4ZOZA

Crystal structure of the chaetomium thermophilum sqt1 bound to the n-terminus of the ribosomal protein l10
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
480
structure length
394
Chain Sequence
ENDSIAYFDGHKDSVFAIAQHPLYPNIVATGGSEGDADDAPGKGYVLDISSLNPIFEIDGHTDSINALTFTLPRGDFLVSGGMDGRMRVYAVSVPQNGALAQFKFLAESQETEEINWFAPCPSPDHPNTIALGASDGSVWVFTLDASDPSNPVQIVQSYFLHTGPCTAGAWSPDGLLLATVSEDESLHVYDVFGVAASKSLVTDNGQTVVSLTNVDQRFAVEGGLFSVAVSPTGAVVAVGGAGGQIKIVGLPRLAGTILASLQIQSDNIESLAFSPSAPILAAGSTDGSIAVFDTSRSFALRRHLRGAHAEDPVVKVEFVKSPPNAAMAGWLLTSCGMDGVVRRWDLRGGGLVKEWKGHRSGQEGGGVLGFVQGETGERIVTVGDDAVVLVFEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Sqt1
publication title Co-translational capturing of nascent ribosomal proteins by their dedicated chaperones.
pubmed doi rcsb
source organism Chaetomium thermophilum
total genus 101
structure length 394
sequence length 480
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-05-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4zozA00
4CZVA 3SBPA 3I7HA 3IJCA 5IJ8E 4CI8A 2P9SC 2YB8B 3UVNA 1PBYB 2CNXA 2H6NA 5CXBB 4ZOVA 3JZNA 1NEXB 2AGWA 3B7FA 1K8KC 2P9KC 4QQEA 2OJYA 2O9KA 4L9OA 1Q47A 4CY1A 5FQDA 4FA5D 5AJAA 2G99A 2GNQA 2TRCB 3OKYA 1MG3A 4LGNA 4ERQA 1JMZB 3AL8A 1SHYB 2BBKH 3I7NA 2J55H 3EWEA 4PXWA 3J81g 2CO0A 5KDOB 3GREA 3W15A 3BG0A 3SFZA 4IMMA 3DXKC 2EBSA 2I0TA 2GC7A 3SXTD 4R7AB 3ORVD 3PVWB 4GQBB 2PM9A 5EAPA 3RRMC 3SBQA 5IC7A 3AL9A 2IWKA 4A08A 4OZUA 2AQ5A 2MTAH 3RSEC 3SHFA 2H13A 3A0FA 4GGDA 3EU7A 2OVRB 1TYQC 1GG2B 2HKMA 3DM0A 5CXBA 3P4FA 4ERZA 4E5ZB 2HXCA 4TZ4A 4ZN4A 5GSAA 3KRWB 1FWXA 5CYKB 4J87A 3FRXA 4A0AB 4JT5C 3FGBA 3JRPA 4QT8A 4LG8A 4JSXC 4L1QD 1GP2B 3JZHA 2H6QA 2P9UC 3OKYB 3EMHA 4PSXB 4GMBA 4ERYA 4ES0A 3UVKA 4J0XA 4LG9A 4A2MA 5FKTA 3V5WB 2OK6A 2IUVA 2I3TA 4AOWA 1L0QA 2B5NA 4J79A 1A0RB 2QXVA 2H9LA 4PBYA 1B9XA 2Q7QA 3RLMD 4ZOYA 2XL3A 2XL2A 1P22A 4JSPC 2AGZA 5EARA 4ESGA 4IA9A 2BCJB 2PM9B 5TDHB 5HYNB 4UI9R 3SBRA 3MKQA 2HKRA 5HE1B 2AGXA 2AGYA 3PXWD 2B5MA 5H1MA 4EWRA 3L4OD 4J77A 4FAVD 4L3GD 1B9YA 5EMLB 4CZXA 1XIPA 5GXHA 4U7AA 4E5ZA 4L3HD 3CIKB 3FM0A 5CYKA 5FKQA 1OLZA 4Y5RD 2PM7B 3AH8B 3PSLA 4A0AA 2H9PA 3N0EA 3I8EA 1S4UX 3F3GA 3MZLA 5IJ7E 2GC4A 3SJLD 5AFU3 3ULEC 4ZOZA 3RFHA 2P9PC 3IIWA 4N14A 4XYHA 4E54B 3C5MA 3JROA 3E0CA 3N0DA 4PC0A 1PI6A 1MG2A 4GGAA 3OKTA 4QL1A 3OTTA 4FA9D 5IGQA 3I8CA 1MDAH 4O3TB 4J78A 2P9LC 4BH6A 5C2WB 3CFVA 1PEVA 1PGUA 4AEZA 4PNKB 4J73A 3V7DB 2B4EA 4D6VA 2W18A 1U2VC 4J81A 4O9DA 2IUPA 3UKRC 1TBGA 2H6KA 2OIZA 2XU7A 1GOTB 3IIYA 4FAND 2YNNA 3MZKA 5EAMA 3DWLC 3ZWLB 4X60B 4A0BA 1XHMA 4GQ2P 3UVOA 2PM6B 4U1EI 2YBAA 4CI2A 5EMJB 4CC9A 3OKWA 3NVXA 4NSXA 4CZYA 3NVNA 1ERJA 3C9CA 1OMWB 3RN0D 4E54A 5THAA 3I7OA 4QRJA 3F3FA 4CY2A 2Z2PA 3V9FA 1JOFA 4FA4D 5TEEA 2AH0A 5B4WA 2OVQB 2CE9A 2I3SA 3RMZD 3ODTA 2H47A 3JB9L 5IT9g 5EALA 4O45A 2CN2A 3CFSB 5FA5B 4O1QD 1SQJA 5EMMB 2H9MA 5CXCA 1N6EA 5H17A 3I2NA 4CY5A 3IJ1A 2XYIA 4CI1A 5EMKB 5FKRA 5K1CC 4BUJC 1JMXB 2B5LA 2YMUA 4J8GA 1YFQA 3BWSA 2IUQA 4X63B 2H3XA 2PBIB 4G56B 3DSMA 4CY3A 3GFCA 3RFGA 4J8BA 4FWWA 4A09B 4FA1D 4H5IA 3PE7A 4A0BB 3C99A 3EI3B 4GZ8A 3VGZA 3UVMA 3NVQA 3JAMg 3VH0A 3I7KA 4K3JB 1GXRA 3JZGA 4CI3A 2OVPB 5I5JA 2UZXB 2G9AA 4ZOXA 3BG1A 4KFMB 4A7JA 2YNOA 5IGOA 3DXMC 3SMRA 3EG6A 4A11B 5H14A 5K19A 3I7LA 1SQ9A 3SCYA 3MMYA 2CO0C 5GXIA 3EI1B 3HFQA 4XYIA 2CN3A 5FLXg 2AGLA 2J57G 4X3EA 3U4YA 5GMKn 2P9IC 3OL2B 1K32A 5HE0B 2IURA 5CXCB 4JXMA 1XKSA 