2AGLA

Crystal structure of the phenylhydrazine adduct of aromatic amine dehydrogenase from alcaligenes faecalis
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
360
structure length
360
Chain Sequence
REVLTGGHSVSAPQENRIYVMDSVFMHLTESRVHVYDYTNGKFLGMVPTAFNGHVQVSNDGKKIYTMTTYHERITRGKRSDVVEVWDADKLTFEKEISLPPKRVQGLNYDGLFRQTTDGKFIVLQNASPATSIGIVDVAKGDYVEDVTAAAGCWSVIPQPNRPRSFMTICGDGGLLTINLGEDGKVASQSRSKQMFSVKDDPIFIAPALDKDKAHFVSYYGNVYSADFSGDEVKVDGPWSLLNDEDKAKNWVPGGYNLVGLHRASGRMYVFMHPDGKEGTHKFPAAEIWVMDTKTKQRVARIPGRDALSMTIDQQRNLMLTLDGGNVNVYDISQPEPKLLRTIEGAAEASLQVQFHPVGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic description of an enzyme reaction dominated by proton tunneling
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Aromatic amine dehydrogenase
total genus 97
structure length 360
sequence length 360
chains with identical sequence B
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2005-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2aglA01
3RSEC 4LG8A 4CZVA 2H9LA 2YNOA 4U7AA 4JT6C 1Q47A 4G56B 2HJBA 2OK4A 5C2WB 3EI4A 1VYHC 3MXXA 3N0EA 3SHFA 4E5ZA 4A09B 1XIPA 2YBAA 3KRXB 1QNIA 3GFCA 4TZ4A 4H5JA 2J57G 4BUJC 4LGNA 4Y7RA 1SHYB 5EAMA 3SXTD 2H9NA 3CFVA 2H68A 1TYQC 3C9CA 5AMSA 2Z2OA 3AL8B 4X63B 4GQ1A 4A11A 1B9YA 2AGLA 3PXWD 3SLED 4L1QD 3EG6A 2CE9A 5GSAA 4FHLA 4AOWA 4O45A 2TRCB 4J8GA 3KRWB 4O9DA 5IJ8E 4CI3A 3JAMg 2J55H 2CE8A 4JSVC 2QXVA 4LG9A 3MKSB 2I0TA 3OL2B 3GREA 4NSXA 4CZXA 4GQ2P 2H6QA 3F3FA 5HE2B 4XYHA 3MKQA 5EMKB 4CZYA 3EI4B 4ZOZA 5B4WA 4Z8LA 3DM0A 4BH6A 3JPXA 3MZKA 4J82A 4CC9A 1GG2B 1PBYB 3VA6A 1N6FA 5K19A 4X3EA 3PXTD 3BWSA 5GMKn 5SXMA 3AL8A 4CY5A 3C99A 2J56H 5EMMB 3SBRA 3VH0A 2P9LC 3J81g 3OKYA 3UR4A 4QT8A 2P9KC 3B7FA 4PBZA 4ES0A 2IWFA 3EI1A 2QC5A 2GC7A 4PNKB 3SBQA 2YMUA 4FAND 2BBKH 2O9KA 2YNNA 4A0AA 4O3UB 2AH1A 3W15A 4MK0B 5IC7A 3SFZA 5FQDA 4CI2A 1PI6A 4E54A 3ODTA 5FLXg 3F3PA 2CO0A 3SVWD 3IJ0A 4L9OA 4O3TB 1JJUB 3MZLA 4PC0A 4GM3A 2HESX 3A0FA 4UI9R 3VGZA 4A0BB 1NR0A 3DSMA 4ERQA 3EMHA 5I5JA 5GXHA 4XEIC 2IWKA 2AGWA 2OVPB 1SQ9A 3J80g 4L3HD 5IGOA 3UVMA 4E5ZB 4J73A 4FA4D 2AGYA 1JOFA 2XYIA 5HE1B 2H9MA 3N0DA 1JMXB 1GP2B 5EAPA 1FWXA 4J86A 4QL1A 2OJYA 5I5MA 1L0QA 3F3GA 2B5MA 3UKRC 1NEXB 2HKMA 4J87A 1K8KC 5K1CC 4A0AB 2P9SC 1S4UX 5TEEA 3PE7A 1OMWB 1GOTB 5CXCA 4J0XA 2AH0A 4FAVD 5EARA 3PVUB 2UZYB 2Z2NA 3NVXA 3UVLA 2UZXB 2Z2PA 3AL9A 3IIWA 4AEZA 4PSWB 5IJ7E 4JD2C 3FGBA 1N6DA 1K32A 3FM0A 1XKSA 2MTAH 3ZWLB 4D6VA 3K26A 3I7PA 3SMRA 5FKSA 5FKQA 4A11B 5CYKB 2PM6B 4BL0A 3SWSD 3JRPA 4HDJA 5TDHB 4J0WA 4GQBB 5FXYA 3RN0D 2GC4A 3U4YA 4GM9A 4GZ8A 3V7DB 5HYNB 4E54B 3JROA 2I0RA 2H47A 2OVRB 3UVNA 4D0KA 2I0SA 1GXRA 3UKUC 3RRMC 5KDOB 3I8CA 4PSXB 4GGCA 5CXCB 4IA9A 3OW8A 4J79A 3UVKA 2YNPA 3BG0A 4JSPC 5C9ZB 1YFQA 2B4EA 3I7LA 1PEVA 2PBIB 2OVQB 2HXCA 3NVQA 3PXSD 4U1EI 3I8EA 4JT5C 5C2VB 4PXWA 3I89A 5EM2A 1R5MA 2H3XA 4FA1D 1RI6A 1MG2A 2XU7A 2P9NC 4GGAA 5FA5B 3OKYB 2P9UC 3EU7A 3EI3A 3IKOA 4L3GD 4J8BA 5AJAA 3EI3B 3AFCA 5A2Qg 3OKWA 2CN3A 3DWLC 2PM9B 2PM7B 2P9PC 1OLZA 1N6EA 3OL2A 4FB1D 4JXMA 3I2NA 5JWZA 4J84A 2IUVA 2CNXA 4JSXC 4N14A 5H1MA 3SBPA 3E0CA 3RMZD 3JZHA 2H6NA 3IIYA 3ORVD 5AFU3 4IMMA 3EI2A 3UVOA 5IT9g 3P4FA 3ULEC 2B5NA 3C75H 3SCYA 5H14A 5GXIA 4K3ID 4CY2A 2H14A 4A0BA 2G9AA 3I7NA 1U4CA 4CY1A 3PVWB 4FA5D 3L4MD 5FKTA 2BCJB 3EI1B 1SQJA 4O1QD 4A08A 3DXMC 3I7HA 2B5LA 3DXKC 2IUPA 3RN1D 4EWRA 2IAAA 5H17A 2IUQA 3L4OD 4CY3A 1MG3A 3NVNA 3EWEA 2AGZA 4H5IA 