2AGLA

Crystal structure of the phenylhydrazine adduct of aromatic amine dehydrogenase from alcaligenes faecalis
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
360
structure length
360
Chain Sequence
REVLTGGHSVSAPQENRIYVMDSVFMHLTESRVHVYDYTNGKFLGMVPTAFNGHVQVSNDGKKIYTMTTYHERITRGKRSDVVEVWDADKLTFEKEISLPPKRVQGLNYDGLFRQTTDGKFIVLQNASPATSIGIVDVAKGDYVEDVTAAAGCWSVIPQPNRPRSFMTICGDGGLLTINLGEDGKVASQSRSKQMFSVKDDPIFIAPALDKDKAHFVSYYGNVYSADFSGDEVKVDGPWSLLNDEDKAKNWVPGGYNLVGLHRASGRMYVFMHPDGKEGTHKFPAAEIWVMDTKTKQRVARIPGRDALSMTIDQQRNLMLTLDGGNVNVYDISQPEPKLLRTIEGAAEASLQVQFHPVGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aromatic amine dehydrogenase
publication title Atomic description of an enzyme reaction dominated by proton tunneling
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 97
structure length 360
sequence length 360
chains with identical sequence B
ec nomenclature ec 1.4.9.2: Aralkylamine dehydrogenase (azurin).
pdb deposition date 2005-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06433 Me-amine-dh_H Methylamine dehydrogenase heavy chain (MADH)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2aglA01
4A11A 3PXSD 3IKOA 4A11B 2YNNA 2I0TA 5K1CC 5EMJB 4J79A 2O9KA 4PNKB 5FKRA 2CE9A 3V5WB 5EARA 4J8GA 3DXMC 3RRMC 3OTTA 2W18A 3SBPA 1XKSA 4H5JA 3SHFA 5I5JA 5TF2A 4ERYA 5A2Qg 2H47A 3NVXA 5FQDA 2CE8A 4A08A 4A09A 5C2VB 3F3GA 5HE1B 4A08B 4A09B 1OMWB 4O3UB 5JWZA 5K19A 5H17A 3PVWB 4J81A 2I3TA 4U7AA 4BL0A 4JT6C 4AOWA 5EMLB 5CXBA 1N6DA 3RFHA 2CN3A 5CXBB 3DM0A 2OVPB 5FKQA 3UVOA 4FAND 2AGYA 3EU7A 4R7AB 2OJYA 2AH1A 2Z2OA 4FB1D 4O3TB 4A0BA 2OVQB 4CI8A 3OKYA 3RLMD 4A0BB 3UKRC 5HE0B 3OKYB 3JZGA 5EM2A 2OVRB 4CC9A 3UVKA 4FA5D 5EM2B 4BUJC 3IJ1A 4J0WA 4JT5C 5IJ7E 3SLED 4O45A 4LG8A 1SQJA 4L3GD 3I89A 4JSXC 5I5IA 2P9KC 5FKSA 5AFU3 5C2WB 4TZ4A 4CY5A 4GM9A 4PSXB 3PVUB 5FLXg 3C5MA 2H9NA 1GXRA 2YNPA 2P9NC 3EI4A 2GNQA 4ZOVA 4CI1A 5HE2B 3EI4B 4CY1A 4PC0A 3PSCB 3I7OA 3V9FA 4XYHA 4JD2C 5IGQA 4AEZA 4D6VA 5SXMA 2B5MA 4X3EA 2P9PC 2P9LC 3F3PA 2HJBA 3DXKC 3MZLA 4J82A 2IURA 1QNIA 3EI2A 2I0RA 1K8KC 3RN0D 4ZOZA 1TBGA 3EI2B 5EMKB 4QRJA 4CI3A 5EAMA 1MG2A 2H6QA 2QC5A 3UVNA 2AGWA 3KRXB 2B5NA 4XYIA 2H9MA 2CO0C 5HYNB 3ZWLB 2H68A 3SN6B 2P9IC 2OIZA 5IJ8E 2IAAA 5EALA 5KDOB 3VH0A 3SCYA 3VGZA 4JSPC 1SHYB 2PM6B 2PM9A 3SBRA 4CZXA 3I7KA 3A0FA 2H13A 4GQ2P 1U4CA 3PXWD 1PBYB 3ORVD 4NSXA 2G99A 5GSAA 1FWXA 3PE7A 1VYHC 2H14A 4CI2A 3SBQA 4A2MA 4BH6A 3BG1A 3ODTA 3V7DB 1NR0A 1JOFA 4CY3A 4KFMB 2H6NA 2XL3A 3L4OD 5H1MA 5FKTA 5I5MA 3AL8A 3DWLC 5HE3B 5IGOA 3AL8B 4GGDA 5THAA 4ZN4A 4QQEA 3EWEA 5HQGA 3GFCA 4H5IA 4J77A 3W15A 2BBKH 4L1QD 1JJUB 5B4WA 4IA9A 5FXYA 1JMZB 2OK6A 3NVNA 3UKUC 2YB8B 3FRXA 3IIWA 3NVQA 5CXCA 3SMRA 4A2LA 1N6FA 1ERJA 5AJAA 4K3JB 4K3ID 3JROA 4PXWA 4E5ZA 3FM0A 3VA6A 3SFZA 5AMSA 4E5ZB 3K27A 4ZOYA 4FAVD 3K26A 4GQBB 3OL2A 2Z2NA 2PM7B 2I0SA 4J0XA 4JXMA 3OL2B 4U1EI 3MZKA 2J55H 3ULEC 4N14A 4X63B 5C9ZB 3SXTD 3U4YA 4J87A 3RSEC 2P9SC 2PBIB 3E0CA 1L0QA 4A0AA 3CFVA 1R5MA 2HKRA 4J73A 4A0AB 2HKMA 4CY2A 2AGLA 2IWKA 4JSVC 4EWRA 3I2NA 2HYEA 3L4MD 4FHLA 3JZHA 4E54A 3KRWB 4E54B 4Z8LA 5TEFA 5EMMB 3C75H 4D0KA 4YVDA 4QL1A 3I8CA 3N0EA 3OKWA 2IWFA 2HESX 3I8EA 3RMZD 2CN2A 4J86A 3IJCA 3C9CA 4J78A 5IT9g 1OLZA 2OK4A 4UI9R 4FA4D 3PSLA 4O9DA 3MMYA 3BG0A 3MKQA 1MG3A 3UR4A 4CZYA 2B4EA 3SWSD 2YBAA 3CIKB 1GP2B 4LG9A 4ZOXA 1GOTB 2AQ5A 4L3HD 3UVLA 4A7JA 3SJLD 2PM9B 3F3FA 4J8BA 2IUPA 3N0DA 1SQ9A 2HXCA 5CYKA 3HFQA 4GM8A 1U2VC 