2CO0C

Wdr5 and unmodified histone h3 complex at 2.25 angstrom
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
304
structure length
304
Chain Sequence
b'VKPNYALMFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGMCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD-REPEAT PROTEIN 5
publication title Histone H3 Recognition and Presentation by the Wdr5 Module of the Mll1 Complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 94
structure length 304
sequence length 304
ec nomenclature
pdb deposition date 2006-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2co0C00
2OK4A 1YFQA 5EMMB 3EMHA 5FKRA 5HYNB 4A09B 3JRPA 5CYKB 3PXTD 2Q7QA 4JT6C 4GQ2P 5EMLB 4XEIC 3PXSD 4QQEA 4J82A 4A7JA 3K27A 4Z8LA 4PNKB 1SHYB 4L3GD 4BH6A 4CI2A 4JXMA 2B5MA 2UZXB 5AFU3 1PBYB 2OIZA 1XHMA 4I79A 4A2MA 4L9OA 2H14A 1NEXB 2B5NA 3BG1A 3A0FA 4ZOYA 3SBPA 4EWRA 2H13A 2AQ5A 2IWFA 2GC7A 3JZGA 4PBYA 4A2LA 2I0SA 5K19A 4JSXC 3RSEC 2P9IC 3PVUB 4L1QD 4JD2C 5GSAA 3C9CA 3V9FA 2OJYA 5CXCB 2HKRA 2J56H 3EI4B 5H17A 4E5ZB 1FWXA 5HE0B 4D0KA 2P9UC 4K3JB 1PI6A 4GQ1A 3SVWD 2CE8A 1XKSA 4O45A 2H9LA 4A08A 5B4WA 4CY2A 3MMYA 3KRXB 3IKOA 3L4OD 4J8GA 4A0AB 3JPXA 2YNOA 1MG3A 4K3ID 1QNIA 3UVNA 5EM2A 3VGZA 5C2VB 3EU7A 1N6FA 4FAVD 4GM8A 4GM3A 3AL9A 3IIYA 5EALA 2GNQA 4X61B 4FB1D 3DXMC 4AEZA 3F3PA 5HE3B 3BWSA 2HXCA 4J77A 3I7NA 3JB9L 4ESGA 3N0EA 4BUJC 5A2Qg 2P9NC 2H9NA 3W15A 4ERQA 3UVMA 4E5ZA 3EI1A 3I7HA 3V7DB 4PSXB 3JROA 2AGWA 5H14A 5GXHA 3GFCA 4ES0A 5C9ZB 4IA9A 3RFHA 1U2VC 2HJBA 3F3GA 3OKYB 1P22A 4MK0B 3MKSB 5FQDA 2W18A 4FA9D 3C75H 4J0XA 3HFQA 3EI3A 3UVOA 4CY3A 2G9AA 3MZKA 4CZXA 3SMRA 5FA5B 3J81g 4O9DA 4PC0A 1TYQC 2CN3A 4JSNC 2IURA 3N0DA 5AJAA 1PGUA 3UKRC 3AFCA 5FKTA 5JWZA 4IMMA 3SJLD 2P9LC 4UI9R 1MDAH 3IJCA 4FA1D 2AH1A 1SQ9A 5I5IA 3MKQA 2P9KC 4J0WA 3IJ1A 2YNPA 2YB8B 4GGCA 2UZYB 4BL0A 4Y7RA 2H9PA 2H47A 3I7KA 4A08B 3E0CA 4LGNA 5IJ7E 3RN0D 4J78A 3EWEA 4CI3A 2I0RA 2I0TA 5FLXg 3PSLA 2I3TA 2IUQA 4L3HD 3V5WB 3J80g 3OTTA 3OKYA 2OK6A 5EM2B 5HE1B 4LG8A 3I8EA 3PE7A 3K26A 5I5JA 4J8BA 4FHLA 5EMKB 2BCJB 2TRCB 5FXYA 4HDJA 4LG9A 3B7FA 2AGXA 4G56B 3I7PA 3CFSB 1N6DA 2PM6B 4H5IA 1R5MA 3I7LA 3EI1B 3KRWB 3ZWLB 2XYIA 2CO0A 3AL8A 3RMZD 4PBZA 4GM9A 3SFZA 1JOFA 3SLED 3EI3B 1U4CA 2AGZA 4NSXA 3I89A 2P9SC 3PSCB 4X3EA 3RFGA 4GGDA 5FKQA 2H9MA 3I8CA 2H68A 4CC9A 2AGYA 5THAA 5GXIA 1JMXB 4CZVA 4A11B 4O1QD 1NR0A 3SCYA 1SQJA 1S4UX 3DXKC 3NVXA 2J55H 3IIWA 4J73A 2AGLA 2Z2OA 4J84A 3FM0A 3SBRA 3SN6B 4OWRA 5IJ8E 2HKMA 3CFVA 2CE9A 2I3SA 3BG0A 1GOTB 1JJUB 2Z2PA 4QL1A 2J57G 4R7AB 3ULEC 4KFMB 4X63B 2MTAH 5K1CC 2HJ4A 4FA5D 2QXVA 2CN2A 3PVWB 4CY1A 3RLMD 4CY5A 5AMSA 3DSMA 3RN1D 4FWWA 2H6NA 5FKSA 4J86A 3UVKA 3VA6A 2IUVA 3SWSD 3NVNA 3SHFA 2YNNA 4A11A 3OW8A 3JZNA 2YBAA 4JSVC 4PXWA 4O3TB 3AL8B 3DWLC 3DM0A 5GMKn 3ODTA 4GGAA 3FRXA 1VYHC 1B9YA 3MXXA 3OL2A 2EBSA 4CI8A 4U1EI 3UR4A 4N14A 5EMJB 3MZLA 4O3UB 5I5MA 3PXWD 5TEFA 1TBGA 3SXTD 1B9XA 1GP2B 4E54A 1N6EA 3I7OA 5CXBB 3L4MD 3GREA 1K8KC 3C99A 4JSPC 2B5LA 4J79A 4GZ8A 4QRJA 4ERZA 5EAPA 2H6KA 3P4FA 1MG2A 3C5MA 5EAMA 2H3XA 1ERJA 3AH8B 5SXMA 5IC7A 2P9PC 4CI1A 5IGQA 4A0BB 2PM9A 2OVQB 3OKWA 3SBQA 3RRMC 4J87A 2PM7B 4OZUA 2H6QA 1K32A 5TEEA 3EG6A 4A09A 5CYKA 3UVLA 4H5JA 2XL3A 1Q47A 1GG2B 1OMWB 5HQGA 3CIKB 1L0QA 4ZN4A 2B4EA 5IGOA 4ERYA 3FGBA 5CXBA 4ZOXA 5TDHB 4PSWB 3NVQA 4GMBA 4ZOZA 2HESX 3EI2B 2BBKH 2CNXA 2AH0A 4Y5RD 4QT8A 1JMZB 2IUPA 5KDOB 2GC4A 2IAAA 3JAMg 2YMUA 4AOWA 5EARA 3U4YA 1PEVA 2OVRB 4A0BA 4CZYA 3OL2B 1OLZA 5HE2B 3OKTA 3UKUC 5H1MA 5C2WB 4JT5C 2PBIB 2HYEA 3JZHA 3F3FA 4YVDA 4D6VA 2IWKA 5CXCA 4GQBB 4E54B 3EI4A 4X60B 2CO0C 2G99A 3ORVD 4TZ4A 5IT9g 2QC5A 2O9KA 1A0RB 2XL2A 3VH0A 2OVPB 2Z2NA 3IJ0A 4FA4D 4XYIA 4FAND 4ZOVA 4U7AA 2XU7A 3EI2A 3I2NA 1RI6A 4XYHA 4A0AA 5TF2A 1XIPA 4J81A 2PM9B 1GXRA