3CFSB 4CI8A 3V5WB 2HYEA 3SJLD 3IJCA 3FRXA 2AGXA 2GNQA 4A7JA 2I3TA 5HE0B 5CXBA 4A2MA 2CO0C 2YB8B 5THAA 4QQEA 2XL3A 4GGDA 3RLMD 4ERZA 3RFHA 3CIKB 5TEFA 1B9XA 3V9FA 2H13A 2I3SA 4ESGA 4ZOYA 4JSNC 4K3JB 3BG1A 4GMBA 4I79A 2XL2A 4J78A 2W18A 4PBYA 2P9IC 3I7KA 2G99A 1U2VC 4J81A 4YVDA 5HQGA 4XYIA 4OWRA 3MMYA 3PSCB 3RFGA 4CI1A 4ERYA 4FWWA 3OKTA 2IURA 1TBGA 2HKRA 2CN2A 4R7AB 5FKRA 3OTTA 3HFQA 1PGUA 2H9PA 4GM8A 4X60B 4Y5RD 4X61B 1ERJA 3AH8B 2OIZA 4ZN4A 3PSLA 3K27A 1P22A 2H6KA 3I7OA 2OK6A 4J77A 5IGQA 3C5MA 1JMZB 5EALA 3SN6B 3JB9L 5EMJB 4QRJA 5EM2B 4KFMB 5HE3B 4A09A 1XHMA 4FA9D 3EI2B 1MDAH 2Q7QA 4OZUA 2HJ4A 5CYKA 4A2LA 1A0RB 2PM9A 4ZOXA 3JZNA 3JZGA 2EBSA 5EMLB 5I5IA 3IJ1A 4ZOVA 5CXBB 4A08B 2AQ5A 5TF2A
chains in the Genus database with same CATH superfamily
5E6SA 4LG8A 3RSEC 4CZVA 2H9LA 2VDOA 2YNOA 4U7AA 4JT6C 1Q47A 4G56B 2HJBA 2OK4A 5C2WB 3EI4A 2QZPA 1VYHC 3MXXA 3N0EA 3SHFA 4E5ZA 1YR2A 4A09B 1XIPA 2YBAA 4JHPC 4NBMA 3KRXB 1QNIA 1UOQA 3GFCA 4TZ4A 4H5JA 2J57G 4BUJC 4LGNA 4Y7RA 1SHYB 5EAMA 3SXTD 2H9NA 3CFVA 2H68A 1TYQC 3C9CA 2XDWA 5AMSA 2Z2OA 3IUNA 3AL8B 4X63B 4GQ1A 4A11A 1B9YA 2AGLA 3PXWD 3SLED 4L1QD 3EG6A 2CE9A 5GSAA 4FHLA 4AOWA 1O6GA 4O45A 2TRCB 4J8GA 3KRWB 2JKXA 4O9DA 1M1XA 2VDRA 5IJ8E 4CI3A 3JAMg 2J55H 2CE8A 4BCCA 4JSVC 2QXVA 4LG9A 3MKSB 2I0TA 3OL2B 3ZE1A 3GREA 4MMXA 4NSXA 4CZXA 4GQ2P 2VDQA 2H6QA 3F3FA 5HE2B 4XYHA 4UM8A 3MKQA 1H2WA 5EMKB 4CZYA 3EI4B 4ZOZA 2XZGA 5B4WA 4Z8LA 3DM0A 4BH6A 3JPXA 3MZKA 4J82A 4CC9A 1GG2B 1PBYB 4AN1A 3VA6A 2VDNA 1N6FA 5K19A 4X3EA 3PXTD 4QAMA 3BWSA 5GMKn 4Z7QA 5SXMA 3AL8A 2HU8A 4CY5A 3C99A 2J56H 5EMMB 3SBRA 5E6RA 3VH0A 2P9LC 3J81g 3OKYA 3UR4A 4QT8A 2P9KC 3B7FA 3V4PA 3K6SA 4PBZA 4ES0A 2IWFA 3EI1A 2QC5A 2GC7A 2VDKA 4PNKB 5TF2A 1JV2A 3SBQA 2YMUA 3ZDYA 4FAND 2BBKH 2O9KA 2YNNA 4A0AA 4O3UB 2AH1A 3W15A 4MK0B 5IC7A 3SFZA 5FQDA 4CI2A 1PI6A 1UTCA 4E54A 5HDBA 3ODTA 5FLXg 5C86A 3F3PA 2CO0A 3SVWD 3IJ0A 4L9OA 1UOPA 4O3TB 1JJUB 3MZLA 4PC0A 4GM3A 2HESX 3NIDA 4Z7NA 3A0FA 4UI9R 3VGZA 4DNUA 4A0BB 1NR0A 3DSMA 2EIBA 4ERQA 3EMHA 5I5JA 5GXHA 2IWKA 2AGWA 4XEIC 2OVPB 3O4JA 1SQ9A 3J80g 2VDLA 5E6UA 4L3HD 1VZ2A 3ZDXA 5IGOA 3UVMA 3K71A 4E5ZB 4J73A 1VE6A 4FA4D 2AGYA 1JOFA 3IURA 2XYIA 5HE1B 1E5TA 2H9MA 3N0DA 1JMXB 1GP2B 5EAPA 1FWXA 4J86A 4MMZA 4QL1A 2OJYA 5I5MA 4BCBA 1L0QA 3F3GA 2EIEA 2B5MA 3UKRC 1T2XA 1NEXB 2HKMA 4WK2A 4J87A 2VZ3A 1K8KC 5K1CC 4A0AB 2P9SC 1S4UX 3QI0A 5TEEA 3PE7A 4L1MA 4AN0A 2WQ8A 1OMWB 1GOGA 1E8NA 4O02A 4BP9A 1GOTB 5CXCA 4J0XA 2VC2A 4AX4A 2AH0A 3NIFA 4DNVA 1UOOA 4FAVD 5EARA 3PVUB 2UZYB 2Z2NA 3NVXA 3UVLA 2UZXB 2Z2PA 3AL9A 3IIWA 3EQ9A 4AEZA 4PSWB 1VE7A 5IJ7E 3MUNA 4JD2C 1JTDB 3FGBA 1N6DA 1K32A 3FM0A 1XKSA 2MTAH 1VZ3A 3ZWLB 4D6VA 4O2WA 3K26A 3I7PA 4MMYA 3SMRA 5FKSA 4G55A 5FKQA 4A11B 5CYKB 2PM6B 4BL0A 3SWSD 3JRPA 4HDJA 5TDHB 4J0WA 4GQBB 5FXYA 3RN0D 2GC4A 3U4YA 4GM9A 4GZ8A 3V7DB 5HYNB 4E54B 3JROA 2I0RA 2H47A 2OVRB 3O4IA 3UVNA 4D0KA 2I0SA 1GXRA 4IRZA 5C92A 3UKUC 3RRMC 5KDOB 3I8CA 4PSXB 4G1EA 4GGCA 3KCIA 5CXCB 4IA9A 3OW8A 4J79A 3FCSA 3UVKA 2YNPA 3BG0A 4JSPC 5C9ZB 1YFQA 2B4EA 3I7LA 1PEVA 2PBIB 2OVQB 2HXCA 3PXSD 3NVQA 4U1EI 5M5VA 3I8EA 4JT5C 3ZE2A 1GOHA 2EIDA 5C2VB 1H2YA 4PXWA 3I89A 1I2MB 5EM2A 1R5MA 2H3XA 4FA1D 4RE6A 1RI6A 1MG2A 3T3MA 2XU7A 2P9NC 4GGAA 5FA5B 2BKLA 3OKYB 2P9UC 3EU7A 3EI3A 3IKOA 4L3GD 4J8BA 5AJAA 3DDUA 4JHNA 1U8CA 3EI3B 3AFCA 5A2Qg 3OKWA 2CN3A 3DWLC 2PM9B 2PM7B 2P9PC 1OLZA 1N6EA 3OL2A 4FB1D 4JXMA 3I2NA 3V4VA 5JWZA 3IUMA 