5EMMB

Crystal structure of prmt5:mep50 with compound 15 and sinefungin
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
313
structure length
313
Chain Sequence
EWNLPPNAPACMERQLEAARYRSDGALLLGASSLSGRCWAGSLWLFKDPCAAPNEGFCSAGVQTEAGVADLTWVGERGILVASDSGAVELWELDENETLIVSKFCKYEHDDIVSTVSVLSSGTQAVSGSKDICIKVWDLAQQVVLSSYRAHAAQVTCVAASPHKDSVFLSCSEDNRILLWDTRCPKPASQIGCSAPGYLPTSLAWHPQQSEVFVFGDENGTVSLVDTKSTSCVLSSAVHSQCVTGLVFSPHSVPFLASLSEDCSLAVLDSSLSELFRSQAHRDFVRDATWSPLNHSLLTTVGWDHQVVHHVVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transferase inhibitor
molecule keywords Protein arginine N-methyltransferase 5
publication title Structure and Property Guided Design in the Identification of PRMT5 Tool Compound EPZ015666.
pubmed doi rcsb
source organism Homo sapiens
total genus 77
structure length 313
sequence length 313
ec nomenclature
pdb deposition date 2015-11-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5emmB00
5HE2B 2YBAA 4O3UB 2EBSA 3JAMg 1GP2B 5EMKB 5AMSA 1MG2A 4QL1A 4PBYA 4LG9A 3IKOA 3J81g 5IC7A 4FA1D 3CFVA 4J8GA 2H9NA 5CXCB 2IUPA 2H68A 4A08B 4XYIA 4X63B 4KFMB 4Y5RD 2H9MA 1U2VC 3SXTD 1JOFA 4O3TB 4JSNC 3SWSD 4A2LA 2I0SA 2CO0A 4H5IA 1Q47A 2YB8B 3CIKB 2B4EA 4CY5A 2AH1A 3SN6B 4A2MA 5CXCA 1S4UX 2OVPB 3OKTA 2UZYB 4FA9D 4A08A 4GZ8A 2YNNA 4J77A 4XEIC 1K8KC 2AH0A 2Z2NA 5KDOB 4A0AB 5HYNB 4J82A 4ZOXA 4CC9A 2I3SA 3EG6A 4IA9A 1B9XA 4FA5D 4JSPC 1VYHC 3MZLA 4EWRA 2IWKA 3U4YA 4O45A 2YMUA 4ZOVA 4JD2C 5CXBB 3JRPA 5FA5B 4GM8A 3J80g 2P9SC 2OJYA 4L3GD 4A0AA 5HQGA 3K26A 4QQEA 4BL0A 4QRJA 3RFGA 3V9FA 3SLED 5FLXg 3SVWD 4CI8A 4PSXB 4J78A 3L4MD 1NR0A 3KRXB 3VA6A 4JSVC 3IJ0A 5CXBA 2P9PC 5C2VB 4UI9R 4A0BB 3FGBA 3AH8B 3C5MA 3JZGA 1N6DA 