6GA 3UKRC 1JMZB 4X61B 3IJCA 4JHPC 3DXKC 2OVRB 2XL3A 3NVXA 3ORVD 4DNWA 1GG2B 4QRJA 4CY3A 2Q7QA 4GM9A 1QFMA 5IGQA 3GREA 3SWSD 5AJAA 5FFOA 3IURA 4BP9A 3AFCA 5AMSA 4CZXA 4CI3A 4FA9D 2GC7A 3PSLA 2J57G 3DWLC 3C99A 1Q47A 3NIFA 3SBQA 1H2XA 2JKXA 4NAAA 4JHNA 3OTTA 3OKTA 1P22A 2XZGA 5E6UA 4CI2A 3P4FA 3SCYA 4U1EI 2B5MA 2CO0A
chains in the Genus database with same CATH topology
2CNXA 3EU7A 4PSWB 5TDHB 4L3GD 2YNNA 4A2LA 3JZGA 2H9PA 4J8GA 2EBSA 3B7FA 5HE3B 5FKTA 2IAAA 3BG0A 4ZOXA 2P9IC 3SBRA 3I7HA 3RRMC 4CY5A 5IT9g 2XYIA 3VH0A 2O9KA 3PSCB 4OZUA 5FA5B 2B5NA 3I8CA 4O9DA 1PGUA 2CE8A 2G99A 2H13A 3UVMA 1SQJA 4U7AA 3FRXA 2J56H 5C2WB 2B5LA 2UZYB 1B9YA 2I0RA 5K19A 4ZN4A 3I2NA 3IIYA 1XHMA 4FA1D 1JMXB 2AH0A 2OIZA 5HE1B 4J87A 4CZVA 4QL1A 5CXBA 1JJUB 1GXRA 3SJLD 1QNIA 4X3EA 2YBAA 5EAPA 2GC4A 3F3PA 2XL2A 4PBZA 3IJ0A 4JSXC 1PBYB 2PM9B 5IGOA 4FAVD 5I5IA 4H5IA 3JROA 4CY2A 3CFVA 5TEFA 5TF2A 4J79A 5H17A 5CXBB 3MKQA 2P9PC 4J78A 2P9SC 4L1QD 1PEVA 5H14A 5FKQA 2CN3A 4GQ2P 1L0QA 2AGZA 3JRPA 3EI3B 2P9LC 5EAMA 2H14A 5EMMB 4GZ8A 1MG2A 2IUPA 3JZNA 3V7DB 3NVNA 4HDJA 5C9ZB 5GMKn 4N14A 4JT5C 3C5MA 3JAMg 4JSVC 2BBKH 4CI8A 3MKSB 3CFSB 3UVOA 3SMRA 3IJ1A 3PVWB 4A11B 1R5MA 3N0EA 5FLXg 3EI2A 2AGXA 2QXVA 3A0FA 2J55H 5SXMA 4LG9A 2H68A 2HKMA 3V5WB 4A0AA 3VA6A 4JSPC 1OMWB 5TEEA 5AFU3 2QC5A 3EI1B 3K27A 4JXMA 2YMUA 3IIWA 4A09B 1GOTB 4J8BA 4Z8LA 3KRXB 3OW8A 4FAND 1OLZA 1FWXA 4CY1A 5A2Qg 2AGYA 3UVNA 1ERJA 3L4MD 4IA9A 3FM0A 4OWRA 3DSMA 2CO0C 4GQBB 4UI9R 4MK0B 1PI6A 3F3FA 3MZKA 2H9LA 4XEIC 3EI1A 2HXCA 3RN1D 5THAA 4CI1A 3ZWLB 4EWRA 5CXCB 1K8KC 4D0KA 1SQ9A 3EG6A 5EM2A 5EALA 5GXIA 3I89A 3BG1A 3HFQA 2IUQA 3I7PA 2H6QA 3OL2A 2OJYA 4CC9A 2HESX 3EWEA 4GM8A 4L3HD 3SFZA 4J73A 3U4YA 4E54A 2PM6B 1JOFA 3SBPA 2AGWA 4PNKB 3K26A 3W15A 4GGAA 4A08B 4K3ID 5EARA 3DXMC 5I5MA 1MG3A 3PVUB 3EI3A 4FA5D 3JB9L 1MDAH 4J0XA 1A0RB 4PSXB 4AEZA 3MZLA 4LGNA 1XIPA 4A08A 3PXTD 5HE0B 5EMKB 2P9NC 1YFQA 3RFHA 3I7OA 4ZOVA 4G56B 4H5JA 3FGBA 5IJ8E 3JPXA 5FXYA 2Z2OA 4ERZA 4A7JA 3L4OD 3MMYA 3SVWD 5CXCA 3RLMD 4CZYA 4FWWA 1U2VC 3AL8B 4YVDA 2PBIB 3OKWA 4GQ1A 5HYNB 2BCJB 5I5JA 4A11A 1B9XA 4GGCA 3UR4A 3EMHA 4E54B 5JWZA 3RSEC 3UVKA 4J86A 4I79A 3BWSA 2Z2PA 3F3GA 4L9OA 1N6FA 4R7AB 4XYIA 3KRWB 2IWKA 3EI4A 4K3JB 3PE7A 3IKOA 1TBGA 2I0TA 1S4UX 4X60B 3AL8A 2OVPB 5IC7A 3J80g 3PXSD 4E5ZB 1GP2B 2OK6A 3SXTD 3V9FA 3RFGA 3JZHA 2H6KA 3RMZD 2W18A 3EI4B 3E0CA 4PBYA 2PM9A 2AGLA 4J81A 4O3TB 4D6VA 4O3UB 5EM2B 