4J84A 2IUVA 2CNXA 4JSXC 4N14A 5H1MA 3SBPA 3E0CA 3RMZD 4NC4A 3JZHA 1C9IA 1H2XA 2H6NA 5M61A 3IIYA 3ORVD 2XE4A 1QFMA 2VDPA 5AFU3 4IMMA 1C9LA 3EI2A 3UVOA 5IT9g 1GOFA 4G1MA 3P4FA 3ULEC 2B5NA 3C75H 3SCYA 5M5TA 5H14A 5GXIA 4K3ID 5M5RA 1QFSA 4CY2A 2H14A 4A0BA 2G9AA 3I7NA 4RE5A 1U4CA 4CY1A 3PVWB 3MVDK 4FA5D 3L4MD 3EQ7A 5FKTA 2BCJB 1H2ZA 3EI1B 1SQJA 4O1QD 4A08A 3DXMC 3I7HA 1O6FA 2B5LA 3ZDZA 3DXKC 2IUPA 3RN1D 4EWRA 2HU5A 2IAAA 5H17A 2IUQA 3L4OD 4CY3A 1MG3A 3NVNA 3GD1I 3EWEA 3VI3A 2AGZA 4H5IA 4AMYA 4Z7OA 3CFSB 4CI8A 2QR5A 3V5WB 2HYEA 3SJLD 3IJCA 3FRXA 2AGXA 2GNQA 4A7JA 2I3TA 5HE0B 5CXBA 4A2MA 1K3IA 2CO0C 2YB8B 5THAA 4QQEA 2XL3A 4GGDA 3RLMD 4ERZA 3RFHA 3CIKB 5TEFA 1B9XA 3MUOA 2H13A 3V9FA 3QHYB 2I3SA 4ESGA 4AMZA 4ZOYA 4JSNC 3O4HA 4K3JB 2VZ1A 3BG1A 4GMBA 4I79A 2XL2A 3GC3B 4J78A 2W18A 4PBYA 2P9IC 3IJEA 2HU7A 2G99A 1U2VC 3I7KA 3IUQA 4J81A 4YVDA 5HQGA 3ZE0A 4XYIA 5M5SA 4OWRA 5M5UA 5FFOA 3IUJA 3MMYA 3PSCB 3RFGA 1E8MA 4CI1A 3OF7A 4ERYA 4FWWA 3OKTA 2IURA 1TBGA 2HKRA 2CN2A 4NAAA 4R7AB 3IULA 5FKRA 3OTTA 3HFQA 1PGUA 2H9PA 4GM8A 4X60B 3T3PA 4Y5RD 3VI4A 4X61B 1ERJA 3AH8B 2OIZA 4ZN4A 3PSLA 3K27A 1P22A 2H6KA 3I7OA 2OK6A 4J77A 5IGQA 1BPOA 1TYEA 3C5MA 1JMZB 3EQ8A 5EALA 3SN6B 3JB9L 5EMJB 4QRJA 5EM2B 4KFMB 5HE3B 4A09A 1XHMA 4FA9D 4UM9A 3EI2B 3O4GA 1MDAH 2Q7QA 4OZUA 2HJ4A 2VDMA 5CYKA 4BP8A 4A2LA 1A0RB 4WJKA 2PM9A 4NENA 4ZOXA 3JZNA 2EICA 3JZGA 2EBSA 4WK0A 3K72A 1A12A 4BCDA 5EMLB 4DNWA 5I5IA 3IJ1A 5FFGA 4ZOVA 5CXBB 4D9SA 4A08B 1L5GA 3FCUA 2AQ5A 4WK4A 3NIGA 3IVMA
chains in the Genus database with same CATH topology
3RSEC 4LG8A 4CZVA 2H9LA 2YNOA 4U7AA 4JT6C 1Q47A 4G56B 2HJBA 2OK4A 5C2WB 3EI4A 1VYHC 3MXXA 3N0EA 3SHFA 4E5ZA 4A09B 1XIPA 2YBAA 3KRXB 1QNIA 3GFCA 4TZ4A 4H5JA 2J57G 4BUJC 4LGNA 4Y7RA 1SHYB 5EAMA 3SXTD 2H9NA 3CFVA 2H68A 1TYQC 3C9CA 5AMSA 2Z2OA 3AL8B 4X63B 4GQ1A 4A11A 1B9YA 2AGLA 3PXWD 3SLED 4L1QD 3EG6A 2CE9A 5GSAA 4FHLA 4AOWA 4O45A 2TRCB 4J8GA 3KRWB 4O9DA 5IJ8E 4CI3A 3JAMg 2J55H 2CE8A 4JSVC 2QXVA 4LG9A 3MKSB 2I0TA 3OL2B 3GREA 4NSXA 4CZXA 4GQ2P 2H6QA 3F3FA 5HE2B 4XYHA 3MKQA 5EMKB 4CZYA 3EI4B 4ZOZA 5B4WA 4Z8LA 3DM0A 4BH6A 3JPXA 3MZKA 4J82A 4CC9A 1GG2B 1PBYB 3VA6A 1N6FA 5K19A 4X3EA 3PXTD 3BWSA 5GMKn 5SXMA 3AL8A 4CY5A 3C99A 2J56H 5EMMB 3SBRA 3VH0A 2P9LC 3J81g 3OKYA 3UR4A 4QT8A 2P9KC 3B7FA 4PBZA 4ES0A 2IWFA 3EI1A 2QC5A 2GC7A 4PNKB 3SBQA 2YMUA 4FAND 2BBKH 2O9KA 2YNNA 4A0AA 4O3UB 2AH1A 3W15A 4MK0B 5IC7A 3SFZA 5FQDA 4CI2A 1PI6A 4E54A 3ODTA 5FLXg 3F3PA 2CO0A 3SVWD 3IJ0A 4L9OA 4O3TB 1JJUB 3MZLA 4PC0A 4GM3A 2HESX 3A0FA 4UI9R 3VGZA 4A0BB 1NR0A 3DSMA 4ERQA 3EMHA 5I5JA 5GXHA 4XEIC 2IWKA 2AGWA 2OVPB 1SQ9A 3J80g 4L3HD 5IGOA 3UVMA 4E5ZB 4J73A 4FA4D 2AGYA 1JOFA 2XYIA 5HE1B 2H9MA 3N0DA 1JMXB 1GP2B 5EAPA 1FWXA 4J86A 4QL1A 2OJYA 5I5MA 1L0QA 3F3GA 2B5MA 3UKRC 1NEXB 2HKMA 4J87A 1K8KC 5K1CC 4A0AB 2P9SC 1S4UX 5TEEA 3PE7A 1OMWB 1GOTB 5CXCA 4J0XA 2AH0A 4FAVD 5EARA 3PVUB 2UZYB 2Z2NA 3NVXA 3UVLA 2UZXB 2Z2PA 3AL9A 3IIWA 4AEZA 4PSWB 5IJ7E 4JD2C 3FGBA 1N6DA 1K32A 3FM0A 1XKSA 2MTAH 3ZWLB 4D6VA 3K26A 3I7PA 3SMRA 5FKSA 5FKQA 4A11B 5CYKB 2PM6B 4BL0A 3SWSD 3JRPA 4HDJA 5TDHB 4J0WA 4GQBB 5FXYA 3RN0D 2GC4A 3U4YA 4GM9A 4GZ8A 3V7DB 5HYNB 4E54B 3JROA 2I0RA 2H47A 2OVRB 3UVNA 4D0KA 2I0SA 1GXRA 3UKUC 3RRMC 5KDOB 3I8CA 4PSXB 4GGCA 5CXCB 4IA9A 3OW8A 4J79A 3UVKA 2YNPA 3BG0A 4JSPC 5C9ZB 1YFQA 2B4EA 3I7LA 1PEVA 2PBIB 2OVQB 2HXCA 3NVQA 3PXSD 4U1EI 3I8EA 4JT5C 5C2VB 4PXWA 3I89A 5EM2A 1R5MA 2H3XA 4FA1D 1RI6A 