1ERJA 3VGZA 3RLMD 3EI3B 1PBYB 2CO0C 4X61B 3JPXA 2PM7B 5IGOA 4PNKB 5H17A 2IUVA 1PI6A 3KRWB 1TBGA 4GQ1A 1XIPA 5A2Qg 1A0RB 4GGCA 3PSLA 3NVNA 4ERZA 2CNXA 4AEZA 2J56H 3EI3A 3RFHA 2CN3A 4GGAA 3F3PA 4PBZA 3SBPA 3W15A 5FKTA 2YNOA 5IGQA 2HJBA 5HE3B 3MKSB 5B4WA 4ZN4A 4ZOYA 2IWFA 5IT9g 4CY1A 2TRCB 2G9AA 4X60B 1JMXB 3ORVD 2H13A 3IJCA 4GM3A 3EU7A 3PVWB 4J84A 3SMRA 4BH6A 4XYHA 2P9UC 3N0DA 2BBKH 5IJ7E 5EAPA 2YNPA 3UVLA 3I7NA 4Z8LA 5H14A 3RN0D 4YVDA 3V7DB 1XKSA 2I3TA 2H3XA 3P4FA 3V5WB 3MKQA 3SBQA 2W18A 1TYQC 4OWRA 2HYEA 4N14A 4G56B 5TDHB 3DXKC 3CFSB 2XYIA 1GG2B 2Z2OA 4U7AA 4H5JA 1XHMA 3DSMA 2H6QA 1NEXB 5EAMA 3AFCA 4A11B 3C9CA 5FKRA 2IAAA 4O1QD 2OK6A 3I8EA 2J57G 4K3ID 3NVQA 3SBRA 3UKUC 3RMZD 5IJ8E 5K19A 5GXIA 3ZWLB 5EM2B 1U4CA 3C99A 4A11A 2I0TA 2AGLA 4A7JA 2O9KA 5K1CC 5HE0B 3EI1B 3SFZA 1PEVA 3FRXA 1MG3A 2IURA 1K32A 4ESGA 5EMLB 5EALA 5EM2A 1N6FA 3DXMC 1JJUB 4LGNA 5I5IA 3JZHA 4MK0B 4GMBA 4OZUA 3PXTD 2MTAH 4CZYA 3UKRC 1N6EA 3I7KA 4NSXA 4FAND 3EI1A 3OKYA 2GC4A 4J0WA 1GOTB 2XL3A 3RRMC 3VH0A 1GXRA 5HE1B 2HESX 3F3FA 3IIWA 1OMWB 2B5NA 3I7LA 4FWWA 3I89A 3I8CA 4CZVA 1YFQA 3ULEC 1B9YA 2QXVA 3UR4A 3DWLC 2HKRA 5TEEA 4D6VA 5CYKB 2OIZA 3BG0A 2AGXA 2HXCA 3I7OA 3PVUB 3K27A 5FKQA 2CE8A 3AL8B 4LG8A 4ZOZA 3ODTA 4AOWA 2PM9B 2P9IC 5FQDA 2GNQA 4PC0A 5CYKA 4J79A 5GSAA 3EI2A 3EMHA 2HKMA 4L1QD 4Y7RA 1MDAH 4BUJC 2CN2A 2QC5A 4GQBB 4CZXA 4CI1A 3L4OD 3AL8A 1PGUA 5EMJB 2PM9A 3OKWA 4PXWA 5AFU3 1OLZA 2H47A 4QT8A 2OVRB 4JSXC 4K3JB 2IUQA 3EI4A 2AGZA 4IMMA 5THAA 2J55H 2P9KC 5TEFA 3NVXA 3UVNA 3JROA 4E5ZB 4X3EA 4ERQA 4A09B 4JT5C 3FM0A 5FXYA 4FHLA 1FWXA 2UZXB 2Q7QA 2I0RA 4J87A 4PSWB 3C75H 4J0XA 4O9DA 3UVMA 4L9OA 2OK4A 4JXMA 4E5ZA 3SCYA 2P9LC 2AGYA 2PM6B 4FA4D 3UVOA 