2AGLA

Crystal structure of the phenylhydrazine adduct of aromatic amine dehydrogenase from alcaligenes faecalis
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
360
structure length
360
Chain Sequence
REVLTGGHSVSAPQENRIYVMDSVFMHLTESRVHVYDYTNGKFLGMVPTAFNGHVQVSNDGKKIYTMTTYHERITRGKRSDVVEVWDADKLTFEKEISLPPKRVQGLNYDGLFRQTTDGKFIVLQNASPATSIGIVDVAKGDYVEDVTAAAGCWSVIPQPNRPRSFMTICGDGGLLTINLGEDGKVASQSRSKQMFSVKDDPIFIAPALDKDKAHFVSYYGNVYSADFSGDEVKVDGPWSLLNDEDKAKNWVPGGYNLVGLHRASGRMYVFMHPDGKEGTHKFPAAEIWVMDTKTKQRVARIPGRDALSMTIDQQRNLMLTLDGGNVNVYDISQPEPKLLRTIEGAAEASLQVQFHPVGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aromatic amine dehydrogenase
publication title Atomic description of an enzyme reaction dominated by proton tunneling
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 97
structure length 360
sequence length 360
chains with identical sequence B
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2005-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2aglA01
3MMYA 3I8EA 4XYHA 4J79A 5TEFA 4E54A 1N6EA 4JSXC 3SMRA 2HKMA 2HJBA 5AFU3 2H47A 2QC5A 3AL8B 4D6VA 3RRMC 3A0FA 2MTAH 2AQ5A 2OVPB 5EARA 5FKRA 2UZYB 2B5NA 5HE3B 5I5IA 3OKTA 4ZOYA 2Q7QA 2YMUA 2J57G 2H68A 4CY2A 3UR4A 2EBSA 2Z2PA 1SQJA 3AFCA 1GG2B 4MK0B 4A0BB 2I3SA 2YBAA 4AEZA 3OL2A 5IGOA 1NEXB 4LG8A 5HE1B 1JOFA 4LG9A 4A11B 3EI1A 4UI9R 3SN6B 3W15A 4O1QD 2I0TA 4FAVD 2I0RA 2IWKA 1A0RB 3UKRC 1S4UX 1JMXB 3AL8A 2GC7A 4YVDA 5H17A 5H14A 3MZKA 3IKOA 4FAND 4L9OA 4L3HD 3I7OA 3KRXB 4J8BA 2CE8A 3EI4B 4FA1D 5CXBB 5I5MA 3I7HA 2CN2A 4PC0A 2AGXA 3B7FA 3VA6A 1K8KC 3RFHA 2Z2OA 4JT5C 3RSEC 2PBIB 4JT6C 4O3TB 4E5ZB 4A0BA 4GGCA 1U4CA 3IJ1A 1JMZB 1QNIA 4IA9A 5EAPA 2BCJB 4Z8LA 2P9SC 1RI6A 4JSVC 3JZHA 2PM7B 4GM9A 2PM9A 5K19A 4FWWA 1TYQC 4JSPC 1Q47A 2H9LA 1OMWB 3SBPA 3L4OD 4CI8A 2P9PC 1PI6A 3V9FA 1MDAH 3UVNA 2HXCA 2J55H 1MG3A 2XYIA 3CIKB 5FKTA 3I7NA 5GXHA 4AOWA 5CYKB 3NVXA 3VGZA 4CY3A 2B4EA 5EALA 3SWSD 5SXMA 1ERJA 5K1CC 5EMJB 4GQ1A 4JSNC 3PXSD 5IC7A 4CY1A 5C2WB 4J78A 1R5MA 5KDOB 4A09A 3OL2B 2HKRA 3K27A 5AMSA 3RLMD 2UZXB 3MKQA 4ERZA 2XL2A 4O3UB 3EI1B 2OK6A 1SHYB 2YB8B 3J80g 4FHLA 3PVWB 3I7KA 3IJCA 3VH0A 3CFVA 5CYKA 3AH8B 4NSXA 3ZWLB 4KFMB 1K32A 1MG2A 4OZUA 5FKSA 1B9YA 1NR0A 3ULEC 2H13A 3EG6A 3J81g 1N6FA 2G99A 3JPXA 2AGYA 3RN0D 1P22A 3AL9A 4H5IA 4O9DA 2YNPA 2P9UC 3KRWB 4A2LA 4CZXA 5EAMA 3RFGA 4CZVA 2P9IC 2AH1A 2PM9B 3C5MA 3SXTD 3UKUC 5B4WA 2B5LA 2CE9A 2QXVA 1N6DA 3CFSB 3ODTA 5FXYA 1JJUB 3OTTA 5EMMB 2CO0C 4BH6A 2IWFA 5IGQA 4U1EI 4X3EA 3EWEA 4XEIC 4X61B 3SHFA 5H1MA 4H5JA 4I79A 3JROA 4HDJA 4PSWB 2H9NA 3OKYA 3I7PA 4ESGA 4ERQA 3C75H 4ZOZA 3UVKA 1VYHC 5FLXg 4PNKB 4CI1A 2J56H 1PGUA 5IJ8E 3N0EA 5IT9g 4J0WA 5JWZA 5EMKB 4PBYA 4BUJC 4QT8A 4J82A 2BBKH 2P9LC 4GM3A 4A09B 2AGWA 4J81A 5FQDA 3GFCA 4JD2C 3SVWD 2CNXA 4K3JB 3L4MD 3FM0A 3V5WB 4J73A 4FA5D 3F3GA 3MZLA 4CI3A 1XHMA 4GQ2P 4GZ8A 4J87A 3IIYA 3FGBA 2I0SA 1XKSA 3E0CA 3V7DB 2GNQA 5IJ7E 4QQEA 4D0KA 4X60B 3DWLC 3SFZA 4J0XA 3EMHA 2AH0A 3IIWA 4CC9A 4OWRA 3BG0A 3I89A 3ORVD 5CXCB 5C9ZB 2GC4A 3PSCB 3HFQA 3UVOA 4QRJA 5THAA 3SLED 1OLZA 2W18A 3DSMA 2OVQB 1PBYB 4A08A 4J84A 3F3PA 3SCYA 3IJ0A 4LGNA 2IURA 4K3ID 3C99A 4GM8A 2IUQA 4FB1D 2O9KA 2I3TA 4TZ4A 5GMKn 4PXWA 2H6QA 2HESX 3PSLA 4Y7RA 3OKWA 4L3GD 2TRCB 5EM2B 3C9CA 4ERYA 3MXXA 2OVRB 5HQGA 5CXCA 3SJLD 1GP2B 3OKYB 2IUVA 4L1QD 5GSAA 3JZNA 2P9KC 3DXMC 2H6KA 3N0DA 5AJAA 5GXIA 2H9PA 5FA5B 4A2MA 1SQ9A 1GXRA 4CI2A 3MKSB 3I8CA 