2CO0C

Wdr5 and unmodified histone h3 complex at 2.25 angstrom
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
304
structure length
304
Chain Sequence
VKPNYALMFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGMCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD-REPEAT PROTEIN 5
publication title Histone H3 Recognition and Presentation by the Wdr5 Module of the Mll1 Complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 94
structure length 304
sequence length 304
ec nomenclature
pdb deposition date 2006-05-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2co0C00
5THAA 3IKOA 1RI6A 3JZGA 2PM9B 1B9YA 3UVOA 4CI1A 3PVUB 4J84A 3I89A 4JT6C 2IUQA 4PXWA 3FM0A 4U7AA 1QNIA 5EALA 3JZNA 4QT8A 3I7OA 3IIYA 5EM2A 2Q7QA 2B4EA 3FGBA 4Y7RA 1L0QA 4J8GA 3UVKA 3DWLC 2G99A 3C75H 3JB9L 2P9LC 3F3FA 4CZXA 2CNXA 4AEZA 4L9OA 4CZYA 2P9PC 4QRJA 3EMHA 4PBZA 4EWRA 3GREA 4J8BA 2CO0C 4PC0A 3SJLD 3I7LA 3AL8B 1XKSA 3DXMC 4J78A 3V7DB 4GGAA 5TEFA 3E0CA 4J82A 1MG3A 4MK0B 4FAND 5GSAA 5HE1B 5IJ7E 2H47A 2AQ5A 4CY5A 3I8EA 3SWSD 4ES0A 2O9KA 3ORVD 2OJYA 1Q47A 4GM3A 4JT5C 3JAMg 4N14A 4FB1D 3J80g 4A2LA 5EMJB 4XYHA 2H3XA 4HDJA 1U2VC 3K27A 4J79A 5IC7A 3AL8A 4ERQA 1PGUA 5HE3B 3SBRA 3SVWD 2H13A 3I8CA 3PXSD 3RLMD 3RRMC 2UZXB 4D0KA 3L4OD 3EI2A 3JZHA 5TF2A 2B5NA 1JMXB 4H5IA 5FA5B 2PM6B 4BUJC 3F3GA 3PXTD 4O45A 4O3TB 1NR0A 2YNPA 2HJ4A 2CN3A 3MZKA 3W15A 5HE0B 3SBPA 5CXCB 3UR4A 2P9NC 3OL2A 4CY1A 5FXYA 5K1CC 3JRPA 4A0BB 3JPXA 3DXKC 3DSMA 4XEIC 3IJ0A 3SCYA 3VA6A 1GP2B 4CY3A 4E5ZB 3OW8A 3SXTD 5H17A 1GOTB 3AH8B 1A0RB 1SHYB 3N0DA 3UVMA 4CI3A 1GXRA 2IUVA 5CXCA 4J0XA 2H6NA 4K3JB 4A0BA 4J77A 3BWSA 4A7JA 4J0WA 4QQEA 3EI3A 4JSPC 1PBYB 3MMYA 3NVNA 4E5ZA 2XU7A 2BBKH 5I5JA 4A0AB 3B7FA 2OVQB 2YB8B 3HFQA 5GMKn 4JXMA 4I79A 2HJBA 4IMMA 5B4WA 4X61B 4X63B 4FA4D 4CI8A 4PNKB 2OVPB 2GC7A 4PBYA 3AFCA 4J73A 3C99A 3RN1D 4CZVA 5IJ8E 2QC5A 4OZUA 3MKSB 4QL1A 2XL3A 4GQ2P 3RFGA 3PE7A 4E54B 4FA1D 4ESGA 4A0AA 2I0TA 1GG2B 3VGZA 3CFSB 2H6KA 3A0FA 4IA9A 3UVNA 3DM0A 4Y5RD 2UZYB 5AMSA 3IJCA 2AGWA 2IURA 1XHMA 2H68A 5IT9g 3EI2B 2H14A 4BL0A 5GXHA 1B9XA 3SHFA 1TBGA 4E54A 5EMLB 2B5LA 1N6DA 4O9DA 5HE2B 2HESX 1FWXA 3OKYA 3OL2B 3ZWLB 3RFHA 3ODTA 3IIWA 3SN6B 2G9AA 3JROA 3PVWB 1K8KC 4J86A 2CO0A 4A09B 2P9IC 2HXCA 2Z2OA 2J56H 5EMKB 2YNNA 5HQGA 4BH6A 4CC9A 2I0SA 1ERJA 1XIPA 4ZOXA 4D6VA 3UKUC 5H14A 2W18A 4LG9A 3FRXA 3P4FA 3KRXB 3IJ1A 5EAMA 3MXXA 4O3UB 1SQ9A 1P22A 1OLZA 5A2Qg 1SQJA 3EI3B 4ZOVA 4A09A 1N6EA 2AGYA 2AGZA 3I7NA 2Z2PA 4ERZA 4G56B 3VH0A 4GM9A 4GMBA 3I2NA 4XYIA 2HYEA 2OIZA 4L3GD 3PSLA 4FA5D 3CFVA 4X60B 2H9NA 2AGXA 3SLED 3KRWB 4CI2A 2EBSA 2H6QA 4K3ID 3L4MD 4ZOZA 5AFU3 5TDHB 2HKRA 1YFQA 4ZOYA 2AGLA 3I7KA 5C2WB 3UVLA 3OKWA 1PI6A 2B5MA 3SMRA 5C9ZB 3BG0A 4FA9D 4CY2A 4PSWB 2GC4A 4H5JA 5AJAA 3C5MA 1MG2A 1MDAH 1PEVA 3GFCA 3OTTA 5FKRA 2OVRB 5FKTA 2J55H 3SBQA 2I3SA 4A11A 3MZLA 3SFZA 2IAAA 3BG1A 3OKYB 4FWWA 4NSXA 4LGNA 3EI4B 4A08B 5FKQA 2YBAA 2GNQA 4ERYA 5CXBB 5FQDA 2J57G 2IWKA 3NVXA 5EMMB 2YNOA 4U1EI 5KDOB 3I7PA 5K19A 4A2MA 5IGOA 5I5IA 2IWFA 2PM9A 1JMZB 4R7AB 4JSVC 4X3EA 3RMZD 2QXVA 4LG8A 5CYKB 3EU7A 3CIKB 4GGCA 3EI4A 3N0EA 3V5WB 5HYNB 4A08A 2TRCB 5CXBA 2PBIB 5SXMA 1NEXB 5JWZA 2IUPA 4OWRA 2H9MA 1JOFA 3MKQA 2P9KC 1R5MA 2I3TA 4FHLA 1U4CA 3V9FA 3J81g 5FKSA 5CYKA 2YMUA 1S4UX 3OKTA 1K32A 4JSNC 2CE9A 4PSXB 4L3HD 2OK6A 3AL9A 2BCJB 5H1MA 5GXIA 1JJUB 5EAPA 4J87A 3RN0D 3PSCB 3EI1B 2H9LA 2AH0A 2CN2A 2AH1A 1TYQC 3K26A 3ULEC 1N6FA 5I5MA 1OMWB 3F3PA 5C2VB 2Z2NA 3RSEC 4FAVD 4Z8LA 2CE8A 4KFMB 3UKRC 2HKMA 2I0RA 4UI9R 2PM7B 2OK4A 4GQ1A 4JD2C 3I7HA 3EWEA 2MTAH 5EARA 4GM8A 3PXWD 2XL2A 5IGQA 4O1QD 4GQBB 4GZ8A 3C9CA 3EI1A 2H9PA 1VYHC 2P9SC 3U4YA 4A11B 4TZ4A 4JSXC 2P9UC 5EM2B 4YVDA 4J81A 3EG6A 4GGDA 5FLXg 4L1QD 4ZN4A 2XYIA 4AOWA 5TEEA 3NVQA