chains in the Genus database with same CATH superfamily
2OK4A 1YFQA 5EMMB 4RE5A 3EMHA 5FKRA 3EQ8A 5HYNB 4A09B 3JRPA 5CYKB 3PXTD 2Q7QA 4JT6C 4GQ2P 5EMLB 4XEIC 3PXSD 1UOOA 4QQEA 4J82A 2VDKA 4A7JA 3K27A 4Z8LA 4PNKB 2VDOA 1SHYB 4L3GD 4BH6A 4CI2A 5E6RA 1YR2A 4JXMA 2B5MA 2UZXB 5AFU3 1VE7A 4G1EA 1PBYB 4MMZA 2OIZA 3K6SA 1C9IA 4DNUA 1XHMA 3ZDYA 4I79A 4A2MA 4L9OA 3V4VA 2H14A 4L1MA 1NEXB 2B5NA 3BG1A 3A0FA 4ZOYA 4QAMA 2EICA 2BKLA 3SBPA 4EWRA 2H13A 2AQ5A 2IWFA 2GC7A 3JZGA 1H2WA 4PBYA 4A2LA 2I0SA 5K19A 2VDRA 4JSXC 4UM8A 3RSEC 2P9IC 4WK2A 1GOHA 1H2ZA 3PVUB 4L1QD 4JD2C 5GSAA 3C9CA 3V9FA 2OJYA 5CXCB 2HKRA 2J56H 3EI4B 5H17A 4E5ZB 2QZPA 1FWXA 5HE0B 4D0KA 2P9UC 4K3JB 1PI6A 4GQ1A 3SVWD 2CE8A 4O2WA 1XKSA 4O45A 4WK4A 1M1XA 2H9LA 4A08A 1VE6A 5B4WA 4CY2A 3MMYA 3KRXB 3IKOA 3L4OD 4J8GA 4DNWA 4A0AB 2VDMA 3JPXA 2YNOA 1E5TA 1MG3A 4K3ID 3VI3A 1QNIA 3UVNA 5EM2A 3VGZA 5C2VB 3EU7A 1N6FA 4FAVD 4D9SA 4GM8A 4GM3A 3AL9A 3IIYA 5EALA 3EQ9A 2GNQA 4X61B 4FB1D 3DXMC 3EQ7A 4AEZA 3F3PA 5HE3B 3BWSA 2HXCA 3IUQA 4J77A 4O02A 3I7NA 4NBMA 3JB9L 4ESGA 3N0EA 4Z7QA 4BUJC 5A2Qg 2P9NC 2H9NA 2HU8A 3W15A 2EIEA 4ERQA 3UVMA 4E5ZA 3ZDZA 3EI1A 3I7HA 3V7DB 4PSXB 3JROA 2AGWA 5H14A 5GXHA 3GFCA 4ES0A 5C9ZB 5M5UA 4IA9A 3RFHA 1U2VC 2HJBA 3F3GA 3OKYB 1P22A 4MK0B 3MKSB 5FQDA 5M5VA 2W18A 4FA9D 3C75H 4J0XA 3HFQA 3EI3A 3UVOA 4CY3A 2G9AA 3MZKA 3IUMA 4CZXA 3SMRA 5FA5B 2EIBA 3J81g 4O9DA 3FCSA 1A12A 4PC0A 1TYQC 2CN3A 4JSNC 2IURA 3N0DA 5AJAA 1PGUA 3NIDA 3UKRC 3AFCA 5FKTA 5JWZA 4IMMA 3SJLD 4AMYA 2P9LC 4UI9R 1MDAH 4BCBA 3IJCA 4FA1D 2AH1A 3DDUA 1SQ9A 5I5IA 3MKQA 2P9KC 4J0WA 3IJ1A 1H2YA 2YNPA 2YB8B 4GGCA 2UZYB 4BL0A 5M5RA 4Y7RA 2H9PA 2H47A 3I7KA 4A08B 3E0CA 4LGNA 5IJ7E 3RN0D 4J78A 1JTDB 3EWEA 4CI3A 2I0RA 2I0TA 5FLXg 2EIDA 3IULA 3PSLA 2I3TA 2IUQA 4L3HD 3V5WB 3J80g 3OTTA 3OKYA 5M5TA 2OK6A 5EM2B 5HE1B 4LG8A 3VI4A 3I8EA 3PE7A 3K26A 4NENA 5I5JA 4J8BA 4FHLA 5EMKB 2BCJB 2TRCB 5FXYA 4HDJA 3QHYB 4LG9A 3KCIA 4NC4A 3B7FA 2AGXA 1E8MA 4G56B 3I7PA 3CFSB 1N6DA 4NAAA 1O6GA 2PM6B 4UM9A 4H5IA 4AMZA 1R5MA 3I7LA 1C9LA 4BCCA 3EI1B 4Z7NA 3KRWB 3ZWLB 2QR5A 2XYIA 2CO0A 1QFSA 3V4PA 3MVDK 3AL8A 3RMZD 4PBZA 4GM9A 2XE4A 3SFZA 1JOFA 3SLED 4G55A 3K71A 3O4GA 3EI3B 1U4CA 2AGZA 4NSXA 3I89A 3IUJA 2P9SC 3PSCB 4X3EA 3RFGA 4JHNA 4GGDA 1UOQA 5FKQA 2H9MA 3I8CA 2H68A 4JHPC 4CC9A 2AGYA 3NIFA 5THAA 5GXIA 4WJKA 1JMXB 4CZVA 4A11B 4O1QD 1NR0A 3SCYA 1SQJA 1S4UX 3DXKC 3NVXA 2J55H 3IIWA 2JKXA 3IVMA 4AX4A 4J73A 2AGLA 2Z2OA 4J84A 3FM0A 3SBRA 3SN6B 4OWRA 5IJ8E 2XZGA 2HKMA 3IURA 3CFVA 2CE9A 2I3SA 3BG0A 1GOTB 1JJUB 2VDLA 2Z2PA 4QL1A 2J57G 4R7AB 3ULEC 4KFMB 4X63B 2MTAH 5K1CC 2HJ4A 4BP8A 4FA5D 2VDQA 1VZ2A 2QXVA 2CN2A 3PVWB 4CY1A 3RLMD 4CY5A 5AMSA 5C92A 3DSMA 5E6SA 3RN1D 4FWWA 2H6NA 5FKSA 3ZE0A 4J86A 2VDPA 3UVKA 3VA6A 2IUVA 3SWSD 3NVNA 3SHFA 2YNNA 4A11A 3OW8A 3ZE1A 3JZNA 2YBAA 2VC2A 4JSVC 4PXWA 4WK0A 4O3TB 5FFGA 3AL8B 3DWLC 3DM0A 5M61A 5GMKn 3ODTA 4GGAA 1TYEA 3NIGA 3T3MA 3FRXA 1VYHC 1B9YA 4RE6A 4AN1A 3MXXA 3OL2A 2EBSA 4CI8A 4U1EI 3UR4A 4N14A 5EMJB 3MZLA 4O3UB 