2AGLA

Crystal structure of the phenylhydrazine adduct of aromatic amine dehydrogenase from alcaligenes faecalis
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
360
structure length
360
Chain Sequence
REVLTGGHSVSAPQENRIYVMDSVFMHLTESRVHVYDYTNGKFLGMVPTAFNGHVQVSNDGKKIYTMTTYHERITRGKRSDVVEVWDADKLTFEKEISLPPKRVQGLNYDGLFRQTTDGKFIVLQNASPATSIGIVDVAKGDYVEDVTAAAGCWSVIPQPNRPRSFMTICGDGGLLTINLGEDGKVASQSRSKQMFSVKDDPIFIAPALDKDKAHFVSYYGNVYSADFSGDEVKVDGPWSLLNDEDKAKNWVPGGYNLVGLHRASGRMYVFMHPDGKEGTHKFPAAEIWVMDTKTKQRVARIPGRDALSMTIDQQRNLMLTLDGGNVNVYDISQPEPKLLRTIEGAAEASLQVQFHPVGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic description of an enzyme reaction dominated by proton tunneling
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Aromatic amine dehydrogenase
total genus 97
structure length 360
sequence length 360
chains with identical sequence B
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2005-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2aglA01
5HE0B 2YNOA 3MXXA 4AOWA 4BUJC 2PM7B 4A0BA 5AFU3 3AL8B 3V5WB 4A08A 2MTAH 4GM3A 4A0AA 3KRWB 2PM9A 3PXTD 2H9LA 2H9PA 4GGAA 1S4UX 3MKSB 2XL3A 3E0CA 4J78A 1FWXA 4Z8LA 5EMLB 2G9AA 2Z2PA 1GXRA 5I5MA 4ZOZA 5EM2A 5H17A 4X60B 4E54B 3ODTA 1XIPA 2J55H 4PBZA 4ERQA 4YVDA 2CNXA 4IA9A 2HJBA 3IJCA 5FQDA 3VH0A 5GMKn 2I3TA 4O45A 4A7JA 3JB9L 4QL1A 2HESX 3GREA 5K19A 4ES0A 3ZWLB 3JAMg 3SWSD 2XL2A 4JXMA 3AFCA 1OLZA 4N14A 4CY1A 3ULEC 2OK4A 4J87A 2Q7QA 1B9XA 3JROA 1GG2B 1L0QA 4GGCA 3EU7A 3C9CA 1XKSA 4PXWA 1SQJA 3HFQA 4J77A 5H14A 3J81g 2IURA 5A2Qg 4FAND 5CYKB 4J8GA 4O3TB 3DXKC 5TEFA 5EMKB 3RN0D 3SFZA 1JOFA 1TBGA 4FAVD 3SBRA 4D6VA 4ERZA 5IT9g 4H5IA 3SN6B 5TEEA 1N6DA 4L3GD 5EAPA 1B9YA 4A0BB 2QXVA 4LG8A 3VA6A 4GQBB 3UKUC 5CXCA 3I7OA 2PM9B 3PXSD 3I7LA 3PSLA 5C2VB 3JZGA 4GGDA 4GMBA 4JSNC 5TDHB 3IIWA 5GXIA 4QT8A 5EMJB 4Y7RA 4BL0A 2GC4A 4JD2C 3EI3A 1JMXB 5HYNB 5AJAA 2I3SA 1XHMA 5C9ZB 3DSMA 4O3UB 4ZOYA 4MK0B 1PEVA 2HJ4A 4A09A 2YNPA 2OVPB 2OVRB 4U1EI 2IUPA 2BCJB 4J0WA 4FB1D 3I8CA 2IWFA 4J79A 3V9FA 2H13A 3IJ1A 4X63B 4XEIC 4JT5C 5FKQA 1GOTB 3OKYB 4A0AB 4GQ2P 1YFQA 5TF2A 4XYHA 4O1QD 3RMZD 4QQEA 5I5IA 3UVNA 3CIKB 4JSVC 3N0EA 3I7NA 5H1MA 1K8KC 3CFSB 4J84A 5THAA 1QNIA 4U7AA 2YBAA 4OZUA 3SBQA 1TYQC 3EI2A 3RRMC 2CO0A 1MDAH 2B5LA 4J73A 4CY5A 5IGOA 4ESGA 5HE2B 3DWLC 4CI8A 2Z2OA 2B4EA 3EI4A 4E54A 2HKRA 3I89A 4L9OA 2H47A 2P9SC 3UVKA 5KDOB 3SLED 4JSPC 2HYEA 4FA9D 3IKOA 5FKSA 3IIYA 5EAMA 3NVNA 3OL2A 3SCYA 3PSCB 2B5MA 3BWSA 3K26A 4K3ID 3EI1A 2IUQA 3I7HA 5JWZA 4IMMA 3UKRC 3U4YA 3B7FA 5EALA 4AEZA 4J86A 2G99A 2XU7A 1U2VC 2B5NA 3SXTD 4D0KA 3SJLD 4LG9A 4J82A 5CXCB 3RSEC 4ZOXA 2AH0A 3VGZA 3C75H 1JMZB 4A2MA 2OVQB 4I79A 1GP2B 3N0DA 2P9PC 4ZOVA 2OIZA 2W18A 3V7DB 3ORVD 2AGXA 2IUVA 2YB8B 3FRXA 2CE9A 1NEXB 4QRJA 1PBYB 2I0RA 4EWRA 4L3HD 5CXBB 3EWEA 4A2LA 4A11A 4ERYA 4CI3A 3SHFA 4A09B 4E5ZA 2H9NA 3AL9A 2AGYA 3OKWA 4H5JA 4K3JB 4HDJA 3FGBA 4A08B 2CN2A 2AGWA 5B4WA 4OWRA 4FHLA 4PBYA 4CZXA 3JZHA 5K1CC 5HQGA 2EBSA 3GFCA 4PC0A 4TZ4A 2GC7A 2O9KA 3I2NA 4R7AB 4Y5RD 1P22A 3I7PA 1VYHC 5FLXg 4FA1D 4J81A 4O9DA 2AGZA 3PVWB 2J56H 2OJYA 3EI2B 3MZKA 3OKYA 3DXMC 3I8EA 2QC5A 3W15A 4UI9R 2P9LC 1ERJA 1MG2A 4BH6A 1N6EA 1PGUA 2P9KC 4CZVA 1OMWB 3L4MD 3EG6A 3C5MA 3DM0A 4LGNA 5GXHA 3FM0A 4KFMB 4CI2A 1SHYB 3EI3B 4NSXA 1Q47A 5FKTA 5EM2B 4PNKB 4G56B 5SXMA 3SVWD 2CN3A 3UVLA 3SBPA 3AL8A 4J0XA 5CXBA 4A11B 3BG0A 3SMRA 2HXCA 2XYIA 4FA5D 1JJUB 3F3PA 3OW8A 5HE1B 3AH8B 