1RI6A 3IKOA 3L4MD 4BL0A 3UVLA 4Z8LA 4H5JA 4J82A 2I0SA 1VYHC 1NR0A 2HESX 2CE8A 4A09A 2AH1A 4GGCA 3RN1D 4A2LA 2I0RA 3MXXA 3UR4A 1U4CA 3K26A 4GQ1A 2Z2OA 3MKSB 4PSWB 2H14A 5HQGA 3EI2A 2P9NC 3EI3A 3EI4B 3F3PA 5EM2B 3SLED 3IJ0A 5I5MA 5I5IA 2HJ4A 3J80g 2YNPA 2H68A 5FXYA 4JT6C 4X61B 5HE2B 4J84A 4JSNC 2H9NA 5A2Qg 3AFCA 4GM9A 3I7PA 4D0KA 4GM8A 4A11A 3PSCB 3K27A 2HJBA 2IAAA 3EI1A 5HE3B 5TF2A 4O3UB 5C2VB 4GM3A 3PVUB 3UKUC 5AMSA 4FHLA 3KRXB 2J56H 3AL8B 3OL2A 2IWFA 3PXTD 4JSVC 5FKSA 4K3ID 3SN6B 5TEFA 2QC5A 4J0WA 2Z2NA 4JD2C 4OWRA 4FB1D 1JJUB 2UZYB 1QNIA 2OK4A 3JPXA 3C75H 4J86A 3PXSD 1N6DA 4I79A 3I89A 4Y7RA 4HDJA 4YVDA 5SXMA 5C9ZB 3SWSD 3EI4A 5EM2A 2HYEA 1R5MA 3OW8A 3SVWD 4MK0B 1N6FA 3VA6A 4XEIC 3EI2B 4PBZA 4A08B 5JWZA
chains in the Genus database with same CATH superfamily
4CZVA 3SBPA 3I7HA 3IJCA 1VZ3A 5IJ8E 4CI8A 2P9SC 2YB8B 2VDOA 3UVNA 1PBYB 2CNXA 3NIDA 4WK0A 2H6NA 5CXBB 4ZOVA 3JZNA 1H2WA 1NEXB 2AGWA 4DNUA 3B7FA 1K8KC 2P9KC 4QQEA 2OJYA 2O9KA 4L9OA 1Q47A 4CY1A 5FQDA 4FA5D 5AJAA 2G99A 2GNQA 2TRCB 3OKYA 1MG3A 4LGNA 4ERQA 1JMZB 3AL8A 1SHYB 1YR2A 2BBKH 3I7NA 2J55H 2VDKA 3EWEA 4PXWA 2CO0A 5KDOB 3ZE2A 3MUNA 3J81g 3GREA 2VDRA 3W15A 3BG0A 3SFZA 4IMMA 3DXKC 2EBSA 4Z7OA 3T3MA 2I0TA 2VDLA 2GC7A 1H2YA 3SXTD 3NIFA 1U8CA 4R7AB 3ORVD 3PVWB 4GQBB 3K71A 2PM9A 5EAPA 3MUOA 2VZ3A 3RRMC 3SBQA 5IC7A 3AL9A 2IWKA 2VDMA 2VC2A 4A08A 4OZUA 3T3PA 2AQ5A 2MTAH 4NC4A 3RSEC 3SHFA 4DNVA 2H13A 3A0FA 4GGDA 3EU7A 2OVRB 1TYQC 1GG2B 2HKMA 3IUJA 3DM0A 1C9IA 1H2XA 5CXBA 3P4FA 4ERZA 1TYEA 4E5ZB 2HU8A 2HXCA 4WK2A 4TZ4A 4ZN4A 1C9LA 5GSAA 2EIBA 3KRWB 1FWXA 4O2WA 5CYKB 4J87A 3ZDZA 4AMYA 3FRXA 4BCBA 4A0AB 4JT5C 3FGBA 3JRPA 4QT8A 4LG8A 4JSXC 4NBMA 4L1QD 1GP2B 3JZHA 2H6QA 1VZ2A 2P9UC 3IJEA 3OKYB 3EMHA 4PSXB 4GMBA 4ERYA 4ES0A 3UVKA 4J0XA 1M1XA 1QFSA 4LG9A 3QI0A 3FCSA 1QFMA 4A2MA 5FKTA 3V5WB 2OK6A 2IUVA 2I3TA 4AOWA 1L0QA 2B5NA 4J79A 1A0RB 2QXVA 1GOHA 2H9LA 4PBYA 1B9XA 2Q7QA 1UOQA 3RLMD 4ZOYA 2XL3A 2XL2A 1P22A 4JSPC 2AGZA 5EARA 3O4JA 4ESGA 4IA9A 2BCJB 2PM9B 5TDHB 5HYNB 4UI9R 3SBRA 3MKQA 2HKRA 5HE1B 5FFOA 2AGXA 1T2XA 2QR5A 2AGYA 3PXWD 2B5MA 5H1MA 4EWRA 3L4OD 5HDBA 4J77A 5E6RA 4FAVD 4L3GD 1B9YA 3FCUA 5EMLB 4BCDA 4CZXA 1XIPA 4WJKA 5GXHA 3EQ9A 4U7AA 4E5ZA 4G1MA 3GD1I 4L3HD 3CIKB 3ZDYA 3FM0A 5CYKA 5M5RA 5FKQA 1OLZA 5M5UA 4Y5RD 2PM7B 3AH8B 3PSLA 4A0AA 2H9PA 3N0EA 3I8EA 3KCIA 1S4UX 3F3GA 5M5TA 3MZLA 5IJ7E 2GC4A 3SJLD 5AFU3 3ULEC 4AMZA 4ZOZA 3RFHA 4NAAA 3IURA 4JHNA 2P9PC 3IIWA 4N14A 4XYHA 4E54B 3C5MA 3JROA 3E0CA 3N0DA 3VI3A 3O4HA 3V4PA 4PC0A 1PI6A 1MG2A 4GGAA 3OKTA 4QL1A 3OTTA 4FA9D 5IGQA 3I8CA 1MDAH 1VE6A 4O3TB 4J78A 2P9LC 4BH6A 5C2WB 3CFVA 5M5SA 1PEVA 1PGUA 4AEZA 4BP9A 4PNKB 4J73A 3V7DB 2QZPA 2B4EA 4D6VA 2W18A 1U2VC 4J81A 4O9DA 2IUPA 3ZE0A 3GC3B 3UKRC 4BP8A 1TBGA 3IUQA 2H6KA 2OIZA 2XU7A 1GOTB 3IIYA 4FAND 3ZDXA 2YNNA 3MZKA 1UTCA 5EAMA 2HU5A 2VDQA 3DWLC 4G1EA 3ZWLB 4X60B 4MMXA 4A0BA 1XHMA 3NIGA 4GQ2P 3UVOA 2PM6B 4U1EI 2YBAA 4CI2A 5EMJB 4CC9A 3OKWA 3NVXA 4NSXA 4CZYA 3QHYB 3NVNA 1ERJA 3C9CA 1OMWB 3IULA 3RN0D 4E54A 1O6FA 5THAA 3I7OA 4UM8A 4QRJA 3F3FA 4CY2A 4NENA 2Z2PA 4Z7QA 3V9FA 1JOFA 4FA4D 5TEEA 2AH0A 5B4WA 2OVQB 2CE9A 2I3SA 4MMZA 3RMZD 3ODTA 2H47A 3JB9L 5IT9g 5EALA 3V4VA 4O45A 2CN2A 3CFSB 4RE6A 5FA5B 4O1QD 1SQJA 4RE5A 5EMMB 2H9MA 2XDWA 5CXCA 1N6EA 1E8NA 5H17A 3I2NA 2JKXA 1GOFA 4CY5A 3IJ1A 2XYIA 4CI1A 5EMKB 4AN1A 5FKRA 5K1CC 1UOOA 4Z7NA 4BUJC 1A12A 1JMXB 5E6UA 1H2ZA 2B5LA 4O02A 2YMUA 4J8GA 1YFQA 3BWSA 