5I5MA 3PXWD 5TEFA 1BPOA 1TBGA 3O4IA 3SXTD 1JV2A 1U8CA 1B9XA 1GP2B 1UTCA 4E54A 1N6EA 3I7OA 5CXBB 3L4MD 3GREA 1K8KC 3C99A 4JSPC 2B5LA 4J79A 4GZ8A 4QRJA 4ERZA 5EAPA 5HDBA 1L5GA 2H6KA 3P4FA 1MG2A 3C5MA 5EAMA 4DNVA 2H3XA 1ERJA 3AH8B 5SXMA 5IC7A 2P9PC 4CI1A 5IGQA 4A0BB 3IJEA 2PM9A 2OVQB 3OKWA 3SBQA 2WQ8A 3RRMC 4Z7OA 3GD1I 4BP9A 4J87A 4G1MA 2PM7B 4OZUA 2H6QA 3GC3B 1K32A 5TEEA 3IUNA 4BCDA 3EG6A 4A09A 2VZ1A 5CYKA 1QFMA 3UVLA 3ZDXA 3O4HA 4H5JA 2XL3A 1E8NA 1Q47A 1GG2B 2HU7A 1OMWB 1H2XA 1UOPA 3FCUA 5HQGA 5M5SA 3CIKB 2XDWA 1L0QA 4ZN4A 2B4EA 5IGOA 4ERYA 3FGBA 5CXBA 4ZOXA 5TDHB 4PSWB 3NVQA 4GMBA 4ZOZA 2HESX 3EI2B 2BBKH 2CNXA 2AH0A 4Y5RD 2VDNA 4QT8A 1JMZB 2IUPA 5KDOB 2GC4A 2IAAA 3JAMg 3MUOA 2HU5A 1I2MB 2YMUA 4AOWA 5EARA 3U4YA 1PEVA 1GOGA 2OVRB 4A0BA 4CZYA 3OL2B 1OLZA 1GOFA 5E6UA 3OKTA 5HE2B 1T2XA 3UKUC 3T3PA 5C86A 5H1MA 4MMXA 5C2WB 4JT5C 2PBIB 2HYEA 3JZHA 3F3FA 4YVDA 4D6VA 2IWKA 5CXCA 4GQBB 4E54B 3EI4A 1VZ3A 4MMYA 4X60B 4IRZA 4AN0A 2CO0C 2VZ3A 1K3IA 2G99A 3ORVD 4TZ4A 5IT9g 3O4JA 3K72A 2QC5A 2O9KA 1A0RB 2XL2A 5FFOA 3VH0A 1O6FA 2OVPB 2Z2NA 3IJ0A 4FA4D 4XYIA 4FAND 4ZOVA 4U7AA 2XU7A 3ZE2A 3QI0A 3EI2A 3MUNA 3I2NA 1RI6A 4XYHA 4A0AA 5TF2A 3OF7A 1XIPA 4J81A 2PM9B 1GXRA
chains in the Genus database with same CATH topology
2OK4A 1YFQA 5EMMB 3EMHA 5FKRA 5HYNB 4A09B 3JRPA 5CYKB 3PXTD 2Q7QA 4JT6C 4GQ2P 5EMLB 4XEIC 3PXSD 4QQEA 4J82A 4A7JA 3K27A 4Z8LA 4PNKB 1SHYB 4L3GD 4BH6A 4CI2A 4JXMA 2B5MA 2UZXB 5AFU3 1PBYB 2OIZA 1XHMA 4I79A 4A2MA 4L9OA 2H14A 1NEXB 2B5NA 3BG1A 3A0FA 4ZOYA 3SBPA 4EWRA 2H13A 2AQ5A 2IWFA 2GC7A 3JZGA 4PBYA 4A2LA 2I0SA 5K19A 4JSXC 3RSEC 2P9IC 3PVUB 4L1QD 4JD2C 5GSAA 3C9CA 3V9FA 2OJYA 5CXCB 2HKRA 2J56H 3EI4B 5H17A 4E5ZB 1FWXA 5HE0B 4D0KA 2P9UC 4K3JB 1PI6A 4GQ1A 3SVWD 2CE8A 1XKSA 4O45A 2H9LA 4A08A 5B4WA 4CY2A 3MMYA 3KRXB 3IKOA 3L4OD 4J8GA 4A0AB 3JPXA 2YNOA 1MG3A 4K3ID 1QNIA 3UVNA 5EM2A 3VGZA 5C2VB 3EU7A 1N6FA 4FAVD 4GM8A 4GM3A 3AL9A 3IIYA 5EALA 2GNQA 4X61B 4FB1D 3DXMC 4AEZA 3F3PA 5HE3B 3BWSA 2HXCA 4J77A 3I7NA 3JB9L 4ESGA 3N0EA 4BUJC 5A2Qg 2P9NC 2H9NA 3W15A 4ERQA 3UVMA 4E5ZA 3EI1A 3I7HA 3V7DB 4PSXB 3JROA 2AGWA 5H14A 5GXHA 3GFCA 4ES0A 5C9ZB 4IA9A 3RFHA 1U2VC 2HJBA 3F3GA 3OKYB 1P22A 4MK0B 3MKSB 5FQDA 2W18A 4FA9D 3C75H 4J0XA 3HFQA 3EI3A 3UVOA 4CY3A 2G9AA 3MZKA 4CZXA 3SMRA 5FA5B 3J81g 4O9DA 4PC0A 1TYQC 2CN3A 4JSNC 2IURA 3N0DA 5AJAA 1PGUA 3UKRC 3AFCA 5FKTA 5JWZA 4IMMA 3SJLD 2P9LC 4UI9R 1MDAH 3IJCA 4FA1D 2AH1A 1SQ9A 5I5IA 3MKQA 2P9KC 4J0WA 3IJ1A 2YNPA 2YB8B 4GGCA 2UZYB 4BL0A 4Y7RA 2H9PA 2H47A 3I7KA 4A08B 3E0CA 4LGNA 5IJ7E 3RN0D 4J78A 3EWEA 4CI3A 2I0RA 2I0TA 5FLXg 3PSLA 2I3TA 2IUQA 4L3HD 3V5WB 3J80g 3OTTA 3OKYA 2OK6A 5EM2B 5HE1B 4LG8A 3I8EA 3PE7A 3K26A 5I5JA 4J8BA 4FHLA 5EMKB 2BCJB 2TRCB 5FXYA 4HDJA 4LG9A 3B7FA 2AGXA 4G56B 3I7PA 3CFSB 1N6DA 2PM6B 4H5IA 1R5MA 3I7LA 3EI1B 3KRWB 3ZWLB 2XYIA 2CO0A 3AL8A 3RMZD 4PBZA 4GM9A 3SFZA 1JOFA 3SLED 3EI3B 1U4CA 2AGZA 4NSXA 3I89A 2P9SC 3PSCB 4X3EA 3RFGA 4GGDA 5FKQA 2H9MA 3I8CA 2H68A 4CC9A 2AGYA 5THAA 5GXIA 1JMXB 4CZVA 4A11B 4O1QD 1NR0A 3SCYA 1SQJA 1S4UX 3DXKC 3NVXA 2J55H 3IIWA 4J73A 2AGLA 2Z2OA 4J84A 3FM0A 3SBRA 3SN6B 4OWRA 5IJ8E 2HKMA 3CFVA 2CE9A 2I3SA 3BG0A 1GOTB 1JJUB 2Z2PA 4QL1A 2J57G 4R7AB 3ULEC 4KFMB 4X63B 2MTAH 5K1CC 2HJ4A 4FA5D 2QXVA 2CN2A 3PVWB 4CY1A 3RLMD 4CY5A 5AMSA 3DSMA 3RN1D 4FWWA 2H6NA 5FKSA 4J86A 3UVKA 3VA6A 2IUVA 3SWSD 3NVNA 3SHFA 2YNNA 4A11A 3OW8A 3JZNA 