3PXTD 3RN1D 5CYKB 2AGXA 1TYQC 3OW8A 5GXIA 5GXHA 2IUVA 2HJ4A 4PBZA 2J57G 2BCJB 2P9UC 1NEXB 4JSNC 1N6EA 1K32A 3J80g 3AH8B 3EMHA 2YNOA 3JPXA 2I3SA 4PSWB 2H6KA 1PI6A 4ESGA 1GG2B 2GC7A 3C99A 4I79A 4O1QD 3JZNA 2UZXB 2EBSA 2MTAH 2YMUA 3CFSB 2AH0A 3B7FA 3JB9L 4QT8A 2QXVA 4X61B 4GQ1A 3AFCA 4Y5RD 5CXCB 3IIYA 1Q47A 3MXXA 2IUQA 3I7PA 4HDJA 1B9YA 4GMBA 4FA1D 3RFGA 5EAPA 3SVWD 1PEVA 5TDHB 1XHMA 2B5LA 3FGBA 4OZUA 4PBYA 4Y7RA 1P22A 4FA9D 4ES0A 3EG6A 3P4FA 3MKSB 5IC7A 2TRCB 4G56B 1JMXB 5GMKn 3I7LA 4X60B 3UVMA 1B9XA 4ERQA 1XIPA 3I7HA 3AL9A 4GGAA 2Z2PA 4MK0B 3IJ0A 3J81g 3OKTA 2CNXA 2UZYB 3DSMA 1PGUA 2H9PA 4CZVA 4ERZA 5H14A 2H9LA 3JRPA 2H3XA 4FWWA 1MDAH 4OWRA 4GGCA 3EI3A 4GZ8A 3EI3B 4J84A 2XYIA 2Q7QA 3BWSA 3GREA 2XL2A 4IMMA 2J56H 4XEIC 4L9OA 3EI1A 4LGNA 3JAMg 1RI6A 1YFQA 3EI1B 2CO0A 2AGZA 1A0RB 2XU7A 2GC4A 2G9AA 3I7NA 5TEEA 1S4UX 4GM3A 5FA5B
chains in the Genus database with same CATH superfamily
4A11A 3PXSD 4DNWA 3IKOA 1VE6A 4A11B 2YNNA 5M5TA 2I0TA 5K1CC 5EMJB 4NENA 4J79A 4UM8A 2O9KA 4PNKB 5FKRA 2CE9A 3V5WB 5EARA 4Z7QA 4J8GA 3DXMC 3RRMC 3OTTA 2W18A 3SBPA 1XKSA 4H5JA 3SHFA 3O4HA 5I5JA 5TF2A 4ERYA 4O2WA 5A2Qg 2H47A 3NVXA 3QHYB 5FQDA 2CE8A 4A08A 4A09A 5C2VB 3F3GA 5HE1B 4A08B 1U8CA 4A09B 3GC3B 1OMWB 4DNVA 5HDBA 4O3UB 4BCDA 5JWZA 5K19A 5H17A 3PVWB 4J81A 2I3TA 5FFGA 4U7AA 4BL0A 4JT6C 4AOWA 4O02A 4BCCA 5EMLB 5CXBA 1N6DA 3RFHA 2XE4A 4WK2A 2CN3A 4MMYA 5CXBB 3MVDK 3DM0A 2OVPB 5FKQA 5E6SA 3UVOA 4FAND 3EQ9A 2AGYA 3EU7A 4R7AB 2OJYA 2AH1A 5C92A 2Z2OA 4FB1D 4O3TB 4RE6A 5M5RA 4A0BA 2OVQB 4CI8A 3OKYA 3RLMD 4A0BB 3UKRC 5HE0B 3OKYB 3JZGA 2VZ1A 5EM2A 2OVRB 4CC9A 3O4IA 3UVKA 4FA5D 5EM2B 3MUOA 4BUJC 3IJ1A 4J0WA 4JT5C 1E5TA 5IJ7E 3SLED 4O45A 4LG8A 1SQJA 1C9IA 4G1MA 2XDWA 3K72A 4L3GD 3I89A 4MMXA 4JSXC 5I5IA 2P9KC 5FKSA 5AFU3 3NIDA 4AN1A 5C2WB 4TZ4A 3NIFA 4CY5A 4GM9A 3T3PA 4PSXB 3PVUB 5FLXg 3C5MA 2H9NA 3T3MA 1GXRA 3ZDXA 2YNPA 2P9NC 4NAAA 3EI4A 2GNQA 4ZOVA 4CI1A 5HE2B 4BP8A 3EI4B 4CY1A 4PC0A 3PSCB 3I7OA 3V9FA 4XYHA 4JD2C 5IGQA 4AEZA 4D6VA 5SXMA 2B5MA 4X3EA 2P9PC 2P9LC 3F3PA 2HJBA 3DXKC 3MZLA 4J82A 2IURA 3ZE0A 1QNIA 3EI2A 2I0RA 1K8KC 3RN0D 4ZOZA 1TBGA 3EI2B 5EMKB 4QRJA 4CI3A 5EAMA 1MG2A 2H6QA 2QC5A 2EIBA 3UVNA 2AGWA 1UOQA 3KRXB 2B5NA 4XYIA 2H9MA 3IVMA 3ZDZA 5M5VA 2CO0C 4AN0A 5HYNB 3ZWLB 2H68A 4JHNA 3SN6B 2P9IC 2OIZA 5IJ8E 4WK0A 2IAAA 5EALA 5KDOB 3VH0A 3SCYA 3VGZA 3IURA 4JSPC 1SHYB 2VDPA 2PM6B 3K6SA 2PM9A 3SBRA 1GOGA 4CZXA 3IULA 3I7KA 3A0FA 4QAMA 1VZ3A 4UM9A 2H13A 4GQ2P 1U4CA 3PXWD 1PBYB 2QR5A 3ORVD 4NSXA 3K71A 2G99A 5GSAA 1FWXA 3EQ7A 3IJEA 3PE7A 1VYHC 2H14A 4CI2A 3SBQA 4A2MA 4BH6A 3BG1A 1BPOA 3ODTA 1NR0A 3V7DB 1JOFA 4CY3A 4KFMB 5E6UA 2H6NA 2XL3A 3L4OD 5H1MA 2JKXA 5FKTA 5I5MA 3AL8A 3DWLC 5HE3B 2XZGA 5IGOA 3AL8B 4GGDA 5THAA 4ZN4A 4QQEA 3FCUA 3EWEA 5HQGA 3GFCA 4H5IA 4J77A 3W15A 2BBKH 4L1QD 1JJUB 5B4WA 1L5GA 1VZ2A 4IA9A 5FXYA 1JMZB 2OK6A 3NVNA 3UKUC 2YB8B 3FRXA 3IIWA 3NVQA 4DNUA 1UOOA 3FCSA 5CXCA 3SMRA 4A2LA 1N6FA 1ERJA 5AJAA 4K3JB 4K3ID 3JROA 4PXWA 2EIEA 4E5ZA 3FM0A 3VA6A 3MUNA 3SFZA 3GD1I 5AMSA 4E5ZB 3K27A 4ZOYA 4FAVD 3K26A 4GQBB 1UTCA 1K3IA 3OL2A 2Z2NA 2PM7B 3OF7A 2I0SA 3IUJA 4J0XA 4JXMA 2VC2A 3OL2B 4U1EI 2VDMA 3ZDYA 3MZKA 2J55H 3ULEC 4N14A 4X63B 5C9ZB 3SXTD 3U4YA 4J87A 3RSEC 1E8MA 2P9SC 2PBIB 3E0CA 1L0QA 4A0AA 1A12A 3CFVA 1R5MA 2HKRA 4J73A 4A0AB 2HKMA 2VZ3A 4CY2A 2AGLA 4BP9A 2IWKA 4NBMA 5M5UA 4JSVC 4EWRA 3I2NA 4NC4A 3L4MD 2HYEA 4FHLA 3DDUA 3JZHA 4E54A 3KRWB 3VI3A 3V4VA 4E54B 3V4PA 4Z8LA 