4WK4A 2IUQA 4X63B 2H3XA 3O4GA 4G55A 2PBIB 4G56B 3OF7A 3DSMA 4CY3A 3GFCA 3RFGA 4J8BA 4FWWA 4A09B 4FA1D 3PE7A 4H5IA 4A0BB 4QAMA 3C99A 3EI3B 4GZ8A 2XE4A 3VGZA 3UVMA 3NVQA 3JAMg 3VH0A 3I7KA 4K3JB 1GXRA 3JZGA 4CI3A 2OVPB 5I5JA 2UZXB 2G9AA 1O6GA 4ZOXA 3BG1A 4KFMB 4A7JA 2YNOA 5IGOA 3DXMC 3SMRA 3EG6A 4A11B 5H14A 5K19A 3I7LA 1SQ9A 3SCYA 2VDPA 3K6SA 3MMYA 1E5TA 2CO0C 5GXIA 3EI1B 3HFQA 4XYIA 5FFGA 2CN3A 4JHPC 3O4IA 5FLXg 2AGLA 4IRZA 2J57G 4X3EA 3U4YA 5GMKn 2P9IC 3OL2B 1K32A 3IUNA 5HE0B 2IURA 5CXCB 4JXMA 5E6SA 1XKSA 1RI6A 3IKOA 3L4MD 4BL0A 3UVLA 4AN0A 4Z8LA 4H5JA 4J82A 2I0SA 1VYHC 1NR0A 1GOGA 2HESX 2CE8A 4A09A 2AH1A 4GGCA 3RN1D 4A2LA 2I0RA 3MXXA 3UR4A 1U4CA 3K26A 4GQ1A 2Z2OA 3MKSB 4PSWB 2H14A 5HQGA 1I2MB 3EI2A 2P9NC 3EI3A 3EQ8A 3EI4B 3F3PA 5EM2B 3SLED 3IJ0A 3ZE1A 5I5MA 5C86A 5I5IA 4AX4A 4DNWA 2HJ4A 3J80g 2YNPA 2VZ1A 2H68A 5FXYA 1K3IA 4JT6C 4X61B 1UOPA 5HE2B 3IUMA 4J84A 2EIDA 4JSNC 2H9NA 5A2Qg 3AFCA 4GM9A 3I7PA 4D0KA 4GM8A 2VDNA 1JV2A 4A11A 5M61A 3PSCB 1JTDB 2HU7A 3EQ7A 3K27A 4MMYA 2HJBA 2IAAA 1E8MA 3IVMA 3EI1A 5HE3B 2WQ8A 3K72A 5C92A 3VI4A 5TF2A 4O3UB 5C2VB 2BKLA 4GM3A 1BPOA 3PVUB 3UKUC 2EICA 5AMSA 4FHLA 3KRXB 2J56H 3AL8B 3OL2A 2IWFA 3PXTD 4JSVC 5FKSA 4K3ID 3SN6B 5TEFA 2QC5A 4J0WA 2Z2NA 4JD2C 2XZGA 4UM9A 4OWRA 4FB1D 1JJUB 2UZYB 1QNIA 2OK4A 4L1MA 3JPXA 1VE7A 4D9SA 3C75H 3MVDK 4J86A 3PXSD 1N6DA 4BCCA 4I79A 3I89A 4Y7RA 5M5VA 4HDJA 4YVDA 5SXMA 5C9ZB 3SWSD 3EI4A 5EM2A 1L5GA 1R5MA 3OW8A 2HYEA 3SVWD 4MK0B 1N6FA 3VA6A 4XEIC 3EI2B 4PBZA 4A08B 5JWZA 3DDUA 2EIEA
chains in the Genus database with same CATH topology
4CZVA 3SBPA 3I7HA 3IJCA 5IJ8E 4CI8A 2P9SC 2YB8B 3UVNA 1PBYB 2CNXA 2H6NA 5CXBB 4ZOVA 3JZNA 1NEXB 2AGWA 3B7FA 1K8KC 2P9KC 4QQEA 2OJYA 2O9KA 4L9OA 1Q47A 4CY1A 5FQDA 4FA5D 5AJAA 2G99A 2GNQA 2TRCB 3OKYA 1MG3A 4LGNA 4ERQA 1JMZB 3AL8A 1SHYB 2BBKH 3I7NA 2J55H 3EWEA 4PXWA 3J81g 2CO0A 5KDOB 3GREA 3W15A 3BG0A 3SFZA 4IMMA 3DXKC 2EBSA 2I0TA 2GC7A 3SXTD 4R7AB 3ORVD 3PVWB 4GQBB 2PM9A 5EAPA 3RRMC 3SBQA 5IC7A 3AL9A 2IWKA 4A08A 4OZUA 2AQ5A 2MTAH 3RSEC 3SHFA 2H13A 3A0FA 4GGDA 3EU7A 2OVRB 1TYQC 1GG2B 2HKMA 3DM0A 5CXBA 3P4FA 4ERZA 4E5ZB 2HXCA 4TZ4A 4ZN4A 5GSAA 3KRWB 1FWXA 5CYKB 4J87A 3FRXA 4A0AB 4JT5C 3FGBA 3JRPA 4QT8A 4LG8A 4JSXC 4L1QD 1GP2B 3JZHA 2H6QA 2P9UC 3OKYB 3EMHA 4PSXB 4GMBA 4ERYA 4ES0A 3UVKA 4J0XA 4LG9A 4A2MA 5FKTA 3V5WB 2OK6A 2IUVA 2I3TA 4AOWA 1L0QA 2B5NA 4J79A 1A0RB 2QXVA 2H9LA 4PBYA 1B9XA 2Q7QA 3RLMD 4ZOYA 2XL3A 2XL2A 1P22A 4JSPC 2AGZA 5EARA 4ESGA 4IA9A 2BCJB 2PM9B 5TDHB 5HYNB 4UI9R 3SBRA 3MKQA 2HKRA 5HE1B 2AGXA 2AGYA 3PXWD 2B5MA 5H1MA 4EWRA 3L4OD 4J77A 4FAVD 4L3GD 1B9YA 5EMLB 4CZXA 1XIPA 5GXHA 4U7AA 4E5ZA 4L3HD 3CIKB 3FM0A 5CYKA 5FKQA 1OLZA 4Y5RD 2PM7B 3AH8B 3PSLA 4A0AA 2H9PA 3N0EA 3I8EA 1S4UX 3F3GA 3MZLA 5IJ7E 2GC4A 3SJLD 5AFU3 3ULEC 4ZOZA 3RFHA 2P9PC 3IIWA 4N14A 4XYHA 4E54B 3C5MA 3JROA 3E0CA 3N0DA 4PC0A 1PI6A 1MG2A 4GGAA 3OKTA 4QL1A 3OTTA 4FA9D 5IGQA 3I8CA 1MDAH 4O3TB 4J78A 2P9LC 4BH6A 5C2WB 3CFVA 1PEVA 1PGUA 4AEZA 4PNKB 4J73A 3V7DB 2B4EA 4D6VA 2W18A 1U2VC 4J81A 4O9DA 2IUPA 3UKRC 1TBGA 2H6KA 2OIZA 2XU7A 1GOTB 3IIYA 4FAND 2YNNA 3MZKA 5EAMA 3DWLC 3ZWLB 4X60B 4A0BA 1XHMA 4GQ2P 3UVOA 2PM6B 4U1EI 2YBAA 4CI2A 5EMJB 4CC9A 3OKWA 3NVXA 4NSXA 4CZYA 3NVNA 1ERJA 3C9CA 1OMWB 3RN0D 4E54A 5THAA 3I7OA 4QRJA 3F3FA 4CY2A 2Z2PA 3V9FA 1JOFA 4FA4D 5TEEA 2AH0A 5B4WA 2OVQB 2CE9A 2I3SA 3RMZD 3ODTA 2H47A 3JB9L 5IT9g 5EALA 4O45A 2CN2A 3CFSB 5FA5B 4O1QD 1SQJA 5EMMB 2H9MA 