1MG2A 2XU7A 2P9NC 4GGAA 5FA5B 3OKYB 2P9UC 3EU7A 3EI3A 3IKOA 4L3GD 4J8BA 5AJAA 3EI3B 3AFCA 5A2Qg 3OKWA 2CN3A 3DWLC 2PM9B 2PM7B 2P9PC 1OLZA 1N6EA 3OL2A 4FB1D 4JXMA 3I2NA 5JWZA 4J84A 2IUVA 2CNXA 4JSXC 4N14A 5H1MA 3SBPA 3E0CA 3RMZD 3JZHA 2H6NA 3IIYA 3ORVD 5AFU3 4IMMA 3EI2A 3UVOA 5IT9g 3P4FA 3ULEC 2B5NA 3C75H 3SCYA 5H14A 5GXIA 4K3ID 4CY2A 2H14A 4A0BA 2G9AA 3I7NA 1U4CA 4CY1A 3PVWB 4FA5D 3L4MD 5FKTA 2BCJB 3EI1B 1SQJA 4O1QD 4A08A 3DXMC 3I7HA 2B5LA 3DXKC 2IUPA 3RN1D 4EWRA 2IAAA 5H17A 2IUQA 3L4OD 4CY3A 1MG3A 3NVNA 3EWEA 2AGZA 4H5IA 3CFSB 4CI8A 3V5WB 2HYEA 3SJLD 3IJCA 3FRXA 2AGXA 2GNQA 4A7JA 2I3TA 5HE0B 5CXBA 4A2MA 2CO0C 2YB8B 5THAA 4QQEA 2XL3A 4GGDA 3RLMD 4ERZA 3RFHA 3CIKB 5TEFA 1B9XA 3V9FA 2H13A 2I3SA 4ESGA 4ZOYA 4JSNC 4K3JB 3BG1A 4GMBA 4I79A 2XL2A 4J78A 2W18A 4PBYA 2P9IC 3I7KA 2G99A 1U2VC 4J81A 4YVDA 5HQGA 4XYIA 4OWRA 3MMYA 3PSCB 3RFGA 4CI1A 4ERYA 4FWWA 3OKTA 2IURA 1TBGA 2HKRA 2CN2A 4R7AB 5FKRA 3OTTA 3HFQA 1PGUA 2H9PA 4GM8A 4X60B 4Y5RD 4X61B 1ERJA 3AH8B 2OIZA 4ZN4A 3PSLA 3K27A 1P22A 2H6KA 3I7OA 2OK6A 4J77A 5IGQA 3C5MA 1JMZB 5EALA 3SN6B 3JB9L 5EMJB 4QRJA 5EM2B 4KFMB 5HE3B 4A09A 1XHMA 4FA9D 3EI2B 1MDAH 2Q7QA 4OZUA 2HJ4A 5CYKA 4A2LA 1A0RB 2PM9A 4ZOXA 3JZNA 3JZGA 2EBSA 5EMLB 5I5IA 3IJ1A 4ZOVA 5CXBB 4A08B 2AQ5A 5TF2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RSE C;  4LG8 A;  4CZV A;  2H9L A;  2YNO A;  4U7A A;  4JT6 C;  1Q47 A;  4G56 B;  2HJB A;  2OK4 A;  5C2W B;  3EI4 A;  1VYH C;  3MXX A;  3N0E A;  3SHF A;  4E5Z A;  4A09 B;  1XIP A;  2YBA A;  3KRX B;  1QNI A;  3GFC A;  4TZ4 A;  4H5J A;  2J57 G;  4BUJ C;  4LGN A;  4Y7R A;  1SHY B;  5EAM A;  3SXT D;  2H9N A;  3CFV A;  2H68 A;  1TYQ C;  3C9C A;  5AMS A;  2Z2O A;  3AL8 B;  4X63 B;  4GQ1 A;  4A11 A;  1B9Y A;  2AGL A;  3PXW D;  3SLE D;  4L1Q D;  3EG6 A;  2CE9 A;  5GSA A;  4FHL A;  4AOW A;  4O45 A;  2TRC B;  4J8G A;  3KRW B;  4O9D A;  5IJ8 E;  4CI3 A;  3JAM g;  2J55 H;  2CE8 A;  4JSV C;  2QXV A;  4LG9 A;  3MKS B;  2I0T A;  3OL2 B;  3GRE A;  4NSX A;  4CZX A;  4GQ2 P;  2H6Q A;  3F3F A;  5HE2 B;  4XYH A;  3MKQ A;  5EMK B;  4CZY A;  3EI4 B;  4ZOZ A;  5B4W A;  4Z8L A;  3DM0 A;  4BH6 A;  3JPX A;  3MZK A;  4J82 A;  4CC9 A;  1GG2 B;  1PBY B;  3VA6 A;  1N6F A;  5K19 A;  4X3E A;  3PXT D;  3BWS A;  5GMK n;  5SXM A;  3AL8 A;  4CY5 A;  3C99 A;  2J56 H;  5EMM B;  3SBR A;  3VH0 A;  2P9L C;  3J81 g;  3OKY A;  3UR4 A;  4QT8 A;  2P9K C;  3B7F A;  4PBZ A;  4ES0 A;  2IWF A;  3EI1 A;  2QC5 A;  2GC7 A;  4PNK B;  3SBQ A;  2YMU A;  4FAN D;  2BBK H;  2O9K A;  2YNN A;  4A0A A;  4O3U B;  2AH1 A;  3W15 A;  4MK0 B;  5IC7 A;  3SFZ A;  5FQD A;  4CI2 A;  1PI6 A;  4E54 A;  3ODT A;  5FLX g;  3F3P A;  2CO0 A;  3SVW D;  3IJ0 A;  4L9O A;  4O3T B;  1JJU B;  3MZL A;  4PC0 A;  4GM3 A;  2HES X;  3A0F A;  4UI9 R;  3VGZ A;  4A0B B;  1NR0 A;  3DSM A;  4ERQ A;  3EMH A;  5I5J A;  5GXH A;  4XEI C;  2IWK A;  2AGW A;  2OVP B;  1SQ9 A;  3J80 g;  4L3H D;  5IGO A;  3UVM A;  4E5Z B;  4J73 A;  4FA4 D;  2AGY A;  1JOF A;  2XYI A;  5HE1 B;  2H9M A;  3N0D A;  1JMX B;  1GP2 B;  5EAP A;  1FWX A;  4J86 A;  4QL1 A;  2OJY A;  5I5M A;  1L0Q A;  3F3G A;  2B5M A;  3UKR C;  1NEX B;  2HKM A;  4J87 A;  1K8K C;  5K1C C;  4A0A B;  2P9S C;  1S4U X;  5TEE A;  3PE7 A;  1OMW B;  1GOT B;  5CXC A;  4J0X A;  2AH0 A;  4FAV D;  5EAR A;  3PVU B;  2UZY B;  2Z2N A;  3NVX A;  3UVL A;  2UZX B;  2Z2P A;  3AL9 A;  3IIW A;  4AEZ A;  4PSW B;  5IJ7 E;  4JD2 C;  3FGB A;  1N6D