2CO0C

Wdr5 and unmodified histone h3 complex at 2.25 angstrom
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
304
structure length
304
Chain Sequence
VKPNYALMFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGMCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords WD-REPEAT PROTEIN 5
publication title Histone H3 Recognition and Presentation by the Wdr5 Module of the Mll1 Complex
pubmed doi rcsb
source organism Homo sapiens
total genus 94
structure length 304
sequence length 304
ec nomenclature
pdb deposition date 2006-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2co0C00
4X60B 4J79A 5AJAA 3SBPA 4QQEA 1PEVA 4E5ZA 4L9OA 5CXCA 2CNXA 4A09A 2P9IC 5C2WB 5HYNB 2O9KA 4FA5D 4FB1D 4J8GA 2OVPB 4UI9R 5EAPA 4A2LA 4E54B 3DSMA 5FXYA 3RFGA 3ULEC 2H6KA 2I3SA 5EMKB 1S4UX 3BG0A 3EMHA 3OKYA 2HKRA 1K32A 2IAAA 2OVRB 2YBAA 4J0XA 4O3UB 5GXIA 2P9UC 4FA1D 3DM0A 4K3JB 5GMKn 3ODTA 5FLXg 3SJLD 3EI4A 5IJ8E 4Y7RA 2J57G 1U4CA 4LG8A 4PBZA 3SXTD 4A0BA 3NVXA 3CIKB 5GXHA 4G56B 3JZGA 3EU7A 4PNKB 4BH6A 4GQBB 2OVQB 1MG3A 3OKWA 4HDJA 4ZN4A 5IT9g 2HXCA 4XYHA 4D0KA 2AGXA 2Z2PA 3F3GA 3SWSD 2IUQA 4GM3A 5I5JA 1XKSA 5H14A 2PM6B 2MTAH 2OIZA 3I8EA 3PXSD 2GC7A 2Z2OA 3I89A 5IJ7E 4ZOZA 4O9DA 2B4EA 4CI2A 3OW8A 2PM9A 4L1QD 5IGQA 2H9MA 3JZNA 4ERQA 4A08B 5EMJB 5H1MA 3RN1D 3L4MD 2H9NA 4JSVC 3C5MA 2XL2A 4CZVA 3J81g 3F3PA 5AFU3 4AOWA 5CXBB 2IWKA 4O1QD 2B5NA 4O45A 5FKTA 3UR4A 3C9CA 2OK4A 2XU7A 5H17A 3JAMg 3PE7A 2H6QA 3ORVD 4BL0A 3EG6A 4E54A 3PVWB 1JMZB 5FKSA 5HE3B 1QNIA 2H6NA 5I5IA 4Z8LA 3IIYA 4GGCA 2H14A 4ZOYA 3SN6B 5HE2B 2AGLA 4J78A 4JXMA 4QL1A 3DXKC 3EI1B 2QC5A 2BBKH 2XYIA 3UVKA 4AEZA 4GMBA 2B5LA 4A2MA 3SVWD 4L3GD 3JROA 5HQGA 4I79A 3F3FA 2CN2A 3UKUC 3ZWLB 5TF2A 4A7JA 1PBYB 2G9AA 3I7NA 3BWSA 3SBRA 2J56H 2Q7QA 2CO0A 4N14A 4A11A 3I7OA 4XYIA 5IC7A 1GXRA 2H9PA 3OTTA 3JB9L 2HKMA 2XL3A 2P9SC 2HYEA 3SBQA 3EI2B 3N0EA 1FWXA 3AFCA 3CFVA 3SLED 4GM9A 1L0QA 4U1EI 4A08A 3MZKA 1GG2B 3JRPA 4PXWA 3MKSB 1SQ9A 2BCJB 1B9XA 4IMMA 5TEEA 2H3XA 4BUJC 3N0DA 2HJ4A 1SQJA 3PXWD 3OKTA 1NEXB 5CXBA 2Z2NA 2OJYA 2H47A 1N6EA 4JSNC 4KFMB 1GP2B 2UZYB 3IJ0A 3UVNA 3OL2B 5C2VB 2AQ5A 3PSLA 3I8CA 5HE1B 3HFQA 2YNPA 4QT8A 4ERZA 3V5WB 2G99A 2P9PC 4JSXC 2P9LC 4OZUA 5TDHB 5JWZA 4OWRA 5KDOB 5EMLB 4A09B 4LG9A 5EALA 2AH0A 4PSXB 2IUPA 1JJUB 5HE0B 4J87A 3I7PA 1SHYB 4TZ4A 4CI1A 3EI1A 3RN0D 2GC4A 4A0AB 5K19A 5FA5B 1XIPA 4U7AA 3EWEA 5FQDA 1JOFA 2UZXB 4PSWB 3IJ1A 3W15A 5C9ZB 4GQ2P 5K1CC 3OKYB 2GNQA 3I7HA 2IURA 3EI3B 1RI6A 2PBIB 1Q47A 4X3EA 2IWFA 4H5JA 3K26A 4J82A 4ES0A 3BG1A 2EBSA 2P9KC 3RSEC 3MMYA 4CI8A 1ERJA 4GM8A 2CE8A 5CYKB 3SHFA 5AMSA 5B4WA 2AGZA 3EI2A 1TYQC 4J73A 3SFZA 4QRJA 3SCYA 4JT5C 4GQ1A 3MZLA 3UVMA 3GREA 4H5IA 4PBYA 3IJCA 4ESGA 1OMWB 5EAMA 3UKRC 2YMUA 1N6DA 3K27A 4GZ8A 1NR0A 5TEFA 4CC9A 4JSPC 4LGNA 4Y5RD 4FWWA 4IA9A 4XEIC 5SXMA 3E0CA 3I7KA 3AL9A 5GSAA 3OL2A 2CN3A 3UVOA 3VA6A 2HJBA 5FKQA 1OLZA 4O3TB 1XHMA 3V9FA 2YB8B 2AH1A 2P9NC 1R5MA 1VYHC 4CY1A 3GFCA 3FGBA 3PSCB 1N6FA 1PI6A 4CZXA 4J81A 4A0AA 5EMMB 4L3HD 2AGYA 4NSXA 3U4YA 4JT6C 2H9LA 4CY3A 2OK6A 4K3ID 3KRXB 2J55H 3AL8B 3NVQA 3I2NA 4MK0B 3EI3A 3FM0A 4FAVD 5IGOA 3RLMD 1PGUA 5A2Qg 3AH8B 3P4FA 4GGDA 3NVNA 5EM2B 5THAA 5FKRA 2I0RA 4X61B 2PM7B 1MDAH 3KRWB 3MKQA 3V7DB 2AGWA 3JZHA 1TBGA 4E5ZB 5CXCB 2YNOA 5CYKA 4FA4D 4FA9D 2I3TA 3PXTD 2CE9A 4J8BA 3DXMC 4CZYA 4A11B 1U2VC 2IUVA 3IKOA 3J80g 3B7FA 2I0TA 4X63B 4GGAA 4EWRA 2TRCB 3I7LA 2W18A 5I5MA 4ZOXA 1YFQA 2QXVA 2YNNA 1A0RB 3EI4B 2H68A 3VGZA 1MG2A 4J86A 4J0WA 4FHLA 4CY2A 4PC0A 3FRXA 4A0BB 3L4OD 3SMRA 3MXXA 4J84A 1JMXB 2HESX 4R7AB 3C99A 3PVUB 4J77A 3DWLC 4YVDA 4ZOVA 3CFSB 4CI3A 3UVLA 3C75H 1P22A 1GOTB 3A0FA 1K8KC 3VH0A 3IIWA 2I0SA 2PM9B 3RRMC 4FAND 4ERYA 3AL8A 2CO0C 4CY5A 5EARA 1B9YA 4JD2C 2B5MA 5EM2A 2H13A 4D6VA 3RMZD 3RFHA 3JPXA
