2AGLA

Crystal structure of the phenylhydrazine adduct of aromatic amine dehydrogenase from alcaligenes faecalis
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
360
structure length
360
Chain Sequence
REVLTGGHSVSAPQENRIYVMDSVFMHLTESRVHVYDYTNGKFLGMVPTAFNGHVQVSNDGKKIYTMTTYHERITRGKRSDVVEVWDADKLTFEKEISLPPKRVQGLNYDGLFRQTTDGKFIVLQNASPATSIGIVDVAKGDYVEDVTAAAGCWSVIPQPNRPRSFMTICGDGGLLTINLGEDGKVASQSRSKQMFSVKDDPIFIAPALDKDKAHFVSYYGNVYSADFSGDEVKVDGPWSLLNDEDKAKNWVPGGYNLVGLHRASGRMYVFMHPDGKEGTHKFPAAEIWVMDTKTKQRVARIPGRDALSMTIDQQRNLMLTLDGGNVNVYDISQPEPKLLRTIEGAAEASLQVQFHPVGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Aromatic amine dehydrogenase
publication title Atomic description of an enzyme reaction dominated by proton tunneling
pubmed doi rcsb
total genus 97
structure length 360
sequence length 360
chains with identical sequence B
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2005-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2aglA01
4PNKB 2AGXA 3MZLA 3I7OA 2I0RA 4A08A 2H9LA 5A2Qg 4CI8A 2HJ4A 2XL3A 2OVQB 3FRXA 3SFZA 3EI4A 4J86A 4BUJC 3UVLA 3AL8A 5H14A 2PBIB 4X61B 3V7DB 1NEXB 5FLXg 4A2LA 2J56H 4A08B 2IURA 4J73A 5THAA 4NSXA 2H9PA 2IUQA 5HQGA 1OMWB 3SWSD 4PSXB 5FKSA 1SQJA 4J0XA 3EI4B 5GXHA 4JT5C 3AL8B 5FXYA 3SVWD 3EG6A 3IJCA 5EMKB 3SJLD 3I89A 3UR4A 4PBYA 4X63B 1MDAH 5C2VB 4H5JA 2IUPA 4JSNC 4GZ8A 4UI9R 4K3JB 1VYHC 2I0SA 1ERJA 5EM2A 4KFMB 1XKSA 4QRJA 5TF2A 4FAVD 5IT9g 2CN3A 4GGDA 3RSEC 3OL2A 3RN1D 1N6EA 1U4CA 2YNOA 3NVXA 2QC5A 3I7LA 3BG0A 5EMJB 1GP2B 2H13A 2G99A 1B9YA 3KRXB 1PI6A 5HE0B 4ERQA 1QNIA 5CXCA 4R7AB 3UKUC 2H14A 3ODTA 5EM2B 3SMRA 2PM6B 5HE2B 4L3HD 2W18A 2GC7A 3OL2B 1PEVA 4CZYA 1TYQC 5I5MA 4XEIC 3SBPA 4L3GD 4FA1D 2AH1A 2OK4A 4GQ2P 5IGQA 1K32A 3EI2A 2HESX 5CXCB 4XYHA 2UZXB 3OW8A 4CY1A 4JSVC 5HE1B 4FA4D 3V5WB 2B5LA 3I2NA 3DXMC 3DM0A 3IIYA 4J87A 3I7KA 5AMSA 2B4EA 3MKSB 4YVDA 3JZNA 4CI2A 3MKQA 4CI3A 3SXTD 3SN6B 3EI2B 2TRCB 2HKMA 3SLED 2HKRA 3PXTD 3UVOA 4Y5RD 4J77A 2H3XA 4EWRA 2OVRB 2Z2PA 4H5IA 2XYIA 4MK0B 2P9UC 4A7JA 5GXIA 3OKTA 2OIZA 2P9PC 4A0AA 3C9CA 2UZYB 4J82A 3JZHA 2Z2OA 5TDHB 3UKRC 3FM0A 3JZGA 3A0FA 3L4OD 1JOFA 4Z8LA 4ZOXA 2H6NA 4A0BA 1MG2A 3C75H 2P9IC 3I7HA 3KRWB 3RN0D 2HJBA 4A0AB 1XIPA 4J8BA 2QXVA 3RRMC 3VGZA 2IWKA 4JD2C 3CIKB 2EBSA 2OVPB 3PSLA 3PVUB 3AFCA 3JROA 4JT6C 4A0BB 4GM9A 2IUVA 5IC7A 2J55H 1SHYB 2YMUA 4LGNA 3IJ0A 3PVWB 4CC9A 5SXMA 4D6VA 4L9OA 3AH8B 3CFSB 4GQBB 3SHFA 2CO0C 3DWLC 4PBZA 4O9DA 5EARA 3C5MA 3F3FA 2AGYA 2GC4A 4TZ4A 3NVNA 3VH0A 4BH6A 2HXCA 2YBAA 4GGAA 2YNPA 4OZUA 3GREA 2CE9A 4L1QD 3V9FA 3L4MD 3BG1A 2P9NC 5CYKA 5FKRA 2OJYA 4HDJA 4ES0A 3ZWLB 3GFCA 4D0KA 4J78A 3BWSA 5CXBA 2Z2NA 4J0WA 2IAAA 3RLMD 4FA5D 2I3SA 3I8EA 2PM7B 2I0TA 5FKQA 5CYKB 5H1MA 2BBKH 2CN2A 3K27A 2G9AA 3JRPA 4CI1A 3UVMA 2PM9A 1K8KC 3CFVA 2B5NA 4JSPC 5CXBB 4FHLA 5HYNB 4GQ1A 5IJ7E 4LG9A 1GG2B 4U1EI 3K26A 4A11A 1PGUA 5IJ8E 1A0RB 5KDOB 3F3PA 2CO0A 3EI1A 3RFHA 1JMZB 2AQ5A 3MMYA 4A09A 1JJUB 3E0CA 3SBRA 4XYIA 5FKTA 2PM9B 1YFQA 4K3ID 5EAMA 4QT8A 4U7AA 4A11B 2H68A 1N6DA 2J57G 4FAND 5JWZA 2OK6A 3W15A 3EI1B 4QQEA 3DXKC 4J8GA 4Y7RA 4A09B 5EALA 3ULEC 1RI6A 5FA5B 4FA9D 4G56B 4PC0A 2HYEA 3EWEA 1Q47A 5IGOA 3SCYA 3I7NA 4J84A 5EAPA 4ZOVA 3U4YA 3J81g 3EMHA 1GXRA 1P22A 2AGWA 3OKWA 4N14A 5C9ZB 3F3GA 3B7FA 4PXWA 1TBGA 4QL1A 3PXWD 4X60B 2GNQA 4GM8A 3JPXA 5EMLB 1L0QA 3C99A 2P9LC 4J81A 4FB1D 2AH0A 5K19A 5TEFA 5EMMB 3RFGA 3N0DA 2BCJB 2XU7A 4CY5A 3ORVD 