4A09A 3MXXA 2GC7A 1L0QA 3RN1D 3OW8A 3SJLD 2H9PA 5GXHA 3PXWD 3BG1A 1P22A 3OKYB 3AL9A 4J86A 5I5MA 2H6NA 4E54B 5EMMB 4CY3A 3DM0A 3I7HA 1RI6A 5C9ZB 2B5MA 1SQJA 3A0FA 2XL2A 4FB1D 4J73A 1SHYB 4CI2A 2CE9A 4R7AB 4GQ2P 3BWSA 4I79A 3EWEA 5I5JA 2B5LA 5JWZA 2AQ5A 4GGDA 4E54A 2AGWA 3HFQA 4ERYA 2XU7A 2G99A 5FKSA 4L3HD 2H14A 1R5MA 2P9NC 2H9LA 3RSEC 4FAVD 1QNIA 4D0KA 5GMKn 4J8BA 2HJ4A 3GFCA 2H6KA 3I2NA 3B7FA 4U1EI 3IJ1A 3MMYA 4JT6C 3OL2B 3EI2B 4GM9A 4A0BA 3I7PA 3JZNA 5EARA 3F3GA 5TF2A 1JMZB 4CI3A 3N0EA 5SXMA 4ES0A 3JB9L 2Z2PA 1SQ9A 3GREA 4TZ4A 3PXSD 3UVKA 2PBIB 5H1MA 3OTTA 3PE7A 4HDJA 3SHFA 5C2WB 5AJAA 3EI4B 3IIYA 3OL2A 4CY2A 4J81A 3E0CA 2OVQB 3PSCB 3MZKA 2BCJB
chains in the Genus database with same CATH superfamily
5HE2B 2YBAA 4O3UB 2EBSA 4WJKA 3JAMg 3IUQA 1GP2B 5EMKB 4G1EA 5AMSA 1MG2A 4QL1A 4RE6A 4PBYA 3O4GA 4LG9A 3IKOA 3ZDXA 3J81g 4Z7NA 5IC7A 2QR5A 4FA1D 3CFVA 4J8GA 2H9NA 5CXCB 2IUPA 2H68A 3QI0A 4A08B 4XYIA 4X63B 4KFMB 4Y5RD 2H9MA 1U2VC 3SXTD 1JOFA 1UTCA 4O3TB 3T3PA 4JSNC 3SWSD 4A2LA 2I0SA 2CO0A 4H5IA 1Q47A 2YB8B 1TYEA 3CIKB 2B4EA 2VDPA 4CY5A 2AH1A 3ZE0A 4BCDA 3SN6B 4A2MA 3MUNA 5CXCA 1S4UX 2OVPB 3OKTA 2UZYB 4FA9D 4A08A 3KCIA 2YNNA 4GZ8A 4J77A 3K6SA 1UOPA 2VDLA 5E6RA 4XEIC 1K8KC 2AH0A 2Z2NA 5KDOB 4A0AB 5HYNB 4J82A 5E6UA 4ZOXA 4CC9A 2I3SA 3EG6A 3ZDZA 4IA9A 1B9XA 4FA5D 4JSPC 3ZDYA 1VYHC 3MZLA 4EWRA 2IWKA 3U4YA 4O45A 2YMUA 4ZOVA 4JD2C 5CXBB 4D9SA 3JRPA 1VE7A 5FA5B 4GM8A 3J80g 2P9SC 2OJYA 4L3GD 4A0AA 5HQGA 3K26A 4QQEA 4BL0A 4QRJA 3RFGA 3V9FA 3SLED 5FLXg 3SVWD 3EQ9A 4CI8A 4PSXB 4J78A 3L4MD 1NR0A 3KRXB 4G55A 4JHNA 4JSVC 3T3MA 3IJ0A 3VA6A 5CXBA 2P9PC 5C2VB 4UI9R 4A0BB 3QHYB 3FGBA 4WK2A 3AH8B 3NIGA 1U8CA 3C5MA 3JZGA 5M5VA 1N6DA 1ERJA 