3FRXA 2OJYA 1YFQA 4ZOVA 1L0QA 3UVMA 3JAMg 2AGLA 5I5JA 3PXTD 4BL0A 4N14A 1GOTB 1B9XA 4Y5RD 3SBQA 4FA9D 5EM2A 5HE0B 4U7AA 3PVUB 2H9MA 5EMLB 5TDHB 5FKQA 4J86A 4QL1A 5C2VB 3PE7A 3NVQA 1TBGA 3F3FA 2CN3A 3JRPA 4CY5A 3SBRA 3NVNA 5A2Qg 3UVLA 2OIZA 2B5MA 3EI2B 4IMMA 3DM0A 3I7LA 3GREA 2XU7A 4A7JA 3K26A 3BWSA 2H3XA 4ZN4A 4A0AB 4GQBB 4ES0A 4O45A 4A08B 2Z2NA 1XIPA 3RMZD 3DXKC 5TF2A 2PM6B 4G56B 2H14A 4A11A 5TEEA 3EI3B 4J8GA 3RN1D 4EWRA 2HJ4A 2G9AA 4FA4D 4J77A 4PBZA 4E54B 3EI2A 5HE2B 2P9NC 3P4FA 3EI4A 5CXBA 1U2VC 3JB9L 2HYEA 2IAAA 3EU7A 4R7AB 4CZYA 2YNNA 3JZGA 1FWXA 2IUPA 3I2NA 4A0AA 4JXMA 4E5ZA 4GGAA 2OK4A 3PXWD 5HYNB 2XL3A 2H6NA 2YNOA 4XYIA 4GGDA 3EI3A 3U4YA 4ZOXA 3BG1A 3OW8A 4PSXB 1PEVA 4X63B 2AGZA 2CO0A 4GMBA
chains in the Genus database with same CATH superfamily
3MMYA 3I8EA 1H2YA 4XYHA 4J79A 5TEFA 4E54A 1N6EA 4JSXC 3FCSA 3SMRA 2HKMA 3ZE0A 2HJBA 5AFU3 2H47A 2QC5A 2VDMA 3QI0A 5HDBA 3AL8B 3OF7A 4D6VA 3RRMC 3A0FA 2MTAH 2EIEA 3IUJA 3O4GA 3NIGA 2AQ5A 2OVPB 5EARA 5FKRA 2UZYB 2B5NA 4MMXA 5HE3B 5I5IA 3OKTA 3EQ8A 4ZOYA 2Q7QA 2HU7A 2J57G 2YMUA 2H68A 4CY2A 3UR4A 3ZDXA 1VZ2A 2EBSA 2Z2PA 1SQJA 3AFCA 1GG2B 3IVMA 3K72A 4MK0B 2I3SA 2YBAA 4AEZA 3OL2A 4A0BB 5IGOA 1NEXB 1GOHA 4LG8A 3IURA 5HE1B 1JOFA 4LG9A 4A11B 3EI1A 4UI9R 3SN6B 3W15A 4O1QD 2I0TA 4FAVD 2I0RA 2IWKA 3K6SA 1A0RB 3UKRC 1S4UX 3KCIA 1JMXB 3AL8A 2GC7A 4YVDA 3DDUA 5H17A 5H14A 3MZKA 3IKOA 4AN1A 4FAND 4L9OA 4L3HD 3O4IA 3I7OA 3KRXB 4J8BA 1YR2A 2CE8A 3EI4B 4FA1D 4G1MA 5CXBB 5I5MA 3I7HA 2CN2A 4PC0A 2AGXA 3B7FA 3VA6A 1K8KC 3RFHA 4WK0A 2Z2OA 4JT5C 3RSEC 2PBIB 2HU8A 4JT6C 4O3TB 5M5VA 4E5ZB 4A0BA 2VDNA 4GGCA 1U4CA 3IJ1A 1JMZB 1QNIA 4IA9A 3IUNA 5EAPA 4Z7QA 2BCJB 4Z8LA 2VZ1A 4WK4A 4WK2A 2EIDA 2P9SC 1RI6A 4JSVC 3JZHA 2PM7B 4GM9A 1JTDB 2PM9A 5K19A 4FWWA 1TYQC 4JSPC 1Q47A 2H9LA 1OMWB 3SBPA 3L4OD 4O2WA 4CI8A 2P9PC 1PI6A 3V9FA 3MUNA 1JV2A 1MDAH 3UVNA 2HXCA 3T3PA 2J55H 1MG3A 3IUMA 2XYIA 3CIKB 5FKTA 3I7NA 5GXHA 4AOWA 5CYKB 1VZ3A 3IULA 3NVXA 3VGZA 4CY3A 4Z7OA 2B4EA 5EALA 3SWSD 4AN0A 5SXMA 1ERJA 5K1CC 5EMJB 4GQ1A 4JSNC 5C86A 4MMZA 3PXSD 5IC7A 1E8NA 4CY1A 5C2WB 5FFGA 4J78A 1R5MA 5KDOB 4A09A 3OL2B 2HKRA 3V4PA 3K27A 2VDRA 3QHYB 5AMSA 3RLMD 2UZXB 2VDOA 3MKQA 2XL2A 4ERZA 5M5TA 4O3UB 3EI1B 2OK6A 1O6GA 1SHYB 2YB8B 3J80g 4FHLA 3PVWB 3I7KA 3IJCA 3VH0A 3CFVA 5CYKA 3AH8B 4NSXA 3ZWLB 4KFMB 1K32A 1MG2A 2VDLA 2VDKA 4OZUA 1H2XA 5FKSA 4AX4A 1B9YA 1UOOA 1NR0A 3ULEC 2H13A 3EG6A 3J81g 1N6FA 2G99A 3JPXA 2AGYA 3RN0D 1P22A 3AL9A 4H5IA 4O9DA 3FCUA 2YNPA 2P9UC 4QAMA 3KRWB 2EICA 4A2LA 4CZXA 5EAMA 3RFGA 5E6RA 4CZVA 3ZDZA 2P9IC 2AH1A 2PM9B 4L1MA 3C5MA 1VE6A 3SXTD 3UKUC 5B4WA 4JHPC 2B5LA 2CE9A 2QXVA 1N6DA 3CFSB 3ODTA 5FXYA 1JJUB 3OTTA 5EMMB 2CO0C 4BH6A 2IWFA 5IGQA 4U1EI 4X3EA 3EWEA 4XEIC 4X61B 3SHFA 2QZPA 1I2MB 4H5JA 5H1MA 4I79A 3JROA 4HDJA 4PSWB 2H9NA 3OKYA 3I7PA 4BP9A 4ESGA 4ERQA 3C75H 5C92A 4ZOZA 3UVKA 2QR5A 1VYHC 5FLXg 4PNKB 5E6SA 5FFOA 5M5RA 4CI1A 2J56H 1PGUA 1E8MA 3N0EA 5IJ8E 5IT9g 4J0WA 5JWZA 3IUQA 1GOGA 3GD1I 4IRZA 1M1XA 5EMKB 4PBYA 4BUJC 4QT8A 4J82A 2BBKH 2P9LC 2VC2A 4GM3A 4A09B 2AGWA 4J81A 2HU5A 5FQDA 3GFCA 4JD2C 3SVWD 4JHNA 1U8CA 2CNXA 4UM9A 4K3JB 3L4MD 3FM0A 3V5WB 3IJEA 4J73A 3ZE1A 4FA5D 4NAAA 1A12A 3F3GA 3MZLA 4CI3A 1XHMA 4GQ2P 4GZ8A 4J87A 3IIYA 3FGBA 4UM8A 2I0SA 1XKSA 3E0CA 3V7DB 2GNQA 5IJ7E 4QQEA 4D0KA 4X60B 3DWLC 3SFZA 4BP8A 4J0XA 1H2WA 2EIBA 3EMHA 3ZE2A 2AH0A 3IIWA 4CC9A 5M5SA 1UOQA 1K3IA 3BG0A 3I89A 3ORVD 4OWRA 5CXCB 5C9ZB 2GC4A 