chains in the Genus database with same CATH superfamily
5THAA 3IUQA 3IKOA 1RI6A 3JZGA 2PM9B 3K71A 1B9YA 3UVOA 4CI1A 3PVUB 4J84A 3I89A 2JKXA 4JT6C 2IUQA 4PXWA 3FM0A 4U7AA 1QNIA 3T3PA 5EALA 2VDKA 1VE6A 3JZNA 1UTCA 4QT8A 3I7OA 3IIYA 3FCUA 5EM2A 2Q7QA 2B4EA 3FGBA 3QHYB 4Y7RA 1L0QA 2QR5A 4J8GA 3UVKA 3DWLC 2G99A 5M5UA 3C75H 3JB9L 2P9LC 3F3FA 4CZXA 2CNXA 4AEZA 4L9OA 4CZYA 2P9PC 4QRJA 3EMHA 4PBZA 4EWRA 3GREA 4J8BA 4MMZA 2VZ1A 2CO0C 2EIEA 2BKLA 4PC0A 3SJLD 3I7LA 3AL8B 5E6UA 1XKSA 3DXMC 4J78A 2VDOA 3O4IA 4GGAA 5TEFA 3V7DB 1JTDB 3E0CA 4J82A 4BP8A 1MG3A 4MK0B 4FAND 5GSAA 5HE1B 1H2WA 5IJ7E 2H47A 3NIDA 2AQ5A 4CY5A 3I8EA 3SWSD 4ES0A 3IULA 2O9KA 3ORVD 4JHNA 2OJYA 1Q47A 2VDNA 4GM3A 3ZDYA 4JT5C 3JAMg 4N14A 3ZE1A 4FB1D 3J80g 4A2LA 5EMJB 4XYHA 2H3XA 4HDJA 1U2VC 3K27A 4J79A 5IC7A 3AL8A 4ERQA 1PGUA 5HE3B 3SBRA 1GOFA 3SVWD 2H13A 3I8CA 4BCBA 3PXSD 3EQ7A 3RLMD 3RRMC 2UZXB 4D0KA 3L4OD 3EI2A 5M5VA 3JZHA 5TF2A 1JMXB 2B5NA 4H5IA 5FA5B 3VI3A 2PM6B 1K3IA 4BUJC 2HU8A 3F3GA 3PXTD 4O45A 4O3TB 3GD1I 1NR0A 2YNPA 4JHPC 2HJ4A 2CN3A 3MZKA 3W15A 5HE0B 3SBPA 5CXCB 3UR4A 2P9NC 3OL2A 4CY1A 4L1MA 5FXYA 5K1CC 3JRPA 4A0BB 3JPXA 1O6GA 3DXKC 3DSMA 4XEIC 3IJ0A 3SCYA 3VA6A 5M5RA 3MVDK 3K72A 1GP2B 4CY3A 1BPOA 4E5ZB 3OW8A 3SXTD 5H17A 1GOTB 3AH8B 1A0RB 1SHYB 3N0DA 4DNWA 4DNUA 1T2XA 3UVMA 3V4PA 4CI3A 1GXRA 2IUVA 5CXCA 1TYEA 1A12A 2H6NA 3IUMA 4J0XA 4K3JB 4A0BA 4J77A 3BWSA 4A7JA 1M1XA 4J0WA 4QQEA 3EI3A 3DDUA 4JSPC 1PBYB 3MMYA 3NVNA 4E5ZA 1U8CA 3NIGA 2XU7A 2BBKH 5I5JA 4NBMA 4A0AB 2VDMA 3B7FA 2OVQB 1QFSA 2YB8B 2VDPA 3HFQA 5GMKn 4JXMA 4O02A 4I79A 2HJBA 4IMMA 1L5GA 4X61B 5B4WA 4X63B 4FA4D 4CI8A 4PNKB 3KCIA 3VI4A 2OVPB 2GC7A 4PBYA 3AFCA 4J73A 3C99A 3RN1D 4CZVA 5IJ8E 2QC5A 4OZUA 5C92A 3MKSB 4QL1A 2XL3A 1GOGA 4GQ2P 3RFGA 3PE7A 4E54B 4FA1D 4ESGA 4A0AA 1E8MA 2I0TA 1GG2B 2WQ8A 3VGZA 3CFSB 2H6KA 3A0FA 4IA9A 3UVNA 3DM0A 4RE5A 4O2WA 4RE6A 2UZYB 4Y5RD 5AMSA 3IJCA 2AGWA 2IURA 1XHMA 2H68A 5IT9g 3EI2B 2H14A 3EQ8A 4BL0A 5GXHA 1B9XA 5FFOA 2QZPA 3SHFA 1TBGA 4E54A 5EMLB 3QI0A 2B5LA 1N6DA 4O9DA 5HE2B 2HESX 1FWXA 1H2YA 1UOPA 1C9LA 3OL2B 3OKYA 3ZWLB 1I2MB 3RFHA 3ODTA 3IIWA 3SN6B 2G9AA 3JROA 4AMYA 3PVWB 1K8KC 4J86A 2CO0A 4A09B 2P9IC 2HXCA 2Z2OA 2J56H 5EMKB 2YNNA 5HQGA 4BH6A 4CC9A 4G1EA 2I0SA 1ERJA 1XIPA 4ZOXA 4D6VA 3UKUC 5H14A 2W18A 4LG9A 3FRXA 3P4FA 5C86A 4NC4A 3KRXB 4NENA 3IJ1A 5EAMA 3MXXA 4O3UB 1SQ9A 1P22A 4IRZA 5HDBA 1OLZA 5A2Qg 1H2ZA 2XE4A 3MUOA 1SQJA 3EI3B 4ZOVA 3NIFA 4A09A 1N6EA 2AGYA 3IJEA 2AGZA 3O4JA 3ZE0A 3I7NA 2Z2PA 5M61A 4ERZA 2VC2A 4MMYA 4G56B 3VH0A 4GM9A 4GMBA 1UOQA 3IVMA 4AMZA 3I2NA 4XYIA 3ZDZA 2HYEA 2OIZA 4AN1A 4L3GD 3PSLA 4FA5D 3CFVA 4X60B 2H9NA 2AGXA 3ZDXA 3SLED 4AN0A 1VZ2A 3KRWB 4NAAA 2HU7A 4BCDA 4CI2A 2EBSA 2H6QA 4K3ID 3T3MA 1H2XA 3L4MD 4ZOZA 4BCCA 5AFU3 1JV2A 4UM8A 5TDHB 2HKRA 1YFQA 3IUNA 2AGLA 4ZOYA 3I7KA 3IUJA 2VDRA 5C2WB 3UVLA 3OKWA 1PI6A 2B5MA 3EQ9A 5E6SA 3SMRA 5C9ZB 3BG0A 4FA9D 4CY2A 4PSWB 2GC4A 4UM9A 4H5JA 5AJAA 1C9IA 3C5MA 1MG2A 1MDAH 1PEVA 3GFCA 3OTTA 2HU5A 5FKRA 2OVRB 3O4GA 