4L1MA 5TEFA 5EMMB 3NIGA 3C75H 2VDKA 4G55A 4D0KA 4YVDA 4QL1A 3I8CA 3N0EA 3OKWA 3ZE1A 2IWFA 2HESX 3I8EA 3RMZD 2CN2A 4J86A 4Z7NA 2HU7A 3IJCA 3C9CA 1M1XA 1UOPA 4J78A 5IT9g 1OLZA 4RE5A 3O4JA 2OK4A 4UI9R 4FA4D 3PSLA 4O9DA 3MMYA 3BG0A 3MKQA 1E8NA 1MG3A 3UR4A 4CZYA 2B4EA 3SWSD 2YBAA 3CIKB 1GP2B 4LG9A 4ZOXA 1GOTB 2AQ5A 4L3HD 3UVLA 4A7JA 3SJLD 2PM9B 3F3FA 4J8BA 2VDLA 1O6FA 2IUPA 2QZPA 3N0DA 1H2XA 1SQ9A 2HXCA 5CYKA 3HFQA 4GM8A 1U2VC 3PXTD 3RN1D 5CYKB 2AGXA 1TYQC 3OW8A 5GXIA 5GXHA 2IUVA 2HJ4A 4PBZA 2J57G 2BCJB 4BCBA 2P9UC 1NEXB 4JSNC 1N6EA 2BKLA 1K32A 4IRZA 2VDQA 3J80g 3AH8B 3EMHA 2YNOA 3JPXA 2I3SA 4PSWB 2H6KA 1PI6A 5E6RA 4ESGA 1GG2B 4JHPC 2GC7A 1I2MB 3C99A 4I79A 1O6GA 3IUMA 4O1QD 3JZNA 4AMYA 2UZXB 3EQ8A 2EBSA 4WK4A 2MTAH 2YMUA 3CFSB 2AH0A 3B7FA 3JB9L 4QT8A 2QXVA 1YR2A 4X61B 4GQ1A 2WQ8A 3AFCA 1H2WA 4Y5RD 5CXCB 3IIYA 3ZE2A 3IUNA 1Q47A 1TYEA 2EICA 3MXXA 2IUQA 3I7PA 4HDJA 1B9YA 4GMBA 4FA1D 3RFGA 5EAPA 3SVWD 1PEVA 5TDHB 2VDOA 1XHMA 2B5LA 3FGBA 4OZUA 3KCIA 4PBYA 1P22A 1VE7A 4Y7RA 4FA9D 2VDRA 5C86A 4ES0A 1QFMA 3EG6A 3P4FA 3MKSB 5IC7A 1H2ZA 2TRCB 4Z7OA 4G56B 1JMXB 4G1EA 2VDNA 5GMKn 1T2XA 3I7LA 4X60B 5FFOA 3UVMA 1B9XA 4ERQA 1XIPA 3I7HA 3AL9A 3QI0A 4GGAA 2Z2PA 4MK0B 3IJ0A 1QFSA 1JTDB 2EIDA 3J81g 3O4GA 3OKTA 1JV2A 2CNXA 2UZYB 1C9LA 3DSMA 1PGUA 2H9PA 4WJKA 3VI4A 4CZVA 4ERZA 5H14A 2H9LA 3JRPA 2H3XA 4FWWA 1GOHA 1MDAH 4OWRA 4MMZA 2HU8A 4GGCA 3EI3A 2HU5A 5M5SA 4AX4A 4GZ8A 3EI3B 4J84A 2XYIA 4AMZA 2Q7QA 3BWSA 3GREA 3IUQA 2XL2A 4IMMA 2J56H 4XEIC 4L9OA 3EI1A 4LGNA 3JAMg 1RI6A 1YFQA 3EI1B 2CO0A 5M61A 1H2YA 1A0RB 2AGZA 2XU7A 4D9SA 1GOFA 2G9AA 2GC4A 3I7NA 5TEEA 1S4UX 4GM3A 5FA5B
chains in the Genus database with same CATH topology
4A11A 3PXSD 3IKOA 4A11B 2YNNA 2I0TA 5K1CC 5EMJB 4J79A 2O9KA 4PNKB 5FKRA 2CE9A 3V5WB 5EARA 4J8GA 3DXMC 3RRMC 3OTTA 2W18A 3SBPA 1XKSA 4H5JA 3SHFA 5I5JA 5TF2A 4ERYA 5A2Qg 2H47A 3NVXA 5FQDA 2CE8A 4A08A 4A09A 5C2VB 3F3GA 5HE1B 4A08B 4A09B 1OMWB 4O3UB 5JWZA 5K19A 5H17A 3PVWB 4J81A 2I3TA 4U7AA 4BL0A 4JT6C 4AOWA 5EMLB 5CXBA 1N6DA 3RFHA 2CN3A 5CXBB 3DM0A 2OVPB 5FKQA 3UVOA 4FAND 2AGYA 3EU7A 4R7AB 2OJYA 2AH1A 2Z2OA 4FB1D 4O3TB 4A0BA 2OVQB 4CI8A 3OKYA 3RLMD 4A0BB 3UKRC 5HE0B 3OKYB 3JZGA 5EM2A 2OVRB 4CC9A 3UVKA 4FA5D 5EM2B 4BUJC 3IJ1A 4J0WA 4JT5C 5IJ7E 3SLED 4O45A 4LG8A 1SQJA 4L3GD 3I89A 4JSXC 5I5IA 2P9KC 5FKSA 5AFU3 5C2WB 4TZ4A 4CY5A 4GM9A 4PSXB 3PVUB 5FLXg 3C5MA 2H9NA 1GXRA 2YNPA 2P9NC 3EI4A 2GNQA 4ZOVA 4CI1A 5HE2B 3EI4B 4CY1A 4PC0A 3PSCB 3I7OA 3V9FA 4XYHA 4JD2C 5IGQA 4AEZA 4D6VA 5SXMA 2B5MA 4X3EA 2P9PC 2P9LC 3F3PA 2HJBA 3DXKC 3MZLA 4J82A 2IURA 1QNIA 3EI2A 2I0RA 1K8KC 3RN0D 4ZOZA 1TBGA 3EI2B 5EMKB 4QRJA 4CI3A 5EAMA 1MG2A 2H6QA 2QC5A 3UVNA 2AGWA 3KRXB 2B5NA 4XYIA 2H9MA 2CO0C 5HYNB 3ZWLB 2H68A 3SN6B 2P9IC 2OIZA 5IJ8E 2IAAA 5EALA 5KDOB 3VH0A 3SCYA 3VGZA 4JSPC 1SHYB 2PM6B 2PM9A 3SBRA 4CZXA 3I7KA 3A0FA 2H13A 4GQ2P 1U4CA 3PXWD 1PBYB 3ORVD 4NSXA 2G99A 5GSAA 1FWXA 3PE7A 1VYHC 2H14A 4CI2A 3SBQA 4A2MA 4BH6A 3BG1A 3ODTA 3V7DB 1NR0A 1JOFA 4CY3A 4KFMB 2H6NA 2XL3A 3L4OD 5H1MA 5FKTA 5I5MA 3AL8A 3DWLC 5HE3B 5IGOA 3AL8B 4GGDA 5THAA 4ZN4A 4QQEA 3EWEA 5HQGA 3GFCA 4H5IA 4J77A 3W15A 2BBKH 4L1QD 1JJUB 5B4WA 4IA9A 5FXYA 1JMZB 2OK6A 3NVNA 3UKUC 2YB8B 3FRXA 3IIWA 3NVQA 5CXCA 3SMRA 4A2LA 1N6FA 1ERJA 5AJAA 4K3JB 4K3ID 3JROA 4PXWA 4E5ZA 3FM0A 3VA6A 3SFZA 5AMSA 4E5ZB 3K27A 4ZOYA 4FAVD 3K26A 4GQBB 3OL2A 2Z2NA 2PM7B 2I0SA 4J0XA 4JXMA 3OL2B 4U1EI 3MZKA 2J55H 3ULEC 4N14A 4X63B 5C9ZB 3SXTD 3U4YA 