1NEXB 2P9KC 4X63B 2B4EA 2OVQB 5FKSA 3N0DA 4FB1D 3AL9A 4O45A 5EMLB 2P9UC 4LG8A 4A0BA 1TYQC 1N6DA 3I7NA 2CE9A 2HJBA 4JT6C 2H3XA 2IUVA 4ZOZA 3VGZA 2I3SA 3OKYB 3AH8B 3I7KA 1N6EA 2AH1A 2GNQA 4A09A 2CN2A 4ERQA 4FHLA 4PC0A 4AOWA 2HYEA 3PXWD 5KDOB 4ERYA 4TZ4A 4E5ZA 3RN0D 4A0AB 1SHYB 4GM3A 5EMJB 5CYKA 4XYHA 5B4WA 2HKRA 1RI6A 3C75H 4JD2C 2G9AA 2UZXB 4A2MA 4Y7RA 1NR0A 3DM0A 4IMMA 5HE2B 3OKYA 3MXXA 1U4CA 2MTAH 2AQ5A 5K1CC 4BL0A 1K32A 4GMBA 2YNPA 4GGDA 3UKUC 2YB8B 3NVQA 3ODTA 2TRCB 4ES0A 1VYHC 5HQGA 3GFCA 2H6NA 4J77A 2OK4A 3CIKB 4JSNC 3UVLA 1XKSA 2IWFA 3SHFA 5CYKB 4J84A 3ULEC 5IJ7E 3OL2B 2YNOA 3SN6B 4ZOYA 4Y5RD 2I0SA 2H47A 4J0WA 3I8EA 2XU7A 3J81g 5FQDA 4ESGA 3SLED 2H9NA 4QQEA 4BH6A 4NSXA 2PM7B 4J82A 4BUJC 4FA4D 2IURA 2Z2NA 2H9MA 5H1MA 4O1QD 5GSAA 4PXWA 3C9CA 5GXHA 4KFMB 5FKRA 3EI2B 5C2VB 3I7LA 2I3TA 4A0BB 2HJ4A 4QT8A 3UKRC 1JMZB 4X61B 3IJCA 3DXKC 2OVRB 2XL3A 3NVXA 3ORVD 1GG2B 4QRJA 4CY3A 2Q7QA 4GM9A 5IGQA 3GREA 3SWSD 5AJAA 3AFCA 5AMSA 4CZXA 4CI3A 4FA9D 2GC7A 3PSLA 2J57G 3DWLC 3C99A 1Q47A 3SBQA 3OTTA 3OKTA 1P22A 4CI2A 3P4FA 3SCYA 4U1EI 2B5MA 2CO0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CNX A;  3EU7 A;  4PSW B;  5TDH B;  4L3G D;  2YNN A;  4A2L A;  3JZG A;  2H9P A;  4J8G A;  2EBS A;  3B7F A;  5HE3 B;  5FKT A;  2IAA A;  3BG0 A;  4ZOX A;  2P9I C;  3SBR A;  3I7H A;  3RRM C;  4CY5 A;  5IT9 g;  2XYI A;  3VH0 A;  2O9K A;  3PSC B;  4OZU A;  5FA5 B;  2B5N A;  3I8C A;  4O9D A;  1PGU A;  2CE8 A;  2G99 A;  2H13 A;  3UVM A;  1SQJ A;  4U7A A;  3FRX A;  2J56 H;  5C2W B;  2B5L A;  2UZY B;  1B9Y A;  2I0R A;  5K19 A;  4ZN4 A;  3I2N A;  3IIY A;  1XHM A;  4FA1 D;  1JMX B;  2AH0 A;  2OIZ A;  5HE1 B;  4J87 A;  4CZV A;  4QL1 A;  5CXB A;  1JJU B;  1GXR A;  3SJL D;  1QNI A;  4X3E A;  2YBA A;  5EAP A;  2GC4 A;  3F3P A;  2XL2 A;  4PBZ A;  3IJ0 A;  4JSX C;  1PBY B;  2PM9 B;  5IGO A;  4FAV D;  5I5I A;  4H5I A;  3JRO A;  4CY2 A;  3CFV A;  5TEF A;  5TF2 A;  4J79 A;  5H17 A;  5CXB B;  3MKQ A;  2P9P C;  4J78 A;  2P9S C;  4L1Q D;  1PEV A;  5H14 A;  5FKQ A;  2CN3 A;  4GQ2 P;  1L0Q A;  2AGZ A;  3JRP A;  3EI3 B;  2P9L C;  5EAM A;  2H14 A;  5EMM B;  4GZ8 A;  1MG2 A;  2IUP A;  3JZN A;  3V7D B;  3NVN A;  4HDJ A;  5C9Z B;  5GMK n;  4N14 A;  4JT5 C;  3C5M A;  3JAM g;  4JSV C;  2BBK H;  4CI8 A;  3MKS B;  3CFS B;  3UVO A;  3SMR A;  3IJ1 A;  3PVW B;  4A11 B;  1R5M A;  3N0E A;  5FLX g;  3EI2 A;  2AGX A;  2QXV A;  3A0F A;  2J55 