2YBAA 4JSVC 4PXWA 4O3TB 3AL8B 3DWLC 3DM0A 5GMKn 3ODTA 4GGAA 3FRXA 1VYHC 1B9YA 3MXXA 3OL2A 2EBSA 4CI8A 4U1EI 3UR4A 4N14A 5EMJB 3MZLA 4O3UB 5I5MA 3PXWD 5TEFA 1TBGA 3SXTD 1B9XA 1GP2B 4E54A 1N6EA 3I7OA 5CXBB 3L4MD 3GREA 1K8KC 3C99A 4JSPC 2B5LA 4J79A 4GZ8A 4QRJA 4ERZA 5EAPA 2H6KA 3P4FA 1MG2A 3C5MA 5EAMA 2H3XA 1ERJA 3AH8B 5SXMA 5IC7A 2P9PC 4CI1A 5IGQA 4A0BB 2PM9A 2OVQB 3OKWA 3SBQA 3RRMC 4J87A 2PM7B 4OZUA 2H6QA 1K32A 5TEEA 3EG6A 4A09A 5CYKA 3UVLA 4H5JA 2XL3A 1Q47A 1GG2B 1OMWB 5HQGA 3CIKB 1L0QA 4ZN4A 2B4EA 5IGOA 4ERYA 3FGBA 5CXBA 4ZOXA 5TDHB 4PSWB 3NVQA 4GMBA 4ZOZA 2HESX 3EI2B 2BBKH 2CNXA 2AH0A 4Y5RD 4QT8A 1JMZB 2IUPA 5KDOB 2GC4A 2IAAA 3JAMg 2YMUA 4AOWA 5EARA 3U4YA 1PEVA 2OVRB 4A0BA 4CZYA 3OL2B 1OLZA 5HE2B 3OKTA 3UKUC 5H1MA 5C2WB 4JT5C 2PBIB 2HYEA 3JZHA 3F3FA 4YVDA 4D6VA 2IWKA 5CXCA 4GQBB 4E54B 3EI4A 4X60B 2CO0C 2G99A 3ORVD 4TZ4A 5IT9g 2QC5A 2O9KA 1A0RB 2XL2A 3VH0A 2OVPB 2Z2NA 3IJ0A 4FA4D 4XYIA 4FAND 4ZOVA 4U7AA 2XU7A 3EI2A 3I2NA 1RI6A 4XYHA 4A0AA 5TF2A 1XIPA 4J81A 2PM9B 1GXRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OK4 A;  1YFQ A;  5EMM B;  3EMH A;  5FKR A;  5HYN B;  4A09 B;  3JRP A;  5CYK B;  3PXT D;  2Q7Q A;  4JT6 C;  4GQ2 P;  5EML B;  4XEI C;  3PXS D;  4QQE A;  4J82 A;  4A7J A;  3K27 A;  4Z8L A;  4PNK B;  1SHY B;  4L3G D;  4BH6 A;  4CI2 A;  4JXM A;  2B5M A;  2UZX B;  5AFU 3;  1PBY B;  2OIZ A;  1XHM A;  4I79 A;  4A2M A;  4L9O A;  2H14 A;  1NEX B;  2B5N A;  3BG1 A;  3A0F A;  4ZOY A;  3SBP A;  4EWR A;  2H13 A;  2AQ5 A;  2IWF A;  2GC7 A;  3JZG A;  4PBY A;  4A2L A;  2I0S A;  5K19 A;  4JSX C;  3RSE C;  2P9I C;  3PVU B;  4L1Q D;  4JD2 C;  5GSA A;  3C9C A;  3V9F A;  2OJY A;  5CXC B;  2HKR A;  2J56 H;  3EI4 B;  5H17 A;  4E5Z B;  1FWX A;  5HE0 B;  4D0K A;  2P9U C;  4K3J B;  1PI6 A;  4GQ1 A;  3SVW D;  2CE8 A;  1XKS A;  4O45 A;  2H9L A;  4A08 A;  5B4W A;  4CY2 A;  3MMY A;  3KRX B;  3IKO A;  3L4O D;  4J8G A;  4A0A B;  3JPX A;  2YNO A;  1MG3 A;  4K3I D;  1QNI A;  3UVN A;  5EM2 A;  3VGZ A;  5C2V B;  3EU7 A;  1N6F A;  4FAV D;  4GM8 A;  4GM3 A;  3AL9 A;  3IIY A;  5EAL A;  2GNQ A;  4X61 B;  4FB1 D;  3DXM C;  4AEZ A;  3F3P A;  5HE3 B;  3BWS A;  2HXC A;  4J77 A;  3I7N A;  3JB9 L;  4ESG A;  3N0E A;  4BUJ C;  5A2Q g;  2P9N C;  2H9N A;  3W15 A;  4ERQ A;  3UVM A;  4E5Z A;  3EI1 A;  3I7H A;  3V7D B;  4PSX B;  3JRO A;  2AGW A;  5H14 A;  5GXH A;  3GFC A;  4ES0 A;  5C9Z B;  4IA9 A;  3RFH A;  1U2V C;  2HJB A;  3F3G A;  3OKY B;  1P22 A;  4MK0 B;  3MKS B;  5FQD A;  2W18 A;  4FA9 D;  3C75 H;  4J0X A;  3HFQ A;  3EI3 A;  3UVO A;  4CY3 A;  2G9A A;  3MZK A;  4CZX A;  3SMR A;  5FA5 B;  3J81 g;  4O9D A;  4PC0 A;  1TYQ C;  2CN3 A;  4JSN C;  2IUR A;  3N0D A;  5AJA A;  1PGU A;  3UKR C;  3AFC A;  5FKT A;  5JWZ A;  4IMM A;  3SJL D;  2P9L C;  4UI9 R;  1MDA H;  3IJC A;  4FA1 D;  2AH1 A;  1SQ9 A;  5I5I A;  3MKQ A;  2P9K C;  4J0W A;  3IJ1 A;  2YNP A;  2YB8 B;  4GGC A;  2UZY B;  4BL0 A;  4Y7R A;  2H9P A;  2H47 A;  3I7K A;  4A08 B;  3E0C A;  4LGN A;  5IJ7 E;  3RN0 D;  4J78 A;  3EWE A;  4CI3 A;  2I0R A;  2I0T A;  5FLX g;  3PSL A;  2I3T A;  2IUQ A;  4L3H D;  3V5W B;  3J80 g;  3OTT A;  3OKY A;  2OK6 A;  5EM2 B;  5HE1 B;  4LG8 A;  3I8E A;  3PE7 A;  3K26 A;  5I5J A;  4J8B A;  4FHL A;  5EMK B;  2BCJ B;  2TRC B;  5FXY A;  4HDJ A;  4LG9 A;  3B7F A;  2AGX A;  4G56 B;  3I7P A;  3CFS B;  1N6D A;  2PM6 B;  4H5I A;  1R5M A;  3I7L A;  3EI1 B;  3KRW B;  3ZWL B;  2XYI A;  2CO0 A;  3AL8 A;  3RMZ D;  4PBZ A;  4GM9 A;  3SFZ A;  1JOF A;  3SLE D;  3EI3 B;  1U4C A;  2AGZ A;  4NSX A;  3I89 A;  2P9S C;  3PSC B;  4X3E A;  3RFG A;  4GGD A;  5FKQ A;  2H9M A;  3I8C A;  2H68 A;  4CC9 A;  2AGY A;  5THA A;  5GXI A;  1JMX B;  4CZV A;  4A11 B;  4O1Q D;  1NR0 A;  3SCY A;  1SQJ A;  1S4U X;  3DXK C;  3NVX A;  2J55 H;  3IIW A;  4J73 A;  2AGL A;  2Z2O A;  4J84 A;  3FM0 A;  3SBR A;  3SN6 B;  4OWR A;  5IJ8 E;  2HKM A;  3CFV A;  2CE9 A;  2I3S A;  3BG0 A;  1GOT B;  1JJU B;  2Z2P A;  4QL1 A;  2J57 G;  4R7A B;  3ULE C;  4KFM B;  4X63 B;  2MTA H;  5K1C C;  2HJ4 A;  4FA5 D;  2QXV A;  2CN2 A;  3PVW B;  4CY1 A;  3RLM D;  4CY5 A;  5AMS A;  3DSM A;  3RN1 D;  4FWW A;  2H6N A;  5FKS A;  4J86 A;  3UVK A;  3VA6 A;  2IUV A;  3SWS D;  3NVN A;  3SHF A;  2YNN A;  4A11 A;  3OW8 A;  3JZN A;  2YBA A;  4JSV C;  4PXW A;  4O3T B;  3AL8 B;  3DWL C;  3DM0 A;  5GMK n;  3ODT A;  4GGA A;  3FRX A;  1VYH C;  1B9Y A;  3MXX A;  3OL2 A;  2EBS A;  4CI8 A;  4U1E I;  3UR4 A;  4N14 A;  5EMJ B;  3MZL A;  4O3U B;  5I5M A;  3PXW D;  5TEF A;  1TBG A;  3SXT D;  1B9X A;  1GP2 B;  4E54 A;  1N6E A;  3I7O A;  5CXB B;  3L4M D;  3GRE A;  1K8K C;  3C99 A;  4JSP C;  2B5L A;  4J79 A;  4GZ8 A;  4QRJ A;  4ERZ A;  5EAP A;  2H6K A;  3P4F A;  1MG2 A;  3C5M A;  5EAM A;  2H3X A;  1ERJ A;  3AH8 B;  5SXM A;  5IC7 A;  2P9P C;  4CI1 A;  5IGQ A;  4A0B B;  2PM9 A;  2OVQ B;  3OKW A;  3SBQ A;  3RRM C;  4J87 A;  2PM7 B;  4OZU A;  2H6Q A;  1K32 A;  5TEE A;  3EG6 A;  4A09 A;  5CYK A;  3UVL A;  4H5J A;  2XL3 A;  1Q47 A;  1GG2 B;  1OMW B;  5HQG A;  3CIK B;  1L0Q A;  4ZN4 A;  2B4E A;  5IGO A;  4ERY A;  3FGB A;  5CXB A;  4ZOX A;  5TDH B;  4PSW B;  3NVQ A;  4GMB A;  4ZOZ A;  2HES X;  3EI2 B;  2BBK H;  2CNX A;  2AH0 A;  4Y5R D;  4QT8 A;  1JMZ B;  2IUP A;  5KDO B;  2GC4 A;  2IAA A;  3JAM g;  2YMU A;  4AOW A;  5EAR A;  3U4Y A;  1PEV A;  2OVR B;  4A0B A;  4CZY A;  3OL2 B;  1OLZ A;  5HE2 B;  3OKT A;  3UKU C;  5H1M A;  5C2W B;  4JT5 C;  2PBI B;  2HYE A;  3JZH A;  3F3F A;  4YVD A;  4D6V A;  2IWK A;  5CXC A;  4GQB B;  4E54 B;  3EI4 A;  4X60 B;  2CO0 C;  2G99 A;  3ORV D;  4TZ4 A;  5IT9 g;  2QC5 A;  2O9K A;  1A0R B;  2XL2 A;  3VH0 A;  2OVP B;  2Z2N A;  3IJ0 A;  4FA4 D;  4XYI A;  4FAN D;  4ZOV A;  4U7A A;  2XU7 A;  3EI2 A;  3I2N A;  1RI6 A;  4XYH A;  4A0A A;  5TF2 A;  1XIP A;  4J81 A;  2PM9 B;  1GXR A; 
#chains in the Genus database with same CATH topology
 2OK4 A;  1YFQ A;  5EMM B;  4RE5 A;  3EMH A;  5FKR A;  3EQ8 A;  5HYN B;  4A09 B;  3JRP A;  5CYK B;  3PXT D;  2Q7Q A;  4JT6 C;  4GQ2 P;  5EML B;  4XEI C;  3PXS D;  1UOO A;  4QQE A;  4J82 A;  2VDK A;  4A7J A;  3K27 A;  4Z8L A;  4PNK B;  2VDO A;  1SHY B;  4L3G D;  4BH6 A;  4CI2 A;  5E6R A;  1YR2 A;  4JXM A;  2B5M A;  2UZX B;  5AFU 3;  1VE7 A;  4G1E A;  1PBY B;  4MMZ A;  2OIZ A;  3K6S A;  1C9I A;  4DNU A;  1XHM A;  3ZDY A;  4I79 A;  4A2M A;  4L9O A;  3V4V A;  2H14 A;  4L1M A;  1NEX B;  2B5N A;  3BG1 A;  3A0F A;  4ZOY A;  4QAM A;  2EIC A;  2BKL A;  3SBP A;  4EWR A;  2H13 A;  2AQ5 A;  2IWF A;  2GC7 A;  3JZG A;  1H2W A;  4PBY A;  4A2L A;  2I0S A;  5K19 A;  2VDR A;  4JSX C;  4UM8 A;  3RSE C;  2P9I C;  4WK2 A;  1GOH A;  1H2Z A;  3PVU B;  4L1Q D;  4JD2 C;  5GSA A;  3C9C A;  3V9F A;  2OJY A;  5CXC B;  2HKR A;  2J56 H;  3EI4 B;  5H17 A;  4E5Z B;  2QZP A;  1FWX A;  5HE0 B;  4D0K