4J87A 3RSEC 2P9SC 2PBIB 3E0CA 1L0QA 4A0AA 3CFVA 1R5MA 2HKRA 4J73A 4A0AB 2HKMA 4CY2A 2AGLA 2IWKA 4JSVC 4EWRA 3I2NA 2HYEA 3L4MD 4FHLA 3JZHA 4E54A 3KRWB 4E54B 4Z8LA 5TEFA 5EMMB 3C75H 4D0KA 4YVDA 4QL1A 3I8CA 3N0EA 3OKWA 2IWFA 2HESX 3I8EA 3RMZD 2CN2A 4J86A 3IJCA 3C9CA 4J78A 5IT9g 1OLZA 2OK4A 4UI9R 4FA4D 3PSLA 4O9DA 3MMYA 3BG0A 3MKQA 1MG3A 3UR4A 4CZYA 2B4EA 3SWSD 2YBAA 3CIKB 1GP2B 4LG9A 4ZOXA 1GOTB 2AQ5A 4L3HD 3UVLA 4A7JA 3SJLD 2PM9B 3F3FA 4J8BA 2IUPA 3N0DA 1SQ9A 2HXCA 5CYKA 3HFQA 4GM8A 1U2VC 3PXTD 3RN1D 5CYKB 2AGXA 1TYQC 3OW8A 5GXIA 5GXHA 2IUVA 2HJ4A 4PBZA 2J57G 2BCJB 2P9UC 1NEXB 4JSNC 1N6EA 1K32A 3J80g 3AH8B 3EMHA 2YNOA 3JPXA 2I3SA 4PSWB 2H6KA 1PI6A 4ESGA 1GG2B 2GC7A 3C99A 4I79A 4O1QD 3JZNA 2UZXB 2EBSA 2MTAH 2YMUA 3CFSB 2AH0A 3B7FA 3JB9L 4QT8A 2QXVA 4X61B 4GQ1A 3AFCA 4Y5RD 5CXCB 3IIYA 1Q47A 3MXXA 2IUQA 3I7PA 4HDJA 1B9YA 4GMBA 4FA1D 3RFGA 5EAPA 3SVWD 1PEVA 5TDHB 1XHMA 2B5LA 3FGBA 4OZUA 4PBYA 4Y7RA 1P22A 4FA9D 4ES0A 3EG6A 3P4FA 3MKSB 5IC7A 2TRCB 4G56B 1JMXB 5GMKn 3I7LA 4X60B 3UVMA 1B9XA 4ERQA 1XIPA 3I7HA 3AL9A 4GGAA 2Z2PA 4MK0B 3IJ0A 3J81g 3OKTA 2CNXA 2UZYB 3DSMA 1PGUA 2H9PA 4CZVA 4ERZA 5H14A 2H9LA 3JRPA 2H3XA 4FWWA 1MDAH 4OWRA 4GGCA 3EI3A 4GZ8A 3EI3B 4J84A 2XYIA 2Q7QA 3BWSA 3GREA 2XL2A 4IMMA 2J56H 4XEIC 4L9OA 3EI1A 4LGNA 3JAMg 1RI6A 1YFQA 3EI1B 2CO0A 2AGZA 1A0RB 2XU7A 2GC4A 2G9AA 3I7NA 5TEEA 1S4UX 4GM3A 5FA5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A11 A;  3PXS D;  3IKO A;  4A11 B;  2YNN A;  2I0T A;  5K1C C;  5EMJ B;  4J79 A;  2O9K A;  4PNK B;  5FKR A;  2CE9 A;  3V5W B;  5EAR A;  4J8G A;  3DXM C;  3RRM C;  3OTT A;  2W18 A;  3SBP A;  1XKS A;  4H5J A;  3SHF A;  5I5J A;  5TF2 A;  4ERY A;  5A2Q g;  2H47 A;  3NVX A;  5FQD A;  2CE8 A;  4A08 A;  4A09 A;  5C2V B;  3F3G A;  5HE1 B;  4A08 B;  4A09 B;  1OMW B;  4O3U B;  5JWZ A;  5K19 A;  5H17 A;  3PVW B;  4J81 A;  2I3T A;  4U7A A;  4BL0 A;  4JT6 C;  4AOW A;  5EML B;  5CXB A;  1N6D A;  3RFH A;  2CN3 A;  5CXB B;  3DM0 A;  2OVP B;  5FKQ A;  3UVO A;  4FAN D;  2AGY A;  3EU7 A;  4R7A B;  2OJY A;  2AH1 A;  2Z2O A;  4FB1 D;  4O3T B;  4A0B A;  2OVQ B;  4CI8 A;  3OKY A;  3RLM D;  4A0B B;  3UKR C;  5HE0 B;  3OKY B;  3JZG A;  5EM2 A;  2OVR B;  4CC9 A;  3UVK A;  4FA5 D;  5EM2 B;  4BUJ C;  3IJ1 A;  4J0W A;  4JT5 C;  5IJ7 E;  3SLE D;  4O45 A;  4LG8 A;  1SQJ A;  4L3G D;  3I89 A;  4JSX C;  5I5I A;  2P9K C;  5FKS A;  5AFU 3;  5C2W B;  4TZ4 A;  4CY5 A;  4GM9 A;  4PSX B;  3PVU B;  5FLX g;  3C5M A;  2H9N A;  1GXR A;  2YNP A;  2P9N C;  3EI4 A;  2GNQ A;  4ZOV A;  4CI1 A;  5HE2 B;  3EI4 B;  4CY1 A;  4PC0 A;  3PSC B;  3I7O A;  3V9F A;  4XYH A;  4JD2 C;  5IGQ A;  4AEZ A;  4D6V A;  5SXM A;  2B5M A;  4X3E A;  2P9P C;  2P9L C;  3F3P A;  2HJB A;  3DXK C;  3MZL A;  4J82 A;  2IUR A;  1QNI A;  3EI2 A;  2I0R A;  1K8K C;  3RN0 D;  4ZOZ A;  1TBG A;  3EI2 B;  5EMK B;  4QRJ A;  4CI3 A;  5EAM A;  1MG2 A;  2H6Q A;  2QC5 A;  3UVN A;  2AGW A;  3KRX B;  2B5N A;  4XYI A;  2H9M A;  2CO0 C;  5HYN B;  3ZWL B;  2H68 A;  3SN6 B;  2P9I C;  2OIZ A;  5IJ8 E;  2IAA A;  5EAL A;  5KDO B;  3VH0 A;  3SCY A;  3VGZ A;  4JSP C;  1SHY B;  2PM6 B;  2PM9 A;  3SBR A;  4CZX A;  3I7K A;  3A0F A;  2H13 A;  4GQ2 P;  1U4C A;  3PXW D;  1PBY B;  3ORV D;  4NSX A;  2G99 A;  5GSA A;  1FWX A;  3PE7 A;  1VYH C;  2H14 A;  4CI2 A;  3SBQ A;  4A2M A;  4BH6 A;  3BG1 A;  3ODT A;  3V7D B;  1NR0 A;  1JOF A;  4CY3 A;  4KFM B;  2H6N A;  2XL3 A;  3L4O D;  5H1M A;  5FKT A;  5I5M A;  3AL8 