A;  1K32 A;  3FM0 A;  1XKS A;  2MTA H;  3ZWL B;  4D6V A;  3K26 A;  3I7P A;  3SMR A;  5FKS A;  5FKQ A;  4A11 B;  5CYK B;  2PM6 B;  4BL0 A;  3SWS D;  3JRP A;  4HDJ A;  5TDH B;  4J0W A;  4GQB B;  5FXY A;  3RN0 D;  2GC4 A;  3U4Y A;  4GM9 A;  4GZ8 A;  3V7D B;  5HYN B;  4E54 B;  3JRO A;  2I0R A;  2H47 A;  2OVR B;  3UVN A;  4D0K A;  2I0S A;  1GXR A;  3UKU C;  3RRM C;  5KDO B;  3I8C A;  4PSX B;  4GGC A;  5CXC B;  4IA9 A;  3OW8 A;  4J79 A;  3UVK A;  2YNP A;  3BG0 A;  4JSP C;  5C9Z B;  1YFQ A;  2B4E A;  3I7L A;  1PEV A;  2PBI B;  2OVQ B;  2HXC A;  3NVQ A;  3PXS D;  4U1E I;  3I8E A;  4JT5 C;  5C2V B;  4PXW A;  3I89 A;  5EM2 A;  1R5M A;  2H3X A;  4FA1 D;  1RI6 A;  1MG2 A;  2XU7 A;  2P9N C;  4GGA A;  5FA5 B;  3OKY B;  2P9U C;  3EU7 A;  3EI3 A;  3IKO A;  4L3G D;  4J8B A;  5AJA A;  3EI3 B;  3AFC A;  5A2Q g;  3OKW A;  2CN3 A;  3DWL C;  2PM9 B;  2PM7 B;  2P9P C;  1OLZ A;  1N6E A;  3OL2 A;  4FB1 D;  4JXM A;  3I2N A;  5JWZ A;  4J84 A;  2IUV A;  2CNX A;  4JSX C;  4N14 A;  5H1M A;  3SBP A;  3E0C A;  3RMZ D;  3JZH A;  2H6N A;  3IIY A;  3ORV D;  5AFU 3;  4IMM A;  3EI2 A;  3UVO A;  5IT9 g;  3P4F A;  3ULE C;  2B5N A;  3C75 H;  3SCY A;  5H14 A;  5GXI A;  4K3I D;  4CY2 A;  2H14 A;  4A0B A;  2G9A A;  3I7N A;  1U4C A;  4CY1 A;  3PVW B;  4FA5 D;  3L4M D;  5FKT A;  2BCJ B;  3EI1 B;  1SQJ A;  4O1Q D;  4A08 A;  3DXM C;  3I7H A;  2B5L A;  3DXK C;  2IUP A;  3RN1 D;  4EWR A;  2IAA A;  5H17 A;  2IUQ A;  3L4O D;  4CY3 A;  1MG3 A;  3NVN A;  3EWE A;  2AGZ A;  4H5I A;  3CFS B;  4CI8 A;  3V5W B;  2HYE A;  3SJL D;  3IJC A;  3FRX A;  2AGX A;  2GNQ A;  4A7J A;  2I3T A;  5HE0 B;  5CXB A;  4A2M A;  2CO0 C;  2YB8 B;  5THA A;  4QQE A;  2XL3 A;  4GGD A;  3RLM D;  4ERZ A;  3RFH A;  3CIK B;  5TEF A;  1B9X A;  3V9F A;  2H13 A;  2I3S A;  4ESG A;  4ZOY A;  4JSN C;  4K3J B;  3BG1 A;  4GMB A;  4I79 A;  2XL2 A;  4J78 A;  2W18 A;  4PBY A;  2P9I C;  3I7K A;  2G99 A;  1U2V C;  4J81 A;  4YVD A;  5HQG A;  4XYI A;  4OWR A;  3MMY A;  3PSC B;  3RFG A;  4CI1 A;  4ERY A;  4FWW A;  3OKT A;  2IUR A;  1TBG A;  2HKR A;  2CN2 A;  4R7A B;  5FKR A;  3OTT A;  3HFQ A;  1PGU A;  2H9P A;  4GM8 A;  4X60 B;  4Y5R D;  4X61 B;  1ERJ A;  3AH8 B;  2OIZ A;  4ZN4 A;  3PSL A;  3K27 A;  1P22 A;  2H6K A;  3I7O A;  2OK6 A;  4J77 A;  5IGQ A;  3C5M A;  1JMZ B;  5EAL A;  3SN6 B;  3JB9 L;  5EMJ B;  4QRJ A;  5EM2 B;  4KFM B;  5HE3 B;  4A09 A;  1XHM A;  4FA9 D;  3EI2 B;  1MDA H;  2Q7Q A;  4OZU A;  2HJ4 A;  5CYK A;  4A2L A;  1A0R B;  2PM9 A;  4ZOX A;  3JZN A;  3JZG A;  2EBS A;  5EML B;  5I5I A;  3IJ1 A;  4ZOV A;  5CXB B;  4A08 B;  2AQ5 A;  5TF2 A; 
#chains in the Genus database with same CATH topology
 5E6S A;  4LG8 A;  3RSE C;  4CZV A;  2H9L A;  2VDO A;  2YNO A;  4U7A A;  4JT6 C;  1Q47 A;  4G56 B;  2HJB A;  2OK4 A;  5C2W B;  3EI4 A;  2QZP A;  1VYH C;  3MXX A;  3N0E A;  3SHF A;  4E5Z A;  1YR2 A;  4A09 B;  1XIP A;  2YBA A;  4JHP C;  4NBM A;  3KRX B;  1QNI A;  1UOQ A;  3GFC A;  4TZ4 A;  4H5J A;  2J57 G;  4BUJ C;  4LGN A;  4Y7R A;  1SHY B;  5EAM A;  3SXT D;  2H9N A;  3CFV A;  2H68 A;  1TYQ C;  3C9C A;  2XDW A;  5AMS A;  2Z2O A;  3IUN A;  3AL8 B;  4X63 B;  4GQ1 A;  4A11 A;  1B9Y A;  2AGL A;  3PXW D;  3SLE D;  4L1Q D;  3EG6 A;  2CE9 A;  5GSA A;  4FHL A;  4AOW A;  1O6G A;  4O45 A;  2TRC B;  4J8G A;  3KRW B;  2JKX A;  4O9D A;  1M1X A;  2VDR A;  5IJ8 E;  4CI3 A;  3JAM g;  2J55 H;  2CE8 A;  4BCC A;  4JSV C;  2QXV A;  4LG9 A;  3MKS