3PSCB 2XE4A 3HFQA 3UVOA 4QRJA 5THAA 1C9LA 2VZ3A 4NENA 1H2ZA 4RE5A 4AMYA 1QFMA 3SLED 1OLZA 2W18A 3DSMA 2OVQB 1PBYB 4A08A 4J84A 3F3PA 4BCCA 3SCYA 4DNVA 3IJ0A 1L5GA 4LGNA 3NIDA 2IURA 4K3ID 3C99A 4GM8A 2IUQA 4FB1D 2O9KA 4NC4A 2XDWA 2I3TA 4TZ4A 5GMKn 4PXWA 2H6QA 2HESX 3PSLA 4Y7RA 3OKWA 4L3GD 4D9SA 2TRCB 5EM2B 3C9CA 4ERYA 3MXXA 4WJKA 2OVRB 5HQGA 5CXCA 3SJLD 1GP2B 3OKYB 4NBMA 2IUVA 4L1QD 5GSAA 3JZNA 2P9KC 3DXMC 2H6KA 3N0DA 3O4HA 5AJAA 5GXIA 4MMYA 2H9PA 5FA5B 4A2MA 3NIFA 2VDPA 1SQ9A 1GXRA 4CI2A 3MKSB 2WQ8A 3I8CA 3FRXA 2OJYA 1YFQA 4ZOVA 1L0QA 3UVMA 3EQ9A 1TYEA 3JAMg 2AGLA 5I5JA 3PXTD 1UOPA 4BL0A 4N14A 1GOTB 1B9XA 4Y5RD 3SBQA 4FA9D 2JKXA 5EM2A 5HE0B 4U7AA 3PVUB 2H9MA 5EMLB 4BCDA 5TDHB 5FKQA 4J86A 4QL1A 5C2VB 1E5TA 1QFSA 3PE7A 3NVQA 1TBGA 4AMZA 3F3FA 2CN3A 3JRPA 4CY5A 3SBRA 5M5UA 3NVNA 5A2Qg 4DNWA 3UVLA 2OIZA 2B5MA 3EI2B 4BCBA 4O02A 4IMMA 3V4VA 3DM0A 3I7LA 2BKLA 1C9IA 3GREA 4RE6A 2XU7A 4A7JA 3K26A 3BWSA 2H3XA 4ZN4A 4A0AB 3GC3B 4G55A 4GQBB 4ES0A 4O45A 3MVDK 2Z2NA 1T2XA 4DNUA 4A08B 1XIPA 3RMZD 3DXKC 4Z7NA 5TF2A 2PM6B 4G56B 1BPOA 2H14A 4A11A 5TEEA 3EI3B 4J8GA 3RN1D 2VDQA 4EWRA 2HJ4A 3O4JA 3ZDYA 2G9AA 4FA4D 3EQ7A 3VI4A 3K71A 4J77A 3T3MA 4PBZA 5E6UA 4E54B 3EI2A 5HE2B 2P9NC 3P4FA 3EI4A 3MUOA 5CXBA 1U2VC 3VI3A 3JB9L 2HYEA 2IAAA 3EU7A 4R7AB 4CZYA 4G1EA 2YNNA 3JZGA 1FWXA 2IUPA 3I2NA 4A0AA 5M61A 1UTCA 4JXMA 4E5ZA 4GGAA 2OK4A 3PXWD 5HYNB 2XL3A 2H6NA 1VE7A 2YNOA 4XYIA 4GGDA 3EI3A 3U4YA 4ZOXA 1GOFA 3BG1A 3OW8A 4PSXB 1PEVA 1O6FA 2XZGA 4X63B 2AGZA 2CO0A 4GMBA
chains in the Genus database with same CATH topology
3MMYA 3I8EA 4XYHA 4J79A 5TEFA 4E54A 1N6EA 4JSXC 3SMRA 2HKMA 2HJBA 5AFU3 2H47A 2QC5A 3AL8B 4D6VA 3RRMC 3A0FA 2MTAH 2AQ5A 2OVPB 5EARA 5FKRA 2UZYB 2B5NA 5HE3B 5I5IA 3OKTA 4ZOYA 2Q7QA 2YMUA 2J57G 2H68A 4CY2A 3UR4A 2EBSA 2Z2PA 1SQJA 3AFCA 1GG2B 4MK0B 4A0BB 2I3SA 2YBAA 4AEZA 3OL2A 5IGOA 1NEXB 4LG8A 5HE1B 1JOFA 4LG9A 4A11B 3EI1A 4UI9R 3SN6B 3W15A 4O1QD 2I0TA 4FAVD 2I0RA 2IWKA 1A0RB 3UKRC 1S4UX 1JMXB 3AL8A 2GC7A 4YVDA 5H17A 5H14A 3MZKA 3IKOA 4FAND 4L9OA 4L3HD 3I7OA 3KRXB 4J8BA 2CE8A 3EI4B 4FA1D 5CXBB 5I5MA 3I7HA 2CN2A 4PC0A 2AGXA 3B7FA 3VA6A 1K8KC 3RFHA 2Z2OA 4JT5C 3RSEC 2PBIB 4JT6C 4O3TB 4E5ZB 4A0BA 4GGCA 1U4CA 3IJ1A 1JMZB 1QNIA 4IA9A 5EAPA 2BCJB 4Z8LA 2P9SC 1RI6A 4JSVC 3JZHA 2PM7B 4GM9A 2PM9A 5K19A 4FWWA 1TYQC 4JSPC 1Q47A 2H9LA 1OMWB 3SBPA 3L4OD 4CI8A 2P9PC 1PI6A 3V9FA 1MDAH 3UVNA 2HXCA 2J55H 1MG3A 2XYIA 3CIKB 5FKTA 3I7NA 5GXHA 4AOWA 5CYKB 3NVXA 3VGZA 4CY3A 2B4EA 5EALA 3SWSD 5SXMA 1ERJA 5K1CC 5EMJB 4GQ1A 4JSNC 3PXSD 5IC7A 4CY1A 5C2WB 4J78A 1R5MA 5KDOB 4A09A 3OL2B 2HKRA 3K27A 5AMSA 3RLMD 2UZXB 3MKQA 4ERZA 2XL2A 4O3UB 3EI1B 2OK6A 1SHYB 2YB8B 3J80g 4FHLA 3PVWB 3I7KA 3IJCA 3VH0A 3CFVA 5CYKA 3AH8B 4NSXA 3ZWLB 4KFMB 1K32A 1MG2A 4OZUA 5FKSA 1B9YA 1NR0A 3ULEC 2H13A 3EG6A 3J81g 1N6FA 2G99A 3JPXA 2AGYA 3RN0D 1P22A 3AL9A 4H5IA 4O9DA 2YNPA 2P9UC 3KRWB 4A2LA 4CZXA 5EAMA 3RFGA 4CZVA 2P9IC 2AH1A 2PM9B 3C5MA 3SXTD 3UKUC 5B4WA 2B5LA 2CE9A 2QXVA 1N6DA 3CFSB 3ODTA 5FXYA 1JJUB 3OTTA 5EMMB 2CO0C 4BH6A 2IWFA 5IGQA 4U1EI 4X3EA 3EWEA 4XEIC 4X61B 3SHFA 5H1MA 4H5JA 4I79A 3JROA 4HDJA 4PSWB 2H9NA 3OKYA 3I7PA 4ESGA 4ERQA 3C75H 4ZOZA 3UVKA 1VYHC 5FLXg 4PNKB 4CI1A 2J56H 1PGUA 5IJ8E 3N0EA 5IT9g 4J0WA 5JWZA 5EMKB 4PBYA 4BUJC 4QT8A 4J82A 2BBKH 2P9LC 4GM3A 4A09B 2AGWA 4J81A 5FQDA 3GFCA 4JD2C 3SVWD 2CNXA 4K3JB 3L4MD 3FM0A 3V5WB 4J73A 4FA5D 3F3GA 3MZLA 4CI3A 1XHMA 4GQ2P 4GZ8A 4J87A 3IIYA 3FGBA 2I0SA 1XKSA 3E0CA 3V7DB 2GNQA 5IJ7E 4QQEA 4D0KA 4X60B 3DWLC 3SFZA 4J0XA 3EMHA 2AH0A 3IIWA 4CC9A 4OWRA 3BG0A 3I89A 3ORVD 5CXCB 5C9ZB 2GC4A 3PSCB 3HFQA 3UVOA 4QRJA 5THAA 3SLED 1OLZA 2W18A 3DSMA 2OVQB 1PBYB 4A08A 4J84A 3F3PA 3SCYA 3IJ0A 4LGNA 2IURA 4K3ID 3C99A 4GM8A 2IUQA 4FB1D 2O9KA 2I3TA 4TZ4A 5GMKn 4PXWA 2H6QA 2HESX 3PSLA 4Y7RA 3OKWA 4L3GD 2TRCB 5EM2B 3C9CA 4ERYA 3MXXA 2OVRB 5HQGA 5CXCA 3SJLD 1GP2B 3OKYB 2IUVA 4L1QD 5GSAA 3JZNA 2P9KC 3DXMC 2H6KA 3N0DA 5AJAA 5GXIA 2H9PA 5FA5B 4A2MA 1SQ9A 1GXRA 4CI2A 3MKSB 3I8CA 3FRXA 2OJYA 1YFQA 4ZOVA 1L0QA 3UVMA 3JAMg 2AGLA 5I5JA 3PXTD 4BL0A 4N14A 1GOTB 1B9XA 4Y5RD 3SBQA 4FA9D 5EM2A 5HE0B 4U7AA 3PVUB 2H9MA 5EMLB 5TDHB 5FKQA 4J86A 4QL1A 5C2VB 3PE7A 3NVQA 1TBGA 3F3FA 2CN3A 3JRPA 4CY5A 3SBRA 3NVNA 5A2Qg 3UVLA 2OIZA 2B5MA 3EI2B 4IMMA 3DM0A 3I7LA 3GREA 2XU7A 4A7JA 3K26A 3BWSA 2H3XA 4ZN4A 4A0AB 4GQBB 4ES0A 4O45A 4A08B 2Z2NA 1XIPA 3RMZD 3DXKC 5TF2A 2PM6B 4G56B 2H14A 4A11A 5TEEA 3EI3B 4J8GA 3RN1D 4EWRA 2HJ4A 2G9AA 4FA4D 4J77A 4PBZA 4E54B 3EI2A 5HE2B 2P9NC 3P4FA 3EI4A 5CXBA 1U2VC 3JB9L 2HYEA 2IAAA 3EU7A 4R7AB 4CZYA 2YNNA 3JZGA 1FWXA 2IUPA 3I2NA 4A0AA 4JXMA 4E5ZA 4GGAA 2OK4A 3PXWD 5HYNB 2XL3A 2H6NA 2YNOA 4XYIA 4GGDA 3EI3A 3U4YA 4ZOXA 3BG1A 3OW8A 4PSXB 1PEVA 4X63B 2AGZA 2CO0A 4GMBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MMY A;  3I8E A;  4XYH A;  4J79 A;  5TEF A;  4E54 A;  1N6E A;  4JSX C;  3SMR A;  2HKM A;  2HJB A;  5AFU 3;  2H47 A;  2QC5 A;  3AL8 B;  4D6V A;  3RRM C;  3A0F A;  2MTA H;  2AQ5 A;  2OVP B;  5EAR A;  5FKR A;  2UZY B;  2B5N A;  5HE3 B;  5I5I A;  3OKT A;  4ZOY A;  2Q7Q A;  2YMU A;  2J57 G;  2H68 A;  4CY2 A;  3UR4 A;  2EBS A;  2Z2P A;  1SQJ A;  3AFC A;  1GG2 B;  4MK0 B;  4A0B B;  2I3S A;  2YBA A;  4AEZ A;  3OL2 A;  5IGO A;  1NEX B;  4LG8 A;  5HE1 B;  1JOF A;  4LG9 A;  4A11 B;  3EI1 A;  4UI9 R;  3SN6 B;  3W15 A;  4O1Q D;  2I0T A;  4FAV D;  2I0R A;  2IWK A;  1A0R B;  3UKR C;  1S4U X;  1JMX B;  3AL8 A;  2GC7 A;  4YVD A;  5H17 A;  5H14 A;  3MZK A;  3IKO A;  4FAN D;  4L9O A;  4L3H D;  3I7O A;  3KRX B;  4J8B A;  2CE8 A;  3EI4 B;  4FA1 D;  5CXB B;  5I5M A;  3I7H A;  2CN2 A;  4PC0 A;  2AGX A;  3B7F A;  3VA6 A;  1K8K C;  3RFH A;  2Z2O A;  4JT5 C;  3RSE C;  2PBI B;  4JT6 C;  4O3T B;  4E5Z B;  4A0B A;  4GGC A;  1U4C A;  3IJ1 A;  1JMZ B;  1QNI A;  4IA9 A;  5EAP A;  2BCJ B;  4Z8L A;  2P9S C;  1RI6 A;  4JSV C;  3JZH A;  2PM7 B;  4GM9 A;  2PM9 A;  5K19 A;  4FWW A;  1TYQ C;  4JSP C;  1Q47 A;  2H9L A;  1OMW B;  3SBP A;  3L4O D;  4CI8 A;  2P9P C;  1PI6 A;  3V9F A;  1MDA H;  3UVN A;  2HXC A;  2J55 H;  1MG3 A;  2XYI A;  3CIK B;  5FKT A;  3I7N A;  5GXH A;  4AOW A;  5CYK B;  3NVX A;  3VGZ A;  4CY3 A;  2B4E A;  5EAL A;  3SWS D;  5SXM A;  1ERJ A;  5K1C C;  5EMJ B;  4GQ1 A;  4JSN C;  3PXS D;  5IC7 A;  4CY1 A;  5C2W B;  4J78 A;  1R5M A;  5KDO B;  4A09 A;  3OL2 B;  2HKR A;  3K27 A;  5AMS A;  3RLM D;  2UZX B;  3MKQ A;  4ERZ A;  2XL2 A;  4O3U B;  3EI1 B;  2OK6 A;  1SHY B;  2YB8 B;  3J80 g;  4FHL A;  3PVW B;  3I7K A;  3IJC A;  3VH0 A;  3CFV A;  5CYK A;  3AH8 B;  4NSX A;  3ZWL B;  4KFM B;  1K32 A;  1MG2 A;  4OZU A;  5FKS A;  1B9Y A;  1NR0 A;  3ULE C;  2H13 A;  3EG6 A;  3J81 g;  1N6F A;  2G99 A;  3JPX A;  2AGY A;  3RN0 D;  1P22 A;  3AL9 A;  4H5I A;  4O9D A;  2YNP A;  2P9U C;  3KRW B;  4A2L A;  4CZX A;  5EAM A;  3RFG A;  4CZV A;  2P9I C;  2AH1 A;  2PM9 B;  3C5M A;  3SXT D;  3UKU C;  5B4W A;  2B5L A;  2CE9 A;  