A;  3DWL C;  5HE3 B;  5IGO A;  3AL8 B;  4GGD A;  5THA A;  4ZN4 A;  4QQE A;  3EWE A;  5HQG A;  3GFC A;  4H5I A;  4J77 A;  3W15 A;  2BBK H;  4L1Q D;  1JJU B;  5B4W A;  4IA9 A;  5FXY A;  1JMZ B;  2OK6 A;  3NVN A;  3UKU C;  2YB8 B;  3FRX A;  3IIW A;  3NVQ A;  5CXC A;  3SMR A;  4A2L A;  1N6F A;  1ERJ A;  5AJA A;  4K3J B;  4K3I D;  3JRO A;  4PXW A;  4E5Z A;  3FM0 A;  3VA6 A;  3SFZ A;  5AMS A;  4E5Z B;  3K27 A;  4ZOY A;  4FAV D;  3K26 A;  4GQB B;  3OL2 A;  2Z2N A;  2PM7 B;  2I0S A;  4J0X A;  4JXM A;  3OL2 B;  4U1E I;  3MZK A;  2J55 H;  3ULE C;  4N14 A;  4X63 B;  5C9Z B;  3SXT D;  3U4Y A;  4J87 A;  3RSE C;  2P9S C;  2PBI B;  3E0C A;  1L0Q A;  4A0A A;  3CFV A;  1R5M A;  2HKR A;  4J73 A;  4A0A B;  2HKM A;  4CY2 A;  2AGL A;  2IWK A;  4JSV C;  4EWR A;  3I2N A;  2HYE A;  3L4M D;  4FHL A;  3JZH A;  4E54 A;  3KRW B;  4E54 B;  4Z8L A;  5TEF A;  5EMM B;  3C75 H;  4D0K A;  4YVD A;  4QL1 A;  3I8C A;  3N0E A;  3OKW A;  2IWF A;  2HES X;  3I8E A;  3RMZ D;  2CN2 A;  4J86 A;  3IJC A;  3C9C A;  4J78 A;  5IT9 g;  1OLZ A;  2OK4 A;  4UI9 R;  4FA4 D;  3PSL A;  4O9D A;  3MMY A;  3BG0 A;  3MKQ A;  1MG3 A;  3UR4 A;  4CZY A;  2B4E A;  3SWS D;  2YBA A;  3CIK B;  1GP2 B;  4LG9 A;  4ZOX A;  1GOT B;  2AQ5 A;  4L3H D;  3UVL A;  4A7J A;  3SJL D;  2PM9 B;  3F3F A;  4J8B A;  2IUP A;  3N0D A;  1SQ9 A;  2HXC A;  5CYK A;  3HFQ A;  4GM8 A;  1U2V C;  3PXT D;  3RN1 D;  5CYK B;  2AGX A;  1TYQ C;  3OW8 A;  5GXI A;  5GXH A;  2IUV A;  2HJ4 A;  4PBZ A;  2J57 G;  2BCJ B;  2P9U C;  1NEX B;  4JSN C;  1N6E A;  1K32 A;  3J80 g;  3AH8 B;  3EMH A;  2YNO A;  3JPX A;  2I3S A;  4PSW B;  2H6K A;  1PI6 A;  4ESG A;  1GG2 B;  2GC7 A;  3C99 A;  4I79 A;  4O1Q D;  3JZN A;  2UZX B;  2EBS A;  2MTA H;  2YMU A;  3CFS B;  2AH0 A;  3B7F A;  3JB9 L;  4QT8 A;  2QXV A;  4X61 B;  4GQ1 A;  3AFC A;  4Y5R D;  5CXC B;  3IIY A;  1Q47 A;  3MXX A;  2IUQ A;  3I7P A;  4HDJ A;  1B9Y A;  4GMB A;  4FA1 D;  3RFG A;  5EAP A;  3SVW D;  1PEV A;  5TDH B;  1XHM A;  2B5L A;  3FGB A;  4OZU A;  4PBY A;  4Y7R A;  1P22 A;  4FA9 D;  4ES0 A;  3EG6 A;  3P4F A;  3MKS B;  5IC7 A;  2TRC B;  4G56 B;  1JMX B;  5GMK n;  3I7L A;  4X60 B;  3UVM A;  1B9X A;  4ERQ A;  1XIP A;  3I7H A;  3AL9 A;  4GGA A;  2Z2P A;  4MK0 B;  3IJ0 A;  3J81 g;  3OKT A;  2CNX A;  2UZY B;  3DSM A;  1PGU A;  2H9P A;  4CZV A;  4ERZ A;  5H14 A;  2H9L A;  3JRP A;  2H3X A;  4FWW A;  1MDA H;  4OWR A;  4GGC A;  3EI3 A;  4GZ8 A;  3EI3 B;  4J84 A;  2XYI A;  2Q7Q A;  3BWS A;  3GRE A;  2XL2 A;  4IMM A;  2J56 H;  4XEI C;  4L9O A;  3EI1 A;  4LGN A;  3JAM g;  1RI6 A;  1YFQ A;  3EI1 B;  2CO0 A;  2AGZ A;  1A0R B;  2XU7 A;  2GC4 A;  2G9A A;  3I7N A;  5TEE A;  1S4U X;  4GM3 A;  5FA5 B; 
#chains in the Genus database with same CATH topology
 4A11 A;  3PXS D;  4DNW A;  3IKO A;  1VE6 A;  4A11 B;  2YNN A;  5M5T A;  2I0T A;  5K1C C;  5EMJ B;  4NEN A;  4J79 A;  4UM8 A;  2O9K A;  4PNK B;  5FKR A;  2CE9 A;  3V5W B;  5EAR A;  4Z7Q A;  4J8G A;  3DXM C;  3RRM C;  3OTT A;  2W18 A;  3SBP A;  1XKS A;  4H5J A;  3SHF A;  3O4H A;  5I5J A;  5TF2 A;  4ERY A;  4O2W A;  5A2Q g;  2H47 A;  3NVX A;  3QHY B;  5FQD A;  2CE8 A;  4A08 A;  4A09 A;  5C2V B;  3F3G A;  5HE1 B;  4A08 B;  1U8C A;  4A09 B;  3GC3 B;  1OMW B;  4DNV A;  5HDB A;  4O3U B;  4BCD A;  5JWZ A;  5K19 A;  5H17 A;  3PVW B;  4J81 A;  2I3T A;  5FFG A;  4U7A A;  4BL0 A;  4JT6 C;  4AOW A;  4O02 A;  4BCC A;  5EML B;  5CXB A;  1N6D A;  3RFH A;  2XE4 A;  4WK2 A;  2CN3 A;  