H;  5SXM A;  4LG9 A;  2H68 A;  2HKM A;  3V5W B;  4A0A A;  3VA6 A;  4JSP C;  1OMW B;  5TEE A;  5AFU 3;  2QC5 A;  3EI1 B;  3K27 A;  4JXM A;  2YMU A;  3IIW A;  4A09 B;  1GOT B;  4J8B A;  4Z8L A;  3KRX B;  3OW8 A;  4FAN D;  1OLZ A;  1FWX A;  4CY1 A;  5A2Q g;  2AGY A;  3UVN A;  1ERJ A;  3L4M D;  4IA9 A;  3FM0 A;  4OWR A;  3DSM A;  2CO0 C;  4GQB B;  4UI9 R;  4MK0 B;  1PI6 A;  3F3F A;  3MZK A;  2H9L A;  4XEI C;  3EI1 A;  2HXC A;  3RN1 D;  5THA A;  4CI1 A;  3ZWL B;  4EWR A;  5CXC B;  1K8K C;  4D0K A;  1SQ9 A;  3EG6 A;  5EM2 A;  5EAL A;  5GXI A;  3I89 A;  3BG1 A;  3HFQ A;  2IUQ A;  3I7P A;  2H6Q A;  3OL2 A;  2OJY A;  4CC9 A;  2HES X;  3EWE A;  4GM8 A;  4L3H D;  3SFZ A;  4J73 A;  3U4Y A;  4E54 A;  2PM6 B;  1JOF A;  3SBP A;  2AGW A;  4PNK B;  3K26 A;  3W15 A;  4GGA A;  4A08 B;  4K3I D;  5EAR A;  3DXM C;  5I5M A;  1MG3 A;  3PVU B;  3EI3 A;  4FA5 D;  3JB9 L;  1MDA H;  4J0X A;  1A0R B;  4PSX B;  4AEZ A;  3MZL A;  4LGN A;  1XIP A;  4A08 A;  3PXT D;  5HE0 B;  5EMK B;  2P9N C;  1YFQ A;  3RFH A;  3I7O A;  4ZOV A;  4G56 B;  4H5J A;  3FGB A;  5IJ8 E;  3JPX A;  5FXY A;  2Z2O A;  4ERZ A;  4A7J A;  3L4O D;  3MMY A;  3SVW D;  5CXC A;  3RLM D;  4CZY A;  4FWW A;  1U2V C;  3AL8 B;  4YVD A;  2PBI B;  3OKW A;  4GQ1 A;  5HYN B;  2BCJ B;  5I5J A;  4A11 A;  1B9X A;  4GGC A;  3UR4 A;  3EMH A;  4E54 B;  5JWZ A;  3RSE C;  3UVK A;  4J86 A;  4I79 A;  3BWS A;  2Z2P A;  3F3G A;  4L9O A;  1N6F A;  4R7A B;  4XYI A;  3KRW B;  2IWK A;  3EI4 A;  4K3J B;  3PE7 A;  3IKO A;  1TBG A;  2I0T A;  1S4U X;  4X60 B;  3AL8 A;  2OVP B;  5IC7 A;  3J80 g;  3PXS D;  4E5Z B;  1GP2 B;  2OK6 A;  3SXT D;  3V9F A;  3RFG A;  3JZH A;  2H6K A;  3RMZ D;  2W18 A;  3EI4 B;  3E0C A;  4PBY A;  2PM9 A;  2AGL A;  4J81 A;  4O3T B;  4D6V A;  4O3U B;  5EM2 B;  1NEX B;  2P9K C;  4X63 B;  2B4E A;  2OVQ B;  5FKS A;  3N0D A;  4FB1 D;  3AL9 A;  4O45 A;  5EML B;  2P9U C;  4LG8 A;  4A0B A;  1TYQ C;  1N6D A;  3I7N A;  2CE9 A;  2HJB A;  4JT6 C;  2H3X A;  2IUV A;  4ZOZ A;  3VGZ A;  2I3S A;  3OKY B;  3AH8 B;  3I7K A;  1N6E A;  2AH1 A;  2GNQ A;  4A09 A;  2CN2 A;  4ERQ A;  4FHL A;  4PC0 A;  4AOW A;  2HYE A;  3PXW D;  5KDO B;  4ERY A;  4TZ4 A;  4E5Z A;  3RN0 D;  4A0A B;  1SHY B;  4GM3 A;  5EMJ B;  5CYK A;  4XYH A;  5B4W A;  2HKR A;  1RI6 A;  3C75 H;  4JD2 C;  2G9A A;  2UZX B;  4A2M A;  4Y7R A;  1NR0 A;  3DM0 A;  4IMM A;  5HE2 B;  3OKY A;  3MXX A;  1U4C A;  2MTA H;  2AQ5 