2HKMA 5I5JA 5AMSA 2H3XA 5IC7A 2H6QA 5FA5B 5IJ7E 3L4OD 3OTTA 4CY2A 4X3EA 3NVXA 3F3FA 2AGLA 4CY3A 3UVMA 3UR4A 3OL2B 1MG3A 2UZYB 3KRXB 4FWWA 5IGQA 1U4CA 1R5MA 4J8BA 4X61B 3RFGA 3PE7A 4GM8A 3MMYA 2GNQA 2P9IC 3JPXA 3NVQA 4GM9A 3JRPA 2AH1A 2I0TA 2TRCB 4L1QD 5FKRA 2I0SA 3C99A 3RLMD 4GZ8A 3EI4B 2CE8A 2CO0C 2H14A 4JSXC 2H68A 3PXWD 2P9NC 3PVUB 3BG1A 4CZYA 2H6KA 2H6NA 2PBIB 1SQ9A 3I7KA 5IJ8E 1PI6A 2P9UC 4CC9A 3OKTA 3EI1B 4XYIA 2BBKH 4FA4D 3RFHA 3EMHA 2YNNA 4E5ZB 1A0RB 2IAAA 2UZXB 3P4FA 1NR0A 2H9MA 4JT6C 3JZNA 5C2WB 2J57G 2OK6A 5EARA 5FXYA 4CI1A 3MZLA 4GQ1A 3F3GA 4PSXB 5EMMB 3RN1D 3IJ0A 4PSWB 2YMUA 3CFVA 3J80g 1N6FA 1K32A 2PM6B 5GSAA 4ZN4A 2IWKA 2AQ5A 5CYKA 3UVOA 1RI6A 3MKQA 2Z2NA 3K27A 5HE3B 3A0FA
chains in the Genus database with same CATH superfamily
5HE0B 2YNOA 3MXXA 3QI0A 4AOWA 4BUJC 2PM7B 4A0BA 5AFU3 1VZ3A 3AL8B 3V5WB 4A08A 4NC4A 2MTAH 4GM3A 2EIEA 4A0AA 3KRWB 2PM9A 3PXTD 2H9LA 2H9PA 4GGAA 1L5GA 1S4UX 3MKSB 4Z7QA 2XL3A 3E0CA 4J78A 5M5TA 1H2WA 1FWXA 4UM8A 4Z8LA 5EMLB 2G9AA 2Z2PA 1GXRA 3NIDA 5I5MA 4ZOZA 5EM2A 5H17A 4X60B 4E54B 3ODTA 1XIPA 4JHPC 2J55H 5M5UA 4PBZA 4ERQA 4YVDA 2CNXA 3NIFA 4IA9A 2HJBA 3IJCA 5FQDA 1TYEA 3VH0A 5GMKn 2I3TA 4O45A 3O4JA 4A7JA 3JB9L 4QL1A 2HESX 3GREA 5K19A 4ES0A 3ZWLB 3JAMg 3SWSD 2XL2A 4JXMA 3T3MA 3AFCA 1OLZA 4N14A 4CY1A 3ULEC 2OK4A 4J87A 2Q7QA 5M61A 3NIGA 1B9XA 3IUNA 3JROA 1GG2B 4MMXA 1L0QA 4GGCA 3EU7A 3MVDK 4AMZA 1YR2A 3C9CA 1XKSA 4PXWA 1SQJA 3HFQA 4J77A 4RE5A 5H14A 3J81g 2IURA 5A2Qg 4FAND 5CYKB 4J8GA 4O3TB 3DXKC 5TEFA 5E6SA 5EMKB 3RN0D 3SFZA 1JOFA 3V4PA 1TBGA 4FAVD 3SBRA 4D6VA 4ERZA 5IT9g 4H5IA 3SN6B 1GOGA 5TEEA 1N6DA 3O4HA 4L3GD 5EAPA 1B9YA 4A0BB 2QXVA 4LG8A 3VA6A 4GQBB 3UKUC 3EQ7A 3GC3B 5CXCA 3I7OA 2PM9B 3PXSD 2QZPA 3I7LA 3PSLA 5C2VB 4AX4A 3JZGA 4GGDA 4GMBA 4WK0A 2XDWA 4JSNC 1H2YA 3FCSA 3IUJA 5TDHB 3IIWA 5GXIA 4QT8A 4BCCA 5EMJB 4Y7RA 4BL0A 2GC4A 4JD2C 2VDRA 3VI3A 3EI3A 1JMXB 5HYNB 1C9LA 5AJAA 2I3SA 1U8CA 1XHMA 5C9ZB 3DSMA 4O3UB 4ZOYA 4MK0B 1PEVA 2HJ4A 4A09A 2YNPA 2OVPB 2OVRB 4U1EI 2IUPA 2VDOA 1VZ2A 2BCJB 4J0WA 4FB1D 3I8CA 2IWFA 4J79A 3V9FA 1K3IA 1VE7A 2H13A 3IJ1A 4X63B 4XEIC 4JT5C 5FFOA 1GOTB 3OKYB 5FKQA 4AMYA 4NBMA 4A0AB 4GQ2P 1YFQA 5TF2A 4XYHA 4O1QD 3RMZD 1UTCA 4QQEA 5I5IA 3ZE2A 3UVNA 3CIKB 4JSVC 3N0EA 3I7NA 5H1MA 1K8KC 3CFSB 4BP8A 5HDBA 4J84A 3O4IA 5THAA 4DNUA 1QNIA 4U7AA 3ZDXA 2YBAA 4OZUA 3SBQA 3K72A 1TYQC 3EI2A 4BCDA 3K6SA 3RRMC 2CO0A 1MDAH 2B5LA 4J73A 1JTDB 4CY5A 5IGOA 3QHYB 4ESGA 5HE2B 3DWLC 4L1MA 4CI8A 2Z2OA 3IULA 1E8NA 2B4EA 3EI4A 4E54A 2VDNA 2HKRA 2VZ1A 3I89A 2H47A 2P9SC 4L9OA 3UVKA 4UM9A 5KDOB 3SLED 4JSPC 2HYEA 1JV2A 1M1XA 4FA9D 3IKOA 5FKSA 3IIYA 5EAMA 3NVNA 3OL2A 3SCYA 3PSCB 4DNWA 2B5MA 3MUOA 3BWSA 3K26A 4K3ID 3EI1A 2IUQA 4AN1A 3I7HA 5JWZA 4IMMA 4RE6A 1H2XA 3UKRC 3B7FA 3U4YA 5EALA 4AEZA 3V4VA 4J86A 2G99A 2XU7A 3OF7A 1U2VC 2B5NA 3SXTD 4D0KA 3SJLD 4LG9A 1VE6A 4J82A 5CXCB 3RSEC 4ZOXA 1O6FA 2AH0A 1QFMA 3VGZA 3ZE0A 3C75H 1JMZB 4A2MA 1E5TA 2OVQB 4I79A 1GP2B 3N0DA 4Z7NA 2P9PC 4ZOVA 2OIZA 2W18A 3V7DB 1C9IA 3ORVD 2AGXA 2VZ3A 2IUVA 2YB8B 3FRXA 2CE9A 1NEXB 3IJEA 1PBYB 2I0RA 4QRJA 4L3HD 4EWRA 5CXBB 3EWEA 4A2LA 4A11A 3FCUA 2VDLA 4ERYA 4MMYA 4CI3A 3SHFA 4A09B 4E5ZA 5E6RA 2H9NA 3AL9A 2AGYA 3OKWA 4H5JA 4K3JB 4WK2A 4HDJA 3FGBA 4JHNA 4A08B 2CN2A 2AGWA 5B4WA 4G1MA 4OWRA 3IUMA 4O02A 4WK4A 4FHLA 4PBYA 4CZXA 3JZHA 5K1CC 2QR5A 5HQGA 2EBSA 1BPOA 3GFCA 4PC0A 4TZ4A 2GC7A 1UOPA 2O9KA 3I2NA 4R7AB 4Y5RD 1P22A 3I7PA 2HU8A 