A;  2P9U C;  4K3J B;  1PI6 A;  4GQ1 A;  3SVW D;  2CE8 A;  4O2W A;  1XKS A;  4O45 A;  4WK4 A;  1M1X A;  2H9L A;  4A08 A;  1VE6 A;  5B4W A;  4CY2 A;  3MMY A;  3KRX B;  3IKO A;  3L4O D;  4J8G A;  4DNW A;  4A0A B;  2VDM A;  3JPX A;  2YNO A;  1E5T A;  1MG3 A;  4K3I D;  3VI3 A;  1QNI A;  3UVN A;  5EM2 A;  3VGZ A;  5C2V B;  3EU7 A;  1N6F A;  4FAV D;  4D9S A;  4GM8 A;  4GM3 A;  3AL9 A;  3IIY A;  5EAL A;  3EQ9 A;  2GNQ A;  4X61 B;  4FB1 D;  3DXM C;  3EQ7 A;  4AEZ A;  3F3P A;  5HE3 B;  3BWS A;  2HXC A;  3IUQ A;  4J77 A;  4O02 A;  3I7N A;  4NBM A;  3JB9 L;  4ESG A;  3N0E A;  4Z7Q A;  4BUJ C;  5A2Q g;  2P9N C;  2H9N A;  2HU8 A;  3W15 A;  2EIE A;  4ERQ A;  3UVM A;  4E5Z A;  3ZDZ A;  3EI1 A;  3I7H A;  3V7D B;  4PSX B;  3JRO A;  2AGW A;  5H14 A;  5GXH A;  3GFC A;  4ES0 A;  5C9Z B;  5M5U A;  4IA9 A;  3RFH A;  1U2V C;  2HJB A;  3F3G A;  3OKY B;  1P22 A;  4MK0 B;  3MKS B;  5FQD A;  5M5V A;  2W18 A;  4FA9 D;  3C75 H;  4J0X A;  3HFQ A;  3EI3 A;  3UVO A;  4CY3 A;  2G9A A;  3MZK A;  3IUM A;  4CZX A;  3SMR A;  5FA5 B;  2EIB A;  3J81 g;  4O9D A;  3FCS A;  1A12 A;  4PC0 A;  1TYQ C;  2CN3 A;  4JSN C;  2IUR A;  3N0D A;  5AJA A;  1PGU A;  3NID A;  3UKR C;  3AFC A;  5FKT A;  5JWZ A;  4IMM A;  3SJL D;  4AMY A;  2P9L C;  4UI9 R;  1MDA H;  4BCB A;  3IJC A;  4FA1 D;  2AH1 A;  3DDU A;  1SQ9 A;  5I5I A;  3MKQ A;  2P9K C;  4J0W A;  3IJ1 A;  1H2Y A;  2YNP A;  2YB8 B;  4GGC A;  2UZY B;  4BL0 A;  5M5R A;  4Y7R A;  2H9P A;  2H47 A;  3I7K A;  4A08 B;  3E0C A;  4LGN A;  5IJ7 E;  3RN0 D;  4J78 A;  1JTD B;  3EWE A;  4CI3 A;  2I0R A;  2I0T A;  5FLX g;  2EID A;  3IUL A;  3PSL A;  2I3T A;  2IUQ A;  4L3H D;  3V5W B;  3J80 g;  3OTT A;  3OKY A;  5M5T A;  2OK6 A;  5EM2 B;  5HE1 B;  4LG8 A;  3VI4 A;  3I8E A;  3PE7 A;  3K26 A;  4NEN A;  5I5J A;  4J8B A;  4FHL A;  5EMK B;  2BCJ B;  2TRC B;  5FXY A;  4HDJ A;  3QHY B;  4LG9 A;  3KCI A;  4NC4 A;  3B7F A;  2AGX A;  1E8M A;  4G56 B;  3I7P A;  3CFS B;  1N6D A;  4NAA A;  1O6G A;  2PM6 B;  4UM9 A;  4H5I A;  4AMZ A;  1R5M A;  3I7L A;  1C9L A;  4BCC A;  3EI1 B;  4Z7N A;  3KRW B;  3ZWL B;  2QR5 A;  2XYI A;  2CO0 A;  1QFS A;  3V4P A;  3MVD K;  3AL8 A;  3RMZ D;  4PBZ A;  4GM9 A;  2XE4 A;  3SFZ A;  1JOF A;  3SLE D;  4G55 A;  3K71 A;  3O4G A;  3EI3 B;  1U4C A;  2AGZ A;  4NSX A;  3I89 A;  3IUJ A;  2P9S C;  3PSC B;  4X3E A;  3RFG A;  4JHN A;  4GGD A;  1UOQ A;  5FKQ A;  2H9M A;  3I8C A;  2H68 A;  4JHP C;  4CC9 A;  2AGY A;  3NIF A;  5THA A;  5GXI A;  4WJK A;  1JMX B;  4CZV A;  4A11 B;  4O1Q D;  1NR0 A;  3SCY A;  1SQJ A;  1S4U X;  3DXK C;  3NVX A;  2J55 H;  3IIW A;  2JKX A;  3IVM A;  4AX4 A;  4J73 A;  2AGL A;  2Z2O A;  4J84 A;  3FM0 A;  3SBR A;  3SN6 B;  4OWR A;  5IJ8 E;  2XZG A;  2HKM A;  3IUR A;  3CFV A;  2CE9 A;  2I3S A;  3BG0 A;  1GOT B;  1JJU B;  2VDL A;  2Z2P A;  4QL1 A;  2J57 G;  4R7A B;  3ULE C;  4KFM B;  4X63 B;  2MTA H;  5K1C C;  2HJ4 A;  4BP8 A;  4FA5 D;  2VDQ A;  1VZ2 A;  2QXV A;  2CN2 A;  3PVW B;  4CY1 A;  3RLM D;  4CY5 A;  5AMS A;  5C92 A;  3DSM A;  5E6S A;  3RN1 D;  4FWW A;  2H6N A;  5FKS A;  3ZE0 A;  4J86 A;  2VDP A;  3UVK A;  3VA6 A;  2IUV A;  3SWS D;  3NVN A;  3SHF A;  2YNN A;  4A11 A;  3OW8 A;  3ZE1 A;  3JZN A;  2YBA A;  2VC2 A;  4JSV C;  4PXW A;  4WK0 A;  4O3T B;  5FFG A;  3AL8 B;  3DWL C;  3DM0 A;  5M61 A;  5GMK n;  3ODT A;  4GGA A;  1TYE A;  3NIG A;  3T3M A;  3FRX A;  1VYH C;  1B9Y