B;  2I0T A;  3OL2 B;  3ZE1 A;  3GRE A;  4MMX A;  4NSX A;  4CZX A;  4GQ2 P;  2VDQ A;  2H6Q A;  3F3F A;  5HE2 B;  4XYH A;  4UM8 A;  3MKQ A;  1H2W A;  5EMK B;  4CZY A;  3EI4 B;  4ZOZ A;  2XZG A;  5B4W A;  4Z8L A;  3DM0 A;  4BH6 A;  3JPX A;  3MZK A;  4J82 A;  4CC9 A;  1GG2 B;  1PBY B;  4AN1 A;  3VA6 A;  2VDN A;  1N6F A;  5K19 A;  4X3E A;  3PXT D;  4QAM A;  3BWS A;  5GMK n;  4Z7Q A;  5SXM A;  3AL8 A;  2HU8 A;  4CY5 A;  3C99 A;  2J56 H;  5EMM B;  3SBR A;  5E6R A;  3VH0 A;  2P9L C;  3J81 g;  3OKY A;  3UR4 A;  4QT8 A;  2P9K C;  3B7F A;  3V4P A;  3K6S A;  4PBZ A;  4ES0 A;  2IWF A;  3EI1 A;  2QC5 A;  2GC7 A;  2VDK A;  4PNK B;  5TF2 A;  1JV2 A;  3SBQ A;  2YMU A;  3ZDY A;  4FAN D;  2BBK H;  2O9K A;  2YNN A;  4A0A A;  4O3U B;  2AH1 A;  3W15 A;  4MK0 B;  5IC7 A;  3SFZ A;  5FQD A;  4CI2 A;  1PI6 A;  1UTC A;  4E54 A;  5HDB A;  3ODT A;  5FLX g;  5C86 A;  3F3P A;  2CO0 A;  3SVW D;  3IJ0 A;  4L9O A;  1UOP A;  4O3T B;  1JJU B;  3MZL A;  4PC0 A;  4GM3 A;  2HES X;  3NID A;  4Z7N A;  3A0F A;  4UI9 R;  3VGZ A;  4DNU A;  4A0B B;  1NR0 A;  3DSM A;  2EIB A;  4ERQ A;  3EMH A;  5I5J A;  5GXH A;  2IWK A;  2AGW A;  4XEI C;  2OVP B;  3O4J A;  1SQ9 A;  3J80 g;  2VDL A;  5E6U A;  4L3H D;  1VZ2 A;  3ZDX A;  5IGO A;  3UVM A;  3K71 A;  4E5Z B;  4J73 A;  1VE6 A;  4FA4 D;  2AGY A;  1JOF A;  3IUR A;  2XYI A;  5HE1 B;  1E5T A;  2H9M A;  3N0D A;  1JMX B;  1GP2 B;  5EAP A;  1FWX A;  4J86 A;  4MMZ A;  4QL1 A;  2OJY A;  5I5M A;  4BCB A;  1L0Q A;  3F3G A;  2EIE A;  2B5M A;  3UKR C;  1T2X A;  1NEX B;  2HKM A;  4WK2 A;  4J87 A;  2VZ3 A;  1K8K C;  5K1C C;  4A0A B;  2P9S C;  1S4U X;  3QI0 A;  5TEE A;  3PE7 A;  4L1M A;  4AN0 A;  2WQ8 A;  1OMW B;  1GOG A;  1E8N A;  4O02 A;  4BP9 A;  1GOT B;  5CXC A;  4J0X A;  2VC2 A;  4AX4 A;  2AH0 A;  3NIF A;  4DNV A;  1UOO A;  4FAV D;  5EAR A;  3PVU B;  2UZY B;  2Z2N A;  3NVX A;  3UVL A;  2UZX B;  2Z2P A;  3AL9 A;  3IIW A;  3EQ9 A;  4AEZ A;  4PSW B;  1VE7 A;  5IJ7 E;  3MUN A;  4JD2 C;  1JTD B;  3FGB A;  1N6D A;  1K32 A;  3FM0 A;  1XKS A;  2MTA H;  1VZ3 A;  3ZWL B;  4D6V A;  4O2W A;  3K26 A;  3I7P A;  4MMY A;  3SMR A;  5FKS A;  4G55 A;  5FKQ A;  4A11 B;  5CYK B;  2PM6 B;  4BL0 A;  3SWS D;  3JRP A;  4HDJ A;  5TDH B;  4J0W A;  4GQB B;  5FXY A;  3RN0 D;  2GC4 A;  3U4Y A;  4GM9 A;  4GZ8 A;  3V7D B;  5HYN B;  4E54 B;  3JRO A;  2I0R A;  2H47 A;  2OVR B;  3O4I A;  3UVN A;  4D0K A;  2I0S A;  1GXR A;  4IRZ A;  5C92 A;  3UKU C;  3RRM C;  5KDO B;  3I8C A;  4PSX B;  4G1E A;  4GGC A;  3KCI A;  5CXC B;  4IA9 A;  3OW8 A;  4J79 A;  3FCS A;  3UVK A;  2YNP A;  3BG0 A;  4JSP C;  5C9Z B;  1YFQ A;  2B4E A;  3I7L A;  1PEV A;  2PBI B;  2OVQ B;  2HXC A;  3PXS D;  3NVQ A;  4U1E I;  5M5V A;  3I8E A;  4JT5 C;  3ZE2 A;  1GOH A;  2EID A;  5C2V B;  1H2Y A;  4PXW A;  3I89 A;  1I2M B;  5EM2 A;  1R5M A;  2H3X A;  4FA1 D;  4RE6 A;  1RI6 A;  1MG2 A;  3T3M A;  2XU7 A;  2P9N C;  4GGA A;  5FA5 B;  2BKL A;  3OKY B;  2P9U C;  3EU7 A;  3EI3 A;  3IKO A;  4L3G D;  4J8B A;  5AJA A;  3DDU A;  4JHN A;  1U8C A;  3EI3 B;  3AFC A;  5A2Q g;  3OKW A;  2CN3 A;  3DWL C;  2PM9 B;  2PM7 B;  2P9P C;  1OLZ A;  1N6E A;  3OL2 A;  4FB1 D;  4JXM A;  3I2N A;  3V4V A;  5JWZ A;  3IUM A;  4J84 A;  2IUV A;  2CNX A;  4JSX C;  4N14 A;  5H1M A;  3SBP A;  3E0C A;  3RMZ D;  4NC4 A;  3JZH A;  1C9I A;  1H2X A;  2H6N A;  5M61 A;  3IIY A;  3ORV D;  2XE4 A;  1QFM A;  2VDP A;  5AFU 3;  4IMM A;  1C9L A;  3EI2 A;  3UVO