A;  5K1C C;  4BL0 A;  1K32 A;  4GMB A;  2YNP A;  4GGD A;  3UKU C;  2YB8 B;  3NVQ A;  3ODT A;  2TRC B;  4ES0 A;  1VYH C;  5HQG A;  3GFC A;  2H6N A;  4J77 A;  2OK4 A;  3CIK B;  4JSN C;  3UVL A;  1XKS A;  2IWF A;  3SHF A;  5CYK B;  4J84 A;  3ULE C;  5IJ7 E;  3OL2 B;  2YNO A;  3SN6 B;  4ZOY A;  4Y5R D;  2I0S A;  2H47 A;  4J0W A;  3I8E A;  2XU7 A;  3J81 g;  5FQD A;  4ESG A;  3SLE D;  2H9N A;  4QQE A;  4BH6 A;  4NSX A;  2PM7 B;  4J82 A;  4BUJ C;  4FA4 D;  2IUR A;  2Z2N A;  2H9M A;  5H1M A;  4O1Q D;  5GSA A;  4PXW A;  3C9C A;  5GXH A;  4KFM B;  5FKR A;  3EI2 B;  5C2V B;  3I7L A;  2I3T A;  4A0B B;  2HJ4 A;  4QT8 A;  3UKR C;  1JMZ B;  4X61 B;  3IJC A;  3DXK C;  2OVR B;  2XL3 A;  3NVX A;  3ORV D;  1GG2 B;  4QRJ A;  4CY3 A;  2Q7Q A;  4GM9 A;  5IGQ A;  3GRE A;  3SWS D;  5AJA A;  3AFC A;  5AMS A;  4CZX A;  4CI3 A;  4FA9 D;  2GC7 A;  3PSL A;  2J57 G;  3DWL C;  3C99 A;  1Q47 A;  3SBQ A;  3OTT A;  3OKT A;  1P22 A;  4CI2 A;  3P4F A;  3SCY A;  4U1E I;  2B5M A;  2CO0 A; 
#chains in the Genus database with same CATH topology
 2CNX A;  3EU7 A;  4PSW B;  1L5G A;  5TDH B;  4L3G D;  2YNN A;  4A2L A;  3V4P A;  3JZG A;  2H9P A;  4J8G A;  2EIC A;  2EBS A;  2XDW A;  3B7F A;  5HE3 B;  5FKT A;  2IAA A;  3BG0 A;  4ZOX A;  2P9I C;  3SBR A;  3QI0 A;  3I7H A;  3RRM C;  2QZP A;  3GC3 B;  4CY5 A;  3IUL A;  5IT9 g;  2XYI A;  3VH0 A;  2O9K A;  3PSC B;  4OZU A;  5FA5 B;  2B5N A;  3I8C A;  4O9D A;  1PGU A;  2CE8 A;  3IUM A;  2G99 A;  2H13 A;  3UVM A;  1SQJ A;  4U7A A;  3FRX A;  2EIB A;  2J56 H;  4RE6 A;  5C2W B;  1E8N A;  1VE6 A;  2B5L A;  2UZY B;  1B9Y A;  2I0R A;  5K19 A;  4ZN4 A;  5HDB A;  4O02 A;  3I2N A;  3IIY A;  1XHM A;  4WJK A;  5M61 A;  4NEN A;  4FA1 D;  3FCS A;  1JMX B;  3O4I A;  3IUJ A;  2AH0 A;  2OIZ A;  5C86 A;  5HE1 B;  4J87 A;  4CZV A;  4QL1 A;  5CXB A;  1JJU B;  1GXR A;  2WQ8 A;  3SJL D;  1QNI A;  4X3E A;  2YBA A;  5EAP A;  3MVD K;  2GC4 A;  1T2X A;  3F3P A;  2XL2 A;  4MMZ A;  4PBZ A;  3NIG A;  3IJ0 A;  4JSX C;  1PBY B;  2PM9 B;  5IGO A;  4FAV D;  5I5I A;  4H5I A;  3JRO A;  4CY2 A;  3CFV A;  3K6S A;  5TEF A;  5TF2 A;  4J79 A;  5H17 A;  5CXB B;  3MKQ A;  4WK0 A;  2P9P C;  4J78 A;  2P9S C;  4L1Q D;  1PEV A;  5H14 A;  5FKQ A;  2CN3 A;  4GQ2 P;  4AX4 A;  1L0Q A;  2VC2 A;  2AGZ A;  3JRP A;  3EI3 B;  2P9L C;  4Z7Q A;  5EAM A;  2H14 A;  3MUO A;  3K72 A;  4UM9 A;  5EMM B;  4GZ8 A;  3NID A;  1MG2 A;  2IUP A;  3JZN