2J55H 5FKTA 3SBQA 4BP9A 2I3SA 3MUNA 4WK4A 4A11A 3MZLA 3SFZA 2IAAA 3BG1A 3OKYB 5M5TA 4FWWA 4NSXA 4LGNA 3EI4B 4A08B 5FKQA 2YBAA 2GNQA 4ERYA 5CXBB 5FQDA 4DNVA 4Z7QA 2J57G 2IWKA 1E5TA 3NVXA 5EMMB 2YNOA 4U1EI 5KDOB 3I7PA 1VE7A 5K19A 4A2MA 5IGOA 5I5IA 4AX4A 2IWFA 2PM9A 1UOOA 1JMZB 4MMXA 4R7AB 4JSVC 4X3EA 3RMZD 2QXVA 2EIDA 1GOHA 4LG8A 5CYKB 1QFMA 3EU7A 3CIKB 4GGCA 2XDWA 3EI4A 3N0EA 3V5WB 5HYNB 4A08A 2TRCB 5CXBA 5E6RA 1VZ3A 2PBIB 4Z7NA 5SXMA 1NEXB 4WJKA 5JWZA 2IUPA 3K6SA 4OWRA 4Z7OA 2H9MA 1JOFA 3MKQA 2P9KC 1R5MA 2I3TA 4FHLA 1U4CA 3V9FA 3ZE2A 3J81g 4WK0A 3OF7A 5FKSA 5CYKA 2YMUA 1S4UX 3GC3B 3OKTA 1K32A 4JSNC 3IURA 2CE9A 4PSXB 4L3HD 3AL9A 2OK6A 2VDLA 2BCJB 5H1MA 5GXIA 1JJUB 2VDQA 5EAPA 4J87A 3RN0D 3PSCB 3EI1B 2H9LA 2AH0A 2CN2A 2AH1A 1TYQC 4D9SA 3K26A 3ULEC 1N6FA 2EICA 5I5MA 5M5SA 1OMWB 3F3PA 5C2VB 2Z2NA 3RSEC 4FAVD 4Z8LA 2CE8A 4KFMB 3UKRC 2HKMA 2I0RA 4UI9R 2PM7B 2OK4A 4GQ1A 4JD2C 4QAMA 1O6FA 3I7HA 3EWEA 2MTAH 5EARA 4GM8A 3PXWD 2XL2A 2EIBA 5IGQA 4G1MA 3O4HA 4O1QD 2VZ3A 4GQBB 4GZ8A 3C9CA 1E8NA 3EI1A 3FCSA 2H9PA 1VYHC 2P9SC 3U4YA 4A11B 4TZ4A 2XZGA 4JSXC 2P9UC 4WK2A 5EM2B 4YVDA 4J81A 3EG6A 4G55A 1YR2A 4GGDA 5FLXg 3V4VA 4L1QD 4ZN4A 5FFGA 2XYIA 4AOWA 5TEEA 3NVQA
chains in the Genus database with same CATH topology
5THAA 3IKOA 1RI6A 3JZGA 2PM9B 1B9YA 3UVOA 4CI1A 3PVUB 4J84A 3I89A 4JT6C 2IUQA 4PXWA 3FM0A 4U7AA 1QNIA 5EALA 3JZNA 4QT8A 3I7OA 3IIYA 5EM2A 2Q7QA 2B4EA 3FGBA 4Y7RA 1L0QA 4J8GA 3UVKA 3DWLC 2G99A 3C75H 3JB9L 2P9LC 3F3FA 4CZXA 2CNXA 4AEZA 4L9OA 4CZYA 2P9PC 4QRJA 3EMHA 4PBZA 4EWRA 3GREA 4J8BA 2CO0C 4PC0A 3SJLD 3I7LA 3AL8B 1XKSA 3DXMC 4J78A 3V7DB 4GGAA 5TEFA 3E0CA 4J82A 1MG3A 4MK0B 4FAND 5GSAA 5HE1B 5IJ7E 2H47A 2AQ5A 4CY5A 3I8EA 3SWSD 4ES0A 2O9KA 3ORVD 2OJYA 1Q47A 4GM3A 4JT5C 3JAMg 4N14A 4FB1D 3J80g 4A2LA 5EMJB 4XYHA 2H3XA 4HDJA 1U2VC 3K27A 4J79A 5IC7A 3AL8A 4ERQA 1PGUA 5HE3B 3SBRA 3SVWD 2H13A 3I8CA 3PXSD 3RLMD 3RRMC 2UZXB 4D0KA 3L4OD 3EI2A 3JZHA 5TF2A 2B5NA 1JMXB 4H5IA 5FA5B 2PM6B 4BUJC 3F3GA 3PXTD 4O45A 4O3TB 1NR0A 2YNPA 2HJ4A 2CN3A 3MZKA 3W15A 5HE0B 3SBPA 5CXCB 3UR4A 2P9NC 3OL2A 4CY1A 5FXYA 5K1CC 3JRPA 4A0BB 3JPXA 3DXKC 3DSMA 4XEIC 3IJ0A 3SCYA 3VA6A 1GP2B 4CY3A 4E5ZB 3OW8A 3SXTD 5H17A 1GOTB 3AH8B 1A0RB 1SHYB 3N0DA 3UVMA 4CI3A 1GXRA 2IUVA 5CXCA 4J0XA 2H6NA 4K3JB 4A0BA 4J77A 3BWSA 4A7JA 4J0WA 4QQEA 3EI3A 4JSPC 1PBYB 3MMYA 3NVNA 4E5ZA 2XU7A 2BBKH 5I5JA 4A0AB 3B7FA 2OVQB 2YB8B 3HFQA 5GMKn 4JXMA 4I79A 2HJBA 4IMMA 5B4WA 4X61B 4X63B 4FA4D 4CI8A 4PNKB 2OVPB 2GC7A 4PBYA 3AFCA 4J73A 3C99A 3RN1D 4CZVA 5IJ8E 2QC5A 4OZUA 3MKSB 4QL1A 2XL3A 4GQ2P 3RFGA 3PE7A 4E54B 4FA1D 4ESGA 4A0AA 2I0TA 1GG2B 3VGZA 3CFSB 2H6KA 3A0FA 4IA9A 3UVNA 3DM0A 4Y5RD 2UZYB 5AMSA 3IJCA 2AGWA 2IURA 1XHMA 2H68A 5IT9g 3EI2B 2H14A 4BL0A 5GXHA 1B9XA 3SHFA 1TBGA 4E54A 5EMLB 2B5LA 1N6DA 4O9DA 5HE2B 2HESX 1FWXA 3OKYA 3OL2B 3ZWLB 3RFHA 3ODTA 3IIWA 3SN6B 2G9AA 3JROA 3PVWB 1K8KC 4J86A 2CO0A 4A09B 2P9IC 2HXCA 2Z2OA 2J56H 5EMKB 2YNNA 5HQGA 4BH6A 4CC9A 2I0SA 1ERJA 1XIPA 4ZOXA 4D6VA 3UKUC 5H14A 2W18A 4LG9A 3FRXA 3P4FA 3KRXB 3IJ1A 5EAMA 3MXXA 4O3UB 1SQ9A 1P22A 1OLZA 5A2Qg 1SQJA 3EI3B 4ZOVA 4A09A 1N6EA 2AGYA 2AGZA 3I7NA 2Z2PA 4ERZA 4G56B 3VH0A 4GM9A 4GMBA 3I2NA 4XYIA 2HYEA 2OIZA 4L3GD 3PSLA 4FA5D 3CFVA 4X60B 2H9NA 2AGXA 3SLED 3KRWB 4CI2A 2EBSA 2H6QA 4K3ID 3L4MD 4ZOZA 5AFU3 5TDHB 2HKRA 1YFQA 4ZOYA 2AGLA 3I7KA 5C2WB 3UVLA 3OKWA 1PI6A 2B5MA 3SMRA 5C9ZB 