3IUJA 3VGZA 2VDKA 3RLMD 1C9IA 3EI3B 1PBYB 2CO0C 4X61B 5C86A 3JPXA 2PM7B 5IGOA 3ZE2A 4PNKB 1O6FA 5H17A 2IUVA 1PI6A 3KRWB 1TBGA 4GQ1A 1XIPA 5A2Qg 1A0RB 4GGCA 4AMYA 3PSLA 3NVNA 4DNWA 4ERZA 2CNXA 4AEZA 2J56H 3EI3A 3RFHA 2CN3A 4MMYA 4GGAA 3F3PA 4NAAA 4PBZA 3SBPA 3W15A 5FKTA 2YNOA 5IGQA 3EQ8A 2HJBA 5HE3B 3DDUA 3NIFA 3MKSB 2VDOA 5B4WA 4ZN4A 4ZOYA 4DNUA 2IWFA 1K3IA 5IT9g 4CY1A 1H2XA 4O2WA 3O4JA 1T2XA 2TRCB 2G9AA 4X60B 1JMXB 3ORVD 2H13A 2VDMA 2VC2A 3IJCA 4GM3A 3EU7A 3PVWB 4J84A 3SMRA 4BH6A 4XYHA 2P9UC 3N0DA 2BBKH 5IJ7E 5EAPA 2YNPA 3UVLA 3I7NA 2EIDA 4Z8LA 5H14A 3RN0D 4BP8A 4YVDA 5HDBA 4AMZA 1YR2A 3V7DB 1XKSA 2WQ8A 2I3TA 4NC4A 2H3XA 3P4FA 3V5WB 3MKQA 3SBQA 2W18A 1TYQC 1UOOA 4OWRA 2HYEA 4N14A 4G56B 5TDHB 3DXKC 3CFSB 5M5UA 2VDRA 2XYIA 1GG2B 2Z2OA 4U7AA 3EQ7A 2VDNA 3IURA 4H5JA 1XHMA 3DSMA 1E5TA 2H6QA 1NEXB 5EAMA 3AFCA 4A11B 3C9CA 5FKRA 2IAAA 4O1QD 2OK6A 3I8EA 2J57G 4L1MA 4K3ID 3NVQA 3SBRA 3UKUC 3RMZD 5IJ8E 5E6SA 5K19A 5GXIA 3ZWLB 5EM2B 1U4CA 3C99A 4A11A 2I0TA 2AGLA 4A7JA 2O9KA 5K1CC 3NIDA 5HE0B 3EI1B 2HU8A 3SFZA 4WK4A 1PEVA 3FRXA 3MUOA 1MG3A 2IURA 1K32A 3K72A 4ESGA 4AN0A 1UOQA 4G1MA 5EALA 5EMLB 1H2WA 5EM2A 1E8NA 2EICA 1N6FA 3DXMC 1JJUB 4LGNA 5I5IA 3JZHA 4MK0B 2EIBA 4GMBA 4OZUA 3PXTD 2MTAH 4CZYA 3UKRC 1N6EA 3I7KA 4NSXA 4FAND 4Z7QA 3EI1A 2XE4A 3K71A 3OKYA 2GC4A 4J0WA 1GOTB 2XL3A 3RRMC 4BP9A 3VH0A 1GXRA 1GOHA 3IUMA 5HE1B 5M61A 2JKXA 2XDWA 2HESX 2BKLA 3F3FA 3IIWA 5C92A 1OMWB 3I7LA 2B5NA 4FWWA 3I89A 4NBMA 3I8CA 4CZVA 1YFQA 3ULEC 1GOFA 1B9YA 3V4VA 2QXVA 3IJEA 3DWLC 3UR4A 4O02A 2HKRA 5TEEA 4D6VA 5CYKB 5M5SA 2OIZA 3BG0A 2AGXA 3O4HA 2HXCA 3I7OA 3PVUB 3K27A 5FFOA 5FKQA 2CE8A 3AL8B 3IVMA 1M1XA 4LG8A 4ZOZA 3ODTA 4AOWA 2PM9B 2P9IC 2HU5A 