2QXV A;  1N6D A;  3CFS B;  3ODT A;  5FXY A;  1JJU B;  3OTT A;  5EMM B;  2CO0 C;  4BH6 A;  2IWF A;  5IGQ A;  4U1E I;  4X3E A;  3EWE A;  4XEI C;  4X61 B;  3SHF A;  5H1M A;  4H5J A;  4I79 A;  3JRO A;  4HDJ A;  4PSW B;  2H9N A;  3OKY A;  3I7P A;  4ESG A;  4ERQ A;  3C75 H;  4ZOZ A;  3UVK A;  1VYH C;  5FLX g;  4PNK B;  4CI1 A;  2J56 H;  1PGU A;  5IJ8 E;  3N0E A;  5IT9 g;  4J0W A;  5JWZ A;  5EMK B;  4PBY A;  4BUJ C;  4QT8 A;  4J82 A;  2BBK H;  2P9L C;  4GM3 A;  4A09 B;  2AGW A;  4J81 A;  5FQD A;  3GFC A;  4JD2 C;  3SVW D;  2CNX A;  4K3J B;  3L4M D;  3FM0 A;  3V5W B;  4J73 A;  4FA5 D;  3F3G A;  3MZL A;  4CI3 A;  1XHM A;  4GQ2 P;  4GZ8 A;  4J87 A;  3IIY A;  3FGB A;  2I0S A;  1XKS A;  3E0C A;  3V7D B;  2GNQ A;  5IJ7 E;  4QQE A;  4D0K A;  4X60 B;  3DWL C;  3SFZ A;  4J0X A;  3EMH A;  2AH0 A;  3IIW A;  4CC9 A;  4OWR A;  3BG0 A;  3I89 A;  3ORV D;  5CXC B;  5C9Z B;  2GC4 A;  3PSC B;  3HFQ A;  3UVO A;  4QRJ A;  5THA A;  3SLE D;  1OLZ A;  2W18 A;  3DSM A;  2OVQ B;  1PBY B;  4A08 A;  4J84 A;  3F3P A;  3SCY A;  3IJ0 A;  4LGN A;  2IUR A;  4K3I D;  3C99 A;  4GM8 A;  2IUQ A;  4FB1 D;  2O9K A;  2I3T A;  4TZ4 A;  5GMK n;  4PXW A;  2H6Q A;  2HES X;  3PSL A;  4Y7R A;  3OKW A;  4L3G D;  2TRC B;  5EM2 B;  3C9C A;  4ERY A;  3MXX A;  2OVR B;  5HQG A;  5CXC A;  3SJL D;  1GP2 B;  3OKY B;  2IUV A;  4L1Q D;  5GSA A;  3JZN A;  2P9K C;  3DXM C;  2H6K A;  3N0D A;  5AJA A;  5GXI A;  2H9P A;  5FA5 B;  4A2M A;  1SQ9 A;  1GXR A;  4CI2 A;  3MKS B;  3I8C A;  3FRX A;  2OJY A;  1YFQ A;  4ZOV A;  1L0Q A;  3UVM A;  3JAM g;  2AGL A;  5I5J A;  3PXT D;  4BL0 A;  4N14 A;  1GOT B;  1B9X A;  4Y5R D;  3SBQ A;  4FA9 D;  5EM2 A;  5HE0 B;  4U7A A;  3PVU B;  2H9M A;  5EML B;  5TDH B;  5FKQ A;  4J86 A;  4QL1 A;  5C2V B;  3PE7 A;  3NVQ A;  1TBG A;  3F3F A;  2CN3 A;  3JRP A;  4CY5 A;  3SBR A;  3NVN A;  5A2Q g;  3UVL A;  2OIZ A;  2B5M A;  3EI2 B;  4IMM A;  3DM0 A;  3I7L A;  3GRE A;  2XU7 A;  4A7J A;  3K26 A;  3BWS A;  2H3X A;  4ZN4 A;  4A0A B;  4GQB B;  4ES0 A;  4O45 A;  4A08 B;  2Z2N A;  1XIP A;  3RMZ D;  3DXK C;  5TF2 A;  2PM6 B;  4G56 B;  2H14 A;  4A11 A;  5TEE A;  3EI3 B;  4J8G A;  3RN1 D;  4EWR A;  2HJ4 A;  2G9A A;  4FA4 D;  4J77 A;  4PBZ A;  4E54 B;  3EI2 A;  5HE2 B;  2P9N C;  3P4F A;  3EI4 A;  5CXB A;  1U2V C;  3JB9 L;  2HYE A;  2IAA A;  3EU7 A;  4R7A B;  4CZY A;  2YNN A;  3JZG A;  1FWX A;  2IUP A;  3I2N A;  4A0A A;  4JXM A;  4E5Z A;  4GGA A;  2OK4 A;  3PXW D;  5HYN B;  2XL3 A;  2H6N A;  2YNO A;  4XYI A;  4GGD A;  3EI3 A;  3U4Y A;  4ZOX A;  3BG1 A;  3OW8 A;  4PSX B;  1PEV A;  4X63 B;  2AGZ A;  2CO0 A;  4GMB A; 
#chains in the Genus database with same CATH topology
 3MMY A;  3I8E A;  1H2Y A;  4XYH A;  4J79 A;  5TEF A;  4E54 A;  1N6E A;  4JSX C;  3FCS A;  3SMR A;  2HKM A;  3ZE0 A;  2HJB A;  5AFU 3;  2H47 A;  2QC5 A;  2VDM A;  3QI0 A;  5HDB A;  3AL8 B;  3OF7 A;  4D6V A;  3RRM C;  3A0F A;  2MTA H;  2EIE A;  3IUJ A;  3O4G A;  3NIG A;  2AQ5 A;  2OVP B;  5EAR A;  5FKR A;  2UZY B;  2B5N A;  4MMX A;  5HE3 B;  5I5I A;  3OKT A;  3EQ8 A;  4ZOY A;  2Q7Q A;  2HU7 A;  2J57 G;  2YMU A;  2H68 A;  4CY2 A;  3UR4 A;  3ZDX A;  1VZ2 A;  2EBS A;  2Z2P A;  1SQJ A;  3AFC A;  1GG2 B;  3IVM A;  3K72 A;  4MK0 B;  2I3S A;  2YBA A;  4AEZ A;  3OL2 A;  4A0B B;  5IGO A;  1NEX B;  1GOH A;  4LG8 A;  3IUR A;  5HE1 B;  1JOF A;  4LG9 A;  4A11 B;  3EI1 A;  4UI9 R;  3SN6 B;  3W15 A;  4O1Q D;  2I0T A;  4FAV D;  2I0R A;  