chains in the Genus database with same CATH superfamily
4X60B 3O4JA 4J79A 2QZPA 5AJAA 3SBPA 4QQEA 1PEVA 4E5ZA 4L9OA 5CXCA 2CNXA 4A09A 2P9IC 5C2WB 5HYNB 4AMZA 2O9KA 4FA5D 4FB1D 4J8GA 2OVPB 3QHYB 4UI9R 4WK4A 5EAPA 3V4VA 4A2LA 4E54B 4O2WA 1VZ2A 3DSMA 5FXYA 3RFGA 3ULEC 2H6KA 2I3SA 5EMKB 1S4UX 3BG0A 3EMHA 3OKYA 4DNUA 2HKRA 1K32A 2IAAA 2OVRB 2YBAA 4J0XA 4O3UB 2VDLA 2VDOA 2P9UC 5GXIA 4FA1D 3MUNA 3DM0A 4K3JB 5GMKn 3ODTA 5FLXg 3IUNA 1E8MA 3SJLD 3EI4A 4D9SA 5IJ8E 4Y7RA 3VI4A 2J57G 1U4CA 4LG8A 4PBZA 3IURA 3O4IA 3SXTD 4A0BA 3NVXA 3NIGA 3CIKB 5GXHA 4G56B 3JZGA 3V4PA 3EU7A 4PNKB 4BH6A 4GQBB 2OVQB 1MG3A 2HU7A 3OKWA 4HDJA 4ZN4A 3ZE0A 5IT9g 2HXCA 4JHPC 4L1MA 3EQ9A 4XYHA 4D0KA 2AGXA 3IUQA 2Z2PA 3F3GA 3IUMA 3SWSD 2IUQA 4GM3A 5I5JA 1T2XA 1XKSA 5H14A 2PM6B 2MTAH 2OIZA 3I8EA 3PXSD 2GC7A 2Z2OA 3I89A 5IJ7E 4ZOZA 4O9DA 2B4EA 4CI2A 1C9IA 3OW8A 2PM9A 4L1QD 5IGQA 2WQ8A 2H9MA 3JZNA 4ERQA 4A08B 5EMJB 5M5UA 2VDNA 5H1MA 2VZ1A 4Z7QA 4BP8A 3RN1D 3L4MD 4AX4A 3O4HA 2H9NA 4G1EA 4JSVC 3C5MA 2XL2A 4CZVA 3J81g 3F3PA 5AFU3 4AOWA 5CXBB 2IWKA 3MVDK 4O02A 4O1QD 2B5NA 4O45A 5FKTA 1H2ZA 3UR4A 5M5SA 1H2WA 3C9CA 3K71A 2OK4A 2XU7A 5H17A 3JAMg 3PE7A 1QFSA 2H6QA 3ORVD 4Z7NA 3KCIA 4MMZA 4BL0A 3EG6A 4E54A 3PVWB 1JMZB 5FKSA 5HE3B 1QNIA 3ZE2A 2H6NA 5I5IA 4Z8LA 3IIYA 4GGCA 2H14A 3GD1I 3T3MA 4ZOYA 3SN6B 5HE2B 2JKXA 2AGLA 4J78A 4JXMA 4QL1A 3DXKC 3EI1B 1UOOA 3IJEA 2QC5A 2BBKH 2XYIA 3UVKA 4AEZA 4GMBA 2B5LA 4NAAA 4A2MA 2VDMA 2VDRA 4BP9A 4G1MA 2VC2A 3ZDXA 2EIBA 4AN1A 3SVWD 4L3GD 3JROA 5HQGA 4I79A 3F3FA 2CN2A 3UKUC 3ZWLB 5TF2A 4A7JA 1PBYB 3I7NA 2G9AA 3BWSA 3SBRA 2J56H 2Q7QA 2CO0A 4N14A 4A11A 2EIEA 3I7OA 4XYIA 5IC7A 3DDUA 1GXRA 2H9PA 3OTTA 1C9LA 5C92A 3JB9L 2HKMA 2XL3A 2P9SC 1H2XA 2HYEA 3SBQA 2VDKA 3IULA 3EI2B 3N0EA 1FWXA 3AFCA 3CFVA 3SLED 4GM9A 1L0QA 1VZ3A 3K72A 4U1EI 4A08A 5E6UA 1JV2A 3MZKA 4UM8A 4BCCA 4Z7OA 1GG2B 3JRPA 4PXWA 3MKSB 1H2YA 4BCBA 1SQ9A 2BCJB 1B9XA 4IMMA 5TEEA 2H3XA 4BUJC 3N0DA 2HJ4A 3NIDA 1SQJA 3PXWD 3OKTA 1NEXB 5CXBA 2Z2NA 2OJYA 1I2MB 3IUJA 2H47A 1N6EA 4JSNC 5FFOA 1A12A 4KFMB 1GP2B 2UZYB 5M5TA 1K3IA 3IJ0A 1VE6A 3UVNA 3OL2B 5C2VB 4JHNA 2AQ5A 3PSLA 3I8CA 5HE1B 3HFQA 2YNPA 4QT8A 4ERZA 1YR2A 3V5WB 2G99A 2P9PC 4JSXC 2P9LC 4OZUA 5TDHB 5JWZA 1UOQA 4OWRA 5KDOB 1GOHA 5EMLB 4A09B 4MMYA 4LG9A 5EALA 2AH0A 4PSXB 2IUPA 1JJUB 5HE0B 4J87A 3I7PA 1SHYB 4TZ4A 4CI1A 3EI1A 3RN0D 2GC4A 3GC3B 4A0AB 5K19A 1GOGA 5FA5B 1XIPA 4U7AA 4NBMA 3EWEA 5FQDA 1JOFA 2UZXB 4PSWB 3IJ1A 1VE7A 3W15A 5C9ZB 4GQ2P 5K1CC 3OKYB 3O4GA 2GNQA 3VI3A 2VDPA 4RE6A 4WK0A 5M5VA 3I7HA 2IURA 3EI3B 1RI6A 2PBIB 1Q47A 4X3EA 2IWFA 4H5JA 3FCUA 3ZDZA 3K26A 4AN0A 4J82A 4ES0A 3BG1A 2EBSA 5E6RA 1U8CA 2P9KC 3RSEC 3MMYA 2XE4A 4CI8A 1ERJA 4GM8A 2CE8A 5C86A 5CYKB 3K6SA 3SHFA 5AMSA 5B4WA 2AGZA 3EI2A 1TYQC 4J73A 3SFZA 4QRJA 3SCYA 2EIDA 4JT5C 1O6FA 2HU8A 4GQ1A 4DNVA 3MZLA 3UVMA 3GREA 4H5IA 4PBYA 1M1XA 3IJCA 2VDQA 4ESGA 1OMWB 5EAMA 3UKRC 2YMUA 1N6DA 3K27A 4GZ8A 1NR0A 5TEFA 4BCDA 4CC9A 4JSPC 4LGNA 2EICA 4Y5RD 4FWWA 4IA9A 4XEIC 5SXMA 3E0CA 1GOFA 3I7KA 3AL9A 5GSAA 3OL2A 1UTCA 3ZDYA 2CN3A 3UVOA 3VA6A 2HJBA 5FKQA 1OLZA 4O3TB 1JTDB 1XHMA 3FCSA 3V9FA 4AMYA 2YB8B 1O6GA 5HDBA 2AH1A 2P9NC 1R5MA 2XZGA 1VYHC 4CY1A 3GFCA 3FGBA 3PSCB 1N6FA 2QR5A 1PI6A 1L5GA 4CZXA 4J81A 4A0AA 5EMMB 4L3HD 2AGYA 4NSXA 4RE5A 3U4YA 4JT6C 2H9LA 4CY3A 2OK6A 4K3ID 3KRXB 2J55H 4QAMA 3AL8B 3NVQA 3I2NA 4MK0B 3EI3A 3FM0A 4FAVD 5IGOA 3RLMD 4NENA 1PGUA 5A2Qg 1UOPA 3AH8B 3P4FA 4GGDA 3NVNA 5EM2B 3IVMA 5THAA 5FKRA 2I0RA 4X61B 3MUOA 2PM7B 1MDAH 3KRWB 3MKQA 3V7DB 2AGWA 3JZHA 1TBGA 4E5ZB 2BKLA 5CXCB 4UM9A 2YNOA 5CYKA 4FA4D 4NC4A 2I3TA 4WJKA 4FA9D 3PXTD 3T3PA 2CE9A 4DNWA 4J8BA 3DXMC 4CZYA 4A11B 1U2VC 2IUVA 3IKOA 3J80g 3B7FA 3EQ7A 5E6SA 1BPOA 2I0TA 4X63B 4GGAA 4EWRA 2TRCB 3I7LA 2W18A 5FFGA 5I5MA 4ZOXA 1YFQA 2QXVA 2YNNA 2HU5A 1A0RB 3ZE1A 3EI4B 2H68A 3VGZA 1MG2A 4J86A 4J0WA 4FHLA 4CY2A 2VZ3A 4PC0A 3FRXA 4A0BB 3L4OD 3SMRA 3MXXA 4J84A 1QFMA 1JMXB 1E8NA 2HESX 4R7AB 3OF7A 3C99A 3PVUB 4J77A 3DWLC 4YVDA 3EQ8A 1E5TA 4ZOVA 3CFSB 5M5RA 4CI3A 4WK2A 3UVLA 4G55A 3C75H 1P22A 1GOTB 4IRZA 3A0FA 1K8KC 3VH0A 3IIWA 2I0SA 2PM9B 3NIFA 3RRMC 4FAND 4ERYA 1TYEA 3AL8A 2CO0C 5M61A 4CY5A 5EARA 1B9YA 4JD2C 3QI0A 2B5MA 5EM2A 4MMXA 2H13A 2XDWA 4D6VA 3RMZD 3RFHA 3JPXA
chains in the Genus database with same CATH topology
4X60B 4J79A 5AJAA 3SBPA 4QQEA 1PEVA 4E5ZA 4L9OA 5CXCA 2CNXA 4A09A 2P9IC 5C2WB 5HYNB 2O9KA 4FA5D 4FB1D 4J8GA 2OVPB 4UI9R 5EAPA 4A2LA 4E54B 3DSMA 5FXYA 3RFGA 3ULEC 2H6KA 2I3SA 5EMKB 1S4UX 3BG0A 3EMHA 3OKYA 2HKRA 1K32A 2IAAA 2OVRB 2YBAA 4J0XA 4O3UB 5GXIA 2P9UC 4FA1D 3DM0A 4K3JB 5GMKn 3ODTA 5FLXg 3SJLD 3EI4A 5IJ8E 4Y7RA 2J57G 1U4CA 4LG8A 4PBZA 3SXTD 4A0BA 3NVXA 3CIKB 5GXHA 4G56B 3JZGA 3EU7A 4PNKB 4BH6A 4GQBB 2OVQB 1MG3A 3OKWA 4HDJA 4ZN4A 5IT9g 2HXCA 4XYHA 4D0KA 2AGXA 2Z2PA 3F3GA 3SWSD 2IUQA 4GM3A 5I5JA 1XKSA 5H14A 2PM6B 2MTAH 2OIZA 3I8EA 3PXSD 2GC7A 2Z2OA 3I89A 5IJ7E 4ZOZA 4O9DA 2B4EA 4CI2A 3OW8A 2PM9A 4L1QD 5IGQA 2H9MA 3JZNA 4ERQA 4A08B 5EMJB 5H1MA 3RN1D 3L4MD 2H9NA 4JSVC 3C5MA 2XL2A 4CZVA 3J81g 3F3PA 5AFU3 4AOWA 5CXBB 2IWKA 4O1QD 2B5NA 4O45A 5FKTA 3UR4A 3C9CA 2OK4A 2XU7A 5H17A 3JAMg 3PE7A 2H6QA 3ORVD 4BL0A 3EG6A 4E54A 3PVWB 1JMZB 5FKSA 5HE3B 1QNIA 2H6NA 5I5IA 4Z8LA 3IIYA 4GGCA 2H14A 4ZOYA 3SN6B 5HE2B 2AGLA 4J78A 4JXMA 4QL1A 3DXKC 3EI1B 2QC5A 2BBKH 2XYIA 3UVKA 4AEZA 4GMBA 2B5LA 4A2MA 3SVWD 4L3GD 3JROA 5HQGA 4I79A 3F3FA 2CN2A 3UKUC 3ZWLB 5TF2A 4A7JA 1PBYB 2G9AA 3I7NA 3BWSA 3SBRA 2J56H 2Q7QA 2CO0A 4N14A 4A11A 3I7OA 4XYIA 5IC7A 1GXRA 2H9PA 3OTTA 3JB9L 2HKMA 2XL3A 2P9SC 2HYEA 3SBQA 3EI2B 3N0EA 1FWXA 3AFCA 3CFVA 3SLED 4GM9A 1L0QA 4U1EI 4A08A 3MZKA 1GG2B 3JRPA 4PXWA 3MKSB 1SQ9A 2BCJB 1B9XA 4IMMA 5TEEA 2H3XA 4BUJC 3N0DA 2HJ4A 1SQJA 3PXWD 3OKTA 1NEXB 5CXBA 2Z2NA 2OJYA 2H47A 1N6EA 4JSNC 4KFMB 1GP2B 2UZYB 3IJ0A 3UVNA 3OL2B 5C2VB 2AQ5A 3PSLA 3I8CA 5HE1B 3HFQA 2YNPA 4QT8A 4ERZA 3V5WB 2G99A 2P9PC 4JSXC 2P9LC 4OZUA 5TDHB 5JWZA 4OWRA 5KDOB 5EMLB 4A09B 4LG9A 5EALA 2AH0A 4PSXB 2IUPA 1JJUB 5HE0B 4J87A 3I7PA 1SHYB 4TZ4A 4CI1A 3EI1A 3RN0D 2GC4A 4A0AB 5K19A 5FA5B 1XIPA 4U7AA 3EWEA 5FQDA 1JOFA 2UZXB 4PSWB 3IJ1A 3W15A 5C9ZB 4GQ2P 5K1CC 3OKYB 2GNQA 3I7HA 2IURA 3EI3B 1RI6A 2PBIB 1Q47A 4X3EA 2IWFA 4H5JA 3K26A 4J82A 4ES0A 3BG1A 2EBSA 2P9KC 3RSEC 3MMYA 4CI8A 1ERJA 4GM8A 2CE8A 5CYKB 3SHFA 5AMSA 5B4WA 2AGZA 3EI2A 1TYQC 4J73A 3SFZA 4QRJA 3SCYA 4JT5C 4GQ1A 3MZLA 3UVMA 3GREA 4H5IA 4PBYA 3IJCA 4ESGA 1OMWB 5EAMA 3UKRC 