1VYHC 1QFSA 5FLXg 4FA1D 2HU7A 4J81A 3EQ9A 4O9DA 2AGZA 3PVWB 2J56H 2OJYA 2VDMA 3EI2B 3MZKA 3OKYA 3DXMC 3I8EA 2QC5A 3W15A 4UI9R 2P9LC 4WJKA 5C86A 1ERJA 1MG2A 4BH6A 1N6EA 1PGUA 2P9KC 4CZVA 1OMWB 3L4MD 1A12A 3EG6A 3C5MA 3DM0A 3IURA 4LGNA 5GXHA 3FM0A 1H2ZA 4KFMB 4CI2A 1SHYB 3EI3B 2EIBA 4NSXA 4QAMA 2BKLA 2HU5A 3EQ8A 1Q47A 5FKTA 5EM2B 4PNKB 4G56B 5SXMA 3SVWD 2CN3A 3UVLA 3SBPA 3AL8A 4J0XA 5CXBA 4A11B 3BG0A 3SMRA 2HXCA 3DDUA 2XYIA 4DNVA 4FA5D 1JJUB 3F3PA 3IVMA 2VDPA 3OW8A 3AH8B 5HE1B 2HKMA 5I5JA 5M5VA 2VDKA 5AMSA 2H3XA 5IC7A 2H6QA 5FA5B 5IJ7E 3L4OD 3OTTA 4MMZA 4O2WA 4CY2A 4X3EA 1E8MA 3NVXA 3F3FA 3MUNA 2AGLA 4CY3A 3UVMA 3UR4A 3OL2B 4NENA 1MG3A 2EICA 4IRZA 2UZYB 1T2XA 3KRXB 4FWWA 5IGQA 1U4CA 1R5MA 4J8BA 4X61B 3RFGA 3O4GA 3PE7A 4D9SA 4GM8A 3MMYA 2GNQA 2P9IC 3JPXA 3NVQA 4GM9A 3JRPA 2AH1A 2WQ8A 2I0TA 2TRCB 5C92A 4L1QD 5FKRA 4BCBA 3K71A 2I0SA 3IUQA 3C99A 5M5RA 3RLMD 2VDQA 4GZ8A 3EI4B 2CE8A 4G55A 4BP9A 2CO0C 2H14A 4JSXC 2H68A 3PXWD 2JKXA 3KCIA 2P9NC 3PVUB 3BG1A 2EIDA 1O6GA 4CZYA 2H6KA 2H6NA 2PBIB 1SQ9A 1UOQA 3I7KA 5IJ8E 4Z7OA 1PI6A 2P9UC 4CC9A 3OKTA 3EI1B 2VC2A 4XYIA 5FFGA 2BBKH 4FA4D 3RFHA 3EMHA 3ZDYA 2XE4A 5M5SA 2YNNA 4E5ZB 1A0RB 4AN0A 2IAAA 2UZXB 4G1EA 3P4FA 1NR0A 2H9MA 4JT6C 3JZNA 5C2WB 1UOOA 2J57G 3ZDZA 1GOFA 2OK6A 3GD1I 5EARA 5FXYA 4CI1A 3MZLA 4GQ1A 3F3GA 4PSXB 1I2MB 5EMMB 3RN1D 4NAAA 3IJ0A 4PSWB 2YMUA 3CFVA 3J80g 1N6FA 1K32A 2PM6B 2XZGA 5GSAA 4ZN4A 2IWKA 1GOHA 5E6UA 2AQ5A 5CYKA 3UVOA 1RI6A 3MKQA 3T3PA 2Z2NA 3ZE1A 3VI4A 3K27A 5HE3B 3A0FA
chains in the Genus database with same CATH topology
5HE0B 2YNOA 3MXXA 4AOWA 4BUJC 2PM7B 4A0BA 5AFU3 3AL8B 3V5WB 4A08A 2MTAH 4GM3A 4A0AA 3KRWB 2PM9A 3PXTD 2H9LA 2H9PA 4GGAA 1S4UX 3MKSB 2XL3A 3E0CA 4J78A 1FWXA 4Z8LA 5EMLB 2G9AA 2Z2PA 1GXRA 5I5MA 4ZOZA 5EM2A 5H17A 4X60B 4E54B 3ODTA 1XIPA 2J55H 4PBZA 4ERQA 4YVDA 2CNXA 4IA9A 2HJBA 3IJCA 5FQDA 3VH0A 5GMKn 2I3TA 4O45A 4A7JA 3JB9L 4QL1A 2HESX 3GREA 5K19A 4ES0A 3ZWLB 3JAMg 3SWSD 2XL2A 4JXMA 3AFCA 1OLZA 4N14A 4CY1A 3ULEC 2OK4A 4J87A 2Q7QA 1B9XA 3JROA 1GG2B 1L0QA 4GGCA 3EU7A 3C9CA 1XKSA 4PXWA 1SQJA 3HFQA 4J77A 5H14A 3J81g 2IURA 5A2Qg 4FAND 5CYKB 4J8GA 4O3TB 3DXKC 5TEFA 5EMKB 3RN0D 3SFZA 1JOFA 1TBGA 4FAVD 3SBRA 4D6VA 4ERZA 5IT9g 4H5IA 3SN6B 5TEEA 1N6DA 4L3GD 5EAPA 1B9YA 4A0BB 2QXVA 4LG8A 3VA6A 4GQBB 3UKUC 5CXCA 3I7OA 2PM9B 3PXSD 3I7LA 3PSLA 5C2VB 3JZGA 4GGDA 4GMBA 4JSNC 5TDHB 3IIWA 5GXIA 4QT8A 5EMJB 4Y7RA 4BL0A 2GC4A 4JD2C 3EI3A 1JMXB 5HYNB 5AJAA 2I3SA 1XHMA 5C9ZB 3DSMA 4O3UB 4ZOYA 4MK0B 1PEVA 2HJ4A 4A09A 2YNPA 2OVPB 2OVRB 4U1EI 2IUPA 2BCJB 4J0WA 4FB1D 3I8CA 2IWFA 4J79A 3V9FA 2H13A 3IJ1A 4X63B 4XEIC 4JT5C 5FKQA 1GOTB 3OKYB 4A0AB 4GQ2P 1YFQA 5TF2A 4XYHA 4O1QD 3RMZD 4QQEA 5I5IA 3UVNA 3CIKB 4JSVC 3N0EA 3I7NA 5H1MA 1K8KC 3CFSB 4J84A 5THAA 1QNIA 4U7AA 2YBAA 4OZUA 3SBQA 1TYQC 3EI2A 3RRMC 2CO0A 1MDAH 2B5LA 4J73A 4CY5A 5IGOA 4ESGA 5HE2B 3DWLC 4CI8A 2Z2OA 2B4EA 3EI4A 4E54A 2HKRA 3I89A 4L9OA 2H47A 2P9SC 3UVKA 5KDOB 3SLED 4JSPC 2HYEA 4FA9D 3IKOA 5FKSA 3IIYA 5EAMA 3NVNA 3OL2A 3SCYA 3PSCB 2B5MA 3BWSA 3K26A 4K3ID 3EI1A 2IUQA 3I7HA 5JWZA 4IMMA 3UKRC 3U4YA 3B7FA 5EALA 4AEZA 4J86A 2G99A 2XU7A 1U2VC 2B5NA 3SXTD 4D0KA 3SJLD 4LG9A 4J82A 5CXCB 3RSEC 4ZOXA 2AH0A 3VGZA 3C75H 1JMZB 4A2MA 2OVQB 4I79A 1GP2B 3N0DA 2P9PC 4ZOVA 2OIZA 2W18A 3V7DB 3ORVD 2AGXA 2IUVA 2YB8B 3FRXA 2CE9A 1NEXB 4QRJA 1PBYB 2I0RA 4EWRA 4L3HD 5CXBB 3EWEA 4A2LA 4A11A 4ERYA 4CI3A 3SHFA 4A09B 4E5ZA 2H9NA 3AL9A 2AGYA 3OKWA 