5CXCA 1N6EA 5H17A 3I2NA 4CY5A 3IJ1A 2XYIA 4CI1A 5EMKB 5FKRA 5K1CC 4BUJC 1JMXB 2B5LA 2YMUA 4J8GA 1YFQA 3BWSA 2IUQA 4X63B 2H3XA 2PBIB 4G56B 3DSMA 4CY3A 3GFCA 3RFGA 4J8BA 4FWWA 4A09B 4FA1D 4H5IA 3PE7A 4A0BB 3C99A 3EI3B 4GZ8A 3VGZA 3UVMA 3NVQA 3JAMg 3VH0A 3I7KA 4K3JB 1GXRA 3JZGA 4CI3A 2OVPB 5I5JA 2UZXB 2G9AA 4ZOXA 3BG1A 4KFMB 4A7JA 2YNOA 5IGOA 3DXMC 3SMRA 3EG6A 4A11B 5H14A 5K19A 3I7LA 1SQ9A 3SCYA 3MMYA 2CO0C 5GXIA 3EI1B 3HFQA 4XYIA 2CN3A 5FLXg 2AGLA 2J57G 4X3EA 3U4YA 5GMKn 2P9IC 3OL2B 1K32A 5HE0B 2IURA 5CXCB 4JXMA 1XKSA 1RI6A 3IKOA 3L4MD 4BL0A 3UVLA 4Z8LA 4H5JA 4J82A 2I0SA 1VYHC 1NR0A 2HESX 2CE8A 4A09A 2AH1A 4GGCA 3RN1D 4A2LA 2I0RA 3MXXA 3UR4A 1U4CA 3K26A 4GQ1A 2Z2OA 3MKSB 4PSWB 2H14A 5HQGA 3EI2A 2P9NC 3EI3A 3EI4B 3F3PA 5EM2B 3SLED 3IJ0A 5I5MA 5I5IA 2HJ4A 3J80g 2YNPA 2H68A 5FXYA 4JT6C 4X61B 5HE2B 4J84A 4JSNC 2H9NA 5A2Qg 3AFCA 4GM9A 3I7PA 4D0KA 4GM8A 4A11A 3PSCB 3K27A 2HJBA 2IAAA 3EI1A 5HE3B 5TF2A 4O3UB 5C2VB 4GM3A 3PVUB 3UKUC 5AMSA 4FHLA 3KRXB 2J56H 3AL8B 3OL2A 2IWFA 3PXTD 4JSVC 5FKSA 4K3ID 3SN6B 5TEFA 2QC5A 4J0WA 2Z2NA 4JD2C 4OWRA 4FB1D 1JJUB 2UZYB 1QNIA 2OK4A 3JPXA 3C75H 4J86A 3PXSD 1N6DA 4I79A 3I89A 4Y7RA 4HDJA 4YVDA 5SXMA 5C9ZB 3SWSD 3EI4A 5EM2A 2HYEA 1R5MA 3OW8A 3SVWD 4MK0B 1N6FA 3VA6A 4XEIC 3EI2B 4PBZA 4A08B 5JWZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CZV A;  3SBP A;  3I7H A;  3IJC A;  5IJ8 E;  4CI8 A;  2P9S C;  2YB8 B;  3UVN A;  1PBY B;  2CNX A;  2H6N A;  5CXB B;  4ZOV A;  3JZN A;  1NEX B;  2AGW A;  3B7F A;  1K8K C;  2P9K C;  4QQE A;  2OJY A;  2O9K A;  4L9O A;  1Q47 A;  4CY1 A;  5FQD A;  4FA5 D;  5AJA A;  2G99 A;  2GNQ A;  2TRC B;  3OKY A;  1MG3 A;  4LGN A;  4ERQ A;  1JMZ B;  3AL8 A;  1SHY B;  2BBK H;  3I7N A;  2J55 H;  3EWE A;  4PXW A;  3J81 g;  2CO0 A;  5KDO B;  3GRE A;  3W15 A;  3BG0 A;  3SFZ A;  4IMM A;  3DXK C;  2EBS A;  2I0T A;  2GC7 A;  3SXT D;  4R7A B;  3ORV D;  3PVW B;  4GQB B;  2PM9 A;  5EAP A;  3RRM C;  3SBQ A;  5IC7 A;  3AL9 A;  2IWK A;  4A08 A;  4OZU A;  2AQ5 A;  2MTA H;  3RSE C;  3SHF A;  2H13 A;  3A0F A;  4GGD A;  3EU7 A;  2OVR B;  1TYQ C;  1GG2 B;  2HKM A;  3DM0 A;  5CXB A;  3P4F A;  4ERZ A;  4E5Z B;  2HXC A;  4TZ4 A;  4ZN4 A;  5GSA A;  3KRW B;  1FWX A;  5CYK B;  4J87 A;  3FRX A;  4A0A B;  4JT5 C;  3FGB A;  3JRP A;  4QT8 A;  4LG8 A;  4JSX C;  4L1Q D;  1GP2 B;  3JZH A;  2H6Q A;  2P9U C;  3OKY B;  3EMH A;  4PSX B;  4GMB A;  4ERY A;  4ES0 A;  3UVK A;  4J0X A;  4LG9 A;  4A2M A;  5FKT A;  3V5W B;  2OK6 A;  2IUV A;  2I3T A;  4AOW A;  1L0Q A;  2B5N A;  4J79 A;  1A0R B;  2QXV A;  2H9L A;  4PBY A;  1B9X A;  2Q7Q A;  3RLM D;  4ZOY A;  2XL3 A;  2XL2 A;  1P22 A;  4JSP C;  2AGZ A;  5EAR A;  4ESG A;  4IA9 A;  2BCJ B;  2PM9 B;  5TDH B;  5HYN B;  4UI9 R;  3SBR A;  3MKQ A;  2HKR A;  5HE1 B;  2AGX A;  2AGY A;  3PXW D;  2B5M A;  5H1M A;  4EWR A;  3L4O D;  4J77 A;  4FAV D;  4L3G D;  1B9Y A;  5EML B;  4CZX A;  1XIP A;  5GXH A;  4U7A A;  4E5Z A;  4L3H D;  3CIK B;  3FM0 A;  5CYK A;  5FKQ A;  1OLZ A;  4Y5R D;  2PM7 B;  3AH8 B;  3PSL A;  4A0A A;  2H9P A;  3N0E A;  3I8E A;  1S4U X;  3F3G A;  3MZL A;  5IJ7 E;  2GC4 A;  3SJL D;  5AFU 3;  3ULE C;  4ZOZ A;  3RFH A;  2P9P C;  3IIW A;  4N14 A;  4XYH A;  4E54 B;  3C5M A;  3JRO A;  3E0C A;  3N0D A;  4PC0 A;  1PI6 A;  1MG2 A;  4GGA A;  3OKT A;  4QL1 A;  3OTT A;  4FA9 D;  5IGQ A;  3I8C A;  1MDA H;  4O3T B;  4J78 A;  2P9L C;  4BH6 A;  5C2W B;  3CFV A;  1PEV A;  1PGU A;  4AEZ A;  4PNK