2YMUA 1N6DA 3K27A 4GZ8A 1NR0A 5TEFA 4CC9A 4JSPC 4LGNA 4Y5RD 4FWWA 4IA9A 4XEIC 5SXMA 3E0CA 3I7KA 3AL9A 5GSAA 3OL2A 2CN3A 3UVOA 3VA6A 2HJBA 5FKQA 1OLZA 4O3TB 1XHMA 3V9FA 2YB8B 2AH1A 2P9NC 1R5MA 1VYHC 4CY1A 3GFCA 3FGBA 3PSCB 1N6FA 1PI6A 4CZXA 4J81A 4A0AA 5EMMB 4L3HD 2AGYA 4NSXA 3U4YA 4JT6C 2H9LA 4CY3A 2OK6A 4K3ID 3KRXB 2J55H 3AL8B 3NVQA 3I2NA 4MK0B 3EI3A 3FM0A 4FAVD 5IGOA 3RLMD 1PGUA 5A2Qg 3AH8B 3P4FA 4GGDA 3NVNA 5EM2B 5THAA 5FKRA 2I0RA 4X61B 2PM7B 1MDAH 3KRWB 3MKQA 3V7DB 2AGWA 3JZHA 1TBGA 4E5ZB 5CXCB 2YNOA 5CYKA 4FA4D 4FA9D 2I3TA 3PXTD 2CE9A 4J8BA 3DXMC 4CZYA 4A11B 1U2VC 2IUVA 3IKOA 3J80g 3B7FA 2I0TA 4X63B 4GGAA 4EWRA 2TRCB 3I7LA 2W18A 5I5MA 4ZOXA 1YFQA 2QXVA 2YNNA 1A0RB 3EI4B 2H68A 3VGZA 1MG2A 4J86A 4J0WA 4FHLA 4CY2A 4PC0A 3FRXA 4A0BB 3L4OD 3SMRA 3MXXA 4J84A 1JMXB 2HESX 4R7AB 3C99A 3PVUB 4J77A 3DWLC 4YVDA 4ZOVA 3CFSB 4CI3A 3UVLA 3C75H 1P22A 1GOTB 3A0FA 1K8KC 3VH0A 3IIWA 2I0SA 2PM9B 3RRMC 4FAND 4ERYA 3AL8A 2CO0C 4CY5A 5EARA 1B9YA 4JD2C 2B5MA 5EM2A 2H13A 4D6VA 3RMZD 3RFHA 3JPXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X60 B;  4J79 A;  5AJA A;  3SBP A;  4QQE A;  1PEV A;  4E5Z A;  4L9O A;  5CXC A;  2CNX A;  4A09 A;  2P9I C;  5C2W B;  5HYN B;  2O9K A;  4FA5 D;  4FB1 D;  4J8G A;  2OVP B;  4UI9 R;  5EAP A;  4A2L A;  4E54 B;  3DSM A;  5FXY A;  3RFG A;  3ULE C;  2H6K A;  2I3S A;  5EMK B;  1S4U X;  3BG0 A;  3EMH A;  3OKY A;  2HKR A;  1K32 A;  2IAA A;  2OVR B;  2YBA A;  4J0X A;  4O3U B;  5GXI A;  2P9U C;  4FA1 D;  3DM0 A;  4K3J B;  5GMK n;  3ODT A;  5FLX g;  3SJL D;  3EI4 A;  5IJ8 E;  4Y7R A;  2J57 G;  1U4C A;  4LG8 A;  4PBZ A;  3SXT D;  4A0B A;  3NVX A;  3CIK B;  5GXH A;  4G56 B;  3JZG A;  3EU7 A;  4PNK B;  4BH6 A;  4GQB B;  2OVQ B;  1MG3 A;  3OKW A;  4HDJ A;  4ZN4 A;  5IT9 g;  2HXC A;  4XYH A;  4D0K A;  2AGX A;  2Z2P A;  3F3G A;  3SWS D;  2IUQ A;  4GM3 A;  5I5J A;  1XKS A;  5H14 A;  2PM6 B;  2MTA H;  2OIZ A;  3I8E A;  3PXS D;  2GC7 A;  2Z2O A;  3I89 A;  5IJ7 E;  4ZOZ A;  4O9D A;  2B4E A;  4CI2 A;  3OW8 A;  2PM9 A;  4L1Q D;  5IGQ A;  2H9M A;  3JZN A;  4ERQ A;  4A08 B;  5EMJ B;  5H1M A;  3RN1 D;  3L4M D;  2H9N A;  4JSV C;  3C5M A;  2XL2 A;  4CZV A;  3J81 g;  3F3P A;  5AFU 3;  4AOW A;  5CXB B;  2IWK A;  4O1Q D;  2B5N A;  4O45 A;  5FKT A;  3UR4 A;  3C9C A;  2OK4 A;  2XU7 A;  5H17 A;  3JAM g;  3PE7 A;  2H6Q A;  3ORV D;  4BL0 A;  3EG6 A;  4E54 A;  3PVW B;  1JMZ B;  5FKS A;  5HE3 B;  1QNI A;  2H6N A;  5I5I A;  4Z8L A;  3IIY A;  4GGC A;  2H14 A;  4ZOY A;  3SN6 B;  5HE2 B;  2AGL A;  4J78 A;  4JXM A;  4QL1 A;  3DXK C;  3EI1 B;  2QC5 A;  2BBK H;  2XYI A;  3UVK A;  4AEZ A;  4GMB A;  2B5L A;  4A2M A;  3SVW D;  4L3G D;  3JRO A;  5HQG A;  4I79 A;  3F3F A;  2CN2 A;  3UKU C;  3ZWL B;  5TF2 A;  4A7J A;  1PBY B;  2G9A A;  3I7N A;  3BWS A;  3SBR A;  2J56 H;  2Q7Q A;  2CO0 A;  4N14 A;  4A11 A;  3I7O A;  4XYI A;  5IC7 A;  1GXR A;  2H9P A;  3OTT A;  3JB9 L;  2HKM A;  2XL3 A;  2P9S C;  2HYE A;  3SBQ A;  3EI2 B;  3N0E A;  1FWX A;  3AFC A;  3CFV A;  3SLE D;  4GM9 A;  1L0Q A;  4U1E I;  4A08 A;  3MZK A;  1GG2 B;  3JRP A;  4PXW A;  3MKS B;  1SQ9 A;  2BCJ B;  1B9X A;  4IMM A;  5TEE A;  2H3X A;  4BUJ C;  3N0D A;  2HJ4 A;  1SQJ A;  3PXW D;  3OKT A;  1NEX B;  5CXB A;  2Z2N A;  2OJY A;  2H47 A;  1N6E A;  4JSN C;  4KFM B;  1GP2 B;  2UZY B;  3IJ0 A;  3UVN A;  3OL2 B;  5C2V B;  2AQ5 A;  3PSL A;  3I8C A;  5HE1 B;  3HFQ A;  2YNP A;  4QT8 A;  4ERZ A;  3V5W B;  2G99 A;  2P9P C;  4JSX C;  2P9L C;  4OZU A;  5TDH B;  5JWZ A;  4OWR A;  5KDO B;  5EML B;  4A09 B;  4LG9 A;  5EAL A;  2AH0 A;  4PSX B;  2IUP A;  1JJU B;  5HE0 B;  4J87 A;  3I7P A;  1SHY B;  4TZ4 A;  4CI1 A;  3EI1 A;  3RN0 D;  2GC4 A;  4A0A B;  5K19 A;  5FA5 B;  1XIP A;  4U7A A;  3EWE A;  5FQD A;  1JOF A;  2UZX B;  4PSW B;  3IJ1 A;  3W15 A;  5C9Z B;  4GQ2 P;  5K1C C;  3OKY B;  2GNQ A;  3I7H A;  2IUR A;  3EI3 B;  1RI6 A;  2PBI B;  1Q47 A;  4X3E A;  2IWF A;  4H5J A;  3K26 A;  4J82 A;  4ES0 A;  3BG1 A;  2EBS A;  2P9K C;  3RSE C;  3MMY A;  4CI8 A;  1ERJ A;  4GM8 A;  2CE8 A;  5CYK B;  3SHF A;  5AMS A;  5B4W A;  2AGZ A;  3EI2 A;  1TYQ C;  4J73 A;  3SFZ A;  4QRJ A;  3SCY A;  4JT5 C;  4GQ1 A;  3MZL A;  3UVM A;  3GRE A;  4H5I A;  4PBY A;  3IJC A;  4ESG A;  1OMW B;  5EAM A;  3UKR C;  2YMU A;  1N6D A;  3K27 A;  4GZ8 A;  1NR0 A;  5TEF A;  4CC9 A;  4JSP C;  4LGN A;  4Y5R D;  4FWW A;  4IA9 A;  4XEI C;  5SXM A;  3E0C A;  3I7K A;  3AL9 A;  5GSA A;  3OL2 A;  2CN3 A;  3UVO A;  3VA6 A;  2HJB A;  5FKQ A;  1OLZ A;  4O3T B;  1XHM A;  3V9F A;  2YB8 B;  2AH1 A;  2P9N C;  1R5M A;  1VYH C;  4CY1 A;  3GFC A;  3FGB A;  3PSC B;  1N6F A;  1PI6 A;  4CZX A;  4J81 A;  4A0A A;  5EMM B;  4L3H D;  2AGY A;  4NSX A;  3U4Y A;  4JT6 C;  2H9L A;  4CY3 A;  2OK6 A;  4K3I D;  3KRX B;  2J55 H;  3AL8 B;  3NVQ A;  3I2N A;  4MK0 B;  3EI3 A;  3FM0 A;  4FAV D;  5IGO A;  3RLM D;  1PGU A;  5A2Q g;  3AH8 B;  3P4F A;  4GGD A;  3NVN A;  5EM2 B;  5THA A;  5FKR A;  2I0R A;  4X61 B;  2PM7 B;  1MDA H;  3KRW B;  3MKQ A;  3V7D B;  2AGW A;  3JZH A;  1TBG A;  4E5Z B;  5CXC B;  2YNO A;  5CYK A;  4FA4 D;  4FA9 D;  2I3T A;  3PXT D;  2CE9 A;  4J8B A;  3DXM C;  4CZY A;  4A11 B;  1U2V C;  2IUV A;  3IKO A;  3J80 g;  3B7F A;  2I0T A;  4X63 B;  4GGA A;  4EWR A;  2TRC B;  3I7L A;  2W18 A;  5I5M A;  4ZOX A;  1YFQ A;  2QXV A;  2YNN A;  1A0R B;  3EI4 B;  2H68 A;  3VGZ A;  1MG2 A;  4J86 A;  4J0W A;  4FHL A;  4CY2 A;  4PC0 A;  3FRX A;  4A0B B;  3L4O D;  3SMR A;  3MXX A;  4J84 A;  1JMX B;  2HES X;  4R7A B;  3C99 A;  3PVU B;  4J77 A;  3DWL C;  4YVD A;  4ZOV A;  3CFS B;  4CI3 A;  3UVL A;  3C75 H;  1P22 A;  1GOT B;  3A0F A;  1K8K C;  3VH0 A;  3IIW A;  2I0S A;  2PM9 B;  3RRM C;  4FAN D;  4ERY A;  3AL8 A;  2CO0 C;  4CY5 A;  5EAR A;  1B9Y A;  4JD2 C;  2B5M A;  5EM2 A;  2H13 A;  4D6V A;  3RMZ D;  3RFH A;  3JPX A; 
#chains in the Genus database with same CATH topology
 4X60 B;  3O4J A;  4J79 A;  2QZP A;  5AJA A;  3SBP A;  4QQE A;  1PEV A;  4E5Z A;  4L9O A;  5CXC A;  2CNX A;  4A09 A;  2P9I C;  5C2W B;  5HYN B;  4AMZ A;  2O9K A;  4FA5 D;  4FB1 D;  4J8G A;  2OVP B;  3QHY B;  4UI9 R;  4WK4 A;  5EAP A;  3V4V A;  4A2L A;  4E54 B;  4O2W A;  1VZ2 A;  3DSM A;  5FXY A;  3RFG A;  3ULE C;  2H6K A;  2I3S A;  5EMK B;  1S4U X;  3BG0 A;  3EMH A;  3OKY A;  4DNU A;  2HKR A;  1K32 A;  2IAA A;  2OVR B;  2YBA A;  4J0X A;  4O3U B;  2VDL A;  2VDO A;  2P9U C;  5GXI A;  4FA1 D;  3MUN A;  3DM0 A;  4K3J B;  5GMK n;  3ODT A;  5FLX g;  3IUN A;  1E8M A;  3SJL D;  3EI4 A;  4D9S A;  5IJ8 E;  4Y7R A;  3VI4 A;  2J57 G;  1U4C A;  4LG8 A;  4PBZ A;  3IUR A;  3O4I A;  3SXT D;  4A0B A;  3NVX A;  3NIG A;  3CIK B;  5GXH A;  4G56 B;  3JZG A;  3V4P A;  3EU7 A;  4PNK B;  4BH6 A;  4GQB B;  2OVQ B;  1MG3 A;  2HU7 A;  3OKW A;  4HDJ A;  4ZN4 A;  3ZE0 A;  5IT9 g;  2HXC A;  