3EI3A 3SBQA 5AFU3 3EU7A 1S4UX 4GGCA 4GM3A 3UVKA 3RMZD 3AL9A 3MZKA 1NR0A 3JB9L 2YB8B 4CZXA 3VA6A 5B4WA 4E54A 4PSWB 3OKYA 1FWXA 1B9XA 5GSAA 4O3UB 3EI3B 1GOTB 3IJ1A 4BL0A 3PE7A 1N6FA 5FQDA 4JSXC 3I7PA 3IIWA 2H9MA 2H47A 4I79A 2MTAH 5C2WB 4E54B 2H9NA 4ZOYA 4CY3A 3OKYB 2YNNA 2AGZA 2CE8A 2B5MA 4X3EA 3J80g 4IA9A 4ESGA 4E5ZA 4ERYA 2IWFA 1R5MA 1U2VC 1JMXB 3N0EA 5HE3B 4ZN4A 2Q7QA 5TEEA 2XL2A 5GMKn 4O1QD 3IKOA 4LG8A 3UVNA 4CZVA 2H6QA 3DSMA 5I5IA 1PBYB 3NVQA 1XHMA 4J79A 3OTTA 4E5ZB 2I3TA 4O45A 2O9KA 5H17A 3HFQA 4FWWA 2P9KC 4OWRA 3P4FA 4JXMA 3JAMg 4AOWA 2CNXA 1OLZA 4AEZA 4O3TB 4IMMA 3FGBA 1MG3A 4ZOZA 4ERZA 2AGLA 3PSCB 5I5JA 3I8CA 1SQ9A 2H6KA 3PXSD 2P9SC 4CY2A 5AJAA 3MXXA 4GMBA 5K1CC 4A2MA
chains in the Genus database with same CATH superfamily
4NBMA 4PNKB 4NAAA 2AGXA 1UOQA 3MZLA 3I7OA 2I0RA 4A08A 2H9LA 5A2Qg 4CI8A 4DNVA 2HJ4A 2XL3A 2OVQB 3FRXA 3SFZA 3EI4A 4J86A 4BUJC 3UVLA 3AL8A 5H14A 2PBIB 4X61B 2QR5A 3V7DB 1NEXB 5FLXg 4A2LA 2J56H 4A08B 2IURA 4J73A 5THAA 3NIFA 1M1XA 4NSXA 2H9PA 2IUQA 5HQGA 3IULA 1OMWB 3SWSD 4MMYA 4PSXB 5FKSA 4AX4A 4UM8A 2VZ1A 1SQJA 4J0XA 3EI4B 3ZDXA 5GXHA 1QFSA 4JT5C 3AL8B 2EIEA 5FXYA 3SVWD 3MVDK 1H2XA 3EG6A 3IJCA 5EMKB 5E6UA 3SJLD 4WK0A 3I89A 3UR4A 4PBYA 4X63B 3IUMA 1MDAH 5C2VB 4H5JA 2IUPA 4JSNC 4GZ8A 1E8MA 1GOHA 4K3JB 1VYHC 2I0SA 4UI9R 1ERJA 4Z7OA 5EM2A 4KFMB 1XKSA 2VZ3A 4QRJA 3EQ7A 5TF2A 2CN3A 4GGDA 4FAVD 3RSEC 5IT9g 2VDQA 2VC2A 3OL2A 3V4VA 3RN1D 3T3MA 1N6EA 1U4CA 3IURA 2YNOA 3NVXA 2QC5A 3I7LA 3BG0A 4NENA 1GP2B 3DDUA 5EMJB 2H13A 2G99A 1B9YA 3KRXB 1PI6A 5HE0B 4ERQA 1QNIA 5CXCA 4R7AB 3UKUC 2H14A 3ODTA 5EM2B 1JV2A 2HU8A 3IUJA 3QI0A 2PM6B 3SMRA 5HE2B 4L3HD 2W18A 2GC7A 3OL2B 2HU7A 1PEVA 4CZYA 4MMXA 1TYQC 4WJKA 5I5MA 4XEIC 2EIBA 3SBPA 4L3GD 4FA1D 2AH1A 2OK4A 4GQ2P 3ZDYA 2VDPA 5IGQA 1K32A 3EI2A 2HESX 5CXCB 4XYHA 2UZXB 1L5GA 3OW8A 4CY1A 3IUNA 4JSVC 5HE1B 4FA4D 3V5WB 1T2XA 5FFGA 2B5LA 3I2NA 3DXMC 1VZ3A 3DM0A 4JHPC 4Z7NA 3IIYA 4J87A 3I7KA 5AMSA 2B4EA 3ZE1A 3MKSB 4YVDA 3JZNA 4CI2A 3MKQA 2QZPA 4CI3A 3SXTD 3SN6B 3EI2B 5M5RA 2TRCB 1BPOA 2HKMA 3SLED 2HKRA 3PXTD 3UVOA 2VDRA 4Y5RD 4J77A 2H3XA 4EWRA 2VDOA 2OVRB 2Z2PA 4H5IA 2XYIA 3ZE0A 4MK0B 3QHYB 4DNUA 1A12A 2P9UC 4A7JA 5GXIA 3OKTA 2OIZA 4AN0A 2P9PC 4A0AA 3C9CA 2UZYB 3ZE2A 4J82A 3JZHA 1K3IA 2Z2OA 5TDHB 3UKRC 4MMZA 4AMZA 4BCBA 3FM0A 2VDLA 3JZGA 1JTDB 3A0FA 3L4OD 1JOFA 4Z8LA 4ZOXA 2H6NA 2JKXA 4A0BA 1MG2A 4Z7QA 3C75H 2P9IC 3I7HA 3KRWB 3RN0D 2HJBA 1O6GA 3OF7A 4A0AB 1XIPA 3VI3A 4J8BA 2EIDA 4D9SA 2QXVA 2XZGA 3RRMC 2IWKA 3VGZA 4JD2C 3CIKB 1GOFA 2EBSA 2OVPB 3PSLA 3PVUB 5FFOA 3AFCA 3JROA 4JT6C 4A0BB 3K71A 4GM9A 1GOGA 2IUVA 5IC7A 5C86A 2J55H 1SHYB 2YMUA 4LGNA 1U8CA 2HU5A 3EQ9A 3IJ0A 3PVWB 4CC9A 5SXMA 4D6VA 2XDWA 4L9OA 1QFMA 3AH8B 3CFSB 4L1MA 4GQBB 4AMYA 3SHFA 2CO0C 3DWLC 4PBZA 4O9DA 5M5TA 5EARA 3C5MA 3F3FA 5M61A 2AGYA 2GC4A 4TZ4A 3NVNA 3VH0A 4BH6A 2HXCA 2YBAA 4GGAA 2YNPA 1E5TA 3GREA 4OZUA 2CE9A 4L1QD 3NIDA 3V9FA 3L4MD 3BG1A 4G1MA 2P9NC 5CYKA 3O4JA 5FKRA 2OJYA 4HDJA 3K72A 4ES0A 3ZWLB 3GFCA 4D0KA 4J78A 3BWSA 5HDBA 5CXBA 2Z2NA 4J0WA 3IUQA 2IAAA 4RE5A 3O4GA 3RLMD 4FA5D 2I3SA 3I8EA 2PM7B 2VDMA 2I0TA 1E8NA 5FKQA 5CYKB 3KCIA 2BBKH 2CN2A 3K27A 2G9AA 5H1MA 2VDNA 3JRPA 4CI1A 3UVMA 2PM9A 1K8KC 3CFVA 1UOOA 2B5NA 4JSPC 5CXBB 4FHLA 3FCUA 5HYNB 4GQ1A 5IJ7E 4LG9A 1GG2B 4U1EI 3K26A 4A11A 5C92A 1PGUA 2WQ8A 3FCSA 5IJ8E 1A0RB 5KDOB 3F3PA 2CO0A 4BP8A 3EI1A 3RFHA 1JMZB 2AQ5A 1UTCA 2XE4A 3MMYA 4A09A 1JJUB 3E0CA 3SBRA 