A;  5IT9 g;  1GOF A;  4G1M A;  3P4F A;  3ULE C;  2B5N A;  3C75 H;  3SCY A;  5M5T A;  5H14 A;  5GXI A;  4K3I D;  5M5R A;  1QFS A;  4CY2 A;  2H14 A;  4A0B A;  2G9A A;  3I7N A;  4RE5 A;  1U4C A;  4CY1 A;  3PVW B;  3MVD K;  4FA5 D;  3L4M D;  3EQ7 A;  5FKT A;  2BCJ B;  1H2Z A;  3EI1 B;  1SQJ A;  4O1Q D;  4A08 A;  3DXM C;  3I7H A;  1O6F A;  2B5L A;  3ZDZ A;  3DXK C;  2IUP A;  3RN1 D;  4EWR A;  2HU5 A;  2IAA A;  5H17 A;  2IUQ A;  3L4O D;  4CY3 A;  1MG3 A;  3NVN A;  3GD1 I;  3EWE A;  3VI3 A;  2AGZ A;  4H5I A;  4AMY A;  4Z7O A;  3CFS B;  4CI8 A;  2QR5 A;  3V5W B;  2HYE A;  3SJL D;  3IJC A;  3FRX A;  2AGX A;  2GNQ A;  4A7J A;  2I3T A;  5HE0 B;  5CXB A;  4A2M A;  1K3I A;  2CO0 C;  2YB8 B;  5THA A;  4QQE A;  2XL3 A;  4GGD A;  3RLM D;  4ERZ A;  3RFH A;  3CIK B;  5TEF A;  1B9X A;  3MUO A;  2H13 A;  3V9F A;  3QHY B;  2I3S A;  4ESG A;  4AMZ A;  4ZOY A;  4JSN C;  3O4H A;  4K3J B;  2VZ1 A;  3BG1 A;  4GMB A;  4I79 A;  2XL2 A;  3GC3 B;  4J78 A;  2W18 A;  4PBY A;  2P9I C;  3IJE A;  2HU7 A;  2G99 A;  1U2V C;  3I7K A;  3IUQ A;  4J81 A;  4YVD A;  5HQG A;  3ZE0 A;  4XYI A;  5M5S A;  4OWR A;  5M5U A;  5FFO A;  3IUJ A;  3MMY A;  3PSC B;  3RFG A;  1E8M A;  4CI1 A;  3OF7 A;  4ERY A;  4FWW A;  3OKT A;  2IUR A;  1TBG A;  2HKR A;  2CN2 A;  4NAA A;  4R7A B;  3IUL A;  5FKR A;  3OTT A;  3HFQ A;  1PGU A;  2H9P A;  4GM8 A;  4X60 B;  3T3P A;  4Y5R D;  3VI4 A;  4X61 B;  1ERJ A;  3AH8 B;  2OIZ A;  4ZN4 A;  3PSL A;  3K27 A;  1P22 A;  2H6K A;  3I7O A;  2OK6 A;  4J77 A;  5IGQ A;  1BPO A;  1TYE A;  3C5M A;  1JMZ B;  3EQ8 A;  5EAL A;  3SN6 B;  3JB9 L;  5EMJ B;  4QRJ A;  5EM2 B;  4KFM B;  5HE3 B;  4A09 A;  1XHM A;  4FA9 D;  4UM9 A;  3EI2 B;  3O4G A;  1MDA H;  2Q7Q A;  4OZU A;  2HJ4 A;  2VDM A;  5CYK A;  4BP8 A;  4A2L A;  1A0R B;  4WJK A;  2PM9 A;  4NEN A;  4ZOX A;  3JZN A;  2EIC A;  3JZG A;  2EBS A;  4WK0 A;  3K72 A;  1A12 A;  4BCD A;  5EML B;  4DNW A;  5I5I A;  3IJ1 A;  5FFG A;  4ZOV A;  5CXB B;  4D9S A;  4A08 B;  1L5G A;  3FCU A;  2AQ5 A;  4WK4 A;  3NIG A;  3IVM A; 
#chains in the Genus database with same CATH homology
 3RSE C;  4LG8 A;  4CZV A;  2H9L A;  2YNO A;  4U7A A;  4JT6 C;  1Q47 A;  4G56 B;  2HJB A;  2OK4 A;  5C2W B;  3EI4 A;  1VYH C;  3MXX A;  3N0E A;  3SHF A;  4E5Z A;  4A09 B;  1XIP A;  2YBA A;  3KRX B;  1QNI A;  3GFC A;  4TZ4 A;  4H5J A;  2J57 G;  4BUJ C;  4LGN A;  4Y7R A;  1SHY B;  5EAM A;  3SXT D;  2H9N A;  3CFV A;  2H68 A;  1TYQ C;  3C9C A;  5AMS A;  2Z2O A;  3AL8 B;  4X63 B;  4GQ1 A;  4A11 A;  1B9Y A;  2AGL A;  3PXW D;  3SLE D;  4L1Q D;  3EG6 A;  2CE9 A;  5GSA A;  4FHL A;  4AOW A;  4O45 A;  2TRC B;  4J8G A;  3KRW B;  4O9D A;  5IJ8 E;  4CI3 A;  3JAM g;  2J55 H;  2CE8 A;  4JSV C;  2QXV A;  4LG9 A;  3MKS B;  2I0T A;  3OL2 B;  3GRE A;  4NSX A;  4CZX A;  4GQ2 P;  2H6Q A;  3F3F A;  5HE2 B;  4XYH A;  3MKQ A;  5EMK B;  4CZY A;  3EI4 B;  4ZOZ A;  5B4W A;  4Z8L A;  3DM0 A;  4BH6 A;  3JPX A;  3MZK A;  4J82 A;  4CC9 A;  1GG2 B;  1PBY B;  3VA6 A;  1N6F A;  5K19 A;  4X3E A;  3PXT D;  3BWS A;  5GMK n;  5SXM A;  3AL8 A;  4CY5 A;  3C99 A;  2J56 H;  5EMM B;  3SBR A;  3VH0 A;  2P9L C;  3J81 g;  3OKY A;  3UR4 A;  4QT8 A;  2P9K C;  3B7F A;  4PBZ A;  4ES0 A;  2IWF A;  3EI1 A;  2QC5 A;  2GC7 A;  4PNK B;  3SBQ A;  2YMU A;  4FAN D;  2BBK H;  2O9K A;  2YNN A;  4A0A A;  4O3U B;  2AH1 A;  3W15 A;  4MK0 B;  5IC7 A;  3SFZ A;  5FQD A;  4CI2 A;  1PI6 A;  4E54 A;  3ODT A;  5FLX g;  3F3P