B;  4J73 A;  3V7D B;  2B4E A;  4D6V A;  2W18 A;  1U2V C;  4J81 A;  4O9D A;  2IUP A;  3UKR C;  1TBG A;  2H6K A;  2OIZ A;  2XU7 A;  1GOT B;  3IIY A;  4FAN D;  2YNN A;  3MZK A;  5EAM A;  3DWL C;  3ZWL B;  4X60 B;  4A0B A;  1XHM A;  4GQ2 P;  3UVO A;  2PM6 B;  4U1E I;  2YBA A;  4CI2 A;  5EMJ B;  4CC9 A;  3OKW A;  3NVX A;  4NSX A;  4CZY A;  3NVN A;  1ERJ A;  3C9C A;  1OMW B;  3RN0 D;  4E54 A;  5THA A;  3I7O A;  4QRJ A;  3F3F A;  4CY2 A;  2Z2P A;  3V9F A;  1JOF A;  4FA4 D;  5TEE A;  2AH0 A;  5B4W A;  2OVQ B;  2CE9 A;  2I3S A;  3RMZ D;  3ODT A;  2H47 A;  3JB9 L;  5IT9 g;  5EAL A;  4O45 A;  2CN2 A;  3CFS B;  5FA5 B;  4O1Q D;  1SQJ A;  5EMM B;  2H9M A;  5CXC A;  1N6E A;  5H17 A;  3I2N A;  4CY5 A;  3IJ1 A;  2XYI A;  4CI1 A;  5EMK B;  5FKR A;  5K1C C;  4BUJ C;  1JMX B;  2B5L A;  2YMU A;  4J8G A;  1YFQ A;  3BWS A;  2IUQ A;  4X63 B;  2H3X A;  2PBI B;  4G56 B;  3DSM A;  4CY3 A;  3GFC A;  3RFG A;  4J8B A;  4FWW A;  4A09 B;  4FA1 D;  4H5I A;  3PE7 A;  4A0B B;  3C99 A;  3EI3 B;  4GZ8 A;  3VGZ A;  3UVM A;  3NVQ A;  3JAM g;  3VH0 A;  3I7K A;  4K3J B;  1GXR A;  3JZG A;  4CI3 A;  2OVP B;  5I5J A;  2UZX B;  2G9A A;  4ZOX A;  3BG1 A;  4KFM B;  4A7J A;  2YNO A;  5IGO A;  3DXM C;  3SMR A;  3EG6 A;  4A11 B;  5H14 A;  5K19 A;  3I7L A;  1SQ9 A;  3SCY A;  3MMY A;  2CO0 C;  5GXI A;  3EI1 B;  3HFQ A;  4XYI A;  2CN3 A;  5FLX g;  2AGL A;  2J57 G;  4X3E A;  3U4Y A;  5GMK n;  2P9I C;  3OL2 B;  1K32 A;  5HE0 B;  2IUR A;  5CXC B;  4JXM A;  1XKS A;  1RI6 A;  3IKO A;  3L4M D;  4BL0 A;  3UVL A;  4Z8L A;  4H5J A;  4J82 A;  2I0S A;  1VYH C;  1NR0 A;  2HES X;  2CE8 A;  4A09 A;  2AH1 A;  4GGC A;  3RN1 D;  4A2L A;  2I0R A;  3MXX A;  3UR4 A;  1U4C A;  3K26 A;  4GQ1 A;  2Z2O A;  3MKS B;  4PSW B;  2H14 A;  5HQG A;  3EI2 A;  2P9N C;  3EI3 A;  3EI4 B;  3F3P A;  5EM2 B;  3SLE D;  3IJ0 A;  5I5M A;  5I5I A;  2HJ4 A;  3J80 g;  2YNP A;  2H68 A;  5FXY A;  4JT6 C;  4X61 B;  5HE2 B;  4J84 A;  4JSN C;  2H9N A;  5A2Q g;  3AFC A;  4GM9 A;  3I7P A;  4D0K A;  4GM8 A;  4A11 A;  3PSC B;  3K27 A;  2HJB A;  2IAA A;  3EI1 A;  5HE3 B;  5TF2 A;  4O3U B;  5C2V B;  4GM3 A;  3PVU B;  3UKU C;  5AMS A;  4FHL A;  3KRX B;  2J56 H;  3AL8 B;  3OL2 A;  2IWF A;  3PXT D;  4JSV C;  5FKS A;  4K3I D;  3SN6 B;  5TEF A;  2QC5 A;  4J0W A;  2Z2N A;  4JD2 C;  4OWR A;  4FB1 D;  1JJU B;  2UZY B;  1QNI A;  2OK4 A;  3JPX A;  3C75 H;  4J86 A;  3PXS D;  1N6D A;  4I79 A;  3I89 A;  4Y7R A;  4HDJ A;  4YVD A;  5SXM A;  5C9Z B;  3SWS D;  3EI4 A;  5EM2 A;  2HYE A;  1R5M A;  3OW8 A;  3SVW D;  4MK0 B;  1N6F A;  3VA6 A;  4XEI C;  3EI2 B;  4PBZ A;  4A08 B;  5JWZ A; 
#chains in the Genus database with same CATH topology
 4CZV A;  3SBP A;  3I7H A;  3IJC A;  1VZ3 A;  5IJ8 E;  4CI8 A;  2P9S C;  2YB8 B;  2VDO A;  3UVN A;  1PBY B;  2CNX A;  3NID A;  4WK0 A;  2H6N A;  5CXB B;  4ZOV A;  3JZN A;  1H2W A;  1NEX B;  2AGW A;  4DNU A;  3B7F A;  1K8K C;  2P9K C;  4QQE A;  2OJY A;  2O9K A;  4L9O A;  1Q47 A;  4CY1 A;  5FQD A;  4FA5 D;  5AJA A;  2G99 A;  2GNQ A;  2TRC B;  3OKY A;  1MG3 A;  4LGN A;  4ERQ A;  1JMZ B;  3AL8 A;  1SHY B;  1YR2 A;  2BBK H;  3I7N A;  2J55 H;  2VDK A;  3EWE A;  4PXW A;  2CO0 A;  5KDO B;  3ZE2 A;  3MUN A;  3J81 g;  3GRE A;  2VDR A;  3W15 A;  3BG0 A;  3SFZ A;  4IMM A;  3DXK C;  2EBS A;  4Z7O A;  3T3M A;  2I0T A;  2VDL A;  2GC7 A;  1H2Y A;  3SXT D;  3NIF A;  1U8C A;  4R7A B;  3ORV D;  3PVW B;  4GQB B;  3K71 A;  2PM9 A;  5EAP