3BG0A 4FA9D 4CY2A 4PSWB 2GC4A 4H5JA 5AJAA 3C5MA 1MG2A 1MDAH 1PEVA 3GFCA 3OTTA 5FKRA 2OVRB 5FKTA 2J55H 3SBQA 2I3SA 4A11A 3MZLA 3SFZA 2IAAA 3BG1A 3OKYB 4FWWA 4NSXA 4LGNA 3EI4B 4A08B 5FKQA 2YBAA 2GNQA 4ERYA 5CXBB 5FQDA 2J57G 2IWKA 3NVXA 5EMMB 2YNOA 4U1EI 5KDOB 3I7PA 5K19A 4A2MA 5IGOA 5I5IA 2IWFA 2PM9A 1JMZB 4R7AB 4JSVC 4X3EA 3RMZD 2QXVA 4LG8A 5CYKB 3EU7A 3CIKB 4GGCA 3EI4A 3N0EA 3V5WB 5HYNB 4A08A 2TRCB 5CXBA 2PBIB 5SXMA 1NEXB 5JWZA 2IUPA 4OWRA 2H9MA 1JOFA 3MKQA 2P9KC 1R5MA 2I3TA 4FHLA 1U4CA 3V9FA 3J81g 5FKSA 5CYKA 2YMUA 1S4UX 3OKTA 1K32A 4JSNC 2CE9A 4PSXB 4L3HD 2OK6A 3AL9A 2BCJB 5H1MA 5GXIA 1JJUB 5EAPA 4J87A 3RN0D 3PSCB 3EI1B 2H9LA 2AH0A 2CN2A 2AH1A 1TYQC 3K26A 3ULEC 1N6FA 5I5MA 1OMWB 3F3PA 5C2VB 2Z2NA 3RSEC 4FAVD 4Z8LA 2CE8A 4KFMB 3UKRC 2HKMA 2I0RA 4UI9R 2PM7B 2OK4A 4GQ1A 4JD2C 3I7HA 3EWEA 2MTAH 5EARA 4GM8A 3PXWD 2XL2A 5IGQA 4O1QD 4GQBB 4GZ8A 3C9CA 3EI1A 2H9PA 1VYHC 2P9SC 3U4YA 4A11B 4TZ4A 4JSXC 2P9UC 5EM2B 4YVDA 4J81A 3EG6A 4GGDA 5FLXg 4L1QD 4ZN4A 2XYIA 4AOWA 5TEEA 3NVQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5THA A;  3IKO A;  1RI6 A;  3JZG A;  2PM9 B;  1B9Y A;  3UVO A;  4CI1 A;  3PVU B;  4J84 A;  3I89 A;  4JT6 C;  2IUQ A;  4PXW A;  3FM0 A;  4U7A A;  1QNI A;  5EAL A;  3JZN A;  4QT8 A;  3I7O A;  3IIY A;  5EM2 A;  2Q7Q A;  2B4E A;  3FGB A;  4Y7R A;  1L0Q A;  4J8G A;  3UVK A;  3DWL C;  2G99 A;  3C75 H;  3JB9 L;  2P9L C;  3F3F A;  4CZX A;  2CNX A;  4AEZ A;  4L9O A;  4CZY A;  2P9P C;  4QRJ A;  3EMH A;  4PBZ A;  4EWR A;  3GRE A;  4J8B A;  2CO0 C;  4PC0 A;  3SJL D;  3I7L A;  3AL8 B;  1XKS A;  3DXM C;  4J78 A;  3V7D B;  4GGA A;  5TEF A;  3E0C A;  4J82 A;  1MG3 A;  4MK0 B;  4FAN D;  5GSA A;  5HE1 B;  5IJ7 E;  2H47 A;  2AQ5 A;  4CY5 A;  3I8E A;  3SWS D;  4ES0 A;  2O9K A;  3ORV D;  2OJY A;  1Q47 A;  4GM3 A;  4JT5 C;  3JAM g;  4N14 A;  4FB1 D;  3J80 g;  4A2L A;  5EMJ B;  4XYH A;  2H3X A;  4HDJ A;  1U2V C;  3K27 A;  4J79 A;  5IC7 A;  3AL8 A;  4ERQ A;  1PGU A;  5HE3 B;  3SBR A;  3SVW D;  2H13 A;  3I8C A;  3PXS D;  3RLM D;  3RRM C;  2UZX B;  4D0K A;  3L4O D;  3EI2 A;  3JZH A;  5TF2 A;  2B5N A;  1JMX B;  4H5I A;  5FA5 B;  2PM6 B;  4BUJ C;  3F3G A;  3PXT D;  4O45 A;  4O3T B;  1NR0 A;  2YNP A;  2HJ4 A;  2CN3 A;  3MZK A;  3W15 A;  5HE0 B;  3SBP A;  5CXC B;  3UR4 A;  2P9N C;  3OL2 A;  4CY1 A;  5FXY A;  5K1C C;  3JRP A;  4A0B B;  3JPX A;  3DXK C;  3DSM A;  4XEI C;  3IJ0 A;  3SCY A;  3VA6 A;  1GP2 B;  4CY3 A;  4E5Z B;  3OW8 A;  3SXT D;  5H17 A;  1GOT B;  3AH8 B;  1A0R B;  1SHY B;  3N0D A;  3UVM A;  4CI3 A;  1GXR A;  2IUV A;  5CXC A;  4J0X A;  2H6N A;  4K3J B;  4A0B A;  4J77 A;  3BWS A;  4A7J A;  4J0W A;  4QQE A;  3EI3 A;  4JSP C;  1PBY B;  3MMY A;  3NVN A;  4E5Z A;  2XU7 A;  2BBK H;  5I5J A;  4A0A B;  3B7F A;  2OVQ B;  2YB8 B;  3HFQ A;  5GMK n;  4JXM A;  4I79 A;  2HJB A;  4IMM A;  5B4W A;  4X61 B;  4X63 B;  4FA4 D;  4CI8 A;  4PNK B;  2OVP B;  2GC7 A;  4PBY A;  3AFC A;  4J73 A;  3C99 A;  3RN1 D;  4CZV A;  5IJ8 E;  2QC5 A;  4OZU A;  3MKS B;  4QL1 A;  2XL3 A;  4GQ2 P;  3RFG A;  3PE7 A;  4E54 B;  4FA1 D;  4ESG A;  4A0A A;  2I0T A;  1GG2 B;  3VGZ A;  3CFS B;  2H6K A;  3A0F A;  4IA9 A;  3UVN A;  3DM0 A;  4Y5R D;  2UZY B;  5AMS A;  3IJC A;  2AGW A;  2IUR A;  1XHM A;  2H68 A;  5IT9 g;  3EI2 B;  2H14 A;  4BL0 A;  5GXH A;  1B9X A;  3SHF A;  1TBG A;  4E54 A;  5EML B;  2B5L A;  1N6D A;  4O9D A;  5HE2 B;  2HES X;  1FWX A;  3OKY A;  3OL2 B;  3ZWL B;  3RFH A;  3ODT A;  3IIW A;  3SN6 B;  2G9A A;  3JRO A;  3PVW B;  1K8K C;  4J86 A;  2CO0 A;  4A09 B;  2P9I C;  2HXC A;  2Z2O A;  2J56 H;  5EMK B;  2YNN A;  5HQG A;  4BH6 A;  4CC9 A;  2I0S A;  1ERJ A;  1XIP A;  4ZOX A;  4D6V A;  3UKU C;  5H14 A;  2W18 A;  4LG9 A;  3FRX A;  3P4F A;  3KRX B;  3IJ1 A;  5EAM A;  3MXX A;  4O3U B;  1SQ9 A;  1P22 A;  1OLZ A;  5A2Q g;  1SQJ A;  3EI3 B;  4ZOV A;  4A09 A;  1N6E A;  2AGY A;  2AGZ A;  3I7N A;  2Z2P A;  4ERZ A;  4G56 B;  3VH0 A;  4GM9 A;  4GMB A;  3I2N A;  4XYI A;  2HYE A;  2OIZ A;  4L3G D;  3PSL A;  4FA5 D;  3CFV A;  4X60 B;  2H9N A;  2AGX A;  3SLE D;  3KRW B;  4CI2 A;  2EBS A;  2H6Q A;  4K3I D;  3L4M D;  4ZOZ A;  5AFU 3;  5TDH B;  2HKR A;  1YFQ A;  4ZOY A;  2AGL A;  3I7K A;  5C2W B;  3UVL A;  3OKW A;  1PI6 A;  2B5M A;  3SMR A;  5C9Z B;  3BG0 A;  4FA9 D;  4CY2 A;  4PSW B;  2GC4 A;  4H5J A;  5AJA A;  3C5M A;  1MG2 A;  1MDA H;  1PEV A;  3GFC A;  3OTT A;  5FKR A;  2OVR B;  5FKT A;  2J55 H;  3SBQ A;  2I3S A;  4A11 A;  3MZL A;  3SFZ A;  2IAA A;  3BG1 A;  3OKY B;  4FWW A;  4NSX A;  4LGN A;  3EI4 B;  4A08 B;  5FKQ A;  2YBA A;  2GNQ A;  4ERY A;  5CXB B;  5FQD A;  2J57 G;  2IWK A;  3NVX A;  5EMM B;  2YNO A;  4U1E I;  5KDO B;  3I7P A;  5K19 A;  4A2M A;  5IGO A;  5I5I A;  2IWF A;  2PM9 A;  1JMZ B;  4R7A B;  4JSV C;  4X3E A;  3RMZ D;  2QXV A;  4LG8 A;  5CYK B;  3EU7 A;  3CIK B;  4GGC A;  3EI4 A;  3N0E A;  3V5W B;  5HYN B;  4A08 A;  2TRC B;  5CXB A;  2PBI B;  5SXM A;  1NEX B;  5JWZ A;  2IUP A;  4OWR A;  2H9M A;  1JOF A;  3MKQ A;  2P9K C;  1R5M A;  2I3T A;  4FHL A;  1U4C A;  3V9F A;  3J81 g;  5FKS A;  5CYK A;  2YMU A;  1S4U X;  3OKT A;  1K32 A;  4JSN C;  2CE9 A;  4PSX B;  4L3H D;  2OK6 A;  3AL9 A;  2BCJ B;  5H1M A;  5GXI A;  1JJU B;  5EAP A;  4J87 A;  3RN0 D;  3PSC B;  3EI1 B;  2H9L A;  2AH0 A;  2CN2 A;  2AH1 A;  1TYQ C;  3K26 A;  3ULE C;  1N6F A;  5I5M A;  1OMW B;  3F3P A;  5C2V B;  2Z2N A;  3RSE C;  4FAV D;  4Z8L A;  2CE8 A;  4KFM B;  3UKR C;  2HKM A;  2I0R A;  4UI9 R;  2PM7 B;  2OK4 A;  4GQ1 A;  4JD2 C;  3I7H A;  3EWE A;  2MTA H;  5EAR A;  4GM8 A;  3PXW D;  2XL2 A;  5IGQ A;  4O1Q D;  4GQB B;  4GZ8 A;  3C9C A;  3EI1 A;  2H9P A;  1VYH C;  2P9S C;  3U4Y A;  4A11 B;  4TZ4 A;  4JSX C;  2P9U C;  5EM2 B;  4YVD A;  4J81 A;  3EG6 A;  4GGD A;  5FLX g;  4L1Q D;  4ZN4 A;  2XYI A;  4AOW A;  5TEE A;  3NVQ A; 
#chains in the Genus database with same CATH topology
 5THA A;  3IUQ A;  3IKO A;  1RI6 A;  3JZG A;  2PM9 B;  3K71 A;  1B9Y A;  3UVO A;  4CI1 A;  3PVU B;  4J84 A;  3I89 A;  2JKX A;  4JT6 C;  2IUQ A;  4PXW A;  3FM0 A;  4U7A A;  1QNI A;  3T3P A;  5EAL A;  2VDK A;  1VE6 A;  3JZN A;  1UTC A;  4QT8 A;  3I7O A;  3IIY A;  3FCU A;  5EM2 A;  2Q7Q A;  2B4E A;  3FGB A;  3QHY B;  4Y7R A;  1L0Q A;  2QR5 A;  4J8G A;  3UVK A;  3DWL C;  2G99 A;  5M5U A;  3C75 H;  3JB9 L;  2P9L C;  3F3F A;  4CZX A;  2CNX A;  4AEZ A;  4L9O A;  4CZY A;  2P9P C;  4QRJ A;  3EMH A;  4PBZ A;  4EWR A;  3GRE A;  4J8B A;  4MMZ A;  2VZ1 A;  2CO0 C;  2EIE A;  2BKL A;  4PC0 A;  3SJL D;  3I7L A;  3AL8 B;  5E6U A;  1XKS A;  3DXM C;  4J78 A;  2VDO A;  3O4I A;  4GGA A;  5TEF A;  3V7D B;  1JTD B;  3E0C A;  4J82 A;  4BP8 A;  1MG3 A;  4MK0 B;  4FAN D;  5GSA A;  5HE1 B;  1H2W A;  5IJ7 E;  2H47 A;  3NID A;  2AQ5 A;  4CY5 A;  3I8E A;  3SWS D;  4ES0 A;  3IUL A;  2O9K A;  3ORV