2IWK A;  3K6S A;  1A0R B;  3UKR C;  1S4U X;  3KCI A;  1JMX B;  3AL8 A;  2GC7 A;  4YVD A;  3DDU A;  5H17 A;  5H14 A;  3MZK A;  3IKO A;  4AN1 A;  4FAN D;  4L9O A;  4L3H D;  3O4I A;  3I7O A;  3KRX B;  4J8B A;  1YR2 A;  2CE8 A;  3EI4 B;  4FA1 D;  4G1M A;  5CXB B;  5I5M A;  3I7H A;  2CN2 A;  4PC0 A;  2AGX A;  3B7F A;  3VA6 A;  1K8K C;  3RFH A;  4WK0 A;  2Z2O A;  4JT5 C;  3RSE C;  2PBI B;  2HU8 A;  4JT6 C;  4O3T B;  5M5V A;  4E5Z B;  4A0B A;  2VDN A;  4GGC A;  1U4C A;  3IJ1 A;  1JMZ B;  1QNI A;  4IA9 A;  3IUN A;  5EAP A;  4Z7Q A;  2BCJ B;  4Z8L A;  2VZ1 A;  4WK4 A;  4WK2 A;  2EID A;  2P9S C;  1RI6 A;  4JSV C;  3JZH A;  2PM7 B;  4GM9 A;  1JTD B;  2PM9 A;  5K19 A;  4FWW A;  1TYQ C;  4JSP C;  1Q47 A;  2H9L A;  1OMW B;  3SBP A;  3L4O D;  4O2W A;  4CI8 A;  2P9P C;  1PI6 A;  3V9F A;  3MUN A;  1JV2 A;  1MDA H;  3UVN A;  2HXC A;  3T3P A;  2J55 H;  1MG3 A;  3IUM A;  2XYI A;  3CIK B;  5FKT A;  3I7N A;  5GXH A;  4AOW A;  5CYK B;  1VZ3 A;  3IUL A;  3NVX A;  3VGZ A;  4CY3 A;  4Z7O A;  2B4E A;  5EAL A;  3SWS D;  4AN0 A;  5SXM A;  1ERJ A;  5K1C C;  5EMJ B;  4GQ1 A;  4JSN C;  5C86 A;  4MMZ A;  3PXS D;  5IC7 A;  1E8N A;  4CY1 A;  5C2W B;  5FFG A;  4J78 A;  1R5M A;  5KDO B;  4A09 A;  3OL2 B;  2HKR A;  3V4P A;  3K27 A;  2VDR A;  3QHY B;  5AMS A;  3RLM D;  2UZX B;  2VDO A;  3MKQ A;  2XL2 A;  4ERZ A;  5M5T A;  4O3U B;  3EI1 B;  2OK6 A;  1O6G A;  1SHY B;  2YB8 B;  3J80 g;  4FHL A;  3PVW B;  3I7K A;  3IJC A;  3VH0 A;  3CFV A;  5CYK A;  3AH8 B;  4NSX A;  3ZWL B;  4KFM B;  1K32 A;  1MG2 A;  2VDL A;  2VDK A;  4OZU A;  1H2X A;  5FKS A;  4AX4 A;  1B9Y A;  1UOO A;  1NR0 A;  3ULE C;  2H13 A;  3EG6 A;  3J81 g;  1N6F A;  2G99 A;  3JPX A;  2AGY A;  3RN0 D;  1P22 A;  3AL9 A;  4H5I A;  4O9D A;  3FCU A;  2YNP A;  2P9U C;  4QAM A;  3KRW B;  2EIC A;  4A2L A;  4CZX A;  5EAM A;  3RFG A;  5E6R A;  4CZV A;  3ZDZ A;  2P9I C;  2AH1 A;  2PM9 B;  4L1M A;  3C5M A;  1VE6 A;  3SXT D;  3UKU C;  5B4W A;  4JHP C;  2B5L A;  2CE9 A;  2QXV A;  1N6D A;  3CFS B;  3ODT A;  5FXY A;  1JJU B;  3OTT A;  5EMM B;  2CO0 C;  4BH6 A;  2IWF A;  5IGQ A;  4U1E I;  4X3E A;  3EWE A;  4XEI C;  4X61 B;  3SHF A;  2QZP A;  1I2M B;  4H5J A;  5H1M A;  4I79 A;  3JRO A;  4HDJ A;  4PSW B;  2H9N A;  3OKY A;  3I7P A;  4BP9 A;  4ESG A;  4ERQ A;  3C75 H;  5C92 A;  4ZOZ A;  3UVK A;  2QR5 A;  1VYH C;  5FLX g;  4PNK B;  5E6S A;  5FFO A;  5M5R A;  4CI1 A;  2J56 H;  1PGU A;  1E8M A;  3N0E A;  5IJ8 E;  5IT9 g;  4J0W A;  5JWZ A;  3IUQ A;  1GOG A;  3GD1 I;  4IRZ A;  1M1X A;  5EMK B;  4PBY A;  4BUJ C;  4QT8 A;  4J82 A;  2BBK H;  2P9L C;  2VC2 A;  4GM3 A;  4A09 B;  2AGW A;  4J81 A;  2HU5 A;  5FQD A;  3GFC A;  4JD2 C;  3SVW D;  4JHN A;  1U8C A;  2CNX A;  4UM9 A;  4K3J B;  3L4M D;  3FM0 A;  3V5W B;  3IJE A;  4J73 A;  3ZE1 A;  4FA5 D;  4NAA A;  1A12 A;  3F3G A;  3MZL A;  4CI3 A;  1XHM A;  4GQ2 P;  4GZ8 A;  4J87 A;  3IIY A;  3FGB A;  4UM8 A;  2I0S A;  1XKS A;  3E0C A;  3V7D B;  2GNQ A;  5IJ7 E;  4QQE A;  4D0K A;  4X60 B;  3DWL C;  3SFZ A;  4BP8 A;  4J0X A;  1H2W A;  2EIB A;  3EMH A;  3ZE2 A;  2AH0 A;  3IIW A;  4CC9 A;  5M5S A;  1UOQ A;  1K3I A;  3BG0 A;  3I89 A;  3ORV D;  4OWR A;  5CXC B;  5C9Z B;  2GC4 A;  3PSC B;  2XE4 A;  3HFQ A;  3UVO A;  4QRJ A;  5THA A;  1C9L A;  2VZ3 A;  4NEN A;  1H2Z A;  4RE5 A;  4AMY A;  1QFM A;  3SLE D;  1OLZ A;  2W18 A;  3DSM A;  2OVQ B;  1PBY B;  4A08 A;  4J84 A;  3F3P A;  4BCC A;  3SCY A;  4DNV A;  3IJ0 