A;  3MUO A;  2VZ3 A;  3RRM C;  3SBQ A;  5IC7 A;  3AL9 A;  2IWK A;  2VDM A;  2VC2 A;  4A08 A;  4OZU A;  3T3P A;  2AQ5 A;  2MTA H;  4NC4 A;  3RSE C;  3SHF A;  4DNV A;  2H13 A;  3A0F A;  4GGD A;  3EU7 A;  2OVR B;  1TYQ C;  1GG2 B;  2HKM A;  3IUJ A;  3DM0 A;  1C9I A;  1H2X A;  5CXB A;  3P4F A;  4ERZ A;  1TYE A;  4E5Z B;  2HU8 A;  2HXC A;  4WK2 A;  4TZ4 A;  4ZN4 A;  1C9L A;  5GSA A;  2EIB A;  3KRW B;  1FWX A;  4O2W A;  5CYK B;  4J87 A;  3ZDZ A;  4AMY A;  3FRX A;  4BCB A;  4A0A B;  4JT5 C;  3FGB A;  3JRP A;  4QT8 A;  4LG8 A;  4JSX C;  4NBM A;  4L1Q D;  1GP2 B;  3JZH A;  2H6Q A;  1VZ2 A;  2P9U C;  3IJE A;  3OKY B;  3EMH A;  4PSX B;  4GMB A;  4ERY A;  4ES0 A;  3UVK A;  4J0X A;  1M1X A;  1QFS A;  4LG9 A;  3QI0 A;  3FCS A;  1QFM A;  4A2M A;  5FKT A;  3V5W B;  2OK6 A;  2IUV A;  2I3T A;  4AOW A;  1L0Q A;  2B5N A;  4J79 A;  1A0R B;  2QXV A;  1GOH A;  2H9L A;  4PBY A;  1B9X A;  2Q7Q A;  1UOQ A;  3RLM D;  4ZOY A;  2XL3 A;  2XL2 A;  1P22 A;  4JSP C;  2AGZ A;  5EAR A;  3O4J A;  4ESG A;  4IA9 A;  2BCJ B;  2PM9 B;  5TDH B;  5HYN B;  4UI9 R;  3SBR A;  3MKQ A;  2HKR A;  5HE1 B;  5FFO A;  2AGX A;  1T2X A;  2QR5 A;  2AGY A;  3PXW D;  2B5M A;  5H1M A;  4EWR A;  3L4O D;  5HDB A;  4J77 A;  5E6R A;  4FAV D;  4L3G D;  1B9Y A;  3FCU A;  5EML B;  4BCD A;  4CZX A;  1XIP A;  4WJK A;  5GXH A;  3EQ9 A;  4U7A A;  4E5Z A;  4G1M A;  3GD1 I;  4L3H D;  3CIK B;  3ZDY A;  3FM0 A;  5CYK A;  5M5R A;  5FKQ A;  1OLZ A;  5M5U A;  4Y5R D;  2PM7 B;  3AH8 B;  3PSL A;  4A0A A;  2H9P A;  3N0E A;  3I8E A;  3KCI A;  1S4U X;  3F3G A;  5M5T A;  3MZL A;  5IJ7 E;  2GC4 A;  3SJL D;  5AFU 3;  3ULE C;  4AMZ A;  4ZOZ A;  3RFH A;  4NAA A;  3IUR A;  4JHN A;  2P9P C;  3IIW A;  4N14 A;  4XYH A;  4E54 B;  3C5M A;  3JRO A;  3E0C A;  3N0D A;  3VI3 A;  3O4H A;  3V4P A;  4PC0 A;  1PI6 A;  1MG2 A;  4GGA A;  3OKT A;  4QL1 A;  3OTT A;  4FA9 D;  5IGQ A;  3I8C A;  1MDA H;  1VE6 A;  4O3T B;  4J78 A;  2P9L C;  4BH6 A;  5C2W B;  3CFV A;  5M5S A;  1PEV A;  1PGU A;  4AEZ A;  4BP9 A;  4PNK B;  4J73 A;  3V7D B;  2QZP A;  2B4E A;  4D6V A;  2W18 A;  1U2V C;  4J81 A;  4O9D A;  2IUP A;  3ZE0 A;  3GC3 B;  3UKR C;  4BP8 A;  1TBG A;  3IUQ A;  2H6K A;  2OIZ A;  2XU7 A;  1GOT B;  3IIY A;  4FAN D;  3ZDX A;  2YNN A;  3MZK A;  1UTC A;  5EAM A;  2HU5 A;  2VDQ A;  3DWL C;  4G1E A;  3ZWL B;  4X60 B;  4MMX A;  4A0B A;  1XHM A;  3NIG A;  4GQ2 P;  3UVO A;  2PM6 B;  4U1E I;  2YBA A;  4CI2 A;  5EMJ B;  4CC9 A;  3OKW A;  3NVX A;  4NSX A;  4CZY A;  3QHY B;  3NVN A;  1ERJ A;  3C9C A;  1OMW B;  3IUL A;  3RN0 D;  4E54 A;  1O6F A;  5THA A;  3I7O A;  4UM8 A;  4QRJ A;  3F3F A;  4CY2 A;  4NEN A;  2Z2P A;  4Z7Q A;  3V9F A;  1JOF A;  4FA4 D;  5TEE A;  2AH0 A;  5B4W A;  2OVQ B;  2CE9 A;  2I3S A;  4MMZ A;  3RMZ D;  3ODT A;  2H47 A;  3JB9 L;  5IT9 g;  5EAL A;  3V4V A;  4O45 A;  2CN2 A;  3CFS B;  4RE6 A;  5FA5 B;  4O1Q D;  1SQJ A;  4RE5 A;  5EMM B;  2H9M A;  2XDW A;  5CXC A;  1N6E A;  1E8N A;  5H17 A;  3I2N A;  2JKX A;  1GOF A;  4CY5 A;  3IJ1 A;  2XYI A;  4CI1 A;  5EMK B;  4AN1 A;  5FKR A;  5K1C C;  1UOO A;  4Z7N A;  4BUJ C;  1A12 A;  1JMX B;  5E6U A;  1H2Z A;  2B5L A;  4O02 A;  2YMU A;  4J8G A;  1YFQ A;  3BWS A;  4WK4 A;  2IUQ A;  4X63 B;  2H3X A;  3O4G A;  4G55 A;  2PBI B;  4G56 B;  3OF7 A;  3DSM A;  4CY3 A;  3GFC A;  3RFG A;  4J8B A;  4FWW A;  4A09 B;  4FA1 D;  3PE7 A;  4H5I A;  4A0B B;  4QAM A;  3C99 A;  3EI3 B;  4GZ8 A;  2XE4 A;  3VGZ A;  