A;  2CO0 A;  3SVW D;  3IJ0 A;  4L9O A;  4O3T B;  1JJU B;  3MZL A;  4PC0 A;  4GM3 A;  2HES X;  3A0F A;  4UI9 R;  3VGZ A;  4A0B B;  1NR0 A;  3DSM A;  4ERQ A;  3EMH A;  5I5J A;  5GXH A;  4XEI C;  2IWK A;  2AGW A;  2OVP B;  1SQ9 A;  3J80 g;  4L3H D;  5IGO A;  3UVM A;  4E5Z B;  4J73 A;  4FA4 D;  2AGY A;  1JOF A;  2XYI A;  5HE1 B;  2H9M A;  3N0D A;  1JMX B;  1GP2 B;  5EAP A;  1FWX A;  4J86 A;  4QL1 A;  2OJY A;  5I5M A;  1L0Q A;  3F3G A;  2B5M A;  3UKR C;  1NEX B;  2HKM A;  4J87 A;  1K8K C;  5K1C C;  4A0A B;  2P9S C;  1S4U X;  5TEE A;  3PE7 A;  1OMW B;  1GOT B;  5CXC A;  4J0X A;  2AH0 A;  4FAV D;  5EAR A;  3PVU B;  2UZY B;  2Z2N A;  3NVX A;  3UVL A;  2UZX B;  2Z2P A;  3AL9 A;  3IIW A;  4AEZ A;  4PSW B;  5IJ7 E;  4JD2 C;  3FGB A;  1N6D A;  1K32 A;  3FM0 A;  1XKS A;  2MTA H;  3ZWL B;  4D6V A;  3K26 A;  3I7P A;  3SMR A;  5FKS A;  5FKQ A;  4A11 B;  5CYK B;  2PM6 B;  4BL0 A;  3SWS D;  3JRP A;  4HDJ A;  5TDH B;  4J0W A;  4GQB B;  5FXY A;  3RN0 D;  2GC4 A;  3U4Y A;  4GM9 A;  4GZ8 A;  3V7D B;  5HYN B;  4E54 B;  3JRO A;  2I0R A;  2H47 A;  2OVR B;  3UVN A;  4D0K A;  2I0S A;  1GXR A;  3UKU C;  3RRM C;  5KDO B;  3I8C A;  4PSX B;  4GGC A;  5CXC B;  4IA9 A;  3OW8 A;  4J79 A;  3UVK A;  2YNP A;  3BG0 A;  4JSP C;  5C9Z B;  1YFQ A;  2B4E A;  3I7L A;  1PEV A;  2PBI B;  2OVQ B;  2HXC A;  3NVQ A;  3PXS D;  4U1E I;  3I8E A;  4JT5 C;  5C2V B;  4PXW A;  3I89 A;  5EM2 A;  1R5M A;  2H3X A;  4FA1 D;  1RI6 A;  1MG2 A;  2XU7 A;  2P9N C;  4GGA A;  5FA5 B;  3OKY B;  2P9U C;  3EU7 A;  3EI3 A;  3IKO A;  4L3G D;  4J8B A;  5AJA A;  3EI3 B;  3AFC A;  5A2Q g;  3OKW A;  2CN3 A;  3DWL C;  2PM9 B;  2PM7 B;  2P9P C;  1OLZ A;  1N6E A;  3OL2 A;  4FB1 D;  4JXM A;  3I2N A;  5JWZ A;  4J84 A;  2IUV A;  2CNX A;  4JSX C;  4N14 A;  5H1M A;  3SBP A;  3E0C A;  3RMZ D;  3JZH A;  2H6N A;  3IIY A;  3ORV D;  5AFU 3;  4IMM A;  3EI2 A;  3UVO A;  5IT9 g;  3P4F A;  3ULE C;  2B5N A;  3C75 H;  3SCY A;  5H14 A;  5GXI A;  4K3I D;  4CY2 A;  2H14 A;  4A0B A;  2G9A A;  3I7N A;  1U4C A;  4CY1 A;  3PVW B;  4FA5 D;  3L4M D;  5FKT A;  2BCJ B;  3EI1 B;  1SQJ A;  4O1Q D;  4A08 A;  3DXM C;  3I7H A;  2B5L A;  3DXK C;  2IUP A;  3RN1 D;  4EWR A;  2IAA A;  5H17 A;  2IUQ A;  3L4O D;  4CY3 A;  1MG3 A;  3NVN A;  3EWE A;  2AGZ A;  4H5I A;  3CFS B;  4CI8 A;  3V5W B;  2HYE A;  3SJL D;  3IJC A;  3FRX A;  2AGX A;  2GNQ A;  4A7J A;  2I3T A;  5HE0 B;  5CXB A;  4A2M A;  2CO0 C;  2YB8 B;  5THA A;  4QQE A;  2XL3 A;  4GGD A;  3RLM D;  4ERZ A;  3RFH A;  3CIK B;  5TEF A;  1B9X A;  3V9F A;  2H13 A;  2I3S A;  4ESG A;  4ZOY A;  4JSN C;  4K3J B;  3BG1 A;  4GMB A;  4I79 A;  2XL2 A;  4J78 A;  2W18 A;  4PBY A;  2P9I C;  3I7K A;  2G99 A;  1U2V C;  4J81 A;  4YVD A;  5HQG A;  4XYI A;  4OWR A;  3MMY A;  3PSC B;  3RFG A;  4CI1 A;  4ERY A;  4FWW A;  3OKT A;  2IUR A;  1TBG A;  2HKR A;  2CN2 A;  4R7A B;  5FKR A;  3OTT A;  3HFQ A;  1PGU A;  2H9P A;  4GM8 A;  4X60 B;  4Y5R D;  4X61 B;  1ERJ A;  3AH8 B;  2OIZ A;  4ZN4 A;  3PSL A;  3K27 A;  1P22 A;  2H6K A;  3I7O A;  2OK6 A;  4J77 A;  5IGQ A;  3C5M A;  1JMZ B;  5EAL A;  3SN6 B;  3JB9 L;  5EMJ B;  4QRJ A;  5EM2 B;  4KFM B;  5HE3 B;  4A09 A;  1XHM A;  4FA9 D;  3EI2 B;  1MDA H;  2Q7Q A;  4OZU A;  2HJ4 A;  5CYK A;  4A2L A;  1A0R B;  2PM9 A;  4ZOX A;  3JZN A;  3JZG A;  2EBS A;  5EML B;  5I5I A;  3IJ1 A;  4ZOV A;  5CXB B;  4A08 B;  2AQ5 A;  5TF2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...