A;  1L5G A;  4LGN A;  3NID A;  2IUR A;  4K3I D;  3C99 A;  4GM8 A;  2IUQ A;  4FB1 D;  2O9K A;  4NC4 A;  2XDW A;  2I3T A;  4TZ4 A;  5GMK n;  4PXW A;  2H6Q A;  2HES X;  3PSL A;  4Y7R A;  3OKW A;  4L3G D;  4D9S A;  2TRC B;  5EM2 B;  3C9C A;  4ERY A;  3MXX A;  4WJK A;  2OVR B;  5HQG A;  5CXC A;  3SJL D;  1GP2 B;  3OKY B;  4NBM A;  2IUV A;  4L1Q D;  5GSA A;  3JZN A;  2P9K C;  3DXM C;  2H6K A;  3N0D A;  3O4H A;  5AJA A;  5GXI A;  4MMY A;  2H9P A;  5FA5 B;  4A2M A;  3NIF A;  2VDP A;  1SQ9 A;  1GXR A;  4CI2 A;  3MKS B;  2WQ8 A;  3I8C A;  3FRX A;  2OJY A;  1YFQ A;  4ZOV A;  1L0Q A;  3UVM A;  3EQ9 A;  1TYE A;  3JAM g;  2AGL A;  5I5J A;  3PXT D;  1UOP A;  4BL0 A;  4N14 A;  1GOT B;  1B9X A;  4Y5R D;  3SBQ A;  4FA9 D;  2JKX A;  5EM2 A;  5HE0 B;  4U7A A;  3PVU B;  2H9M A;  5EML B;  4BCD A;  5TDH B;  5FKQ A;  4J86 A;  4QL1 A;  5C2V B;  1E5T A;  1QFS A;  3PE7 A;  3NVQ A;  1TBG A;  4AMZ A;  3F3F A;  2CN3 A;  3JRP A;  4CY5 A;  3SBR A;  5M5U A;  3NVN A;  5A2Q g;  4DNW A;  3UVL A;  2OIZ A;  2B5M A;  3EI2 B;  4BCB A;  4O02 A;  4IMM A;  3V4V A;  3DM0 A;  3I7L A;  2BKL A;  1C9I A;  3GRE A;  4RE6 A;  2XU7 A;  4A7J A;  3K26 A;  3BWS A;  2H3X A;  4ZN4 A;  4A0A B;  3GC3 B;  4G55 A;  4GQB B;  4ES0 A;  4O45 A;  3MVD K;  2Z2N A;  1T2X A;  4DNU A;  4A08 B;  1XIP A;  3RMZ D;  3DXK C;  4Z7N A;  5TF2 A;  2PM6 B;  4G56 B;  1BPO A;  2H14 A;  4A11 A;  5TEE A;  3EI3 B;  4J8G A;  3RN1 D;  2VDQ A;  4EWR A;  2HJ4 A;  3O4J A;  3ZDY A;  2G9A A;  4FA4 D;  3EQ7 A;  3VI4 A;  3K71 A;  4J77 A;  3T3M A;  4PBZ A;  5E6U A;  4E54 B;  3EI2 A;  5HE2 B;  2P9N C;  3P4F A;  3EI4 A;  3MUO A;  5CXB A;  1U2V C;  3VI3 A;  3JB9 L;  2HYE A;  2IAA A;  3EU7 A;  4R7A B;  4CZY A;  4G1E A;  2YNN A;  3JZG A;  1FWX A;  2IUP A;  3I2N A;  4A0A A;  5M61 A;  1UTC A;  4JXM A;  4E5Z A;  4GGA A;  2OK4 A;  3PXW D;  5HYN B;  2XL3 A;  2H6N A;  1VE7 A;  2YNO A;  4XYI A;  4GGD A;  3EI3 A;  3U4Y A;  4ZOX A;  1GOF A;  3BG1 A;  3OW8 A;  4PSX B;  1PEV A;  1O6F A;  2XZG A;  4X63 B;  2AGZ A;  2CO0 A;  4GMB A; 
#chains in the Genus database with same CATH homology
 3MMY A;  3I8E A;  4XYH A;  4J79 A;  5TEF A;  4E54 A;  1N6E A;  4JSX C;  3SMR A;  2HKM A;  2HJB A;  5AFU 3;  2H47 A;  2QC5 A;  3AL8 B;  4D6V A;  3RRM C;  3A0F A;  2MTA H;  2AQ5 A;  2OVP B;  5EAR A;  5FKR A;  2UZY B;  2B5N A;  5HE3 B;  5I5I A;  3OKT A;  4ZOY A;  2Q7Q A;  2YMU A;  2J57 G;  2H68 A;  4CY2 A;  3UR4 A;  2EBS A;  2Z2P A;  1SQJ A;  3AFC A;  1GG2 B;  4MK0 B;  4A0B B;  2I3S A;  2YBA A;  4AEZ A;  3OL2 A;  5IGO A;  1NEX B;  4LG8 A;  5HE1 B;  1JOF A;  4LG9 A;  4A11 B;  3EI1 A;  4UI9 R;  3SN6 B;  3W15 A;  4O1Q D;  2I0T A;  4FAV D;  2I0R A;  2IWK A;  1A0R B;  3UKR C;  1S4U X;  1JMX B;  3AL8 A;  2GC7 A;  4YVD A;  5H17 A;  5H14 A;  3MZK A;  3IKO A;  4FAN D;  4L9O A;  4L3H D;  3I7O A;  3KRX B;  4J8B A;  2CE8 A;  3EI4 B;  4FA1 D;  5CXB B;  5I5M A;  3I7H A;  2CN2 A;  4PC0 A;  2AGX A;  3B7F A;  3VA6 A;  1K8K C;  3RFH A;  2Z2O A;  4JT5 C;  3RSE C;  2PBI B;  4JT6 C;  4O3T B;  4E5Z B;  4A0B A;  4GGC A;  1U4C A;  3IJ1 A;  1JMZ B;  1QNI A;  4IA9 A;  5EAP A;  2BCJ B;  4Z8L A;  2P9S C;  1RI6 A;  4JSV C;  3JZH A;  2PM7 B;  4GM9 A;  2PM9 A;  5K19 A;  4FWW A;  1TYQ C;  4JSP C;  1Q47 A;  2H9L A;  1OMW B;  3SBP A;  3L4O D;  4CI8 A;  2P9P C;  1PI6 A;  3V9F A;  1MDA H;  3UVN A;  2HXC A;  2J55 H;  1MG3 A;  2XYI A;  3CIK B;  5FKT A;  3I7N A;  5GXH A;  4AOW A;  5CYK B;  3NVX