4H5JA 4K3JB 4HDJA 3FGBA 4A08B 2CN2A 2AGWA 5B4WA 4OWRA 4FHLA 4PBYA 4CZXA 3JZHA 5K1CC 5HQGA 2EBSA 3GFCA 4PC0A 4TZ4A 2GC7A 2O9KA 3I2NA 4R7AB 4Y5RD 1P22A 3I7PA 1VYHC 5FLXg 4FA1D 4J81A 4O9DA 2AGZA 3PVWB 2J56H 2OJYA 3EI2B 3MZKA 3OKYA 3DXMC 3I8EA 2QC5A 3W15A 4UI9R 2P9LC 1ERJA 1MG2A 4BH6A 1N6EA 1PGUA 2P9KC 4CZVA 1OMWB 3L4MD 3EG6A 3C5MA 3DM0A 4LGNA 5GXHA 3FM0A 4KFMB 4CI2A 1SHYB 3EI3B 4NSXA 1Q47A 5FKTA 5EM2B 4PNKB 4G56B 5SXMA 3SVWD 2CN3A 3UVLA 3SBPA 3AL8A 4J0XA 5CXBA 4A11B 3BG0A 3SMRA 2HXCA 2XYIA 4FA5D 1JJUB 3F3PA 3OW8A 5HE1B 3AH8B 2HKMA 5I5JA 5AMSA 2H3XA 5IC7A 2H6QA 5FA5B 5IJ7E 3L4OD 3OTTA 4CY2A 4X3EA 3NVXA 3F3FA 2AGLA 4CY3A 3UVMA 3UR4A 3OL2B 1MG3A 2UZYB 3KRXB 4FWWA 5IGQA 1U4CA 1R5MA 4J8BA 4X61B 3RFGA 3PE7A 4GM8A 3MMYA 2GNQA 2P9IC 3JPXA 3NVQA 4GM9A 3JRPA 2AH1A 2I0TA 2TRCB 4L1QD 5FKRA 2I0SA 3C99A 3RLMD 4GZ8A 3EI4B 2CE8A 2CO0C 2H14A 4JSXC 2H68A 3PXWD 2P9NC 3PVUB 3BG1A 4CZYA 2H6KA 2H6NA 2PBIB 1SQ9A 3I7KA 5IJ8E 1PI6A 2P9UC 4CC9A 3OKTA 3EI1B 4XYIA 2BBKH 4FA4D 3RFHA 3EMHA 2YNNA 4E5ZB 1A0RB 2IAAA 2UZXB 3P4FA 1NR0A 2H9MA 4JT6C 3JZNA 5C2WB 2J57G 2OK6A 5EARA 5FXYA 4CI1A 3MZLA 4GQ1A 3F3GA 4PSXB 5EMMB 3RN1D 3IJ0A 4PSWB 2YMUA 3CFVA 3J80g 1N6FA 1K32A 2PM6B 5GSAA 4ZN4A 2IWKA 2AQ5A 5CYKA 3UVOA 1RI6A 3MKQA 2Z2NA 3K27A 5HE3B 3A0FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HE0 B;  2YNO A;  3MXX A;  4AOW A;  4BUJ C;  2PM7 B;  4A0B A;  5AFU 3;  3AL8 B;  3V5W B;  4A08 A;  2MTA H;  4GM3 A;  4A0A A;  3KRW B;  2PM9 A;  3PXT D;  2H9L A;  2H9P A;  4GGA A;  1S4U X;  3MKS B;  2XL3 A;  3E0C A;  4J78 A;  1FWX A;  4Z8L A;  5EML B;  2G9A A;  2Z2P A;  1GXR A;  5I5M A;  4ZOZ A;  5EM2 A;  5H17 A;  4X60 B;  4E54 B;  3ODT A;  1XIP A;  2J55 H;  4PBZ A;  4ERQ A;  4YVD A;  2CNX A;  4IA9 A;  2HJB A;  3IJC A;  5FQD A;  3VH0 A;  5GMK n;  2I3T A;  4O45 A;  4A7J A;  3JB9 L;  4QL1 A;  2HES X;  3GRE A;  5K19 A;  4ES0 A;  3ZWL B;  3JAM g;  3SWS D;  2XL2 A;  4JXM A;  3AFC A;  1OLZ A;  4N14 A;  4CY1 A;  3ULE C;  2OK4 A;  4J87 A;  2Q7Q A;  1B9X A;  3JRO A;  1GG2 B;  1L0Q A;  4GGC A;  3EU7 A;  3C9C A;  1XKS A;  4PXW A;  1SQJ A;  3HFQ A;  4J77 A;  5H14 A;  3J81 g;  2IUR A;  5A2Q g;  4FAN D;  5CYK B;  4J8G A;  4O3T B;  3DXK C;  5TEF A;  5EMK B;  3RN0 D;  3SFZ A;  1JOF A;  1TBG A;  4FAV D;  3SBR A;  4D6V A;  4ERZ A;  5IT9 g;  4H5I A;  3SN6 B;  5TEE A;  1N6D A;  4L3G D;  5EAP A;  1B9Y A;  4A0B B;  2QXV A;  4LG8 A;  3VA6 A;  4GQB B;  3UKU C;  5CXC A;  3I7O A;  2PM9 B;  3PXS D;  3I7L A;  3PSL A;  5C2V B;  3JZG A;  4GGD A;  4GMB A;  4JSN C;  5TDH B;  3IIW A;  5GXI A;  4QT8 A;  5EMJ B;  4Y7R A;  4BL0 A;  2GC4 A;  4JD2 C;  3EI3 A;  1JMX B;  5HYN B;  5AJA A;  2I3S A;  1XHM A;  5C9Z B;  3DSM A;  4O3U B;  4ZOY A;  4MK0 B;  1PEV A;  2HJ4 A;  4A09 A;  2YNP A;  2OVP B;  2OVR B;  4U1E I;  2IUP A;  2BCJ B;  4J0W A;  4FB1 D;  3I8C A;  2IWF A;  4J79 A;  3V9F A;  2H13 A;  3IJ1 A;  4X63 B;  4XEI C;  4JT5 C;  5FKQ A;  1GOT B;  3OKY B;  4A0A B;  4GQ2 P;  1YFQ A;  5TF2 A;  4XYH A;  4O1Q D;  3RMZ D;  4QQE A;  5I5I A;  3UVN A;  3CIK B;  4JSV C;  3N0E A;  3I7N A;  5H1M A;  1K8K C;  3CFS B;  4J84 A;  5THA A;  1QNI A;  4U7A A;  2YBA A;  4OZU A;  3SBQ A;  1TYQ C;  3EI2 A;  3RRM C;  2CO0 A;  1MDA H;  2B5L A;  4J73 A;  4CY5 A;  5IGO A;  4ESG A;  5HE2 B;  3DWL C;  4CI8 A;  2Z2O A;  2B4E A;  3EI4 A;  4E54 A;  2HKR A;  3I89 A;  4L9O A;  2H47 A;  2P9S C;  3UVK A;  5KDO B;  3SLE D;  4JSP C;  2HYE A;  4FA9 D;  3IKO