A;  3V7D B;  1JTD B;  3NVN A;  4HDJ A;  5C9Z B;  5GMK n;  3DDU A;  3KCI A;  2XE4 A;  4N14 A;  4JT5 C;  3C5M A;  3JAM g;  4JSV C;  2BBK H;  4CI8 A;  3MKS B;  3EQ8 A;  3CFS B;  3UVO A;  3SMR A;  3IJ1 A;  4DNV A;  3PVW B;  4A11 B;  1R5M A;  3N0E A;  5FLX g;  3EI2 A;  2AGX A;  3ZE0 A;  2QXV A;  2VDP A;  3A0F A;  2J55 H;  5SXM A;  4LG9 A;  2H68 A;  2HKM A;  4G1E A;  3V5W B;  3IVM A;  4A0A A;  3VA6 A;  4JSP C;  1OMW B;  5TEE A;  5AFU 3;  3O4J A;  2QC5 A;  4DNU A;  3K27 A;  3EI1 B;  4JXM A;  2YMU A;  3IIW A;  3ZDY A;  4A09 B;  4O2W A;  1GOT B;  4J8B A;  4Z8L A;  3KRX B;  3OW8 A;  4FAN D;  1OLZ A;  1FWX A;  4AN0 A;  4QAM A;  4CY1 A;  5A2Q g;  2AGY A;  3UVN A;  1ERJ A;  3L4M D;  4IA9 A;  3FM0 A;  2EIE A;  4OWR A;  3DSM A;  2CO0 C;  2VZ1 A;  4GQB B;  4UI9 R;  4MK0 B;  1PI6 A;  3F3F A;  3MZK A;  2H9L A;  4XEI C;  3EI1 A;  2HXC A;  3RN1 D;  5THA A;  4CI1 A;  3ZWL B;  4EWR A;  5CXC B;  5E6R A;  1K8K C;  4D0K A;  1SQ9 A;  3EG6 A;  5EM2 A;  3MUN A;  1I2M B;  5EAL A;  5GXI A;  3I89 A;  3BG1 A;  3HFQ A;  2IUQ A;  3I7P A;  2H6Q A;  3OL2 A;  2OJY A;  4AMZ A;  2HES X;  3EWE A;  4GM8 A;  4CC9 A;  4D9S A;  4L3H D;  3SFZ A;  5M5V A;  4J73 A;  3U4Y A;  4E54 A;  2PM6 B;  1JOF A;  3SBP A;  2AGW A;  4PNK B;  3K26 A;  3W15 A;  4GGA A;  4A08 B;  2EID A;  4K3I D;  5EAR A;  3IJE A;  3DXM C;  5I5M A;  4BCC A;  1MG3 A;  1QFS A;  3PVU B;  3EI3 A;  4FA5 D;  3JB9 L;  2VDR A;  1MDA H;  4J0X A;  1A0R B;  4PSX B;  5M5R A;  4AEZ A;  3MZL A;  4LGN A;  3T3P A;  1XIP A;  4A08 A;  1C9L A;  3PXT D;  5HE0 B;  5EMK B;  2P9N C;  1YFQ A;  3RFH A;  1H2Y A;  3QHY B;  3I7O A;  4ZOV A;  4G56 B;  4H5J A;  3FGB A;  4G55 A;  5IJ8 E;  2VDQ A;  1U8C A;  3JPX A;  5FXY A;  2Z2O A;  4ERZ A;  4A7J A;  3L4O D;  3MMY A;  3SVW D;  5CXC A;  3RLM D;  3ZE2 A;  4CZY A;  4FWW A;  1U2V C;  4NBM A;  3AL8 B;  1K3I A;  4YVD A;  2PBI B;  3OKW A;  4GQ1 A;  4RE5 A;  5HYN B;  2BCJ B;  2VDO A;  5I5J A;  1VZ2 A;  4A11 A;  1B9X A;  4GGC A;  3O4H A;  3UR4 A;  3EMH A;  4E54 B;  5JWZ A;  1BPO A;  3RSE C;  3UVK A;  3K71 A;  4J86 A;  3O4G A;  4I79 A;  3BWS A;  4Z7O A;  3IUQ A;  2Z2P A;  3F3G A;  4L9O A;  1N6F A;  4R7A B;  4XYI A;  3KRW B;  2IWK A;  3EI4 A;  4K3J B;  2HU7 A;  3PE7 A;  3IKO A;  1TBG A;  2VDM A;  2I0T A;  1S4U X;  4X60 B;  3AL8 A;  2OVP B;  5IC7 A;  3J80 g;  3PXS D;  4E5Z B;  1GP2 B;  2OK6 A;  3SXT D;  3V9F A;  3RFG A;  3FCU A;  3JZH A;  2H6K A;  3ZDZ A;  3V4V A;  4BCB A;  4L1M A;  2BKL A;  3RMZ D;  3EQ7 A;  2W18 A;  1UOQ A;  3VI3 A;  3EI4 B;  3E0C A;  4PBY A;  2PM9 A;  2AGL A;  4J81 A;  4O3T B;  4D6V A;  4O3U B;  2HU8 A;  5EM2 B;  1NEX B;  2P9K C;  4X63 B;  2B4E A;  2OVQ B;  1VE7 A;  5FKS A;  3N0D A;  4FB1 D;  1YR2 A;  3AL9 A;  4O45 A;  5EML B;  2P9U C;  4LG8 A;  4A0B A;  3IUN A;  1TYE A;  1TYQ C;  2VDL A;  5M5S A;  1O6F A;  1E8M A;  1N6D A;  3I7N A;  1VZ3 A;  1C9I A;  2CE9 A;  2HJB A;  2VDN A;  4JT6 C;  5FFG A;  2H3X A;  4MMX A;  2IUV A;  4ZOZ A;  5E6S A;  3VGZ A;  2I3S A;  3T3M A;  1GOF A;  3OKY B;  1A12 A;  4WK4 A;  2VDK A;  3AH8 B;  3ZE1 A;  3I7K A;  1N6E A;  2AH1 A;  3ZDX A;  2GNQ A;  4A09 A;  1UOP A;  2CN2 A;  4WK2 A;  4ERQ A;  4FHL A;  4PC0 A;  4AOW A;  2HYE A;  3PXW D;  5KDO B;  4ERY A;  4TZ4 A;  4E5Z A;  3RN0 D;  4A0A B;  1SHY B;  4GM3 A;  5EMJ B;  5CYK A;  4XYH A;  4BCD A;  5B4W A;  2HKR A;  5M5U A;  1RI6 A;  3C75 H;  4JD2 C;  4MMY A;  2G9A A;  2UZX B;  4A2M A;  4Y7R A;  1NR0 A;  3DM0 A;  3EQ9 A;  1UOO A;  4IMM A;  5HE2 B;  3OKY A;  3MXX A;  1U4C A;  2MTA H;  2AQ5 A;  5K1C C;  4BL0 A;  4NC4 A;  1H2Z A;  1K32 A;  4GMB A;  2YNP A;  4GGD A;  3UKU C;  2YB8 B;  3NVQ A;  3ODT A;  2TRC B;  4ES0 A;  1VYH C;  2HU5 A;  5HQG A;  3GD1 I;  3OF7 A;  3GFC A;  2H6N A;  4AMY A;  4J77 A;  2OK4 A;  3CIK B;  4JSN C;  3UVL A;  1XKS A;  2IWF A;  3SHF A;  5CYK B;  4BP8 A;  5M5T A;  1E5T A;  4G1M A;  4J84 A;  3ULE C;  3VI4 A;  5IJ7 E;  3OL2 B;  1H2W A;  2YNO A;  3SN6 B;  4ZOY A;  4Y5R D;  4Z7N A;  2I0S A;  2H47 A;  4J0W A;  3I8E A;  2XU7 A;  3J81 g;  5FQD A;  4UM8 A;  1JV2 A;  3SLE D;  4ESG A;  2H9N A;  4QQE A;  4BH6 A;  4NSX A;  2PM7 B;  4J82 A;  2VZ3 A;  4BUJ C;  4FA4 D;  2IUR A;  2Z2N A;  2H9M A;  5H1M A;  4O1Q D;  5GSA A;  4PXW A;  3C9C A;  5C92 A;  1M1X A;  5GXH A;  1UTC A;  4KFM B;  5FKR A;  3EI2 B;  4IRZ A;  1GOH A;  5C2V B;  3I7L A;  2I3T A;  4AN1 A;  4A0B B;  1GOG A;  2QR5 A;  2HJ4 A;  4QT8 A;  1O6G A;  3UKR C;  1JMZ B;  4X61 B;  3IJC A;  4JHP C;  3DXK C;  2OVR B;  2XL3 A;  3NVX A;  3ORV D;  4DNW A;  1GG2 B;  4QRJ A;  4CY3 A;  2Q7Q A;  4GM9 A;  1QFM A;  5IGQ A;  3GRE A;  3SWS D;  5AJA A;  5FFO A;  3IUR A;  4BP9 A;  3AFC A;  5AMS A;  4CZX A;  4CI3 A;  4FA9 D;  2GC7 A;  3PSL A;  2J57 G;  3DWL C;  3C99 A;  1Q47 A;  3NIF A;  3SBQ A;  1H2X A;  2JKX A;  4NAA A;  4JHN A;  3OTT A;  3OKT A;  1P22 A;  2XZG A;  5E6U A;  4CI2 A;  3P4F A;  3SCY A;  4U1E I;  2B5M A;  2CO0 A; 