4XYIA 5FKTA 2PM9B 1YFQA 4K3ID 5EAMA 1YR2A 4BCCA 2VDKA 4O02A 4QT8A 4U7AA 3NIGA 4A11B 2H68A 1TYEA 1N6DA 2J57G 4FAND 5JWZA 1H2WA 2OK6A 4G1EA 3W15A 4UM9A 3EI1B 4QQEA 3DXKC 4J8GA 4Y7RA 4A09B 5EALA 2BKLA 3ULEC 1RI6A 5FA5B 4FA9D 4G56B 4PC0A 2HYEA 3EWEA 1Q47A 5IGOA 3SCYA 3I7NA 4J84A 5EAPA 4ZOVA 4DNWA 1VE6A 3U4YA 3J81g 3EMHA 1GXRA 1P22A 2AGWA 3OKWA 4N14A 5C9ZB 4NC4A 3F3GA 3MUNA 3B7FA 4PXWA 1TBGA 3IVMA 4QL1A 4O2WA 3PXWD 4X60B 1I2MB 3ZDZA 2GNQA 4GM8A 3JPXA 5EMLB 1L0QA 3C99A 2P9LC 4J81A 4FB1D 2AH0A 5K19A 4JHNA 5TEFA 5EMMB 1O6FA 1UOPA 3RFGA 3N0DA 2BCJB 2XU7A 4CY5A 3ORVD 5M5VA 3EI3A 3SBQA 5AFU3 3EU7A 1S4UX 4WK4A 3EQ8A 4GGCA 4GM3A 3UVKA 3RMZD 3AL9A 3MZKA 4WK2A 1NR0A 3JB9L 2YB8B 4CZXA 3O4IA 3VA6A 5B4WA 4E54A 4AN1A 4PSWB 3OKYA 3K6SA 1FWXA 3GC3B 1B9XA 5GSAA 4O3UB 3EI3B 1GOTB 3IJ1A 4BL0A 3PE7A 4BP9A 1N6FA 5FQDA 4JSXC 3I7PA 3MUOA 3IIWA 2H9MA 2H47A 4I79A 5E6SA 3V4PA 2MTAH 5C2WB 4RE6A 3VI4A 4E54B 2H9NA 4ZOYA 4CY3A 3OKYB 2YNNA 2AGZA 2CE8A 2B5MA 4X3EA 3J80g 4IA9A 4ESGA 4E5ZA 4ERYA 2IWFA 1R5MA 1U2VC 1JMXB 3O4HA 4G55A 3N0EA 5HE3B 4ZN4A 2Q7QA 5TEEA 2XL2A 5GMKn 4BCDA 4O1QD 3IKOA 4LG8A 3UVNA 4CZVA 2H6QA 3DSMA 5I5IA 1PBYB 3NVQA 5M5UA 3T3PA 1XHMA 4J79A 3OTTA 4E5ZB 2I3TA 4O45A 2O9KA 5H17A 3HFQA 4FWWA 4QAMA 2P9KC 4OWRA 3P4FA 4JXMA 3GD1I 3JAMg 4AOWA 2CNXA 1OLZA 4AEZA 4O3TB 1VZ2A 4IMMA 1C9IA 1H2ZA 3FGBA 1MG3A 1C9LA 2EICA 5E6RA 4ZOZA 4ERZA 1H2YA 2AGLA 3PSCB 5I5JA 3I8CA 5M5SA 1SQ9A 2H6KA 3PXSD 2P9SC 4CY2A 5AJAA 3MXXA 1VE7A 4IRZA 4GMBA 3IJEA 5K1CC 4A2MA
chains in the Genus database with same CATH topology
4PNKB 2AGXA 3MZLA 3I7OA 2I0RA 4A08A 2H9LA 5A2Qg 4CI8A 2HJ4A 2XL3A 2OVQB 3FRXA 3SFZA 3EI4A 4J86A 4BUJC 3UVLA 3AL8A 5H14A 2PBIB 4X61B 3V7DB 1NEXB 5FLXg 4A2LA 2J56H 4A08B 2IURA 4J73A 5THAA 4NSXA 2H9PA 2IUQA 5HQGA 1OMWB 3SWSD 4PSXB 5FKSA 1SQJA 4J0XA 3EI4B 5GXHA 4JT5C 3AL8B 5FXYA 3SVWD 3EG6A 3IJCA 5EMKB 3SJLD 3I89A 3UR4A 4PBYA 4X63B 1MDAH 5C2VB 4H5JA 2IUPA 4JSNC 4GZ8A 4UI9R 4K3JB 1VYHC 2I0SA 1ERJA 5EM2A 4KFMB 1XKSA 4QRJA 5TF2A 4FAVD 5IT9g 2CN3A 4GGDA 3RSEC 3OL2A 3RN1D 1N6EA 1U4CA 2YNOA 3NVXA 2QC5A 3I7LA 3BG0A 5EMJB 1GP2B 2H13A 2G99A 1B9YA 3KRXB 1PI6A 5HE0B 4ERQA 1QNIA 5CXCA 4R7AB 3UKUC 2H14A 3ODTA 5EM2B 3SMRA 2PM6B 5HE2B 4L3HD 2W18A 2GC7A 3OL2B 1PEVA 4CZYA 1TYQC 5I5MA 4XEIC 3SBPA 4L3GD 4FA1D 2AH1A 2OK4A 4GQ2P 5IGQA 1K32A 3EI2A 2HESX 5CXCB 4XYHA 2UZXB 3OW8A 4CY1A 4JSVC 5HE1B 4FA4D 3V5WB 2B5LA 3I2NA 3DXMC 3DM0A 3IIYA 4J87A 3I7KA 5AMSA 2B4EA 3MKSB 4YVDA 3JZNA 4CI2A 3MKQA 4CI3A 3SXTD 3SN6B 3EI2B 2TRCB 2HKMA 3SLED 2HKRA 3PXTD 3UVOA 4Y5RD 4J77A 2H3XA 4EWRA 2OVRB 2Z2PA 4H5IA 2XYIA 4MK0B 2P9UC 4A7JA 5GXIA 3OKTA 2OIZA 2P9PC 4A0AA 3C9CA 2UZYB 4J82A 3JZHA 2Z2OA 5TDHB 3UKRC 3FM0A 3JZGA 3A0FA 3L4OD 1JOFA 4Z8LA 4ZOXA 2H6NA 4A0BA 1MG2A 3C75H 2P9IC 3I7HA 3KRWB 3RN0D 2HJBA 4A0AB 1XIPA 4J8BA 2QXVA 3RRMC 3VGZA 2IWKA 4JD2C 3CIKB 2EBSA 2OVPB 3PSLA 3PVUB 3AFCA 3JROA 4JT6C 4A0BB 4GM9A 2IUVA 5IC7A 2J55H 1SHYB 2YMUA 4LGNA 3IJ0A 3PVWB 4CC9A 5SXMA 4D6VA 4L9OA 3AH8B 3CFSB 4GQBB 3SHFA 2CO0C 3DWLC 4PBZA 4O9DA 5EARA 3C5MA 3F3FA 2AGYA 2GC4A 4TZ4A 3NVNA 3VH0A 4BH6A 2HXCA 2YBAA 4GGAA 2YNPA 4OZUA 3GREA 2CE9A 4L1QD 3V9FA 3L4MD 3BG1A 2P9NC 5CYKA 5FKRA 2OJYA 4HDJA 4ES0A 3ZWLB 3GFCA 4D0KA 4J78A 3BWSA 5CXBA 2Z2NA 4J0WA 2IAAA 3RLMD 4FA5D 2I3SA 3I8EA 2PM7B 2I0TA 5FKQA 5CYKB 5H1MA 2BBKH 2CN2A 3K27A 2G9AA 3JRPA 4CI1A 3UVMA 2PM9A 1K8KC 3CFVA 2B5NA 4JSPC 5CXBB 4FHLA 5HYNB 4GQ1A 5IJ7E 4LG9A 1GG2B 4U1EI 3K26A 4A11A 