4MMY A;  5CXB B;  3MVD K;  3DM0 A;  2OVP B;  5FKQ A;  5E6S A;  3UVO A;  4FAN D;  3EQ9 A;  2AGY A;  3EU7 A;  4R7A B;  2OJY A;  2AH1 A;  5C92 A;  2Z2O A;  4FB1 D;  4O3T B;  4RE6 A;  5M5R A;  4A0B A;  2OVQ B;  4CI8 A;  3OKY A;  3RLM D;  4A0B B;  3UKR C;  5HE0 B;  3OKY B;  3JZG A;  2VZ1 A;  5EM2 A;  2OVR B;  4CC9 A;  3O4I A;  3UVK A;  4FA5 D;  5EM2 B;  3MUO A;  4BUJ C;  3IJ1 A;  4J0W A;  4JT5 C;  1E5T A;  5IJ7 E;  3SLE D;  4O45 A;  4LG8 A;  1SQJ A;  1C9I A;  4G1M A;  2XDW A;  3K72 A;  4L3G D;  3I89 A;  4MMX A;  4JSX C;  5I5I A;  2P9K C;  5FKS A;  5AFU 3;  3NID A;  4AN1 A;  5C2W B;  4TZ4 A;  3NIF A;  4CY5 A;  4GM9 A;  3T3P A;  4PSX B;  3PVU B;  5FLX g;  3C5M A;  2H9N A;  3T3M A;  1GXR A;  3ZDX A;  2YNP A;  2P9N C;  4NAA A;  3EI4 A;  2GNQ A;  4ZOV A;  4CI1 A;  5HE2 B;  4BP8 A;  3EI4 B;  4CY1 A;  4PC0 A;  3PSC B;  3I7O A;  3V9F A;  4XYH A;  4JD2 C;  5IGQ A;  4AEZ A;  4D6V A;  5SXM A;  2B5M A;  4X3E A;  2P9P C;  2P9L C;  3F3P A;  2HJB A;  3DXK C;  3MZL A;  4J82 A;  2IUR A;  3ZE0 A;  1QNI A;  3EI2 A;  2I0R A;  1K8K C;  3RN0 D;  4ZOZ A;  1TBG A;  3EI2 B;  5EMK B;  4QRJ A;  4CI3 A;  5EAM A;  1MG2 A;  2H6Q A;  2QC5 A;  2EIB A;  3UVN A;  2AGW A;  1UOQ A;  3KRX B;  2B5N A;  4XYI A;  2H9M A;  3IVM A;  3ZDZ A;  5M5V A;  2CO0 C;  4AN0 A;  5HYN B;  3ZWL B;  2H68 A;  4JHN A;  3SN6 B;  2P9I C;  2OIZ A;  5IJ8 E;  4WK0 A;  2IAA A;  5EAL A;  5KDO B;  3VH0 A;  3SCY A;  3VGZ A;  3IUR A;  4JSP C;  1SHY B;  2VDP A;  2PM6 B;  3K6S A;  2PM9 A;  3SBR A;  1GOG A;  4CZX A;  3IUL A;  3I7K A;  3A0F A;  4QAM A;  1VZ3 A;  4UM9 A;  2H13 A;  4GQ2 P;  1U4C A;  3PXW D;  1PBY B;  2QR5 A;  3ORV D;  4NSX A;  3K71 A;  2G99 A;  5GSA A;  1FWX A;  3EQ7 A;  3IJE A;  3PE7 A;  1VYH C;  2H14 A;  4CI2 A;  3SBQ A;  4A2M A;  4BH6 A;  3BG1 A;  1BPO A;  3ODT A;  1NR0 A;  3V7D B;  1JOF A;  4CY3 A;  4KFM B;  5E6U A;  2H6N A;  2XL3 A;  3L4O D;  5H1M A;  2JKX A;  5FKT A;  5I5M A;  3AL8 A;  3DWL C;  5HE3 B;  2XZG A;  5IGO A;  3AL8 B;  4GGD A;  5THA A;  4ZN4 A;  4QQE A;  3FCU A;  3EWE A;  5HQG A;  3GFC A;  4H5I A;  4J77 A;  3W15 A;  2BBK H;  4L1Q D;  1JJU B;  5B4W A;  1L5G A;  1VZ2 A;  4IA9 A;  5FXY A;  1JMZ B;  2OK6 A;  3NVN A;  3UKU C;  2YB8 B;  3FRX A;  3IIW A;  3NVQ A;  4DNU A;  1UOO A;  3FCS A;  5CXC A;  3SMR A;  4A2L A;  1N6F A;  1ERJ A;  5AJA A;  4K3J B;  4K3I D;  3JRO A;  4PXW A;  2EIE A;  4E5Z A;  3FM0 A;  3VA6 A;  3MUN A;  3SFZ A;  3GD1 I;  5AMS A;  4E5Z B;  3K27 A;  4ZOY A;  4FAV D;  3K26 A;  4GQB B;  1UTC A;  1K3I A;  3OL2 A;  2Z2N A;  2PM7 B;  3OF7 A;  2I0S A;  3IUJ A;  4J0X A;  4JXM A;  2VC2 A;  3OL2 B;  4U1E I;  2VDM A;  3ZDY A;  3MZK A;  2J55 H;  3ULE C;  4N14 A;  4X63 B;  5C9Z B;  3SXT D;  3U4Y A;  4J87 A;  3RSE C;  1E8M A;  2P9S C;  2PBI B;  3E0C A;  1L0Q A;  4A0A A;  1A12 A;  3CFV A;  1R5M A;  2HKR A;  4J73 A;  4A0A B;  2HKM A;  2VZ3 A;  4CY2 A;  2AGL A;  4BP9 A;  2IWK A;  4NBM A;  5M5U A;  4JSV C;  4EWR A;  3I2N A;  4NC4 A;  3L4M D;  2HYE A;  4FHL A;  3DDU A;  3JZH A;  4E54 A;  3KRW B;  3VI3 A;  3V4V A;  4E54 B;  3V4P A;  4Z8L A;  4L1M A;  5TEF A;  5EMM B;  3NIG A;  3C75 H;  2VDK A;  4G55 A;  4D0K A;  4YVD A;  4QL1 A;  3I8C A;  3N0E A;  3OKW A;  3ZE1 A;  2IWF A;  2HES X;  3I8E A;  3RMZ D;  2CN2 A;  4J86 A;  4Z7N A;  2HU7 A;  3IJC A;  3C9C A;  1M1X A;  1UOP A;  4J78 A;  5IT9 g;  1OLZ A;  4RE5 A;  3O4J A;  2OK4 A;  4UI9 R;  4FA4 D;  3PSL A;  4O9D A;  3MMY A;  3BG0 A;  3MKQ A;  1E8N A;  