#chains in the Genus database with same CATH homology
 2CNX A;  3EU7 A;  4PSW B;  5TDH B;  4L3G D;  2YNN A;  4A2L A;  3JZG A;  2H9P A;  4J8G A;  2EBS A;  3B7F A;  5HE3 B;  5FKT A;  2IAA A;  3BG0 A;  4ZOX A;  2P9I C;  3SBR A;  3I7H A;  3RRM C;  4CY5 A;  5IT9 g;  2XYI A;  3VH0 A;  2O9K A;  3PSC B;  4OZU A;  5FA5 B;  2B5N A;  3I8C A;  4O9D A;  1PGU A;  2CE8 A;  2G99 A;  2H13 A;  3UVM A;  1SQJ A;  4U7A A;  3FRX A;  2J56 H;  5C2W B;  2B5L A;  2UZY B;  1B9Y A;  2I0R A;  5K19 A;  4ZN4 A;  3I2N A;  3IIY A;  1XHM A;  4FA1 D;  1JMX B;  2AH0 A;  2OIZ A;  5HE1 B;  4J87 A;  4CZV A;  4QL1 A;  5CXB A;  1JJU B;  1GXR A;  3SJL D;  1QNI A;  4X3E A;  2YBA A;  5EAP A;  2GC4 A;  3F3P A;  2XL2 A;  4PBZ A;  3IJ0 A;  4JSX C;  1PBY B;  2PM9 B;  5IGO A;  4FAV D;  5I5I A;  4H5I A;  3JRO A;  4CY2 A;  3CFV A;  5TEF A;  5TF2 A;  4J79 A;  5H17 A;  5CXB B;  3MKQ A;  2P9P C;  4J78 A;  2P9S C;  4L1Q D;  1PEV A;  5H14 A;  5FKQ A;  2CN3 A;  4GQ2 P;  1L0Q A;  2AGZ A;  3JRP A;  3EI3 B;  2P9L C;  5EAM A;  2H14 A;  5EMM B;  4GZ8 A;  1MG2 A;  2IUP A;  3JZN A;  3V7D B;  3NVN A;  4HDJ A;  5C9Z B;  5GMK n;  4N14 A;  4JT5 C;  3C5M A;  3JAM g;  4JSV C;  2BBK H;  4CI8 A;  3MKS B;  3CFS B;  3UVO A;  3SMR A;  3IJ1 A;  3PVW B;  4A11 B;  1R5M A;  3N0E A;  5FLX g;  3EI2 A;  2AGX A;  2QXV A;  3A0F A;  2J55 H;  5SXM A;  4LG9 A;  2H68 A;  2HKM A;  3V5W B;  4A0A A;  3VA6 A;  4JSP C;  1OMW B;  5TEE A;  5AFU 3;  2QC5 A;  3EI1 B;  3K27 A;  4JXM A;  2YMU A;  3IIW A;  4A09 B;  1GOT B;  4J8B A;  4Z8L A;  3KRX B;  3OW8 A;  4FAN D;  1OLZ A;  1FWX A;  4CY1 A;  5A2Q g;  2AGY A;  3UVN A;  1ERJ A;  3L4M D;  4IA9 A;  3FM0 A;  4OWR A;  3DSM A;  2CO0 C;  4GQB B;  4UI9 R;  4MK0 B;  1PI6 A;  3F3F A;  3MZK A;  2H9L A;  4XEI C;  3EI1 A;  2HXC A;  3RN1 D;  5THA A;  4CI1 A;  3ZWL B;  4EWR A;  5CXC B;  1K8K C;  4D0K A;  1SQ9 A;  3EG6 A;  5EM2 A;  5EAL A;  5GXI A;  3I89 A;  3BG1 A;  3HFQ A;  2IUQ A;  3I7P A;  2H6Q A;  3OL2 A;  2OJY A;  4CC9 A;  2HES X;  3EWE A;  4GM8 A;  4L3H D;  3SFZ A;  4J73 A;  3U4Y A;  4E54 A;  2PM6 B;  1JOF A;  3SBP A;  2AGW A;  4PNK B;  3K26 A;  3W15 A;  4GGA A;  4A08 B;  4K3I D;  5EAR A;  3DXM C;  5I5M A;  1MG3 A;  3PVU B;  3EI3 A;  4FA5 D;  3JB9 L;  1MDA H;  4J0X A;  1A0R B;  4PSX B;  4AEZ A;  3MZL A;  4LGN A;  1XIP A;  4A08 A;  3PXT D;  5HE0 B;  5EMK B;  2P9N C;  1YFQ A;  3RFH A;  3I7O A;  4ZOV A;  4G56 