1PGUA 5IJ8E 1A0RB 5KDOB 3F3PA 2CO0A 3EI1A 3RFHA 1JMZB 2AQ5A 3MMYA 4A09A 1JJUB 3E0CA 3SBRA 4XYIA 5FKTA 2PM9B 1YFQA 4K3ID 5EAMA 4QT8A 4U7AA 4A11B 2H68A 1N6DA 2J57G 4FAND 5JWZA 2OK6A 3W15A 3EI1B 4QQEA 3DXKC 4J8GA 4Y7RA 4A09B 5EALA 3ULEC 1RI6A 5FA5B 4FA9D 4G56B 4PC0A 2HYEA 3EWEA 1Q47A 5IGOA 3SCYA 3I7NA 4J84A 5EAPA 4ZOVA 3U4YA 3J81g 3EMHA 1GXRA 1P22A 2AGWA 3OKWA 4N14A 5C9ZB 3F3GA 3B7FA 4PXWA 1TBGA 4QL1A 3PXWD 4X60B 2GNQA 4GM8A 3JPXA 5EMLB 1L0QA 3C99A 2P9LC 4J81A 4FB1D 2AH0A 5K19A 5TEFA 5EMMB 3RFGA 3N0DA 2BCJB 2XU7A 4CY5A 3ORVD 3EI3A 3SBQA 5AFU3 3EU7A 1S4UX 4GGCA 4GM3A 3UVKA 3RMZD 3AL9A 3MZKA 1NR0A 3JB9L 2YB8B 4CZXA 3VA6A 5B4WA 4E54A 4PSWB 3OKYA 1FWXA 1B9XA 5GSAA 4O3UB 3EI3B 1GOTB 3IJ1A 4BL0A 3PE7A 1N6FA 5FQDA 4JSXC 3I7PA 3IIWA 2H9MA 2H47A 4I79A 2MTAH 5C2WB 4E54B 2H9NA 4ZOYA 4CY3A 3OKYB 2YNNA 2AGZA 2CE8A 2B5MA 4X3EA 3J80g 4IA9A 4ESGA 4E5ZA 4ERYA 2IWFA 1R5MA 1U2VC 1JMXB 3N0EA 5HE3B 4ZN4A 2Q7QA 5TEEA 2XL2A 5GMKn 4O1QD 3IKOA 4LG8A 3UVNA 4CZVA 2H6QA 3DSMA 5I5IA 1PBYB 3NVQA 1XHMA 4J79A 3OTTA 4E5ZB 2I3TA 4O45A 2O9KA 5H17A 3HFQA 4FWWA 2P9KC 4OWRA 3P4FA 4JXMA 3JAMg 4AOWA 2CNXA 1OLZA 4AEZA 4O3TB 4IMMA 3FGBA 1MG3A 4ZOZA 4ERZA 2AGLA 3PSCB 5I5JA 3I8CA 1SQ9A 2H6KA 3PXSD 2P9SC 4CY2A 5AJAA 3MXXA 4GMBA 5K1CC 4A2MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PNK B;  2AGX A;  3MZL A;  3I7O A;  2I0R A;  4A08 A;  2H9L A;  5A2Q g;  4CI8 A;  2HJ4 A;  2XL3 A;  2OVQ B;  3FRX A;  3SFZ A;  3EI4 A;  4J86 A;  4BUJ C;  3UVL A;  3AL8 A;  5H14 A;  2PBI B;  4X61 B;  3V7D B;  1NEX B;  5FLX g;  4A2L A;  2J56 H;  4A08 B;  2IUR A;  4J73 A;  5THA A;  4NSX A;  2H9P A;  2IUQ A;  5HQG A;  1OMW B;  3SWS D;  4PSX B;  5FKS A;  1SQJ A;  4J0X A;  3EI4 B;  5GXH A;  4JT5 C;  3AL8 B;  5FXY A;  3SVW D;  3EG6 A;  3IJC A;  5EMK B;  3SJL D;  3I89 A;  3UR4 A;  4PBY A;  4X63 B;  1MDA H;  5C2V B;  4H5J A;  2IUP A;  4JSN C;  4GZ8 A;  4UI9 R;  4K3J B;  1VYH C;  2I0S A;  1ERJ A;  5EM2 A;  4KFM B;  1XKS A;  4QRJ A;  5TF2 A;  4FAV D;  5IT9 g;  2CN3 A;  4GGD A;  3RSE C;  3OL2 A;  3RN1 D;  1N6E A;  1U4C A;  2YNO A;  3NVX A;  2QC5 A;  3I7L A;  3BG0 A;  5EMJ B;  1GP2 B;  2H13 A;  2G99 A;  1B9Y A;  3KRX B;  1PI6 A;  5HE0 B;  4ERQ A;  1QNI A;  5CXC A;  4R7A B;  3UKU C;  2H14 A;  3ODT A;  5EM2 B;  3SMR A;  2PM6 B;  5HE2 B;  4L3H D;  2W18 A;  2GC7 A;  3OL2 B;  1PEV A;  4CZY A;  1TYQ C;  5I5M A;  4XEI C;  3SBP A;  4L3G D;  4FA1 D;  2AH1 A;  2OK4 A;  4GQ2 P;  5IGQ A;  1K32 A;  3EI2 A;  2HES X;  5CXC B;  4XYH A;  2UZX B;  3OW8 A;  4CY1 A;  4JSV C;  5HE1 B;  4FA4 D;  3V5W B;  2B5L A;  3I2N A;  3DXM C;  3DM0 A;  3IIY A;  4J87 A;  3I7K A;  5AMS A;  2B4E A;  3MKS B;  4YVD A;  3JZN A;  4CI2 A;  3MKQ A;  4CI3 A;  3SXT D;  3SN6 B;  3EI2 B;  2TRC B;  2HKM A;  3SLE D;  2HKR A;  3PXT D;  3UVO A;  4Y5R D;  4J77 A;  2H3X A;  4EWR A;  2OVR B;  2Z2P A;  4H5I A;  2XYI A;  4MK0 B;  2P9U C;  4A7J A;  5GXI A;  3OKT A;  2OIZ A;  2P9P C;  4A0A A;  3C9C A;  2UZY B;  4J82 A;  3JZH A;  2Z2O A;  5TDH B;  3UKR C;  3FM0 A;  3JZG A;  3A0F A;  3L4O D;  1JOF A;  4Z8L A;  4ZOX A;  2H6N A;  4A0B A;  1MG2 A;  3C75 H;  2P9I C;  3I7H A;  3KRW B;  3RN0 D;  2HJB A;  4A0A B;  1XIP A;  4J8B A;  2QXV A;  3RRM C;  3VGZ A;  2IWK A;  4JD2 C;  3CIK B;  2EBS A;  2OVP B;  3PSL A;  3PVU B;  3AFC A;  3JRO A;  4JT6 C;  4A0B B;  4GM9 A;  2IUV A;  5IC7 A;  2J55 H;  1SHY B;  2YMU A;  4LGN A;  3IJ0 A;  3PVW B;  4CC9 A;  5SXM A;  4D6V A;  4L9O