A;  5FKS A;  3IIY A;  5EAM A;  3NVN A;  3OL2 A;  3SCY A;  3PSC B;  2B5M A;  3BWS A;  3K26 A;  4K3I D;  3EI1 A;  2IUQ A;  3I7H A;  5JWZ A;  4IMM A;  3UKR C;  3U4Y A;  3B7F A;  5EAL A;  4AEZ A;  4J86 A;  2G99 A;  2XU7 A;  1U2V C;  2B5N A;  3SXT D;  4D0K A;  3SJL D;  4LG9 A;  4J82 A;  5CXC B;  3RSE C;  4ZOX A;  2AH0 A;  3VGZ A;  3C75 H;  1JMZ B;  4A2M A;  2OVQ B;  4I79 A;  1GP2 B;  3N0D A;  2P9P C;  4ZOV A;  2OIZ A;  2W18 A;  3V7D B;  3ORV D;  2AGX A;  2IUV A;  2YB8 B;  3FRX A;  2CE9 A;  1NEX B;  4QRJ A;  1PBY B;  2I0R A;  4EWR A;  4L3H D;  5CXB B;  3EWE A;  4A2L A;  4A11 A;  4ERY A;  4CI3 A;  3SHF A;  4A09 B;  4E5Z A;  2H9N A;  3AL9 A;  2AGY A;  3OKW A;  4H5J A;  4K3J B;  4HDJ A;  3FGB A;  4A08 B;  2CN2 A;  2AGW A;  5B4W A;  4OWR A;  4FHL A;  4PBY A;  4CZX A;  3JZH A;  5K1C C;  5HQG A;  2EBS A;  3GFC A;  4PC0 A;  4TZ4 A;  2GC7 A;  2O9K A;  3I2N A;  4R7A B;  4Y5R D;  1P22 A;  3I7P A;  1VYH C;  5FLX g;  4FA1 D;  4J81 A;  4O9D A;  2AGZ A;  3PVW B;  2J56 H;  2OJY A;  3EI2 B;  3MZK A;  3OKY A;  3DXM C;  3I8E A;  2QC5 A;  3W15 A;  4UI9 R;  2P9L C;  1ERJ A;  1MG2 A;  4BH6 A;  1N6E A;  1PGU A;  2P9K C;  4CZV A;  1OMW B;  3L4M D;  3EG6 A;  3C5M A;  3DM0 A;  4LGN A;  5GXH A;  3FM0 A;  4KFM B;  4CI2 A;  1SHY B;  3EI3 B;  4NSX A;  1Q47 A;  5FKT A;  5EM2 B;  4PNK B;  4G56 B;  5SXM A;  3SVW D;  2CN3 A;  3UVL A;  3SBP A;  3AL8 A;  4J0X A;  5CXB A;  4A11 B;  3BG0 A;  3SMR A;  2HXC A;  2XYI A;  4FA5 D;  1JJU B;  3F3P A;  3OW8 A;  5HE1 B;  3AH8 B;  2HKM A;  5I5J A;  5AMS A;  2H3X A;  5IC7 A;  2H6Q A;  5FA5 B;  5IJ7 E;  3L4O D;  3OTT A;  4CY2 A;  4X3E A;  3NVX A;  3F3F A;  2AGL A;  4CY3 A;  3UVM A;  3UR4 A;  3OL2 B;  1MG3 A;  2UZY B;  3KRX B;  4FWW A;  5IGQ A;  1U4C A;  1R5M A;  4J8B A;  4X61 B;  3RFG A;  3PE7 A;  4GM8 A;  3MMY A;  2GNQ A;  2P9I C;  3JPX A;  3NVQ A;  4GM9 A;  3JRP A;  2AH1 A;  2I0T A;  2TRC B;  4L1Q D;  5FKR A;  2I0S A;  3C99 A;  3RLM D;  4GZ8 A;  3EI4 B;  2CE8 A;  2CO0 C;  2H14 A;  4JSX C;  2H68 A;  3PXW D;  2P9N C;  3PVU B;  3BG1 A;  4CZY A;  2H6K A;  2H6N A;  2PBI B;  1SQ9 A;  3I7K A;  5IJ8 E;  1PI6 A;  2P9U C;  4CC9 A;  3OKT A;  3EI1 B;  4XYI A;  2BBK H;  4FA4 D;  3RFH A;  3EMH A;  2YNN A;  4E5Z B;  1A0R B;  2IAA A;  2UZX B;  3P4F A;  1NR0 A;  2H9M A;  4JT6 C;  3JZN A;  5C2W B;  2J57 G;  2OK6 A;  5EAR A;  5FXY A;  4CI1 A;  3MZL A;  4GQ1 A;  3F3G A;  4PSX B;  5EMM B;  3RN1 D;  3IJ0 A;  4PSW B;  2YMU A;  3CFV A;  3J80 g;  1N6F A;  1K32 A;  2PM6 B;  5GSA A;  4ZN4 A;  2IWK A;  2AQ5 A;  5CYK A;  3UVO A;  1RI6 A;  3MKQ A;  2Z2N A;  3K27 A;  5HE3 B;  3A0F A; 
#chains in the Genus database with same CATH topology
 5HE0 B;  2YNO A;  3MXX A;  3QI0 A;  4AOW A;  4BUJ C;  2PM7 B;  4A0B A;  5AFU 3;  1VZ3 A;  3AL8 B;  3V5W B;  4A08 A;  4NC4 A;  2MTA H;  4GM3 A;  2EIE A;  4A0A A;  3KRW B;  2PM9 A;  3PXT D;  2H9L A;  2H9P A;  4GGA A;  1L5G A;  1S4U X;  3MKS B;  4Z7Q A;  2XL3 A;  3E0C A;  4J78 A;  5M5T A;  1H2W A;  1FWX A;  4UM8 A;  4Z8L A;  5EML B;  2G9A A;  2Z2P A;  1GXR A;  3NID A;  5I5M A;  4ZOZ A;  5EM2 A;  5H17 A;  4X60 B;  4E54 B;  3ODT A;  1XIP A;  4JHP C;  2J55 H;  5M5U A;  4PBZ A;  4ERQ A;  4YVD A;  2CNX A;  3NIF A;  4IA9 A;  2HJB A;  3IJC A;  5FQD A;  1TYE A;  3VH0 A;  5GMK n;  2I3T A;  4O45 A;  3O4J A;  4A7J A;  3JB9 L;  4QL1 A;  2HES X;  3GRE A;  5K19 A;  4ES0 A;  3ZWL B;  3JAM g;  3SWS D;  2XL2 A;  4JXM A;  3T3M A;  3AFC A;  1OLZ A;  4N14 A;  4CY1 A;  3ULE C;  2OK4 A;  4J87 A;  2Q7Q A;  5M61 A;  3NIG A;  1B9X A;  3IUN A;  3JRO A;  1GG2 B;  4MMX A;  1L0Q A;  4GGC A;  3EU7 A;  3MVD K;  4AMZ A;  1YR2 A;  3C9C A;  1XKS A;  4PXW A;  1SQJ A;  3HFQ A;  4J77 A;  4RE5 A;  5H14 A;  3J81 g;  2IUR A;  5A2Q g;  4FAN D;  5CYK B;  4J8G A;  4O3T B;  3DXK C;  5TEF A;  5E6S A;  5EMK B;  3RN0 D;  3SFZ A;  1JOF A;  3V4P A;  1TBG A;  4FAV D;  3SBR A;  4D6V A;  4ERZ A;  5IT9 g;  4H5I A;  3SN6 B;  1GOG A;  5TEE A;  1N6D A;  3O4H A;  4L3G D;  5EAP A;  1B9Y A;  4A0B B;  2QXV A;  4LG8 A;  3VA6 A;  4GQB B;  3UKU C;  3EQ7 A;  3GC3 B;  5CXC A;  3I7O A;  2PM9 B;  3PXS D;  2QZP A;  3I7L A;  3PSL A;  5C2V B;  4AX4 A;  3JZG A;  4GGD A;  4GMB A;  4WK0 A;  2XDW A;  4JSN C;  1H2Y A;  3FCS A;  3IUJ A;  5TDH B;  3IIW A;  5GXI A;  4QT8 A;  4BCC A;  5EMJ B;  4Y7R A;  4BL0 A;  2GC4 A;  4JD2 C;  2VDR A;  3VI3 A;  3EI3 A;  1JMX B;  5HYN B;  1C9L A;  5AJA A;  2I3S A;  1U8C A;  1XHM A;  5C9Z B;  3DSM A;  4O3U B;  4ZOY A;  4MK0 B;  1PEV A;  2HJ4 A;  4A09 A;  2YNP A;  2OVP B;  2OVR B;  4U1E I;  2IUP A;  2VDO A;  1VZ2 A;  2BCJ B;  4J0W A;  4FB1 D;  3I8C A;  2IWF A;  4J79 A;  3V9F A;  1K3I A;  1VE7 A;  2H13 A;  3IJ1 A;  4X63 B;  4XEI C;  4JT5 C;  5FFO A;  1GOT B;  3OKY B;  5FKQ A;  4AMY A;  4NBM A;  4A0A B;  4GQ2 P;  1YFQ A;  5TF2 A;  4XYH A;  4O1Q D;  3RMZ D;  1UTC A;  4QQE A;  5I5I A;  3ZE2 A;  3UVN A;  3CIK B;  4JSV C;  3N0E A;  3I7N A;  5H1M A;  1K8K C;  3CFS B;  4BP8 A;  5HDB A;  4J84 A;  3O4I A;  5THA A;  4DNU A;  1QNI A;  4U7A A;  3ZDX A;  2YBA A;  4OZU A;  3SBQ A;  3K72 A;  1TYQ C;  3EI2 A;  4BCD A;  3K6S A;  3RRM C;  2CO0 A;  1MDA H;  2B5L A;  4J73 A;  1JTD B;  4CY5 A;  5IGO A;  3QHY B;  4ESG A;  5HE2 B;  3DWL C;  4L1M A;  4CI8 A;  2Z2O A;  3IUL A;  1E8N A;  2B4E A;  3EI4 A;  4E54 A;  2VDN A;  2HKR A;  2VZ1 A;  3I89 A;  2H47 A;  2P9S C;  4L9O A;  3UVK A;  4UM9 A;  5KDO B;  3SLE D;  4JSP C;  2HYE A;  1JV2 A;  1M1X A;  4FA9 D;  3IKO A;  5FKS A;  3IIY A;  5EAM A;  3NVN A;  3OL2 A;  3SCY A;  3PSC B;  4DNW A;  2B5M A;  3MUO A;  3BWS A;  3K26 A;  4K3I D;  3EI1 A;  2IUQ A;  4AN1 A;  3I7H A;  5JWZ A;  4IMM A;  4RE6 A;  1H2X A;  3UKR C;  3B7F A;  3U4Y A;  5EAL A;  4AEZ A;  3V4V A;  4J86 A;  2G99 A;  2XU7 A;  3OF7 A;  1U2V C;  2B5N A;  3SXT D;  4D0K A;  3SJL D;  4LG9 A;  1VE6 A;  4J82 A;  5CXC B;  3RSE C;  4ZOX A;  1O6F A;  2AH0 A;  1QFM A;  3VGZ A;  3ZE0 A;  3C75 H;  1JMZ B;  4A2M A;  1E5T A;  2OVQ B;  4I79 A;  1GP2 B;  3N0D A;  4Z7N A;  2P9P C;  4ZOV A;  2OIZ A;  2W18 A;  3V7D B;  1C9I A;  3ORV D;  2AGX A;  2VZ3 A;  2IUV A;  2YB8 B;  3FRX A;  2CE9 A;  1NEX B;  3IJE A;  1PBY B;  2I0R A;  4QRJ A;  4L3H D;  4EWR A;  5CXB B;  3EWE A;  4A2L A;  4A11 A;  3FCU A;  2VDL A;  4ERY A;  4MMY A;  4CI3 A;  3SHF A;  4A09 B;  4E5Z A;  5E6R A;  2H9N A;  3AL9 A;  2AGY A;  3OKW A;  4H5J A;  4K3J B;  4WK2 A;  4HDJ A;  3FGB A;  4JHN A;  4A08 B;  2CN2 A;  2AGW A;  5B4W A;  4G1M A;  4OWR A;  3IUM A;  4O02 A;  4WK4 A;  4FHL A;  4PBY A;  4CZX A;  3JZH A;  5K1C C;  2QR5 A;  5HQG A;  2EBS A;  1BPO A;  3GFC A;  4PC0 A;  4TZ4 A;  2GC7 A;  1UOP A;  2O9K A;  3I2N A;  4R7A B;  4Y5R D;  1P22 A;  3I7P A;  2HU8 A;  1VYH C;  1QFS A;  5FLX g;  4FA1 D;  2HU7 A;  4J81 A;  3EQ9 A;  4O9D A;  2AGZ A;  3PVW B;  2J56 H;  2OJY A;  2VDM A;  3EI2 B;  3MZK A;  3OKY A;  3DXM C;  3I8E A;  2QC5 A;  3W15 A;  4UI9 R;  2P9L C;  4WJK A;  5C86 A;  1ERJ A;  1MG2 A;  4BH6 A;  1N6E A;  1PGU A;  2P9K C;  4CZV A;  1OMW B;  3L4M D;  1A12 A;  3EG6 A;  3C5M A;  3DM0 A;  3IUR A;  4LGN A;  5GXH A;  3FM0 A;  1H2Z A;  4KFM B;  4CI2 A;  1SHY B;  3EI3 B;  2EIB A;  4NSX A;  4QAM A;  2BKL A;  2HU5 A;  3EQ8 A;  1Q47 A;  5FKT A;  5EM2 B;  4PNK B;  4G56 B;  5SXM A;  3SVW D;  2CN3 A;  3UVL A;  3SBP A;  3AL8 A;  4J0X A;  5CXB A;  4A11 B;  3BG0 A;  3SMR A;  2HXC A;  3DDU A;  2XYI A;  4DNV A;  4FA5 D;  1JJU B;  3F3P A;  3IVM A;  2VDP A;  3OW8 A;  3AH8 B;  5HE1 B;  2HKM A;  5I5J A;  5M5V A;  2VDK A;  5AMS A;  2H3X A;  5IC7 A;  2H6Q A;  5FA5 B;  5IJ7 E;  3L4O D;  3OTT A;  4MMZ A;  4O2W A;  4CY2 A;  4X3E A;  1E8M A;  3NVX A;  3F3F A;  3MUN A;  2AGL A;  4CY3 A;  3UVM A;  3UR4 A;  3OL2 B;  4NEN A;  1MG3 A;  2EIC A;  4IRZ A;  2UZY B;  1T2X A;  3KRX B;  4FWW A;  5IGQ A;  1U4C A;  1R5M A;  4J8B A;  4X61 B;  3RFG A;  3O4G A;  3PE7 A;  4D9S A;  4GM8 A;  3MMY A;  2GNQ A;  2P9I C;  3JPX A;  3NVQ A;  4GM9 A;  3JRP A;  2AH1 A;  2WQ8 A;  2I0T A;  2TRC B;  5C92 A;  4L1Q D;  5FKR A;  4BCB A;  3K71 A;  2I0S A;  3IUQ A;  3C99 A;  5M5R A;  3RLM D;  2VDQ A;  4GZ8 A;  3EI4 B;  2CE8 A;  4G55 A;  4BP9 A;  2CO0 C;  2H14 A;  4JSX C;  2H68 A;  3PXW D;  2JKX A;  3KCI A;  2P9N C;  3PVU B;  3BG1 A;  2EID A;  1O6G A;  4CZY A;  2H6K A;  2H6N A;  2PBI B;  1SQ9 A;  1UOQ A;  3I7K A;  5IJ8 E;  4Z7O A;  1PI6 A;  2P9U C;  4CC9 A;  3OKT A;  3EI1 B;  2VC2 A;  4XYI A;  5FFG A;  2BBK H;  4FA4 D;  3RFH A;  3EMH A;  3ZDY A;  2XE4 A;  5M5S A;  2YNN A;  4E5Z B;  1A0R B;  4AN0 A;  2IAA A;  2UZX B;  4G1E A;  3P4F A;  1NR0 A;  2H9M A;  4JT6 C;  3JZN A;  5C2W B;  1UOO A;  2J57 G;  3ZDZ A;  1GOF A;  2OK6 A;  3GD1 I;  5EAR A;  5FXY A;  4CI1 A;  3MZL A;  4GQ1 A;  3F3G A;  4PSX B;  1I2M B;  5EMM B;  3RN1 D;  4NAA A;  3IJ0 A;  4PSW B;  2YMU A;  3CFV A;  3J80 g;  1N6F A;  1K32 A;  2PM6 B;  2XZG A;  5GSA A;  4ZN4 A;  2IWK A;  1GOH A;  5E6U A;  2AQ5 A;  5CYK A;  3UVO A;  1RI6 A;  3MKQ A;  3T3P A;  2Z2N A;  3ZE1 A;  3VI4 A;  3K27 A;  5HE3 B;  3A0F A; 
#chains in the Genus database with same CATH homology
 5HE0 B;  2YNO A;  3MXX A;  4AOW A;  4BUJ C;  2PM7 B;  4A0B A;  5AFU 3;  3AL8 B;  3V5W B;  4A08 A;  2MTA H;  4GM3 A;  4A0A A;  3KRW B;  2PM9 A;  3PXT D;  2H9L A;  2H9P A;  4GGA A;  1S4U X;  3MKS B;  2XL3 A;  3E0C A;  4J78 A;  1FWX A;  4Z8L A;  5EML B;  2G9A A;  2Z2P A;  1GXR A;  5I5M A;  4ZOZ A;  5EM2 A;  5H17 A;  4X60 B;  4E54 B;  3ODT A;  1XIP A;  2J55 H;  4PBZ A;  4ERQ A;  4YVD A;  2CNX A;  4IA9 A;  2HJB A;  3IJC A;  5FQD A;  3VH0 A;  5GMK n;  2I3T A;  4O45 A;  4A7J A;  3JB9 L;  4QL1 A;  2HES X;  3GRE A;  5K19 A;  4ES0 A;  3ZWL B;  3JAM g;  3SWS D;  2XL2 A;  4JXM A;  3AFC A;  1OLZ A;  4N14 A;  4CY1 A;  3ULE C;  2OK4 A;  4J87 A;  2Q7Q A;  1B9X A;  3JRO A;  1GG2 B;  1L0Q A;  4GGC A;  3EU7 A;  3C9C A;  1XKS A;  4PXW A;  1SQJ A;  3HFQ A;  4J77 A;  5H14 A;  3J81 g;  2IUR A;  5A2Q g;  4FAN D;  5CYK B;  4J8G A;  4O3T B;  3DXK C;  5TEF A;  5EMK B;  3RN0 D;  3SFZ A;  1JOF A;  1TBG A;  4FAV D;  3SBR A;  4D6V A;  4ERZ A;  5IT9 g;  4H5I A;  3SN6 B;  5TEE A;  1N6D A;  4L3G D;  5EAP A;  1B9Y A;  4A0B B;  2QXV A;  4LG8 A;  3VA6 A;  4GQB B;  3UKU C;  5CXC A;  3I7O A;  2PM9 B;  3PXS D;  3I7L A;  3PSL A;  5C2V B;  3JZG A;  4GGD A;  4GMB A;  4JSN C;  5TDH B;  3IIW A;  5GXI A;  4QT8 A;  5EMJ B;  4Y7R A;  4BL0 A;  2GC4 A;  4JD2 C;  3EI3 A;  1JMX B;  5HYN B;  5AJA A;  2I3S