A;  3VGZ A;  4CY3 A;  2B4E A;  5EAL A;  3SWS D;  5SXM A;  1ERJ A;  5K1C C;  5EMJ B;  4GQ1 A;  4JSN C;  3PXS D;  5IC7 A;  4CY1 A;  5C2W B;  4J78 A;  1R5M A;  5KDO B;  4A09 A;  3OL2 B;  2HKR A;  3K27 A;  5AMS A;  3RLM D;  2UZX B;  3MKQ A;  4ERZ A;  2XL2 A;  4O3U B;  3EI1 B;  2OK6 A;  1SHY B;  2YB8 B;  3J80 g;  4FHL A;  3PVW B;  3I7K A;  3IJC A;  3VH0 A;  3CFV A;  5CYK A;  3AH8 B;  4NSX A;  3ZWL B;  4KFM B;  1K32 A;  1MG2 A;  4OZU A;  5FKS A;  1B9Y A;  1NR0 A;  3ULE C;  2H13 A;  3EG6 A;  3J81 g;  1N6F A;  2G99 A;  3JPX A;  2AGY A;  3RN0 D;  1P22 A;  3AL9 A;  4H5I A;  4O9D A;  2YNP A;  2P9U C;  3KRW B;  4A2L A;  4CZX A;  5EAM A;  3RFG A;  4CZV A;  2P9I C;  2AH1 A;  2PM9 B;  3C5M A;  3SXT D;  3UKU C;  5B4W A;  2B5L A;  2CE9 A;  2QXV A;  1N6D A;  3CFS B;  3ODT A;  5FXY A;  1JJU B;  3OTT A;  5EMM B;  2CO0 C;  4BH6 A;  2IWF A;  5IGQ A;  4U1E I;  4X3E A;  3EWE A;  4XEI C;  4X61 B;  3SHF A;  5H1M A;  4H5J A;  4I79 A;  3JRO A;  4HDJ A;  4PSW B;  2H9N A;  3OKY A;  3I7P A;  4ESG A;  4ERQ A;  3C75 H;  4ZOZ A;  3UVK A;  1VYH C;  5FLX g;  4PNK B;  4CI1 A;  2J56 H;  1PGU A;  5IJ8 E;  3N0E A;  5IT9 g;  4J0W A;  5JWZ A;  5EMK B;  4PBY A;  4BUJ C;  4QT8 A;  4J82 A;  2BBK H;  2P9L C;  4GM3 A;  4A09 B;  2AGW A;  4J81 A;  5FQD A;  3GFC A;  4JD2 C;  3SVW D;  2CNX A;  4K3J B;  3L4M D;  3FM0 A;  3V5W B;  4J73 A;  4FA5 D;  3F3G A;  3MZL A;  4CI3 A;  1XHM A;  4GQ2 P;  4GZ8 A;  4J87 A;  3IIY A;  3FGB A;  2I0S A;  1XKS A;  3E0C A;  3V7D B;  2GNQ A;  5IJ7 E;  4QQE A;  4D0K A;  4X60 B;  3DWL C;  3SFZ A;  4J0X A;  3EMH A;  2AH0 A;  3IIW A;  4CC9 A;  4OWR A;  3BG0 A;  3I89 A;  3ORV D;  5CXC B;  5C9Z B;  2GC4 A;  3PSC B;  3HFQ A;  3UVO A;  4QRJ A;  5THA A;  3SLE D;  1OLZ A;  2W18 A;  3DSM A;  2OVQ B;  1PBY B;  4A08 A;  4J84 A;  3F3P A;  3SCY A;  3IJ0 A;  4LGN A;  2IUR A;  4K3I D;  3C99 A;  4GM8 A;  2IUQ A;  4FB1 D;  2O9K A;  2I3T A;  4TZ4 A;  5GMK n;  4PXW A;  2H6Q A;  2HES X;  3PSL A;  4Y7R A;  3OKW A;  4L3G D;  2TRC B;  5EM2 B;  3C9C A;  4ERY A;  3MXX A;  2OVR B;  5HQG A;  5CXC A;  3SJL D;  1GP2 B;  3OKY B;  2IUV A;  4L1Q D;  5GSA A;  3JZN A;  2P9K C;  3DXM C;  2H6K A;  3N0D A;  5AJA A;  5GXI A;  2H9P A;  5FA5 B;  4A2M A;  1SQ9 A;  1GXR A;  4CI2 A;  3MKS B;  3I8C A;  3FRX A;  2OJY A;  1YFQ A;  4ZOV A;  1L0Q A;  3UVM A;  3JAM g;  2AGL A;  5I5J A;  3PXT D;  4BL0 A;  4N14 A;  1GOT B;  1B9X A;  4Y5R D;  3SBQ A;  4FA9 D;  5EM2 A;  5HE0 B;  4U7A A;  3PVU B;  2H9M A;  5EML B;  5TDH B;  5FKQ A;  4J86 A;  4QL1 A;  5C2V B;  3PE7 A;  3NVQ A;  1TBG A;  3F3F A;  2CN3 A;  3JRP A;  4CY5 A;  3SBR A;  3NVN A;  5A2Q g;  3UVL A;  2OIZ A;  2B5M A;  3EI2 B;  4IMM A;  3DM0 A;  3I7L A;  3GRE A;  2XU7 A;  4A7J A;  3K26 A;  3BWS A;  2H3X A;  4ZN4 A;  4A0A B;  4GQB B;  4ES0 A;  4O45 A;  4A08 B;  2Z2N A;  1XIP A;  3RMZ D;  3DXK C;  5TF2 A;  2PM6 B;  4G56 B;  2H14 A;  4A11 A;  5TEE A;  3EI3 B;  4J8G A;  3RN1 D;  4EWR A;  2HJ4 A;  2G9A A;  4FA4 D;  4J77 A;  4PBZ A;  4E54 B;  3EI2 A;  5HE2 B;  2P9N C;  3P4F A;  3EI4 A;  5CXB A;  1U2V C;  3JB9 L;  2HYE A;  2IAA A;  3EU7 A;  4R7A B;  4CZY A;  2YNN A;  3JZG A;  1FWX A;  2IUP A;  3I2N A;  4A0A A;  4JXM A;  4E5Z A;  4GGA A;  2OK4 A;  3PXW D;  5HYN B;  2XL3 A;  2H6N A;  2YNO A;  4XYI A;  4GGD A;  3EI3 A;  3U4Y A;  4ZOX A;  3BG1 A;  3OW8 A;  4PSX B;  1PEV A;  4X63 B;  2AGZ A;  2CO0 A;  4GMB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...