D;  4JHN A;  2OJY A;  1Q47 A;  2VDN A;  4GM3 A;  3ZDY A;  4JT5 C;  3JAM g;  4N14 A;  3ZE1 A;  4FB1 D;  3J80 g;  4A2L A;  5EMJ B;  4XYH A;  2H3X A;  4HDJ A;  1U2V C;  3K27 A;  4J79 A;  5IC7 A;  3AL8 A;  4ERQ A;  1PGU A;  5HE3 B;  3SBR A;  1GOF A;  3SVW D;  2H13 A;  3I8C A;  4BCB A;  3PXS D;  3EQ7 A;  3RLM D;  3RRM C;  2UZX B;  4D0K A;  3L4O D;  3EI2 A;  5M5V A;  3JZH A;  5TF2 A;  1JMX B;  2B5N A;  4H5I A;  5FA5 B;  3VI3 A;  2PM6 B;  1K3I A;  4BUJ C;  2HU8 A;  3F3G A;  3PXT D;  4O45 A;  4O3T B;  3GD1 I;  1NR0 A;  2YNP A;  4JHP C;  2HJ4 A;  2CN3 A;  3MZK A;  3W15 A;  5HE0 B;  3SBP A;  5CXC B;  3UR4 A;  2P9N C;  3OL2 A;  4CY1 A;  4L1M A;  5FXY A;  5K1C C;  3JRP A;  4A0B B;  3JPX A;  1O6G A;  3DXK C;  3DSM A;  4XEI C;  3IJ0 A;  3SCY A;  3VA6 A;  5M5R A;  3MVD K;  3K72 A;  1GP2 B;  4CY3 A;  1BPO A;  4E5Z B;  3OW8 A;  3SXT D;  5H17 A;  1GOT B;  3AH8 B;  1A0R B;  1SHY B;  3N0D A;  4DNW A;  4DNU A;  1T2X A;  3UVM A;  3V4P A;  4CI3 A;  1GXR A;  2IUV A;  5CXC A;  1TYE A;  1A12 A;  2H6N A;  3IUM A;  4J0X A;  4K3J B;  4A0B A;  4J77 A;  3BWS A;  4A7J A;  1M1X A;  4J0W A;  4QQE A;  3EI3 A;  3DDU A;  4JSP C;  1PBY B;  3MMY A;  3NVN A;  4E5Z A;  1U8C A;  3NIG A;  2XU7 A;  2BBK H;  5I5J A;  4NBM A;  4A0A B;  2VDM A;  3B7F A;  2OVQ B;  1QFS A;  2YB8 B;  2VDP A;  3HFQ A;  5GMK n;  4JXM A;  4O02 A;  4I79 A;  2HJB A;  4IMM A;  1L5G A;  4X61 B;  5B4W A;  4X63 B;  4FA4 D;  4CI8 A;  4PNK B;  3KCI A;  3VI4 A;  2OVP B;  2GC7 A;  4PBY A;  3AFC A;  4J73 A;  3C99 A;  3RN1 D;  4CZV A;  5IJ8 E;  2QC5 A;  4OZU A;  5C92 A;  3MKS B;  4QL1 A;  2XL3 A;  1GOG A;  4GQ2 P;  3RFG A;  3PE7 A;  4E54 B;  4FA1 D;  4ESG A;  4A0A A;  1E8M A;  2I0T A;  1GG2 B;  2WQ8 A;  3VGZ A;  3CFS B;  2H6K A;  3A0F A;  4IA9 A;  3UVN A;  3DM0 A;  4RE5 A;  4O2W A;  4RE6 A;  2UZY B;  4Y5R D;  5AMS A;  3IJC A;  2AGW A;  2IUR A;  1XHM A;  2H68 A;  5IT9 g;  3EI2 B;  2H14 A;  3EQ8 A;  4BL0 A;  5GXH A;  1B9X A;  5FFO A;  2QZP A;  3SHF A;  1TBG A;  4E54 A;  5EML B;  3QI0 A;  2B5L A;  1N6D A;  4O9D A;  5HE2 B;  2HES X;  1FWX A;  1H2Y A;  1UOP A;  1C9L A;  3OL2 B;  3OKY A;  3ZWL B;  1I2M B;  3RFH A;  3ODT A;  3IIW A;  3SN6 B;  2G9A A;  3JRO A;  4AMY A;  3PVW B;  1K8K C;  4J86 A;  2CO0 A;  4A09 B;  2P9I C;  2HXC A;  2Z2O A;  2J56 H;  5EMK B;  2YNN A;  5HQG A;  4BH6 A;  4CC9 A;  4G1E A;  2I0S A;  1ERJ A;  1XIP A;  4ZOX A;  4D6V A;  3UKU C;  5H14 A;  2W18 A;  4LG9 A;  3FRX A;  3P4F A;  5C86 A;  4NC4 A;  3KRX B;  4NEN A;  3IJ1 A;  5EAM A;  3MXX A;  4O3U B;  1SQ9 A;  1P22 A;  4IRZ A;  5HDB A;  1OLZ A;  5A2Q g;  1H2Z A;  2XE4 A;  3MUO A;  1SQJ A;  3EI3 B;  4ZOV A;  3NIF A;  4A09 A;  1N6E A;  2AGY A;  3IJE A;  2AGZ A;  3O4J A;  3ZE0 A;  3I7N A;  2Z2P A;  5M61 A;  4ERZ A;  2VC2 A;  4MMY A;  4G56 B;  3VH0 A;  4GM9 A;  4GMB A;  1UOQ A;  3IVM A;  4AMZ A;  3I2N A;  4XYI A;  3ZDZ A;  2HYE A;  2OIZ A;  4AN1 A;  4L3G D;  3PSL A;  4FA5 D;  3CFV A;  4X60 B;  2H9N A;  2AGX A;  3ZDX A;  3SLE D;  4AN0 A;  1VZ2 A;  3KRW B;  4NAA A;  2HU7 A;  4BCD A;  4CI2 A;  2EBS A;  2H6Q A;  4K3I D;  3T3M A;  1H2X A;  3L4M D;  4ZOZ A;  4BCC A;  5AFU 3;  1JV2 A;  4UM8 A;  5TDH B;  2HKR A;  1YFQ A;  3IUN A;  2AGL A;  4ZOY A;  3I7K A;  3IUJ A;  2VDR A;  5C2W B;  3UVL A;  3OKW A;  1PI6 A;  2B5M A;  3EQ9 A;  5E6S A;  3SMR A;  5C9Z B;  3BG0 A;  4FA9 D;  4CY2 A;  4PSW B;  2GC4 A;  4UM9 A;  