5FQDA 3GD1I 2GNQA 4JHPC 4PC0A 3VI4A 1O6GA 5CYKA 1L5GA 4J79A 5GSAA 3EI2A 3EMHA 2HKMA 4L1QD 4Y7RA 1MDAH 4BUJC 2CN2A 2QC5A 3VI3A 4MMZA 4GQBB 4CZXA 4CI1A 3L4OD 3AL8A 1PGUA 5EMJB 2PM9A 4MMXA 3OKWA 4PXWA 5AFU3 1OLZA 1JV2A 2H47A 4QT8A 1GOGA 1BPOA 2OVRB 4JSXC 4K3JB 2IUQA 3EI4A 2AGZA 4IMMA 5THAA 2J55H 1JTDB 2P9KC 2XZGA 5TEFA 5M5TA 2EIEA 3NVXA 3UVNA 3V4PA 3MVDK 3JROA 4E5ZB 4X3EA 2VZ3A 4ERQA 4A09B 4JT5C 3FM0A 5FXYA 4WK0A 4FHLA 1FWXA 2UZXB 2Q7QA 2I0RA 4J87A 4PSWB 3C75H 4J0XA 4O9DA 3UVMA 2VZ1A 4L9OA 2OK4A 4JXMA 4E5ZA 3SCYA 2P9LC 2AGYA 2PM6B 4FA4D 3UVOA 4A09A 3MXXA 1C9LA 2GC7A 1L0QA 3FCSA 4UM8A 3RN1D 4BCCA 3OW8A 4IRZA 3SJLD 1VE6A 1QFMA 2H9PA 5GXHA 3PXWD 3BG1A 1P22A 3OKYB 3AL9A 4J86A 5I5MA 4RE5A 2H6NA 4E54B 5EMMB 3FCUA 4CY3A 3DM0A 3I7HA 1RI6A 5FFGA 5C9ZB 2B5MA 1SQJA 3A0FA 2XL2A 4FB1D 4DNVA 3IUNA 4J73A 1SHYB 4QAMA 4CI2A 5M5RA 2CE9A 4R7AB 4GQ2P 2HU7A 3BWSA 4I79A 1QFSA 3EWEA 1H2YA 1I2MB 5I5JA 2B5LA 5JWZA 2AQ5A 4GGDA 4E54A 1A12A 2AGWA 2QZPA 2XU7A 3HFQA 2G99A 5FKSA 4AN1A 4ERYA 4L3HD 2H14A 3ZE1A 1R5MA 2P9NC 2H9LA 4UM9A 4AX4A 3RSEC 4FAVD 1QNIA 4D0KA 5GMKn 1VZ3A 4J8BA 2HJ4A 3GFCA 4Z7OA 2H6KA 3I2NA 3B7FA 4U1EI 2VDQA 3IJ1A 3MMYA 4JT6C 3OL2B 3EI2B 4GM9A 4A0BA 3I7PA 3JZNA 5EARA 3F3GA 4NENA 5TF2A 1JMZB 4CI3A 3N0EA 3O4IA 5SXMA 4ES0A 3IULA 2Z2PA 3JB9L 1SQ9A 3GREA 4TZ4A 3PXSD 4BCBA 3UVKA 1E8MA 2PBIB 5H1MA 3OTTA 3PE7A 4HDJA 1H2ZA 3SHFA 5C2WB 5AJAA 3EI4B 3IIYA 3OL2A 4CY2A 4J81A 3E0CA 2OVQB 1VZ2A 3PSCB 3OF7A 3GC3B 3MZKA 2BCJB
chains in the Genus database with same CATH topology