B;  4H5J A;  3FGB A;  5IJ8 E;  3JPX A;  5FXY A;  2Z2O A;  4ERZ A;  4A7J A;  3L4O D;  3MMY A;  3SVW D;  5CXC A;  3RLM D;  4CZY A;  4FWW A;  1U2V C;  3AL8 B;  4YVD A;  2PBI B;  3OKW A;  4GQ1 A;  5HYN B;  2BCJ B;  5I5J A;  4A11 A;  1B9X A;  4GGC A;  3UR4 A;  3EMH A;  4E54 B;  5JWZ A;  3RSE C;  3UVK A;  4J86 A;  4I79 A;  3BWS A;  2Z2P A;  3F3G A;  4L9O A;  1N6F A;  4R7A B;  4XYI A;  3KRW B;  2IWK A;  3EI4 A;  4K3J B;  3PE7 A;  3IKO A;  1TBG A;  2I0T A;  1S4U X;  4X60 B;  3AL8 A;  2OVP B;  5IC7 A;  3J80 g;  3PXS D;  4E5Z B;  1GP2 B;  2OK6 A;  3SXT D;  3V9F A;  3RFG A;  3JZH A;  2H6K A;  3RMZ D;  2W18 A;  3EI4 B;  3E0C A;  4PBY A;  2PM9 A;  2AGL A;  4J81 A;  4O3T B;  4D6V A;  4O3U B;  5EM2 B;  1NEX B;  2P9K C;  4X63 B;  2B4E A;  2OVQ B;  5FKS A;  3N0D A;  4FB1 D;  3AL9 A;  4O45 A;  5EML B;  2P9U C;  4LG8 A;  4A0B A;  1TYQ C;  1N6D A;  3I7N A;  2CE9 A;  2HJB A;  4JT6 C;  2H3X A;  2IUV A;  4ZOZ A;  3VGZ A;  2I3S A;  3OKY B;  3AH8 B;  3I7K A;  1N6E A;  2AH1 A;  2GNQ A;  4A09 A;  2CN2 A;  4ERQ A;  4FHL A;  4PC0 A;  4AOW A;  2HYE A;  3PXW D;  5KDO B;  4ERY A;  4TZ4 A;  4E5Z A;  3RN0 D;  4A0A B;  1SHY B;  4GM3 A;  5EMJ B;  5CYK A;  4XYH A;  5B4W A;  2HKR A;  1RI6 A;  3C75 H;  4JD2 C;  2G9A A;  2UZX B;  4A2M A;  4Y7R A;  1NR0 A;  3DM0 A;  4IMM A;  5HE2 B;  3OKY A;  3MXX A;  1U4C A;  2MTA H;  2AQ5 A;  5K1C C;  4BL0 A;  1K32 A;  4GMB A;  2YNP A;  4GGD A;  3UKU C;  2YB8 B;  3NVQ A;  3ODT A;  2TRC B;  4ES0 A;  1VYH C;  5HQG A;  3GFC A;  2H6N A;  4J77 A;  2OK4 A;  3CIK B;  4JSN C;  3UVL A;  1XKS A;  2IWF A;  3SHF A;  5CYK B;  4J84 A;  3ULE C;  5IJ7 E;  3OL2 B;  2YNO A;  3SN6 B;  4ZOY A;  4Y5R D;  2I0S A;  2H47 A;  4J0W A;  3I8E A;  2XU7 A;  3J81 g;  5FQD A;  4ESG A;  3SLE D;  2H9N A;  4QQE A;  4BH6 A;  4NSX A;  2PM7 B;  4J82 A;  4BUJ C;  4FA4 D;  2IUR A;  2Z2N A;  2H9M A;  5H1M A;  4O1Q D;  5GSA A;  4PXW A;  3C9C A;  5GXH A;  4KFM B;  5FKR A;  3EI2 B;  5C2V B;  3I7L A;  2I3T A;  4A0B B;  2HJ4 A;  4QT8 A;  3UKR C;  1JMZ B;  4X61 B;  3IJC A;  3DXK C;  2OVR B;  2XL3 A;  3NVX A;  3ORV D;  1GG2 B;  4QRJ A;  4CY3 A;  2Q7Q A;  4GM9 A;  5IGQ A;  3GRE A;  3SWS D;  5AJA A;  3AFC A;  5AMS A;  4CZX A;  4CI3 A;  4FA9 D;  2GC7 A;  3PSL A;  2J57 G;  3DWL C;  3C99 A;  1Q47 A;  3SBQ A;  3OTT A;  3OKT A;  1P22 A;  4CI2 A;  3P4F A;  3SCY A;  4U1E I;  2B5M A;  2CO0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...