4H5J A;  5AJA A;  1C9I A;  3C5M A;  1MG2 A;  1MDA H;  1PEV A;  3GFC A;  3OTT A;  2HU5 A;  5FKR A;  2OVR B;  3O4G A;  2J55 H;  5FKT A;  3SBQ A;  4BP9 A;  2I3S A;  3MUN A;  4WK4 A;  4A11 A;  3MZL A;  3SFZ A;  2IAA A;  3BG1 A;  3OKY B;  5M5T A;  4FWW A;  4NSX A;  4LGN A;  3EI4 B;  4A08 B;  5FKQ A;  2YBA A;  2GNQ A;  4ERY A;  5CXB B;  5FQD A;  4DNV A;  4Z7Q A;  2J57 G;  2IWK A;  1E5T A;  3NVX A;  5EMM B;  2YNO A;  4U1E I;  5KDO B;  3I7P A;  1VE7 A;  5K19 A;  4A2M A;  5IGO A;  5I5I A;  4AX4 A;  2IWF A;  2PM9 A;  1UOO A;  1JMZ B;  4MMX A;  4R7A B;  4JSV C;  4X3E A;  3RMZ D;  2QXV A;  2EID A;  1GOH A;  4LG8 A;  5CYK B;  1QFM A;  3EU7 A;  3CIK B;  4GGC A;  2XDW A;  3EI4 A;  3N0E A;  3V5W B;  5HYN B;  4A08 A;  2TRC B;  5CXB A;  5E6R A;  1VZ3 A;  2PBI B;  4Z7N A;  5SXM A;  1NEX B;  4WJK A;  5JWZ A;  2IUP A;  3K6S A;  4OWR A;  4Z7O A;  2H9M A;  1JOF A;  3MKQ A;  2P9K C;  1R5M A;  2I3T A;  4FHL A;  1U4C A;  3V9F A;  3ZE2 A;  3J81 g;  4WK0 A;  3OF7 A;  5FKS A;  5CYK A;  2YMU A;  1S4U X;  3GC3 B;  3OKT A;  1K32 A;  4JSN C;  3IUR A;  2CE9 A;  4PSX B;  4L3H D;  3AL9 A;  2OK6 A;  2VDL A;  2BCJ B;  5H1M A;  5GXI A;  1JJU B;  2VDQ A;  5EAP A;  4J87 A;  3RN0 D;  3PSC B;  3EI1 B;  2H9L A;  2AH0 A;  2CN2 A;  2AH1 A;  1TYQ C;  4D9S A;  3K26 A;  3ULE C;  1N6F A;  2EIC A;  5I5M A;  5M5S A;  1OMW B;  3F3P A;  5C2V B;  2Z2N A;  3RSE C;  4FAV D;  4Z8L A;  2CE8 A;  4KFM B;  3UKR C;  2HKM A;  2I0R A;  4UI9 R;  2PM7 B;  2OK4 A;  4GQ1 A;  4JD2 C;  4QAM A;  1O6F A;  3I7H A;  3EWE A;  2MTA H;  5EAR A;  4GM8 A;  3PXW D;  2XL2 A;  2EIB A;  5IGQ A;  4G1M A;  3O4H A;  4O1Q D;  2VZ3 A;  4GQB B;  4GZ8 A;  3C9C A;  1E8N A;  3EI1 A;  3FCS A;  2H9P A;  1VYH C;  2P9S C;  3U4Y A;  4A11 B;  4TZ4 A;  2XZG A;  4JSX C;  2P9U C;  4WK2 A;  5EM2 B;  4YVD A;  4J81 A;  3EG6 A;  4G55 A;  1YR2 A;  4GGD A;  5FLX g;  3V4V A;  4L1Q D;  4ZN4 A;  5FFG A;  2XYI A;  4AOW A;  5TEE A;  3NVQ A; 
#chains in the Genus database with same CATH homology
 5THA A;  3IKO A;  1RI6 A;  3JZG A;  2PM9 B;  1B9Y A;  3UVO A;  4CI1 A;  3PVU B;  4J84 A;  3I89 A;  4JT6 C;  2IUQ A;  4PXW A;  3FM0 A;  4U7A A;  1QNI A;  5EAL A;  3JZN A;  4QT8 A;  3I7O A;  3IIY A;  5EM2 A;  2Q7Q A;  2B4E A;  3FGB A;  4Y7R A;  1L0Q A;  4J8G A;  3UVK A;  3DWL C;  2G99 A;  3C75 H;  3JB9 L;  2P9L C;  3F3F A;  4CZX A;  2CNX A;  4AEZ A;  4L9O A;  4CZY A;  2P9P C;  4QRJ A;  3EMH A;  4PBZ A;  4EWR A;  3GRE A;  4J8B A;  2CO0 C;  4PC0 A;  3SJL D;  3I7L A;  3AL8 B;  1XKS A;  3DXM C;  4J78 A;  3V7D B;  4GGA A;  5TEF A;  3E0C A;  4J82 A;  1MG3 A;  4MK0 B;  4FAN D;  5GSA A;  5HE1 B;  5IJ7 E;  2H47 A;  2AQ5 A;  4CY5 A;  3I8E A;  3SWS D;  4ES0 A;  2O9K A;  3ORV D;  2OJY A;  1Q47 A;  4GM3 A;  4JT5 C;  3JAM g;  4N14 A;  4FB1 D;  3J80 g;  4A2L A;  5EMJ B;  4XYH A;  2H3X A;  4HDJ A;  1U2V C;  3K27 A;  4J79 A;  5IC7 A;  3AL8 A;  4ERQ A;  1PGU A;  5HE3 B;  3SBR A;  3SVW D;  2H13 A;  3I8C A;  3PXS D;  3RLM D;  3RRM C;  2UZX B;  4D0K A;  3L4O D;  3EI2 A;  3JZH A;  5TF2 A;  2B5N A;  1JMX B;  4H5I A;  5FA5 B;  2PM6 B;  4BUJ C;  3F3G A;  3PXT D;  4O45 A;  4O3T B;  1NR0 A;  2YNP A;  2HJ4 A;  2CN3 A;  3MZK A;  3W15 A;  5HE0 B;  3SBP A;  5CXC B;  3UR4 A;  2P9N C;  3OL2 A;  4CY1 A;  5FXY A;  5K1C C;  3JRP A;  4A0B B;  3JPX A;  3DXK C;  3DSM A;  4XEI C;  3IJ0 A;  3SCY A;  3VA6 A;  1GP2 B;  4CY3 A;  4E5Z B;  3OW8 A;  