5HE2B 2YBAA 4O3UB 2EBSA 3JAMg 1GP2B 5EMKB 5AMSA 1MG2A 4QL1A 4PBYA 4LG9A 3IKOA 3J81g 5IC7A 4FA1D 3CFVA 4J8GA 2H9NA 5CXCB 2IUPA 2H68A 4A08B 4XYIA 4X63B 4KFMB 4Y5RD 2H9MA 1U2VC 3SXTD 1JOFA 4O3TB 4JSNC 3SWSD 4A2LA 2I0SA 2CO0A 4H5IA 1Q47A 2YB8B 3CIKB 2B4EA 4CY5A 2AH1A 3SN6B 4A2MA 5CXCA 1S4UX 2OVPB 3OKTA 2UZYB 4FA9D 4A08A 4GZ8A 2YNNA 4J77A 4XEIC 1K8KC 2AH0A 2Z2NA 5KDOB 4A0AB 5HYNB 4J82A 4ZOXA 4CC9A 2I3SA 3EG6A 4IA9A 1B9XA 4FA5D 4JSPC 1VYHC 3MZLA 4EWRA 2IWKA 3U4YA 4O45A 2YMUA 4ZOVA 4JD2C 5CXBB 3JRPA 5FA5B 4GM8A 3J80g 2P9SC 2OJYA 4L3GD 4A0AA 5HQGA 3K26A 4QQEA 4BL0A 4QRJA 3RFGA 3V9FA 3SLED 5FLXg 3SVWD 4CI8A 4PSXB 4J78A 3L4MD 1NR0A 3KRXB 3VA6A 4JSVC 3IJ0A 5CXBA 2P9PC 5C2VB 4UI9R 4A0BB 3FGBA 3AH8B 3C5MA 3JZGA 1N6DA 1ERJA 3VGZA 3RLMD 3EI3B 1PBYB 2CO0C 4X61B 3JPXA 2PM7B 5IGOA 4PNKB 5H17A 2IUVA 1PI6A 3KRWB 1TBGA 4GQ1A 1XIPA 5A2Qg 1A0RB 4GGCA 3PSLA 3NVNA 4ERZA 2CNXA 4AEZA 2J56H 3EI3A 3RFHA 2CN3A 4GGAA 3F3PA 4PBZA 3SBPA 3W15A 5FKTA 2YNOA 5IGQA 2HJBA 5HE3B 3MKSB 5B4WA 4ZN4A 4ZOYA 2IWFA 5IT9g 4CY1A 2TRCB 2G9AA 4X60B 1JMXB 3ORVD 2H13A 3IJCA 4GM3A 3EU7A 3PVWB 4J84A 3SMRA 4BH6A 4XYHA 2P9UC 3N0DA 2BBKH 5IJ7E 5EAPA 2YNPA 3UVLA 3I7NA 4Z8LA 5H14A 3RN0D 4YVDA 3V7DB 1XKSA 2I3TA 2H3XA 3P4FA 3V5WB 3MKQA 3SBQA 2W18A 1TYQC 4OWRA 2HYEA 4N14A 4G56B 5TDHB 3DXKC 3CFSB 2XYIA 1GG2B 2Z2OA 4U7AA 4H5JA 1XHMA 3DSMA 2H6QA 1NEXB 5EAMA 3AFCA 4A11B 3C9CA 5FKRA 2IAAA 4O1QD 2OK6A 3I8EA 2J57G 4K3ID 3NVQA 3SBRA 3UKUC 3RMZD 5IJ8E 5K19A 5GXIA 3ZWLB 5EM2B 1U4CA 3C99A 4A11A 2I0TA 2AGLA 4A7JA 2O9KA 5K1CC 5HE0B 3EI1B 3SFZA 1PEVA 3FRXA 1MG3A 2IURA 1K32A 4ESGA 5EMLB 5EALA 5EM2A 1N6FA 3DXMC 1JJUB 4LGNA 5I5IA 3JZHA 4MK0B 4GMBA 4OZUA 3PXTD 2MTAH 4CZYA 3UKRC 1N6EA 3I7KA 4NSXA 4FAND 3EI1A 3OKYA 2GC4A 4J0WA 1GOTB 2XL3A 3RRMC 3VH0A 1GXRA 5HE1B 2HESX 3F3FA 3IIWA 1OMWB 2B5NA 3I7LA 4FWWA 3I89A 3I8CA 4CZVA 1YFQA 3ULEC 1B9YA 2QXVA 3UR4A 3DWLC 2HKRA 