4JHP C;  4L1M A;  3EQ9 A;  4XYH A;  4D0K A;  2AGX A;  3IUQ A;  2Z2P A;  3F3G A;  3IUM A;  3SWS D;  2IUQ A;  4GM3 A;  5I5J A;  1T2X A;  1XKS A;  5H14 A;  2PM6 B;  2MTA H;  2OIZ A;  3I8E A;  3PXS D;  2GC7 A;  2Z2O A;  3I89 A;  5IJ7 E;  4ZOZ A;  4O9D A;  2B4E A;  4CI2 A;  1C9I A;  3OW8 A;  2PM9 A;  4L1Q D;  5IGQ A;  2WQ8 A;  2H9M A;  3JZN A;  4ERQ A;  4A08 B;  5EMJ B;  5M5U A;  2VDN A;  5H1M A;  2VZ1 A;  4Z7Q A;  4BP8 A;  3RN1 D;  3L4M D;  4AX4 A;  3O4H A;  2H9N A;  4G1E A;  4JSV C;  3C5M A;  2XL2 A;  4CZV A;  3J81 g;  3F3P A;  5AFU 3;  4AOW A;  5CXB B;  2IWK A;  3MVD K;  4O02 A;  4O1Q D;  2B5N A;  4O45 A;  5FKT A;  1H2Z A;  3UR4 A;  5M5S A;  1H2W A;  3C9C A;  3K71 A;  2OK4 A;  2XU7 A;  5H17 A;  3JAM g;  3PE7 A;  1QFS A;  2H6Q A;  3ORV D;  4Z7N A;  3KCI A;  4MMZ A;  4BL0 A;  3EG6 A;  4E54 A;  3PVW B;  1JMZ B;  5FKS A;  5HE3 B;  1QNI A;  3ZE2 A;  2H6N A;  5I5I A;  4Z8L A;  3IIY A;  4GGC A;  2H14 A;  3GD1 I;  3T3M A;  4ZOY A;  3SN6 B;  5HE2 B;  2JKX A;  2AGL A;  4J78 A;  4JXM A;  4QL1 A;  3DXK C;  3EI1 B;  1UOO A;  3IJE A;  2QC5 A;  2BBK H;  2XYI A;  3UVK A;  4AEZ A;  4GMB A;  2B5L A;  4NAA A;  4A2M A;  2VDM A;  2VDR A;  4BP9 A;  4G1M A;  2VC2 A;  3ZDX A;  2EIB A;  4AN1 A;  3SVW D;  4L3G D;  3JRO A;  5HQG A;  4I79 A;  3F3F A;  2CN2 A;  3UKU C;  3ZWL B;  5TF2 A;  4A7J A;  1PBY B;  3I7N A;  2G9A A;  3BWS A;  3SBR A;  2J56 H;  2Q7Q A;  2CO0 A;  4N14 A;  4A11 A;  2EIE A;  3I7O A;  4XYI A;  5IC7 A;  3DDU A;  1GXR A;  2H9P A;  3OTT A;  1C9L A;  5C92 A;  3JB9 L;  2HKM A;  2XL3 A;  2P9S C;  1H2X A;  2HYE A;  3SBQ A;  2VDK A;  3IUL A;  3EI2 B;  3N0E A;  1FWX A;  3AFC A;  3CFV A;  3SLE D;  4GM9 A;  1L0Q A;  1VZ3 A;  3K72 A;  4U1E I;  4A08 A;  5E6U A;  1JV2 A;  3MZK A;  4UM8 A;  4BCC A;  4Z7O A;  1GG2 B;  3JRP A;  4PXW A;  3MKS B;  1H2Y A;  4BCB A;  1SQ9 A;  2BCJ B;  1B9X A;  4IMM A;  5TEE A;  2H3X A;  4BUJ C;  3N0D A;  2HJ4 A;  3NID A;  1SQJ A;  3PXW D;  3OKT A;  1NEX B;  5CXB A;  2Z2N A;  2OJY A;  1I2M B;  3IUJ A;  2H47 A;  1N6E A;  4JSN C;  5FFO A;  1A12 A;  4KFM B;  1GP2 B;  2UZY B;  5M5T A;  1K3I A;  3IJ0 A;  1VE6 A;  3UVN A;  3OL2 B;  5C2V B;  4JHN A;  2AQ5 A;  3PSL A;  3I8C A;  5HE1 B;  3HFQ A;  2YNP A;  4QT8 A;  4ERZ A;  1YR2 A;  3V5W B;  2G99 A;  2P9P C;  4JSX C;  2P9L C;  4OZU A;  5TDH B;  5JWZ A;  1UOQ A;  4OWR A;  5KDO B;  1GOH A;  5EML B;  4A09 B;  4MMY A;  4LG9 A;  5EAL A;  2AH0 A;  4PSX B;  2IUP A;  1JJU B;  5HE0 B;  4J87 A;  3I7P A;  1SHY B;  4TZ4 A;  4CI1 A;  3EI1 A;  3RN0 D;  2GC4 A;  3GC3 B;  4A0A B;  5K19 A;  1GOG A;  5FA5 B;  1XIP A;  4U7A A;  4NBM A;  3EWE A;  5FQD A;  1JOF A;  2UZX B;  4PSW B;  3IJ1 A;  1VE7 A;  3W15 A;  5C9Z B;  4GQ2 P;  5K1C C;  3OKY B;  3O4G A;  2GNQ A;  3VI3 A;  2VDP A;  4RE6 A;  4WK0 A;  5M5V A;  3I7H A;  2IUR A;  3EI3 B;  1RI6 A;  2PBI B;  1Q47 A;  4X3E A;  2IWF A;  4H5J A;  3FCU A;  3ZDZ A;  3K26 A;  4AN0 A;  4J82 A;  4ES0 A;  3BG1 A;  2EBS A;  5E6R A;  1U8C A;  2P9K C;  3RSE C;  3MMY A;  2XE4 A;  4CI8 A;  1ERJ A;  4GM8 A;  2CE8 A;  5C86 A;  5CYK B;  3K6S A;  3SHF A;  5AMS A;  5B4W A;  2AGZ A;  3EI2 A;  1TYQ C;  4J73 A;  3SFZ A;  4QRJ A;  3SCY A;  2EID A;  4JT5 C;  1O6F A;  2HU8 A;  4GQ1 A;  4DNV A;  3MZL A;  3UVM A;  3GRE A;  4H5I A;  4PBY A;  1M1X A;  3IJC A;  2VDQ A;  4ESG A;  1OMW B;  5EAM A;  3UKR C;  2YMU A;  1N6D A;  3K27 A;  4GZ8 A;  1NR0 A;  