A;  4RE6 A;  4AN1 A;  3MXX A;  3OL2 A;  2EBS A;  4CI8 A;  4U1E I;  3UR4 A;  4N14 A;  5EMJ B;  3MZL A;  4O3U B;  5I5M A;  3PXW D;  5TEF A;  1BPO A;  1TBG A;  3O4I A;  3SXT D;  1JV2 A;  1U8C A;  1B9X A;  1GP2 B;  1UTC A;  4E54 A;  1N6E A;  3I7O A;  5CXB B;  3L4M D;  3GRE A;  1K8K C;  3C99 A;  4JSP C;  2B5L A;  4J79 A;  4GZ8 A;  4QRJ A;  4ERZ A;  5EAP A;  5HDB A;  1L5G A;  2H6K A;  3P4F A;  1MG2 A;  3C5M A;  5EAM A;  4DNV A;  2H3X A;  1ERJ A;  3AH8 B;  5SXM A;  5IC7 A;  2P9P C;  4CI1 A;  5IGQ A;  4A0B B;  3IJE A;  2PM9 A;  2OVQ B;  3OKW A;  3SBQ A;  2WQ8 A;  3RRM C;  4Z7O A;  3GD1 I;  4BP9 A;  4J87 A;  4G1M A;  2PM7 B;  4OZU A;  2H6Q A;  3GC3 B;  1K32 A;  5TEE A;  3IUN A;  4BCD A;  3EG6 A;  4A09 A;  2VZ1 A;  5CYK A;  1QFM A;  3UVL A;  3ZDX A;  3O4H A;  4H5J A;  2XL3 A;  1E8N A;  1Q47 A;  1GG2 B;  2HU7 A;  1OMW B;  1H2X A;  1UOP A;  3FCU A;  5HQG A;  5M5S A;  3CIK B;  2XDW A;  1L0Q A;  4ZN4 A;  2B4E A;  5IGO A;  4ERY A;  3FGB A;  5CXB A;  4ZOX A;  5TDH B;  4PSW B;  3NVQ A;  4GMB A;  4ZOZ A;  2HES X;  3EI2 B;  2BBK H;  2CNX A;  2AH0 A;  4Y5R D;  2VDN A;  4QT8 A;  1JMZ B;  2IUP A;  5KDO B;  2GC4 A;  2IAA A;  3JAM g;  3MUO A;  2HU5 A;  1I2M B;  2YMU A;  4AOW A;  5EAR A;  3U4Y A;  1PEV A;  1GOG A;  2OVR B;  4A0B A;  4CZY A;  3OL2 B;  1OLZ A;  1GOF A;  5E6U A;  3OKT A;  5HE2 B;  1T2X A;  3UKU C;  3T3P A;  5C86 A;  5H1M A;  4MMX A;  5C2W B;  4JT5 C;  2PBI B;  2HYE A;  3JZH A;  3F3F A;  4YVD A;  4D6V A;  2IWK A;  5CXC A;  4GQB B;  4E54 B;  3EI4 A;  1VZ3 A;  4MMY A;  4X60 B;  4IRZ A;  4AN0 A;  2CO0 C;  2VZ3 A;  1K3I A;  2G99 A;  3ORV D;  4TZ4 A;  5IT9 g;  3O4J A;  3K72 A;  2QC5 A;  2O9K A;  1A0R B;  2XL2 A;  5FFO A;  3VH0 A;  1O6F A;  2OVP B;  2Z2N A;  3IJ0 A;  4FA4 D;  4XYI A;  4FAN D;  4ZOV A;  4U7A A;  2XU7 A;  3ZE2 A;  3QI0 A;  3EI2 A;  3MUN A;  3I2N A;  1RI6 A;  4XYH A;  4A0A A;  5TF2 A;  3OF7 A;  1XIP A;  4J81 A;  2PM9 B;  1GXR A; 
#chains in the Genus database with same CATH homology
 2OK4 A;  1YFQ A;  5EMM B;  3EMH A;  5FKR A;  5HYN B;  4A09 B;  3JRP A;  5CYK B;  3PXT D;  2Q7Q A;  4JT6 C;  4GQ2 P;  5EML B;  4XEI C;  3PXS D;  4QQE A;  4J82 A;  4A7J A;  3K27 A;  4Z8L A;  4PNK B;  1SHY B;  4L3G D;  4BH6 A;  4CI2 A;  4JXM A;  2B5M A;  2UZX B;  5AFU 3;  1PBY B;  2OIZ A;  1XHM A;  4I79 A;  4A2M A;  4L9O A;  2H14 A;  1NEX B;  2B5N A;  3BG1 A;  3A0F A;  4ZOY A;  3SBP A;  4EWR A;  2H13 A;  2AQ5 A;  2IWF A;  2GC7 A;  3JZG A;  4PBY A;  4A2L A;  2I0S A;  5K19 A;  4JSX C;  3RSE C;  2P9I C;  3PVU B;  4L1Q D;  4JD2 C;  5GSA A;  3C9C A;  3V9F A;  2OJY A;  5CXC B;  2HKR A;  2J56 H;  3EI4 B;  5H17 A;  4E5Z B;  1FWX A;  5HE0 B;  4D0K A;  2P9U C;  4K3J B;  1PI6 A;  4GQ1 A;  3SVW D;  2CE8 A;  1XKS A;  4O45 A;  2H9L A;  4A08 A;  5B4W A;  4CY2 A;  3MMY A;  3KRX B;  3IKO A;  3L4O D;  4J8G A;  4A0A B;  3JPX A;  2YNO A;  1MG3 A;  4K3I D;  1QNI A;  3UVN A;  5EM2 A;  3VGZ A;  5C2V B;  3EU7 A;  1N6F A;  4FAV D;  4GM8 A;  4GM3 A;  3AL9 A;  3IIY A;  5EAL A;  2GNQ A;  4X61 B;  4FB1 D;  3DXM C;  4AEZ A;  3F3P A;  5HE3 B;  3BWS A;  2HXC A;  4J77 A;  3I7N A;  3JB9 L;  4ESG A;  3N0E A;  4BUJ C;  5A2Q g;  2P9N C;  2H9N A;  3W15 A;  4ERQ A;  3UVM A;  4E5Z A;  3EI1 A;  3I7H A;  3V7D B;  4PSX B;  3JRO A;  2AGW A;  5H14 A;  5GXH A;  3GFC A;  4ES0 A;  5C9Z B;  4IA9 A;  3RFH A;  1U2V C;  2HJB A;  3F3G A;  3OKY B;  1P22 A;  