A;  3AH8 B;  3CFS B;  4GQB B;  3SHF A;  2CO0 C;  3DWL C;  4PBZ A;  4O9D A;  5EAR A;  3C5M A;  3F3F A;  2AGY A;  2GC4 A;  4TZ4 A;  3NVN A;  3VH0 A;  4BH6 A;  2HXC A;  2YBA A;  4GGA A;  2YNP A;  4OZU A;  3GRE A;  2CE9 A;  4L1Q D;  3V9F A;  3L4M D;  3BG1 A;  2P9N C;  5CYK A;  5FKR A;  2OJY A;  4HDJ A;  4ES0 A;  3ZWL B;  3GFC A;  4D0K A;  4J78 A;  3BWS A;  5CXB A;  2Z2N A;  4J0W A;  2IAA A;  3RLM D;  4FA5 D;  2I3S A;  3I8E A;  2PM7 B;  2I0T A;  5FKQ A;  5CYK B;  5H1M A;  2BBK H;  2CN2 A;  3K27 A;  2G9A A;  3JRP A;  4CI1 A;  3UVM A;  2PM9 A;  1K8K C;  3CFV A;  2B5N A;  4JSP C;  5CXB B;  4FHL A;  5HYN B;  4GQ1 A;  5IJ7 E;  4LG9 A;  1GG2 B;  4U1E I;  3K26 A;  4A11 A;  1PGU A;  5IJ8 E;  1A0R B;  5KDO B;  3F3P A;  2CO0 A;  3EI1 A;  3RFH A;  1JMZ B;  2AQ5 A;  3MMY A;  4A09 A;  1JJU B;  3E0C A;  3SBR A;  4XYI A;  5FKT A;  2PM9 B;  1YFQ A;  4K3I D;  5EAM A;  4QT8 A;  4U7A A;  4A11 B;  2H68 A;  1N6D A;  2J57 G;  4FAN D;  5JWZ A;  2OK6 A;  3W15 A;  3EI1 B;  4QQE A;  3DXK C;  4J8G A;  4Y7R A;  4A09 B;  5EAL A;  3ULE C;  1RI6 A;  5FA5 B;  4FA9 D;  4G56 B;  4PC0 A;  2HYE A;  3EWE A;  1Q47 A;  5IGO A;  3SCY A;  3I7N A;  4J84 A;  5EAP A;  4ZOV A;  3U4Y A;  3J81 g;  3EMH A;  1GXR A;  1P22 A;  2AGW A;  3OKW A;  4N14 A;  5C9Z B;  3F3G A;  3B7F A;  4PXW A;  1TBG A;  4QL1 A;  3PXW D;  4X60 B;  2GNQ A;  4GM8 A;  3JPX A;  5EML B;  1L0Q A;  3C99 A;  2P9L C;  4J81 A;  4FB1 D;  2AH0 A;  5K19 A;  5TEF A;  5EMM B;  3RFG A;  3N0D A;  2BCJ B;  2XU7 A;  4CY5 A;  3ORV D;  3EI3 A;  3SBQ A;  5AFU 3;  3EU7 A;  1S4U X;  4GGC A;  4GM3 A;  3UVK A;  3RMZ D;  3AL9 A;  3MZK A;  1NR0 A;  3JB9 L;  2YB8 B;  4CZX A;  3VA6 A;  5B4W A;  4E54 A;  4PSW B;  3OKY A;  1FWX A;  1B9X A;  5GSA A;  4O3U B;  3EI3 B;  1GOT B;  3IJ1 A;  4BL0 A;  3PE7 A;  1N6F A;  5FQD A;  4JSX C;  3I7P A;  3IIW A;  2H9M A;  2H47 A;  4I79 A;  2MTA H;  5C2W B;  4E54 B;  2H9N A;  4ZOY A;  4CY3 A;  3OKY B;  2YNN A;  2AGZ A;  2CE8 A;  2B5M A;  4X3E A;  3J80 g;  4IA9 A;  4ESG A;  4E5Z A;  4ERY A;  2IWF A;  1R5M A;  1U2V C;  1JMX B;  3N0E A;  5HE3 B;  4ZN4 A;  2Q7Q A;  5TEE A;  2XL2 A;  5GMK n;  4O1Q D;  3IKO A;  4LG8 A;  3UVN A;  4CZV A;  2H6Q A;  3DSM A;  5I5I A;  1PBY B;  3NVQ A;  1XHM A;  4J79 A;  3OTT A;  4E5Z B;  2I3T A;  4O45 A;  2O9K A;  5H17 A;  3HFQ A;  4FWW A;  2P9K C;  4OWR A;  3P4F A;  4JXM A;  3JAM g;  4AOW A;  2CNX A;  1OLZ A;  4AEZ A;  4O3T B;  4IMM A;  3FGB A;  1MG3 A;  4ZOZ A;  4ERZ A;  2AGL A;  3PSC B;  5I5J A;  3I8C A;  1SQ9 A;  2H6K A;  3PXS D;  2P9S C;  4CY2 A;  5AJA A;  3MXX A;  4GMB A;  5K1C C;  4A2M A; 
#chains in the Genus database with same CATH topology
 4NBM A;  4PNK B;  4NAA A;  2AGX A;  1UOQ A;  3MZL A;  3I7O A;  2I0R A;  4A08 A;  2H9L A;  5A2Q g;  4CI8 A;  4DNV A;  2HJ4 A;  2XL3 A;  2OVQ B;  3FRX A;  3SFZ A;  3EI4 A;  4J86 A;  4BUJ C;  3UVL A;  3AL8 A;  5H14 A;  2PBI B;  4X61 B;  2QR5 A;  3V7D B;  1NEX B;  5FLX g;  4A2L A;  2J56 H;  4A08 B;  2IUR A;  4J73 A;  5THA A;  3NIF A;  1M1X A;  4NSX A;  2H9P A;  2IUQ A;  5HQG A;  3IUL A;  1OMW B;  3SWS D;  4MMY A;  4PSX B;  5FKS A;  4AX4 A;  4UM8 A;  2VZ1 A;  1SQJ A;  4J0X A;  3EI4 B;  3ZDX A;  5GXH A;  1QFS A;  4JT5 C;  3AL8 B;  2EIE A;  5FXY A;  3SVW D;  3MVD K;  1H2X A;  3EG6 A;  3IJC A;  5EMK B;  5E6U A;  3SJL D;  4WK0 A;  3I89 A;  3UR4 A;  4PBY A;  4X63 B;  3IUM A;  1MDA H;  5C2V B;  4H5J A;  2IUP A;  4JSN C;  4GZ8 A;  1E8M A;  