3UVM A;  3NVQ A;  3JAM g;  3VH0 A;  3I7K A;  4K3J B;  1GXR A;  3JZG A;  4CI3 A;  2OVP B;  5I5J A;  2UZX B;  2G9A A;  1O6G A;  4ZOX A;  3BG1 A;  4KFM B;  4A7J A;  2YNO A;  5IGO A;  3DXM C;  3SMR A;  3EG6 A;  4A11 B;  5H14 A;  5K19 A;  3I7L A;  1SQ9 A;  3SCY A;  2VDP A;  3K6S A;  3MMY A;  1E5T A;  2CO0 C;  5GXI A;  3EI1 B;  3HFQ A;  4XYI A;  5FFG A;  2CN3 A;  4JHP C;  3O4I A;  5FLX g;  2AGL A;  4IRZ A;  2J57 G;  4X3E A;  3U4Y A;  5GMK n;  2P9I C;  3OL2 B;  1K32 A;  3IUN A;  5HE0 B;  2IUR A;  5CXC B;  4JXM A;  5E6S A;  1XKS A;  1RI6 A;  3IKO A;  3L4M D;  4BL0 A;  3UVL A;  4AN0 A;  4Z8L A;  4H5J A;  4J82 A;  2I0S A;  1VYH C;  1NR0 A;  1GOG A;  2HES X;  2CE8 A;  4A09 A;  2AH1 A;  4GGC A;  3RN1 D;  4A2L A;  2I0R A;  3MXX A;  3UR4 A;  1U4C A;  3K26 A;  4GQ1 A;  2Z2O A;  3MKS B;  4PSW B;  2H14 A;  5HQG A;  1I2M B;  3EI2 A;  2P9N C;  3EI3 A;  3EQ8 A;  3EI4 B;  3F3P A;  5EM2 B;  3SLE D;  3IJ0 A;  3ZE1 A;  5I5M A;  5C86 A;  5I5I A;  4AX4 A;  4DNW A;  2HJ4 A;  3J80 g;  2YNP A;  2VZ1 A;  2H68 A;  5FXY A;  1K3I A;  4JT6 C;  4X61 B;  1UOP A;  5HE2 B;  3IUM A;  4J84 A;  2EID A;  4JSN C;  2H9N A;  5A2Q g;  3AFC A;  4GM9 A;  3I7P A;  4D0K A;  4GM8 A;  2VDN A;  1JV2 A;  4A11 A;  5M61 A;  3PSC B;  1JTD B;  2HU7 A;  3EQ7 A;  3K27 A;  4MMY A;  2HJB A;  2IAA A;  1E8M A;  3IVM A;  3EI1 A;  5HE3 B;  2WQ8 A;  3K72 A;  5C92 A;  3VI4 A;  5TF2 A;  4O3U B;  5C2V B;  2BKL A;  4GM3 A;  1BPO A;  3PVU B;  3UKU C;  2EIC A;  5AMS A;  4FHL A;  3KRX B;  2J56 H;  3AL8 B;  3OL2 A;  2IWF A;  3PXT D;  4JSV C;  5FKS A;  4K3I D;  3SN6 B;  5TEF A;  2QC5 A;  4J0W A;  2Z2N A;  4JD2 C;  2XZG A;  4UM9 A;  4OWR A;  4FB1 D;  1JJU B;  2UZY B;  1QNI A;  2OK4 A;  4L1M A;  3JPX A;  1VE7 A;  4D9S A;  3C75 H;  3MVD K;  4J86 A;  3PXS D;  1N6D A;  4BCC A;  4I79 A;  3I89 A;  4Y7R A;  5M5V A;  4HDJ A;  4YVD A;  5SXM A;  5C9Z B;  3SWS D;  3EI4 A;  5EM2 A;  1L5G A;  1R5M A;  3OW8 A;  2HYE A;  3SVW D;  4MK0 B;  1N6F A;  3VA6 A;  4XEI C;  3EI2 B;  4PBZ A;  4A08 B;  5JWZ A;  3DDU A;  2EIE A; 
#chains in the Genus database with same CATH homology
 4CZV A;  3SBP A;  3I7H A;  3IJC A;  5IJ8 E;  4CI8 A;  2P9S C;  2YB8 B;  3UVN A;  1PBY B;  2CNX A;  2H6N A;  5CXB B;  4ZOV A;  3JZN A;  1NEX B;  2AGW A;  3B7F A;  1K8K C;  2P9K C;  4QQE A;  2OJY A;  2O9K A;  4L9O A;  1Q47 A;  4CY1 A;  5FQD A;  4FA5 D;  5AJA A;  2G99 A;  2GNQ A;  2TRC B;  3OKY A;  1MG3 A;  4LGN A;  4ERQ A;  1JMZ B;  3AL8 A;  1SHY B;  2BBK H;  3I7N A;  2J55 H;  3EWE A;  4PXW A;  3J81 g;  2CO0 A;  5KDO B;  3GRE A;  3W15 A;  3BG0 A;  3SFZ A;  4IMM A;  3DXK C;  2EBS A;  2I0T A;  2GC7 A;  3SXT D;  4R7A B;  3ORV D;  3PVW B;  4GQB B;  2PM9 A;  5EAP A;  3RRM C;  3SBQ A;  5IC7 A;  3AL9 A;  2IWK A;  4A08 A;  4OZU A;  2AQ5 A;  2MTA H;  3RSE C;  3SHF A;  2H13 A;  3A0F A;  4GGD A;  3EU7 A;  2OVR B;  1TYQ C;  1GG2 B;  2HKM A;  3DM0 A;  5CXB A;  3P4F A;  4ERZ A;  4E5Z B;  2HXC A;  4TZ4 A;  4ZN4 A;  5GSA A;  3KRW B;  1FWX A;  5CYK B;  4J87 A;  3FRX A;  4A0A B;  4JT5 C;  3FGB A;  3JRP A;  4QT8 A;  4LG8 A;  4JSX C;  4L1Q D;  1GP2 B;  3JZH A;  2H6Q A;  2P9U C;  3OKY B;  3EMH A;  4PSX B;  4GMB A;  4ERY A;  4ES0 A;  3UVK A;  4J0X A;  4LG9 A;  4A2M A;  5FKT A;  3V5W B;  2OK6 A;  2IUV A;  2I3T A;  4AOW A;  1L0Q A;  2B5N A;  4J79 A;  1A0R B;  2QXV A;  2H9L A;  4PBY A;  1B9X A;  2Q7Q A;  3RLM D;  4ZOY A;  2XL3 A;  2XL2 A;  1P22 A;  4JSP C;  2AGZ A;  5EAR A;  4ESG