4MK0 B;  3MKS B;  5FQD A;  2W18 A;  4FA9 D;  3C75 H;  4J0X A;  3HFQ A;  3EI3 A;  3UVO A;  4CY3 A;  2G9A A;  3MZK A;  4CZX A;  3SMR A;  5FA5 B;  3J81 g;  4O9D A;  4PC0 A;  1TYQ C;  2CN3 A;  4JSN C;  2IUR A;  3N0D A;  5AJA A;  1PGU A;  3UKR C;  3AFC A;  5FKT A;  5JWZ A;  4IMM A;  3SJL D;  2P9L C;  4UI9 R;  1MDA H;  3IJC A;  4FA1 D;  2AH1 A;  1SQ9 A;  5I5I A;  3MKQ A;  2P9K C;  4J0W A;  3IJ1 A;  2YNP A;  2YB8 B;  4GGC A;  2UZY B;  4BL0 A;  4Y7R A;  2H9P A;  2H47 A;  3I7K A;  4A08 B;  3E0C A;  4LGN A;  5IJ7 E;  3RN0 D;  4J78 A;  3EWE A;  4CI3 A;  2I0R A;  2I0T A;  5FLX g;  3PSL A;  2I3T A;  2IUQ A;  4L3H D;  3V5W B;  3J80 g;  3OTT A;  3OKY A;  2OK6 A;  5EM2 B;  5HE1 B;  4LG8 A;  3I8E A;  3PE7 A;  3K26 A;  5I5J A;  4J8B A;  4FHL A;  5EMK B;  2BCJ B;  2TRC B;  5FXY A;  4HDJ A;  4LG9 A;  3B7F A;  2AGX A;  4G56 B;  3I7P A;  3CFS B;  1N6D A;  2PM6 B;  4H5I A;  1R5M A;  3I7L A;  3EI1 B;  3KRW B;  3ZWL B;  2XYI A;  2CO0 A;  3AL8 A;  3RMZ D;  4PBZ A;  4GM9 A;  3SFZ A;  1JOF A;  3SLE D;  3EI3 B;  1U4C A;  2AGZ A;  4NSX A;  3I89 A;  2P9S C;  3PSC B;  4X3E A;  3RFG A;  4GGD A;  5FKQ A;  2H9M A;  3I8C A;  2H68 A;  4CC9 A;  2AGY A;  5THA A;  5GXI A;  1JMX B;  4CZV A;  4A11 B;  4O1Q D;  1NR0 A;  3SCY A;  1SQJ A;  1S4U X;  3DXK C;  3NVX A;  2J55 H;  3IIW A;  4J73 A;  2AGL A;  2Z2O A;  4J84 A;  3FM0 A;  3SBR A;  3SN6 B;  4OWR A;  5IJ8 E;  2HKM A;  3CFV A;  2CE9 A;  2I3S A;  3BG0 A;  1GOT B;  1JJU B;  2Z2P A;  4QL1 A;  2J57 G;  4R7A B;  3ULE C;  4KFM B;  4X63 B;  2MTA H;  5K1C C;  2HJ4 A;  4FA5 D;  2QXV A;  2CN2 A;  3PVW B;  4CY1 A;  3RLM D;  4CY5 A;  5AMS A;  3DSM A;  3RN1 D;  4FWW A;  2H6N A;  5FKS A;  4J86 A;  3UVK A;  3VA6 A;  2IUV A;  3SWS D;  3NVN A;  3SHF A;  2YNN A;  4A11 A;  3OW8 A;  3JZN A;  2YBA A;  4JSV C;  4PXW A;  4O3T B;  3AL8 B;  3DWL C;  3DM0 A;  5GMK n;  3ODT A;  4GGA A;  3FRX A;  1VYH C;  1B9Y A;  3MXX A;  3OL2 A;  2EBS A;  4CI8 A;  4U1E I;  3UR4 A;  4N14 A;  5EMJ B;  3MZL A;  4O3U B;  5I5M A;  3PXW D;  5TEF A;  1TBG A;  3SXT D;  1B9X A;  1GP2 B;  4E54 A;  1N6E A;  3I7O A;  5CXB B;  3L4M D;  3GRE A;  1K8K C;  3C99 A;  4JSP C;  2B5L A;  4J79 A;  4GZ8 A;  4QRJ A;  4ERZ A;  5EAP A;  2H6K A;  3P4F A;  1MG2 A;  3C5M A;  5EAM A;  2H3X A;  1ERJ A;  3AH8 B;  5SXM A;  5IC7 A;  2P9P C;  4CI1 A;  5IGQ A;  4A0B B;  2PM9 A;  2OVQ B;  3OKW A;  3SBQ A;  3RRM C;  4J87 A;  2PM7 B;  4OZU A;  2H6Q A;  1K32 A;  5TEE A;  3EG6 A;  4A09 A;  5CYK A;  3UVL A;  4H5J A;  2XL3 A;  1Q47 A;  1GG2 B;  1OMW B;  5HQG A;  3CIK B;  1L0Q A;  4ZN4 A;  2B4E A;  5IGO A;  4ERY A;  3FGB A;  5CXB A;  4ZOX A;  5TDH B;  4PSW B;  3NVQ A;  4GMB A;  4ZOZ A;  2HES X;  3EI2 B;  2BBK H;  2CNX A;  2AH0 A;  4Y5R D;  4QT8 A;  1JMZ B;  2IUP A;  5KDO B;  2GC4 A;  2IAA A;  3JAM g;  2YMU A;  4AOW A;  5EAR A;  3U4Y A;  1PEV A;  2OVR B;  4A0B A;  4CZY A;  3OL2 B;  1OLZ A;  5HE2 B;  3OKT A;  3UKU C;  5H1M A;  5C2W B;  4JT5 C;  2PBI B;  2HYE A;  3JZH A;  3F3F A;  4YVD A;  4D6V A;  2IWK A;  5CXC A;  4GQB B;  4E54 B;  3EI4 A;  4X60 B;  2CO0 C;  2G99 A;  3ORV D;  4TZ4 A;  5IT9 g;  2QC5 A;  2O9K A;  1A0R B;  2XL2 A;  3VH0 A;  2OVP B;  2Z2N A;  3IJ0 A;  4FA4 D;  4XYI A;  4FAN D;  4ZOV A;  4U7A A;  2XU7 A;  3EI2 A;  3I2N A;  1RI6 A;  4XYH A;  4A0A A;  5TF2 A;  1XIP A;  4J81 A;  2PM9 B;  1GXR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...