1GOH A;  4K3J B;  1VYH C;  2I0S A;  4UI9 R;  1ERJ A;  4Z7O A;  5EM2 A;  4KFM B;  1XKS A;  2VZ3 A;  4QRJ A;  3EQ7 A;  5TF2 A;  2CN3 A;  4GGD A;  4FAV D;  3RSE C;  5IT9 g;  2VDQ A;  2VC2 A;  3OL2 A;  3V4V A;  3RN1 D;  3T3M A;  1N6E A;  1U4C A;  3IUR A;  2YNO A;  3NVX A;  2QC5 A;  3I7L A;  3BG0 A;  4NEN A;  1GP2 B;  3DDU A;  5EMJ B;  2H13 A;  2G99 A;  1B9Y A;  3KRX B;  1PI6 A;  5HE0 B;  4ERQ A;  1QNI A;  5CXC A;  4R7A B;  3UKU C;  2H14 A;  3ODT A;  5EM2 B;  1JV2 A;  2HU8 A;  3IUJ A;  3QI0 A;  2PM6 B;  3SMR A;  5HE2 B;  4L3H D;  2W18 A;  2GC7 A;  3OL2 B;  2HU7 A;  1PEV A;  4CZY A;  4MMX A;  1TYQ C;  4WJK A;  5I5M A;  4XEI C;  2EIB A;  3SBP A;  4L3G D;  4FA1 D;  2AH1 A;  2OK4 A;  4GQ2 P;  3ZDY A;  2VDP A;  5IGQ A;  1K32 A;  3EI2 A;  2HES X;  5CXC B;  4XYH A;  2UZX B;  1L5G A;  3OW8 A;  4CY1 A;  3IUN A;  4JSV C;  5HE1 B;  4FA4 D;  3V5W B;  1T2X A;  5FFG A;  2B5L A;  3I2N A;  3DXM C;  1VZ3 A;  3DM0 A;  4JHP C;  4Z7N A;  3IIY A;  4J87 A;  3I7K A;  5AMS A;  2B4E A;  3ZE1 A;  3MKS B;  4YVD A;  3JZN A;  4CI2 A;  3MKQ A;  2QZP A;  4CI3 A;  3SXT D;  3SN6 B;  3EI2 B;  5M5R A;  2TRC B;  1BPO A;  2HKM A;  3SLE D;  2HKR A;  3PXT D;  3UVO A;  2VDR A;  4Y5R D;  4J77 A;  2H3X A;  4EWR A;  2VDO A;  2OVR B;  2Z2P A;  4H5I A;  2XYI A;  3ZE0 A;  4MK0 B;  3QHY B;  4DNU A;  1A12 A;  2P9U C;  4A7J A;  5GXI A;  3OKT A;  2OIZ A;  4AN0 A;  2P9P C;  4A0A A;  3C9C A;  2UZY B;  3ZE2 A;  4J82 A;  3JZH A;  1K3I A;  2Z2O A;  5TDH B;  3UKR C;  4MMZ A;  4AMZ A;  4BCB A;  3FM0 A;  2VDL A;  3JZG A;  1JTD B;  3A0F A;  3L4O D;  1JOF A;  4Z8L A;  4ZOX A;  2H6N A;  2JKX A;  4A0B A;  1MG2 A;  4Z7Q A;  3C75 H;  2P9I C;  3I7H A;  3KRW B;  3RN0 D;  2HJB A;  1O6G A;  3OF7 A;  4A0A B;  1XIP A;  3VI3 A;  4J8B A;  2EID A;  4D9S A;  2QXV A;  2XZG A;  3RRM C;  2IWK A;  3VGZ A;  4JD2 C;  3CIK B;  1GOF A;  2EBS A;  2OVP B;  3PSL A;  3PVU B;  5FFO A;  3AFC A;  3JRO A;  4JT6 C;  4A0B B;  3K71 A;  4GM9 A;  1GOG A;  2IUV A;  5IC7 A;  5C86 A;  2J55 H;  1SHY B;  2YMU A;  4LGN A;  1U8C A;  2HU5 A;  3EQ9 A;  3IJ0 A;  3PVW B;  4CC9 A;  5SXM A;  4D6V A;  2XDW A;  4L9O A;  1QFM A;  3AH8 B;  3CFS B;  4L1M A;  4GQB B;  4AMY A;  3SHF A;  2CO0 C;  3DWL C;  4PBZ A;  4O9D A;  5M5T A;  5EAR A;  3C5M A;  3F3F A;  5M61 A;  2AGY A;  2GC4 A;  4TZ4 A;  3NVN A;  3VH0 A;  4BH6 A;  2HXC A;  2YBA A;  4GGA A;  2YNP A;  1E5T A;  3GRE A;  4OZU A;  2CE9 A;  4L1Q D;  3NID A;  3V9F A;  3L4M D;  3BG1 A;  4G1M A;  2P9N C;  5CYK A;  3O4J A;  5FKR A;  2OJY A;  4HDJ A;  3K72 A;  4ES0 A;  3ZWL B;  3GFC A;  4D0K A;  4J78 A;  3BWS A;  5HDB A;  5CXB A;  2Z2N A;  4J0W A;  3IUQ A;  2IAA A;  4RE5 A;  3O4G A;  3RLM D;  4FA5 D;  2I3S A;  3I8E A;  2PM7 B;  2VDM A;  2I0T A;  1E8N A;  5FKQ A;  5CYK B;  3KCI A;  2BBK H;  2CN2 A;  3K27 A;  2G9A A;  5H1M A;  2VDN A;  3JRP A;  4CI1 A;  3UVM A;  2PM9 A;  1K8K C;  3CFV A;  1UOO A;  2B5N A;  4JSP C;  5CXB B;  4FHL A;  3FCU A;  5HYN B;  4GQ1 A;  5IJ7 E;  4LG9 A;  1GG2 B;  4U1E I;  3K26 A;  4A11 A;  5C92 A;  1PGU A;  2WQ8 A;  3FCS A;  5IJ8 E;  1A0R B;  5KDO B;  3F3P A;  2CO0 A;  4BP8 A;  3EI1 A;  3RFH A;  1JMZ B;  2AQ5 A;  1UTC A;  2XE4 A;  3MMY A;  4A09 A;  1JJU B;  3E0C A;  3SBR A;  4XYI A;  5FKT A;  2PM9 B;  1YFQ A;  4K3I D;  5EAM A;  1YR2 A;  4BCC A;  2VDK A;  4O02 A;  4QT8 A;  4U7A A;  3NIG A;  4A11 B;  2H68 A;  1TYE A;  1N6D A;  2J57 G;  4FAN D;  5JWZ A;  1H2W A;  2OK6 A;  4G1E A;  