A;  4IA9 A;  2BCJ B;  2PM9 B;  5TDH B;  5HYN B;  4UI9 R;  3SBR A;  3MKQ A;  2HKR A;  5HE1 B;  2AGX A;  2AGY A;  3PXW D;  2B5M A;  5H1M A;  4EWR A;  3L4O D;  4J77 A;  4FAV D;  4L3G D;  1B9Y A;  5EML B;  4CZX A;  1XIP A;  5GXH A;  4U7A A;  4E5Z A;  4L3H D;  3CIK B;  3FM0 A;  5CYK A;  5FKQ A;  1OLZ A;  4Y5R D;  2PM7 B;  3AH8 B;  3PSL A;  4A0A A;  2H9P A;  3N0E A;  3I8E A;  1S4U X;  3F3G A;  3MZL A;  5IJ7 E;  2GC4 A;  3SJL D;  5AFU 3;  3ULE C;  4ZOZ A;  3RFH A;  2P9P C;  3IIW A;  4N14 A;  4XYH A;  4E54 B;  3C5M A;  3JRO A;  3E0C A;  3N0D A;  4PC0 A;  1PI6 A;  1MG2 A;  4GGA A;  3OKT A;  4QL1 A;  3OTT A;  4FA9 D;  5IGQ A;  3I8C A;  1MDA H;  4O3T B;  4J78 A;  2P9L C;  4BH6 A;  5C2W B;  3CFV A;  1PEV A;  1PGU A;  4AEZ A;  4PNK B;  4J73 A;  3V7D B;  2B4E A;  4D6V A;  2W18 A;  1U2V C;  4J81 A;  4O9D A;  2IUP A;  3UKR C;  1TBG A;  2H6K A;  2OIZ A;  2XU7 A;  1GOT B;  3IIY A;  4FAN D;  2YNN A;  3MZK A;  5EAM A;  3DWL C;  3ZWL B;  4X60 B;  4A0B A;  1XHM A;  4GQ2 P;  3UVO A;  2PM6 B;  4U1E I;  2YBA A;  4CI2 A;  5EMJ B;  4CC9 A;  3OKW A;  3NVX A;  4NSX A;  4CZY A;  3NVN A;  1ERJ A;  3C9C A;  1OMW B;  3RN0 D;  4E54 A;  5THA A;  3I7O A;  4QRJ A;  3F3F A;  4CY2 A;  2Z2P A;  3V9F A;  1JOF A;  4FA4 D;  5TEE A;  2AH0 A;  5B4W A;  2OVQ B;  2CE9 A;  2I3S A;  3RMZ D;  3ODT A;  2H47 A;  3JB9 L;  5IT9 g;  5EAL A;  4O45 A;  2CN2 A;  3CFS B;  5FA5 B;  4O1Q D;  1SQJ A;  5EMM B;  2H9M A;  5CXC A;  1N6E A;  5H17 A;  3I2N A;  4CY5 A;  3IJ1 A;  2XYI A;  4CI1 A;  5EMK B;  5FKR A;  5K1C C;  4BUJ C;  1JMX B;  2B5L A;  2YMU A;  4J8G A;  1YFQ A;  3BWS A;  2IUQ A;  4X63 B;  2H3X A;  2PBI B;  4G56 B;  3DSM A;  4CY3 A;  3GFC A;  3RFG A;  4J8B A;  4FWW A;  4A09 B;  4FA1 D;  4H5I A;  3PE7 A;  4A0B B;  3C99 A;  3EI3 B;  4GZ8 A;  3VGZ A;  3UVM A;  3NVQ A;  3JAM g;  3VH0 A;  3I7K A;  4K3J B;  1GXR A;  3JZG A;  4CI3 A;  2OVP B;  5I5J A;  2UZX B;  2G9A A;  4ZOX A;  3BG1 A;  4KFM B;  4A7J A;  2YNO A;  5IGO A;  3DXM C;  3SMR A;  3EG6 A;  4A11 B;  5H14 A;  5K19 A;  3I7L A;  1SQ9 A;  3SCY A;  3MMY A;  2CO0 C;  5GXI A;  3EI1 B;  3HFQ A;  4XYI A;  2CN3 A;  5FLX g;  2AGL A;  2J57 G;  4X3E A;  3U4Y A;  5GMK n;  2P9I C;  3OL2 B;  1K32 A;  5HE0 B;  2IUR A;  5CXC B;  4JXM A;  1XKS A;  1RI6 A;  3IKO A;  3L4M D;  4BL0 A;  3UVL A;  4Z8L A;  4H5J A;  4J82 A;  2I0S A;  1VYH C;  1NR0 A;  2HES X;  2CE8 A;  4A09 A;  2AH1 A;  4GGC A;  3RN1 D;  4A2L A;  2I0R A;  3MXX A;  3UR4 A;  1U4C A;  3K26 A;  4GQ1 A;  2Z2O A;  3MKS B;  4PSW B;  2H14 A;  5HQG A;  3EI2 A;  2P9N C;  3EI3 A;  3EI4 B;  3F3P A;  5EM2 B;  3SLE D;  3IJ0 A;  5I5M A;  5I5I A;  2HJ4 A;  3J80 g;  2YNP A;  2H68 A;  5FXY A;  4JT6 C;  4X61 B;  5HE2 B;  4J84 A;  4JSN C;  2H9N A;  5A2Q g;  3AFC A;  4GM9 A;  3I7P A;  4D0K A;  4GM8 A;  4A11 A;  3PSC B;  3K27 A;  2HJB A;  2IAA A;  3EI1 A;  5HE3 B;  5TF2 A;  4O3U B;  5C2V B;  4GM3 A;  3PVU B;  3UKU C;  5AMS A;  4FHL A;  3KRX B;  2J56 H;  3AL8 B;  3OL2 A;  2IWF A;  3PXT D;  4JSV C;  5FKS A;  4K3I D;  3SN6 B;  5TEF A;  2QC5 A;  4J0W A;  2Z2N A;  4JD2 C;  4OWR A;  4FB1 D;  1JJU B;  2UZY B;  1QNI A;  2OK4 A;  3JPX A;  3C75 H;  4J86 A;  3PXS D;  1N6D A;  4I79 A;  3I89 A;  4Y7R A;  4HDJ A;  4YVD A;  5SXM A;  5C9Z B;  3SWS D;  3EI4 A;  5EM2 A;  2HYE A;  1R5M A;  3OW8 A;  3SVW D;  4MK0 B;  1N6F A;  3VA6 A;  4XEI C;  3EI2 B;  4PBZ A;  4A08 B;  5JWZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...