3SXT D;  5H17 A;  1GOT B;  3AH8 B;  1A0R B;  1SHY B;  3N0D A;  3UVM A;  4CI3 A;  1GXR A;  2IUV A;  5CXC A;  4J0X A;  2H6N A;  4K3J B;  4A0B A;  4J77 A;  3BWS A;  4A7J A;  4J0W A;  4QQE A;  3EI3 A;  4JSP C;  1PBY B;  3MMY A;  3NVN A;  4E5Z A;  2XU7 A;  2BBK H;  5I5J A;  4A0A B;  3B7F A;  2OVQ B;  2YB8 B;  3HFQ A;  5GMK n;  4JXM A;  4I79 A;  2HJB A;  4IMM A;  5B4W A;  4X61 B;  4X63 B;  4FA4 D;  4CI8 A;  4PNK B;  2OVP B;  2GC7 A;  4PBY A;  3AFC A;  4J73 A;  3C99 A;  3RN1 D;  4CZV A;  5IJ8 E;  2QC5 A;  4OZU A;  3MKS B;  4QL1 A;  2XL3 A;  4GQ2 P;  3RFG A;  3PE7 A;  4E54 B;  4FA1 D;  4ESG A;  4A0A A;  2I0T A;  1GG2 B;  3VGZ A;  3CFS B;  2H6K A;  3A0F A;  4IA9 A;  3UVN A;  3DM0 A;  4Y5R D;  2UZY B;  5AMS A;  3IJC A;  2AGW A;  2IUR A;  1XHM A;  2H68 A;  5IT9 g;  3EI2 B;  2H14 A;  4BL0 A;  5GXH A;  1B9X A;  3SHF A;  1TBG A;  4E54 A;  5EML B;  2B5L A;  1N6D A;  4O9D A;  5HE2 B;  2HES X;  1FWX A;  3OKY A;  3OL2 B;  3ZWL B;  3RFH A;  3ODT A;  3IIW A;  3SN6 B;  2G9A A;  3JRO A;  3PVW B;  1K8K C;  4J86 A;  2CO0 A;  4A09 B;  2P9I C;  2HXC A;  2Z2O A;  2J56 H;  5EMK B;  2YNN A;  5HQG A;  4BH6 A;  4CC9 A;  2I0S A;  1ERJ A;  1XIP A;  4ZOX A;  4D6V A;  3UKU C;  5H14 A;  2W18 A;  4LG9 A;  3FRX A;  3P4F A;  3KRX B;  3IJ1 A;  5EAM A;  3MXX A;  4O3U B;  1SQ9 A;  1P22 A;  1OLZ A;  5A2Q g;  1SQJ A;  3EI3 B;  4ZOV A;  4A09 A;  1N6E A;  2AGY A;  2AGZ A;  3I7N A;  2Z2P A;  4ERZ A;  4G56 B;  3VH0 A;  4GM9 A;  4GMB A;  3I2N A;  4XYI A;  2HYE A;  2OIZ A;  4L3G D;  3PSL A;  4FA5 D;  3CFV A;  4X60 B;  2H9N A;  2AGX A;  3SLE D;  3KRW B;  4CI2 A;  2EBS A;  2H6Q A;  4K3I D;  3L4M D;  4ZOZ A;  5AFU 3;  5TDH B;  2HKR A;  1YFQ A;  4ZOY A;  2AGL A;  3I7K A;  5C2W B;  3UVL A;  3OKW A;  1PI6 A;  2B5M A;  3SMR A;  5C9Z B;  3BG0 A;  4FA9 D;  4CY2 A;  4PSW B;  2GC4 A;  4H5J A;  5AJA A;  3C5M A;  1MG2 A;  1MDA H;  1PEV A;  3GFC A;  3OTT A;  5FKR A;  2OVR B;  5FKT A;  2J55 H;  3SBQ A;  2I3S A;  4A11 A;  3MZL A;  3SFZ A;  2IAA A;  3BG1 A;  3OKY B;  4FWW A;  4NSX A;  4LGN A;  3EI4 B;  4A08 B;  5FKQ A;  2YBA A;  2GNQ A;  4ERY A;  5CXB B;  5FQD A;  2J57 G;  2IWK A;  3NVX A;  5EMM B;  2YNO A;  4U1E I;  5KDO B;  3I7P A;  5K19 A;  4A2M A;  5IGO A;  5I5I A;  2IWF A;  2PM9 A;  1JMZ B;  4R7A B;  4JSV C;  4X3E A;  3RMZ D;  2QXV A;  4LG8 A;  5CYK B;  3EU7 A;  3CIK B;  4GGC A;  3EI4 A;  3N0E A;  3V5W B;  5HYN B;  4A08 A;  2TRC B;  5CXB A;  2PBI B;  5SXM A;  1NEX B;  5JWZ A;  2IUP A;  4OWR A;  2H9M A;  1JOF A;  3MKQ A;  2P9K C;  1R5M A;  2I3T A;  4FHL A;  1U4C A;  3V9F A;  3J81 g;  5FKS A;  5CYK A;  2YMU A;  1S4U X;  3OKT A;  1K32 A;  4JSN C;  2CE9 A;  4PSX B;  4L3H D;  2OK6 A;  3AL9 A;  2BCJ B;  5H1M A;  5GXI A;  1JJU B;  5EAP A;  4J87 A;  3RN0 D;  3PSC B;  3EI1 B;  2H9L A;  2AH0 A;  2CN2 A;  2AH1 A;  1TYQ C;  3K26 A;  3ULE C;  1N6F A;  5I5M A;  1OMW B;  3F3P A;  5C2V B;  2Z2N A;  3RSE C;  4FAV D;  4Z8L A;  2CE8 A;  4KFM B;  3UKR C;  2HKM A;  2I0R A;  4UI9 R;  2PM7 B;  2OK4 A;  4GQ1 A;  4JD2 C;  3I7H A;  3EWE A;  2MTA H;  5EAR A;  4GM8 A;  3PXW D;  2XL2 A;  5IGQ A;  4O1Q D;  4GQB B;  4GZ8 A;  3C9C A;  3EI1 A;  2H9P A;  1VYH C;  2P9S C;  3U4Y A;  4A11 B;  4TZ4 A;  4JSX C;  2P9U C;  5EM2 B;  4YVD A;  4J81 A;  3EG6 A;  4GGD A;  5FLX g;  4L1Q D;  4ZN4 A;  2XYI A;  4AOW A;  5TEE A;  3NVQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...