1MG3 A;  3UR4 A;  4CZY A;  2B4E A;  3SWS D;  2YBA A;  3CIK B;  1GP2 B;  4LG9 A;  4ZOX A;  1GOT B;  2AQ5 A;  4L3H D;  3UVL A;  4A7J A;  3SJL D;  2PM9 B;  3F3F A;  4J8B A;  2VDL A;  1O6F A;  2IUP A;  2QZP A;  3N0D A;  1H2X A;  1SQ9 A;  2HXC A;  5CYK A;  3HFQ A;  4GM8 A;  1U2V C;  3PXT D;  3RN1 D;  5CYK B;  2AGX A;  1TYQ C;  3OW8 A;  5GXI A;  5GXH A;  2IUV A;  2HJ4 A;  4PBZ A;  2J57 G;  2BCJ B;  4BCB A;  2P9U C;  1NEX B;  4JSN C;  1N6E A;  2BKL A;  1K32 A;  4IRZ A;  2VDQ A;  3J80 g;  3AH8 B;  3EMH A;  2YNO A;  3JPX A;  2I3S A;  4PSW B;  2H6K A;  1PI6 A;  5E6R A;  4ESG A;  1GG2 B;  4JHP C;  2GC7 A;  1I2M B;  3C99 A;  4I79 A;  1O6G A;  3IUM A;  4O1Q D;  3JZN A;  4AMY A;  2UZX B;  3EQ8 A;  2EBS A;  4WK4 A;  2MTA H;  2YMU A;  3CFS B;  2AH0 A;  3B7F A;  3JB9 L;  4QT8 A;  2QXV A;  1YR2 A;  4X61 B;  4GQ1 A;  2WQ8 A;  3AFC A;  1H2W A;  4Y5R D;  5CXC B;  3IIY A;  3ZE2 A;  3IUN A;  1Q47 A;  1TYE A;  2EIC A;  3MXX A;  2IUQ A;  3I7P A;  4HDJ A;  1B9Y A;  4GMB A;  4FA1 D;  3RFG A;  5EAP A;  3SVW D;  1PEV A;  5TDH B;  2VDO A;  1XHM A;  2B5L A;  3FGB A;  4OZU A;  3KCI A;  4PBY A;  1P22 A;  1VE7 A;  4Y7R A;  4FA9 D;  2VDR A;  5C86 A;  4ES0 A;  1QFM A;  3EG6 A;  3P4F A;  3MKS B;  5IC7 A;  1H2Z A;  2TRC B;  4Z7O A;  4G56 B;  1JMX B;  4G1E A;  2VDN A;  5GMK n;  1T2X A;  3I7L A;  4X60 B;  5FFO A;  3UVM A;  1B9X A;  4ERQ A;  1XIP A;  3I7H A;  3AL9 A;  3QI0 A;  4GGA A;  2Z2P A;  4MK0 B;  3IJ0 A;  1QFS A;  1JTD B;  2EID A;  3J81 g;  3O4G A;  3OKT A;  1JV2 A;  2CNX A;  2UZY B;  1C9L A;  3DSM A;  1PGU A;  2H9P A;  4WJK A;  3VI4 A;  4CZV A;  4ERZ A;  5H14 A;  2H9L A;  3JRP A;  2H3X A;  4FWW A;  1GOH A;  1MDA H;  4OWR A;  4MMZ A;  2HU8 A;  4GGC A;  3EI3 A;  2HU5 A;  5M5S A;  4AX4 A;  4GZ8 A;  3EI3 B;  4J84 A;  2XYI A;  4AMZ A;  2Q7Q A;  3BWS A;  3GRE A;  3IUQ A;  2XL2 A;  4IMM A;  2J56 H;  4XEI C;  4L9O A;  3EI1 A;  4LGN A;  3JAM g;  1RI6 A;  1YFQ A;  3EI1 B;  2CO0 A;  5M61 A;  1H2Y A;  1A0R B;  2AGZ A;  2XU7 A;  4D9S A;  1GOF A;  2G9A A;  2GC4 A;  3I7N A;  5TEE A;  1S4U X;  4GM3 A;  5FA5 B; 
#chains in the Genus database with same CATH homology
 4A11 A;  3PXS D;  3IKO A;  4A11 B;  2YNN A;  2I0T A;  5K1C C;  5EMJ B;  4J79 A;  2O9K A;  4PNK B;  5FKR A;  2CE9 A;  3V5W B;  5EAR A;  4J8G A;  3DXM C;  3RRM C;  3OTT A;  2W18 A;  3SBP A;  1XKS A;  4H5J A;  3SHF A;  5I5J A;  5TF2 A;  4ERY A;  5A2Q g;  2H47 A;  3NVX A;  5FQD A;  2CE8 A;  4A08 A;  4A09 A;  5C2V B;  3F3G A;  5HE1 B;  4A08 B;  4A09 B;  1OMW B;  4O3U B;  5JWZ A;  5K19 A;  5H17 A;  3PVW B;  4J81 A;  2I3T A;  4U7A A;  4BL0 A;  4JT6 C;  4AOW A;  5EML B;  5CXB A;  1N6D A;  3RFH A;  2CN3 A;  5CXB B;  3DM0 A;  2OVP B;  5FKQ A;  3UVO A;  4FAN D;  2AGY A;  3EU7 A;  4R7A B;  2OJY A;  2AH1 A;  2Z2O A;  4FB1 D;  4O3T B;  4A0B A;  2OVQ B;  4CI8 A;  3OKY A;  3RLM D;  4A0B B;  3UKR C;  5HE0 B;  3OKY B;  3JZG A;  5EM2 A;  2OVR B;  4CC9 A;  3UVK A;  4FA5 D;  5EM2 B;  4BUJ C;  3IJ1 A;  4J0W A;  4JT5 C;  5IJ7 E;  3SLE D;  4O45 A;  4LG8 A;  1SQJ A;  4L3G D;  3I89 A;  4JSX C;  5I5I A;  2P9K C;  5FKS A;  5AFU 3;  5C2W B;  4TZ4 A;  4CY5 A;  4GM9 A;  4PSX B;  3PVU B;  5FLX g;  3C5M A;  2H9N A;  1GXR A;  2YNP A;  2P9N C;  3EI4 A;  2GNQ A;  4ZOV A;  4CI1 A;  5HE2 B;  3EI4 B;  4CY1 A;  4PC0 A;  3PSC B;  3I7O A;  3V9F A;  4XYH A;  4JD2 C;  5IGQ A;  4AEZ A;  4D6V A;  5SXM A;  2B5M A;  4X3E A;  2P9P C;  2P9L C;  3F3P A;  2HJB A;  3DXK C;  3MZL A;  4J82 