A;  1XHM A;  5C9Z B;  3DSM A;  4O3U B;  4ZOY A;  4MK0 B;  1PEV A;  2HJ4 A;  4A09 A;  2YNP A;  2OVP B;  2OVR B;  4U1E I;  2IUP A;  2BCJ B;  4J0W A;  4FB1 D;  3I8C A;  2IWF A;  4J79 A;  3V9F A;  2H13 A;  3IJ1 A;  4X63 B;  4XEI C;  4JT5 C;  5FKQ A;  1GOT B;  3OKY B;  4A0A B;  4GQ2 P;  1YFQ A;  5TF2 A;  4XYH A;  4O1Q D;  3RMZ D;  4QQE A;  5I5I A;  3UVN A;  3CIK B;  4JSV C;  3N0E A;  3I7N A;  5H1M A;  1K8K C;  3CFS B;  4J84 A;  5THA A;  1QNI A;  4U7A A;  2YBA A;  4OZU A;  3SBQ A;  1TYQ C;  3EI2 A;  3RRM C;  2CO0 A;  1MDA H;  2B5L A;  4J73 A;  4CY5 A;  5IGO A;  4ESG A;  5HE2 B;  3DWL C;  4CI8 A;  2Z2O A;  2B4E A;  3EI4 A;  4E54 A;  2HKR A;  3I89 A;  4L9O A;  2H47 A;  2P9S C;  3UVK A;  5KDO B;  3SLE D;  4JSP C;  2HYE A;  4FA9 D;  3IKO A;  5FKS A;  3IIY A;  5EAM A;  3NVN A;  3OL2 A;  3SCY A;  3PSC B;  2B5M A;  3BWS A;  3K26 A;  4K3I D;  3EI1 A;  2IUQ A;  3I7H A;  5JWZ A;  4IMM A;  3UKR C;  3U4Y A;  3B7F A;  5EAL A;  4AEZ A;  4J86 A;  2G99 A;  2XU7 A;  1U2V C;  2B5N A;  3SXT D;  4D0K A;  3SJL D;  4LG9 A;  4J82 A;  5CXC B;  3RSE C;  4ZOX A;  2AH0 A;  3VGZ A;  3C75 H;  1JMZ B;  4A2M A;  2OVQ B;  4I79 A;  1GP2 B;  3N0D A;  2P9P C;  4ZOV A;  2OIZ A;  2W18 A;  3V7D B;  3ORV D;  2AGX A;  2IUV A;  2YB8 B;  3FRX A;  2CE9 A;  1NEX B;  4QRJ A;  1PBY B;  2I0R A;  4EWR A;  4L3H D;  5CXB B;  3EWE A;  4A2L A;  4A11 A;  4ERY A;  4CI3 A;  3SHF A;  4A09 B;  4E5Z A;  2H9N A;  3AL9 A;  2AGY A;  3OKW A;  4H5J A;  4K3J B;  4HDJ A;  3FGB A;  4A08 B;  2CN2 A;  2AGW A;  5B4W A;  4OWR A;  4FHL A;  4PBY A;  4CZX A;  3JZH A;  5K1C C;  5HQG A;  2EBS A;  3GFC A;  4PC0 A;  4TZ4 A;  2GC7 A;  2O9K A;  3I2N A;  4R7A B;  4Y5R D;  1P22 A;  3I7P A;  1VYH C;  5FLX g;  4FA1 D;  4J81 A;  4O9D A;  2AGZ A;  3PVW B;  2J56 H;  2OJY A;  3EI2 B;  3MZK A;  3OKY A;  3DXM C;  3I8E A;  2QC5 A;  3W15 A;  4UI9 R;  2P9L C;  1ERJ A;  1MG2 A;  4BH6 A;  1N6E A;  1PGU A;  2P9K C;  4CZV A;  1OMW B;  3L4M D;  3EG6 A;  3C5M A;  3DM0 A;  4LGN A;  5GXH A;  3FM0 A;  4KFM B;  4CI2 A;  1SHY B;  3EI3 B;  4NSX A;  1Q47 A;  5FKT A;  5EM2 B;  4PNK B;  4G56 B;  5SXM A;  3SVW D;  2CN3 A;  3UVL A;  3SBP A;  3AL8 A;  4J0X A;  5CXB A;  4A11 B;  3BG0 A;  3SMR A;  2HXC A;  2XYI A;  4FA5 D;  1JJU B;  3F3P A;  3OW8 A;  5HE1 B;  3AH8 B;  2HKM A;  5I5J A;  5AMS A;  2H3X A;  5IC7 A;  2H6Q A;  5FA5 B;  5IJ7 E;  3L4O D;  3OTT A;  4CY2 A;  4X3E A;  3NVX A;  3F3F A;  2AGL A;  4CY3 A;  3UVM A;  3UR4 A;  3OL2 B;  1MG3 A;  2UZY B;  3KRX B;  4FWW A;  5IGQ A;  1U4C A;  1R5M A;  4J8B A;  4X61 B;  3RFG A;  3PE7 A;  4GM8 A;  3MMY A;  2GNQ A;  2P9I C;  3JPX A;  3NVQ A;  4GM9 A;  3JRP A;  2AH1 A;  2I0T A;  2TRC B;  4L1Q D;  5FKR A;  2I0S A;  3C99 A;  3RLM D;  4GZ8 A;  3EI4 B;  2CE8 A;  2CO0 C;  2H14 A;  4JSX C;  2H68 A;  3PXW D;  2P9N C;  3PVU B;  3BG1 A;  4CZY A;  2H6K A;  2H6N A;  2PBI B;  1SQ9 A;  3I7K A;  5IJ8 E;  1PI6 A;  2P9U C;  4CC9 A;  3OKT A;  3EI1 B;  4XYI A;  2BBK H;  4FA4 D;  3RFH A;  3EMH A;  2YNN A;  4E5Z B;  1A0R B;  2IAA A;  2UZX B;  3P4F A;  1NR0 A;  2H9M A;  4JT6 C;  3JZN A;  5C2W B;  2J57 G;  2OK6 A;  5EAR A;  5FXY A;  4CI1 A;  3MZL A;  4GQ1 A;  3F3G A;  4PSX B;  5EMM B;  3RN1 D;  3IJ0 A;  4PSW B;  2YMU A;  3CFV A;  3J80 g;  1N6F A;  1K32 A;  2PM6 B;  5GSA A;  4ZN4 A;  2IWK A;  2AQ5 A;  5CYK A;  3UVO A;  1RI6 A;  3MKQ A;  2Z2N A;  3K27 A;  5HE3 B;  3A0F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...