5TEF A;  4BCD A;  4CC9 A;  4JSP C;  4LGN A;  2EIC A;  4Y5R D;  4FWW A;  4IA9 A;  4XEI C;  5SXM A;  3E0C A;  1GOF A;  3I7K A;  3AL9 A;  5GSA A;  3OL2 A;  1UTC A;  3ZDY A;  2CN3 A;  3UVO A;  3VA6 A;  2HJB A;  5FKQ A;  1OLZ A;  4O3T B;  1JTD B;  1XHM A;  3FCS A;  3V9F A;  4AMY A;  2YB8 B;  1O6G A;  5HDB A;  2AH1 A;  2P9N C;  1R5M A;  2XZG A;  1VYH C;  4CY1 A;  3GFC A;  3FGB A;  3PSC B;  1N6F A;  2QR5 A;  1PI6 A;  1L5G A;  4CZX A;  4J81 A;  4A0A A;  5EMM B;  4L3H D;  2AGY A;  4NSX A;  4RE5 A;  3U4Y A;  4JT6 C;  2H9L A;  4CY3 A;  2OK6 A;  4K3I D;  3KRX B;  2J55 H;  4QAM A;  3AL8 B;  3NVQ A;  3I2N A;  4MK0 B;  3EI3 A;  3FM0 A;  4FAV D;  5IGO A;  3RLM D;  4NEN A;  1PGU A;  5A2Q g;  1UOP A;  3AH8 B;  3P4F A;  4GGD A;  3NVN A;  5EM2 B;  3IVM A;  5THA A;  5FKR A;  2I0R A;  4X61 B;  3MUO A;  2PM7 B;  1MDA H;  3KRW B;  3MKQ A;  3V7D B;  2AGW A;  3JZH A;  1TBG A;  4E5Z B;  2BKL A;  5CXC B;  4UM9 A;  2YNO A;  5CYK A;  4FA4 D;  4NC4 A;  2I3T A;  4WJK A;  4FA9 D;  3PXT D;  3T3P A;  2CE9 A;  4DNW A;  4J8B A;  3DXM C;  4CZY A;  4A11 B;  1U2V C;  2IUV A;  3IKO A;  3J80 g;  3B7F A;  3EQ7 A;  5E6S A;  1BPO A;  2I0T A;  4X63 B;  4GGA A;  4EWR A;  2TRC B;  3I7L A;  2W18 A;  5FFG A;  5I5M A;  4ZOX A;  1YFQ A;  2QXV A;  2YNN A;  2HU5 A;  1A0R B;  3ZE1 A;  3EI4 B;  2H68 A;  3VGZ A;  1MG2 A;  4J86 A;  4J0W A;  4FHL A;  4CY2 A;  2VZ3 A;  4PC0 A;  3FRX A;  4A0B B;  3L4O D;  3SMR A;  3MXX A;  4J84 A;  1QFM A;  1JMX B;  1E8N A;  2HES X;  4R7A B;  3OF7 A;  3C99 A;  3PVU B;  4J77 A;  3DWL C;  4YVD A;  3EQ8 A;  1E5T A;  4ZOV A;  3CFS B;  5M5R A;  4CI3 A;  4WK2 A;  3UVL A;  4G55 A;  3C75 H;  1P22 A;  1GOT B;  4IRZ A;  3A0F A;  1K8K C;  3VH0 A;  3IIW A;  2I0S A;  2PM9 B;  3NIF A;  3RRM C;  4FAN D;  4ERY A;  1TYE A;  3AL8 A;  2CO0 C;  5M61 A;  4CY5 A;  5EAR A;  1B9Y A;  4JD2 C;  3QI0 A;  2B5M A;  5EM2 A;  4MMX A;  2H13 A;  2XDW A;  4D6V A;  3RMZ D;  3RFH A;  3JPX A; 
#chains in the Genus database with same CATH homology
 4X60 B;  4J79 A;  5AJA A;  3SBP A;  4QQE A;  1PEV A;  4E5Z A;  4L9O A;  5CXC A;  2CNX A;  4A09 A;  2P9I C;  5C2W B;  5HYN B;  2O9K A;  4FA5 D;  4FB1 D;  4J8G A;  2OVP B;  4UI9 R;  5EAP A;  4A2L A;  4E54 B;  3DSM A;  5FXY A;  3RFG A;  3ULE C;  2H6K A;  2I3S A;  5EMK B;  1S4U X;  3BG0 A;  3EMH A;  3OKY A;  2HKR A;  1K32 A;  2IAA A;  2OVR B;  2YBA A;  4J0X A;  4O3U B;  5GXI A;  2P9U C;  4FA1 D;  3DM0 A;  4K3J B;  5GMK n;  3ODT A;  5FLX g;  3SJL D;  3EI4 A;  5IJ8 E;  4Y7R A;  2J57 G;  1U4C A;  4LG8 A;  4PBZ A;  3SXT D;  4A0B A;  3NVX A;  3CIK B;  5GXH A;  4G56 B;  3JZG A;  3EU7 A;  4PNK B;  4BH6 A;  4GQB B;  2OVQ B;  1MG3 A;  3OKW A;  4HDJ A;  4ZN4 A;  5IT9 g;  2HXC A;  4XYH A;  4D0K A;  2AGX A;  2Z2P A;  3F3G A;  3SWS D;  2IUQ A;  4GM3 A;  5I5J A;  1XKS A;  5H14 A;  2PM6 B;  2MTA H;  2OIZ A;  3I8E A;  3PXS D;  2GC7 A;  2Z2O A;  3I89 A;  5IJ7 E;  4ZOZ A;  4O9D A;  2B4E A;  4CI2 A;  3OW8 A;  2PM9 A;  4L1Q D;  5IGQ A;  2H9M A;  3JZN A;  4ERQ A;  4A08 B;  5EMJ B;  5H1M A;  3RN1 D;  3L4M D;  2H9N A;  4JSV C;  3C5M A;  2XL2 A;  4CZV A;  3J81 g;  3F3P A;  5AFU 3;  4AOW A;  5CXB B;  2IWK A;  4O1Q D;  2B5N A;  4O45 A;  5FKT A;  3UR4 A;  3C9C A;  2OK4 A;  2XU7 A;  5H17 A;  3JAM g;  3PE7 A;  2H6Q A;  3ORV D;  4BL0 A;  3EG6 A;  4E54 A;  3PVW B;  1JMZ B;  5FKS A;  5HE3 B;  1QNI A;  2H6N A;  5I5I A;  4Z8L A;  3IIY A;  