A;  2IUR A;  1QNI A;  3EI2 A;  2I0R A;  1K8K C;  3RN0 D;  4ZOZ A;  1TBG A;  3EI2 B;  5EMK B;  4QRJ A;  4CI3 A;  5EAM A;  1MG2 A;  2H6Q A;  2QC5 A;  3UVN A;  2AGW A;  3KRX B;  2B5N A;  4XYI A;  2H9M A;  2CO0 C;  5HYN B;  3ZWL B;  2H68 A;  3SN6 B;  2P9I C;  2OIZ A;  5IJ8 E;  2IAA A;  5EAL A;  5KDO B;  3VH0 A;  3SCY A;  3VGZ A;  4JSP C;  1SHY B;  2PM6 B;  2PM9 A;  3SBR A;  4CZX A;  3I7K A;  3A0F A;  2H13 A;  4GQ2 P;  1U4C A;  3PXW D;  1PBY B;  3ORV D;  4NSX A;  2G99 A;  5GSA A;  1FWX A;  3PE7 A;  1VYH C;  2H14 A;  4CI2 A;  3SBQ A;  4A2M A;  4BH6 A;  3BG1 A;  3ODT A;  3V7D B;  1NR0 A;  1JOF A;  4CY3 A;  4KFM B;  2H6N A;  2XL3 A;  3L4O D;  5H1M A;  5FKT A;  5I5M A;  3AL8 A;  3DWL C;  5HE3 B;  5IGO A;  3AL8 B;  4GGD A;  5THA A;  4ZN4 A;  4QQE A;  3EWE A;  5HQG A;  3GFC A;  4H5I A;  4J77 A;  3W15 A;  2BBK H;  4L1Q D;  1JJU B;  5B4W A;  4IA9 A;  5FXY A;  1JMZ B;  2OK6 A;  3NVN A;  3UKU C;  2YB8 B;  3FRX A;  3IIW A;  3NVQ A;  5CXC A;  3SMR A;  4A2L A;  1N6F A;  1ERJ A;  5AJA A;  4K3J B;  4K3I D;  3JRO A;  4PXW A;  4E5Z A;  3FM0 A;  3VA6 A;  3SFZ A;  5AMS A;  4E5Z B;  3K27 A;  4ZOY A;  4FAV D;  3K26 A;  4GQB B;  3OL2 A;  2Z2N A;  2PM7 B;  2I0S A;  4J0X A;  4JXM A;  3OL2 B;  4U1E I;  3MZK A;  2J55 H;  3ULE C;  4N14 A;  4X63 B;  5C9Z B;  3SXT D;  3U4Y A;  4J87 A;  3RSE C;  2P9S C;  2PBI B;  3E0C A;  1L0Q A;  4A0A A;  3CFV A;  1R5M A;  2HKR A;  4J73 A;  4A0A B;  2HKM A;  4CY2 A;  2AGL A;  2IWK A;  4JSV C;  4EWR A;  3I2N A;  2HYE A;  3L4M D;  4FHL A;  3JZH A;  4E54 A;  3KRW B;  4E54 B;  4Z8L A;  5TEF A;  5EMM B;  3C75 H;  4D0K A;  4YVD A;  4QL1 A;  3I8C A;  3N0E A;  3OKW A;  2IWF A;  2HES X;  3I8E A;  3RMZ D;  2CN2 A;  4J86 A;  3IJC A;  3C9C A;  4J78 A;  5IT9 g;  1OLZ A;  2OK4 A;  4UI9 R;  4FA4 D;  3PSL A;  4O9D A;  3MMY A;  3BG0 A;  3MKQ A;  1MG3 A;  3UR4 A;  4CZY A;  2B4E A;  3SWS D;  2YBA A;  3CIK B;  1GP2 B;  4LG9 A;  4ZOX A;  1GOT B;  2AQ5 A;  4L3H D;  3UVL A;  4A7J A;  3SJL D;  2PM9 B;  3F3F A;  4J8B A;  2IUP A;  3N0D A;  1SQ9 A;  2HXC A;  5CYK A;  3HFQ A;  4GM8 A;  1U2V C;  3PXT D;  3RN1 D;  5CYK B;  2AGX A;  1TYQ C;  3OW8 A;  5GXI A;  5GXH A;  2IUV A;  2HJ4 A;  4PBZ A;  2J57 G;  2BCJ B;  2P9U C;  1NEX B;  4JSN C;  1N6E A;  1K32 A;  3J80 g;  3AH8 B;  3EMH A;  2YNO A;  3JPX A;  2I3S A;  4PSW B;  2H6K A;  1PI6 A;  4ESG A;  1GG2 B;  2GC7 A;  3C99 A;  4I79 A;  4O1Q D;  3JZN A;  2UZX B;  2EBS A;  2MTA H;  2YMU A;  3CFS B;  2AH0 A;  3B7F A;  3JB9 L;  4QT8 A;  2QXV A;  4X61 B;  4GQ1 A;  3AFC A;  4Y5R D;  5CXC B;  3IIY A;  1Q47 A;  3MXX A;  2IUQ A;  3I7P A;  4HDJ A;  1B9Y A;  4GMB A;  4FA1 D;  3RFG A;  5EAP A;  3SVW D;  1PEV A;  5TDH B;  1XHM A;  2B5L A;  3FGB A;  4OZU A;  4PBY A;  4Y7R A;  1P22 A;  4FA9 D;  4ES0 A;  3EG6 A;  3P4F A;  3MKS B;  5IC7 A;  2TRC B;  4G56 B;  1JMX B;  5GMK n;  3I7L A;  4X60 B;  3UVM A;  1B9X A;  4ERQ A;  1XIP A;  3I7H A;  3AL9 A;  4GGA A;  2Z2P A;  4MK0 B;  3IJ0 A;  3J81 g;  3OKT A;  2CNX A;  2UZY B;  3DSM A;  1PGU A;  2H9P A;  4CZV A;  4ERZ A;  5H14 A;  2H9L A;  3JRP A;  2H3X A;  4FWW A;  1MDA H;  4OWR A;  4GGC A;  3EI3 A;  4GZ8 A;  3EI3 B;  4J84 A;  2XYI A;  2Q7Q A;  3BWS A;  3GRE A;  2XL2 A;  4IMM A;  2J56 H;  4XEI C;  4L9O A;  3EI1 A;  4LGN A;  3JAM g;  1RI6 A;  1YFQ A;  3EI1 B;  2CO0 A;  2AGZ A;  1A0R B;  2XU7 A;  2GC4 A;  2G9A A;  3I7N A;  5TEE A;  1S4U X;  4GM3 A;  5FA5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...