3W15 A;  4UM9 A;  3EI1 B;  4QQE A;  3DXK C;  4J8G A;  4Y7R A;  4A09 B;  5EAL A;  2BKL A;  3ULE C;  1RI6 A;  5FA5 B;  4FA9 D;  4G56 B;  4PC0 A;  2HYE A;  3EWE A;  1Q47 A;  5IGO A;  3SCY A;  3I7N A;  4J84 A;  5EAP A;  4ZOV A;  4DNW A;  1VE6 A;  3U4Y A;  3J81 g;  3EMH A;  1GXR A;  1P22 A;  2AGW A;  3OKW A;  4N14 A;  5C9Z B;  4NC4 A;  3F3G A;  3MUN A;  3B7F A;  4PXW A;  1TBG A;  3IVM A;  4QL1 A;  4O2W A;  3PXW D;  4X60 B;  1I2M B;  3ZDZ A;  2GNQ A;  4GM8 A;  3JPX A;  5EML B;  1L0Q A;  3C99 A;  2P9L C;  4J81 A;  4FB1 D;  2AH0 A;  5K19 A;  4JHN A;  5TEF A;  5EMM B;  1O6F A;  1UOP A;  3RFG A;  3N0D A;  2BCJ B;  2XU7 A;  4CY5 A;  3ORV D;  5M5V A;  3EI3 A;  3SBQ A;  5AFU 3;  3EU7 A;  1S4U X;  4WK4 A;  3EQ8 A;  4GGC A;  4GM3 A;  3UVK A;  3RMZ D;  3AL9 A;  3MZK A;  4WK2 A;  1NR0 A;  3JB9 L;  2YB8 B;  4CZX A;  3O4I A;  3VA6 A;  5B4W A;  4E54 A;  4AN1 A;  4PSW B;  3OKY A;  3K6S A;  1FWX A;  3GC3 B;  1B9X A;  5GSA A;  4O3U B;  3EI3 B;  1GOT B;  3IJ1 A;  4BL0 A;  3PE7 A;  4BP9 A;  1N6F A;  5FQD A;  4JSX C;  3I7P A;  3MUO A;  3IIW A;  2H9M A;  2H47 A;  4I79 A;  5E6S A;  3V4P A;  2MTA H;  5C2W B;  4RE6 A;  3VI4 A;  4E54 B;  2H9N A;  4ZOY A;  4CY3 A;  3OKY B;  2YNN A;  2AGZ A;  2CE8 A;  2B5M A;  4X3E A;  3J80 g;  4IA9 A;  4ESG A;  4E5Z A;  4ERY A;  2IWF A;  1R5M A;  1U2V C;  1JMX B;  3O4H A;  4G55 A;  3N0E A;  5HE3 B;  4ZN4 A;  2Q7Q A;  5TEE A;  2XL2 A;  5GMK n;  4BCD A;  4O1Q D;  3IKO A;  4LG8 A;  3UVN A;  4CZV A;  2H6Q A;  3DSM A;  5I5I A;  1PBY B;  3NVQ A;  5M5U A;  3T3P A;  1XHM A;  4J79 A;  3OTT A;  4E5Z B;  2I3T A;  4O45 A;  2O9K A;  5H17 A;  3HFQ A;  4FWW A;  4QAM A;  2P9K C;  4OWR A;  3P4F A;  4JXM A;  3GD1 I;  3JAM g;  4AOW A;  2CNX A;  1OLZ A;  4AEZ A;  4O3T B;  1VZ2 A;  4IMM A;  1C9I A;  1H2Z A;  3FGB A;  1MG3 A;  1C9L A;  2EIC A;  5E6R A;  4ZOZ A;  4ERZ A;  1H2Y A;  2AGL A;  3PSC B;  5I5J A;  3I8C A;  5M5S A;  1SQ9 A;  2H6K A;  3PXS D;  2P9S C;  4CY2 A;  5AJA A;  3MXX A;  1VE7 A;  4IRZ A;  4GMB A;  3IJE A;  5K1C C;  4A2M A; 
#chains in the Genus database with same CATH homology
 4PNK B;  2AGX A;  3MZL A;  3I7O A;  2I0R A;  4A08 A;  2H9L A;  5A2Q g;  4CI8 A;  2HJ4 A;  2XL3 A;  2OVQ B;  3FRX A;  3SFZ A;  3EI4 A;  4J86 A;  4BUJ C;  3UVL A;  3AL8 A;  5H14 A;  2PBI B;  4X61 B;  3V7D B;  1NEX B;  5FLX g;  4A2L A;  2J56 H;  4A08 B;  2IUR A;  4J73 A;  5THA A;  4NSX A;  2H9P A;  2IUQ A;  5HQG A;  1OMW B;  3SWS D;  4PSX B;  5FKS A;  1SQJ A;  4J0X A;  3EI4 B;  5GXH A;  4JT5 C;  3AL8 B;  5FXY A;  3SVW D;  3EG6 A;  3IJC A;  5EMK B;  3SJL D;  3I89 A;  3UR4 A;  4PBY A;  4X63 B;  1MDA H;  5C2V B;  4H5J A;  2IUP A;  4JSN C;  4GZ8 A;  4UI9 R;  4K3J B;  1VYH C;  2I0S A;  1ERJ A;  5EM2 A;  4KFM B;  1XKS A;  4QRJ A;  5TF2 A;  4FAV D;  5IT9 g;  2CN3 A;  4GGD A;  3RSE C;  3OL2 A;  3RN1 D;  1N6E A;  1U4C A;  2YNO A;  3NVX A;  2QC5 A;  3I7L A;  3BG0 A;  5EMJ B;  1GP2 B;  2H13 A;  2G99 A;  1B9Y A;  3KRX B;  1PI6 A;  5HE0 B;  4ERQ A;  1QNI A;  5CXC A;  4R7A B;  3UKU C;  2H14 A;  3ODT A;  5EM2 B;  3SMR A;  2PM6 B;  5HE2 B;  4L3H D;  2W18 A;  2GC7 A;  3OL2 B;  1PEV A;  4CZY A;  1TYQ C;  5I5M A;  4XEI C;  3SBP A;  4L3G D;  4FA1 D;  2AH1 A;  2OK4 A;  4GQ2 P;  5IGQ A;  1K32 A;  3EI2 A;  2HES X;  5CXC B;  4XYH A;  2UZX B;  3OW8 A;  4CY1 A;  4JSV C;  5HE1 B;  4FA4 D;  3V5W B;  2B5L A;  3I2N A;  3DXM C;  3DM0 A;  3IIY A;  4J87 A;  3I7K A;  5AMS A;  2B4E A;  3MKS B;  