4GGC A;  2H14 A;  4ZOY A;  3SN6 B;  5HE2 B;  2AGL A;  4J78 A;  4JXM A;  4QL1 A;  3DXK C;  3EI1 B;  2QC5 A;  2BBK H;  2XYI A;  3UVK A;  4AEZ A;  4GMB A;  2B5L A;  4A2M A;  3SVW D;  4L3G D;  3JRO A;  5HQG A;  4I79 A;  3F3F A;  2CN2 A;  3UKU C;  3ZWL B;  5TF2 A;  4A7J A;  1PBY B;  2G9A A;  3I7N A;  3BWS A;  3SBR A;  2J56 H;  2Q7Q A;  2CO0 A;  4N14 A;  4A11 A;  3I7O A;  4XYI A;  5IC7 A;  1GXR A;  2H9P A;  3OTT A;  3JB9 L;  2HKM A;  2XL3 A;  2P9S C;  2HYE A;  3SBQ A;  3EI2 B;  3N0E A;  1FWX A;  3AFC A;  3CFV A;  3SLE D;  4GM9 A;  1L0Q A;  4U1E I;  4A08 A;  3MZK A;  1GG2 B;  3JRP A;  4PXW A;  3MKS B;  1SQ9 A;  2BCJ B;  1B9X A;  4IMM A;  5TEE A;  2H3X A;  4BUJ C;  3N0D A;  2HJ4 A;  1SQJ A;  3PXW D;  3OKT A;  1NEX B;  5CXB A;  2Z2N A;  2OJY A;  2H47 A;  1N6E A;  4JSN C;  4KFM B;  1GP2 B;  2UZY B;  3IJ0 A;  3UVN A;  3OL2 B;  5C2V B;  2AQ5 A;  3PSL A;  3I8C A;  5HE1 B;  3HFQ A;  2YNP A;  4QT8 A;  4ERZ A;  3V5W B;  2G99 A;  2P9P C;  4JSX C;  2P9L C;  4OZU A;  5TDH B;  5JWZ A;  4OWR A;  5KDO B;  5EML B;  4A09 B;  4LG9 A;  5EAL A;  2AH0 A;  4PSX B;  2IUP A;  1JJU B;  5HE0 B;  4J87 A;  3I7P A;  1SHY B;  4TZ4 A;  4CI1 A;  3EI1 A;  3RN0 D;  2GC4 A;  4A0A B;  5K19 A;  5FA5 B;  1XIP A;  4U7A A;  3EWE A;  5FQD A;  1JOF A;  2UZX B;  4PSW B;  3IJ1 A;  3W15 A;  5C9Z B;  4GQ2 P;  5K1C C;  3OKY B;  2GNQ A;  3I7H A;  2IUR A;  3EI3 B;  1RI6 A;  2PBI B;  1Q47 A;  4X3E A;  2IWF A;  4H5J A;  3K26 A;  4J82 A;  4ES0 A;  3BG1 A;  2EBS A;  2P9K C;  3RSE C;  3MMY A;  4CI8 A;  1ERJ A;  4GM8 A;  2CE8 A;  5CYK B;  3SHF A;  5AMS A;  5B4W A;  2AGZ A;  3EI2 A;  1TYQ C;  4J73 A;  3SFZ A;  4QRJ A;  3SCY A;  4JT5 C;  4GQ1 A;  3MZL A;  3UVM A;  3GRE A;  4H5I A;  4PBY A;  3IJC A;  4ESG A;  1OMW B;  5EAM A;  3UKR C;  2YMU A;  1N6D A;  3K27 A;  4GZ8 A;  1NR0 A;  5TEF A;  4CC9 A;  4JSP C;  4LGN A;  4Y5R D;  4FWW A;  4IA9 A;  4XEI C;  5SXM A;  3E0C A;  3I7K A;  3AL9 A;  5GSA A;  3OL2 A;  2CN3 A;  3UVO A;  3VA6 A;  2HJB A;  5FKQ A;  1OLZ A;  4O3T B;  1XHM A;  3V9F A;  2YB8 B;  2AH1 A;  2P9N C;  1R5M A;  1VYH C;  4CY1 A;  3GFC A;  3FGB A;  3PSC B;  1N6F A;  1PI6 A;  4CZX A;  4J81 A;  4A0A A;  5EMM B;  4L3H D;  2AGY A;  4NSX A;  3U4Y A;  4JT6 C;  2H9L A;  4CY3 A;  2OK6 A;  4K3I D;  3KRX B;  2J55 H;  3AL8 B;  3NVQ A;  3I2N A;  4MK0 B;  3EI3 A;  3FM0 A;  4FAV D;  5IGO A;  3RLM D;  1PGU A;  5A2Q g;  3AH8 B;  3P4F A;  4GGD A;  3NVN A;  5EM2 B;  5THA A;  5FKR A;  2I0R A;  4X61 B;  2PM7 B;  1MDA H;  3KRW B;  3MKQ A;  3V7D B;  2AGW A;  3JZH A;  1TBG A;  4E5Z B;  5CXC B;  2YNO A;  5CYK A;  4FA4 D;  4FA9 D;  2I3T A;  3PXT D;  2CE9 A;  4J8B A;  3DXM C;  4CZY A;  4A11 B;  1U2V C;  2IUV A;  3IKO A;  3J80 g;  3B7F A;  2I0T A;  4X63 B;  4GGA A;  4EWR A;  2TRC B;  3I7L A;  2W18 A;  5I5M A;  4ZOX A;  1YFQ A;  2QXV A;  2YNN A;  1A0R B;  3EI4 B;  2H68 A;  3VGZ A;  1MG2 A;  4J86 A;  4J0W A;  4FHL A;  4CY2 A;  4PC0 A;  3FRX A;  4A0B B;  3L4O D;  3SMR A;  3MXX A;  4J84 A;  1JMX B;  2HES X;  4R7A B;  3C99 A;  3PVU B;  4J77 A;  3DWL C;  4YVD A;  4ZOV A;  3CFS B;  4CI3 A;  3UVL A;  3C75 H;  1P22 A;  1GOT B;  3A0F A;  1K8K C;  3VH0 A;  3IIW A;  2I0S A;  2PM9 B;  3RRM C;  4FAN D;  4ERY A;  3AL8 A;  2CO0 C;  4CY5 A;  5EAR A;  1B9Y A;  4JD2 C;  2B5M A;  5EM2 A;  2H13 A;  4D6V A;  3RMZ D;  3RFH A;  3JPX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...