4YVD A;  3JZN A;  4CI2 A;  3MKQ A;  4CI3 A;  3SXT D;  3SN6 B;  3EI2 B;  2TRC B;  2HKM A;  3SLE D;  2HKR A;  3PXT D;  3UVO A;  4Y5R D;  4J77 A;  2H3X A;  4EWR A;  2OVR B;  2Z2P A;  4H5I A;  2XYI A;  4MK0 B;  2P9U C;  4A7J A;  5GXI A;  3OKT A;  2OIZ A;  2P9P C;  4A0A A;  3C9C A;  2UZY B;  4J82 A;  3JZH A;  2Z2O A;  5TDH B;  3UKR C;  3FM0 A;  3JZG A;  3A0F A;  3L4O D;  1JOF A;  4Z8L A;  4ZOX A;  2H6N A;  4A0B A;  1MG2 A;  3C75 H;  2P9I C;  3I7H A;  3KRW B;  3RN0 D;  2HJB A;  4A0A B;  1XIP A;  4J8B A;  2QXV A;  3RRM C;  3VGZ A;  2IWK A;  4JD2 C;  3CIK B;  2EBS A;  2OVP B;  3PSL A;  3PVU B;  3AFC A;  3JRO A;  4JT6 C;  4A0B B;  4GM9 A;  2IUV A;  5IC7 A;  2J55 H;  1SHY B;  2YMU A;  4LGN A;  3IJ0 A;  3PVW B;  4CC9 A;  5SXM A;  4D6V A;  4L9O A;  3AH8 B;  3CFS B;  4GQB B;  3SHF A;  2CO0 C;  3DWL C;  4PBZ A;  4O9D A;  5EAR A;  3C5M A;  3F3F A;  2AGY A;  2GC4 A;  4TZ4 A;  3NVN A;  3VH0 A;  4BH6 A;  2HXC A;  2YBA A;  4GGA A;  2YNP A;  4OZU A;  3GRE A;  2CE9 A;  4L1Q D;  3V9F A;  3L4M D;  3BG1 A;  2P9N C;  5CYK A;  5FKR A;  2OJY A;  4HDJ A;  4ES0 A;  3ZWL B;  3GFC A;  4D0K A;  4J78 A;  3BWS A;  5CXB A;  2Z2N A;  4J0W A;  2IAA A;  3RLM D;  4FA5 D;  2I3S A;  3I8E A;  2PM7 B;  2I0T A;  5FKQ A;  5CYK B;  5H1M A;  2BBK H;  2CN2 A;  3K27 A;  2G9A A;  3JRP A;  4CI1 A;  3UVM A;  2PM9 A;  1K8K C;  3CFV A;  2B5N A;  4JSP C;  5CXB B;  4FHL A;  5HYN B;  4GQ1 A;  5IJ7 E;  4LG9 A;  1GG2 B;  4U1E I;  3K26 A;  4A11 A;  1PGU A;  5IJ8 E;  1A0R B;  5KDO B;  3F3P A;  2CO0 A;  3EI1 A;  3RFH A;  1JMZ B;  2AQ5 A;  3MMY A;  4A09 A;  1JJU B;  3E0C A;  3SBR A;  4XYI A;  5FKT A;  2PM9 B;  1YFQ A;  4K3I D;  5EAM A;  4QT8 A;  4U7A A;  4A11 B;  2H68 A;  1N6D A;  2J57 G;  4FAN D;  5JWZ A;  2OK6 A;  3W15 A;  3EI1 B;  4QQE A;  3DXK C;  4J8G A;  4Y7R A;  4A09 B;  5EAL A;  3ULE C;  1RI6 A;  5FA5 B;  4FA9 D;  4G56 B;  4PC0 A;  2HYE A;  3EWE A;  1Q47 A;  5IGO A;  3SCY A;  3I7N A;  4J84 A;  5EAP A;  4ZOV A;  3U4Y A;  3J81 g;  3EMH A;  1GXR A;  1P22 A;  2AGW A;  3OKW A;  4N14 A;  5C9Z B;  3F3G A;  3B7F A;  4PXW A;  1TBG A;  4QL1 A;  3PXW D;  4X60 B;  2GNQ A;  4GM8 A;  3JPX A;  5EML B;  1L0Q A;  3C99 A;  2P9L C;  4J81 A;  4FB1 D;  2AH0 A;  5K19 A;  5TEF A;  5EMM B;  3RFG A;  3N0D A;  2BCJ B;  2XU7 A;  4CY5 A;  3ORV D;  3EI3 A;  3SBQ A;  5AFU 3;  3EU7 A;  1S4U X;  4GGC A;  4GM3 A;  3UVK A;  3RMZ D;  3AL9 A;  3MZK A;  1NR0 A;  3JB9 L;  2YB8 B;  4CZX A;  3VA6 A;  5B4W A;  4E54 A;  4PSW B;  3OKY A;  1FWX A;  1B9X A;  5GSA A;  4O3U B;  3EI3 B;  1GOT B;  3IJ1 A;  4BL0 A;  3PE7 A;  1N6F A;  5FQD A;  4JSX C;  3I7P A;  3IIW A;  2H9M A;  2H47 A;  4I79 A;  2MTA H;  5C2W B;  4E54 B;  2H9N A;  4ZOY A;  4CY3 A;  3OKY B;  2YNN A;  2AGZ A;  2CE8 A;  2B5M A;  4X3E A;  3J80 g;  4IA9 A;  4ESG A;  4E5Z A;  4ERY A;  2IWF A;  1R5M A;  1U2V C;  1JMX B;  3N0E A;  5HE3 B;  4ZN4 A;  2Q7Q A;  5TEE A;  2XL2 A;  5GMK n;  4O1Q D;  3IKO A;  4LG8 A;  3UVN A;  4CZV A;  2H6Q A;  3DSM A;  5I5I A;  1PBY B;  3NVQ A;  1XHM A;  4J79 A;  3OTT A;  4E5Z B;  2I3T A;  4O45 A;  2O9K A;  5H17 A;  3HFQ A;  4FWW A;  2P9K C;  4OWR A;  3P4F A;  4JXM A;  3JAM g;  4AOW A;  2CNX A;  1OLZ A;  4AEZ A;  4O3T B;  4IMM A;  3FGB A;  1MG3 A;  4ZOZ A;  4ERZ A;  2AGL A;  3PSC B;  5I5J A;  3I8C A;  1SQ9 A;  2H6K A;  3PXS D;  2P9S C;  4CY2 A;  5AJA A;  3MXX A;  4GMB A;  5K1C C;  4A2M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...