5TEEA 4D6VA 5CYKB 2OIZA 3BG0A 2AGXA 2HXCA 3I7OA 3PVUB 3K27A 5FKQA 2CE8A 3AL8B 4LG8A 4ZOZA 3ODTA 4AOWA 2PM9B 2P9IC 5FQDA 2GNQA 4PC0A 5CYKA 4J79A 5GSAA 3EI2A 3EMHA 2HKMA 4L1QD 4Y7RA 1MDAH 4BUJC 2CN2A 2QC5A 4GQBB 4CZXA 4CI1A 3L4OD 3AL8A 1PGUA 5EMJB 2PM9A 3OKWA 4PXWA 5AFU3 1OLZA 2H47A 4QT8A 2OVRB 4JSXC 4K3JB 2IUQA 3EI4A 2AGZA 4IMMA 5THAA 2J55H 2P9KC 5TEFA 3NVXA 3UVNA 3JROA 4E5ZB 4X3EA 4ERQA 4A09B 4JT5C 3FM0A 5FXYA 4FHLA 1FWXA 2UZXB 2Q7QA 2I0RA 4J87A 4PSWB 3C75H 4J0XA 4O9DA 3UVMA 4L9OA 2OK4A 4JXMA 4E5ZA 3SCYA 2P9LC 2AGYA 2PM6B 4FA4D 3UVOA 4A09A 3MXXA 2GC7A 1L0QA 3RN1D 3OW8A 3SJLD 2H9PA 5GXHA 3PXWD 3BG1A 1P22A 3OKYB 3AL9A 4J86A 5I5MA 2H6NA 4E54B 5EMMB 4CY3A 3DM0A 3I7HA 1RI6A 5C9ZB 2B5MA 1SQJA 3A0FA 2XL2A 4FB1D 4J73A 1SHYB 4CI2A 2CE9A 4R7AB 4GQ2P 3BWSA 4I79A 3EWEA 5I5JA 2B5LA 5JWZA 2AQ5A 4GGDA 4E54A 2AGWA 3HFQA 4ERYA 2XU7A 2G99A 5FKSA 4L3HD 2H14A 1R5MA 2P9NC 2H9LA 3RSEC 4FAVD 1QNIA 4D0KA 5GMKn 4J8BA 2HJ4A 3GFCA 2H6KA 3I2NA 3B7FA 4U1EI 3IJ1A 3MMYA 4JT6C 3OL2B 3EI2B 4GM9A 4A0BA 3I7PA 3JZNA 5EARA 3F3GA 5TF2A 1JMZB 4CI3A 3N0EA 5SXMA 4ES0A 3JB9L 2Z2PA 1SQ9A 3GREA 4TZ4A 3PXSD 3UVKA 2PBIB 5H1MA 3OTTA 3PE7A 4HDJA 3SHFA 5C2WB 5AJAA 3EI4B 3IIYA 3OL2A 4CY2A 4J81A 3E0CA 2OVQB 3PSCB 3MZKA 2BCJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HE2 B;  2YBA A;  4O3U B;  2EBS A;  3JAM g;  1GP2 B;  5EMK B;  5AMS A;  1MG2 A;  4QL1 A;  4PBY A;  4LG9 A;  3IKO A;  3J81 g;  5IC7 A;  4FA1 D;  3CFV A;  4J8G A;  2H9N A;  5CXC B;  2IUP A;  2H68 A;  4A08 B;  4XYI A;  4X63 B;  4KFM B;  4Y5R D;  2H9M A;  1U2V C;  3SXT D;  1JOF A;  4O3T B;  4JSN C;  3SWS D;  4A2L A;  2I0S A;  2CO0 A;  4H5I A;  1Q47 A;  2YB8 B;  3CIK B;  2B4E A;  4CY5 A;  2AH1 A;  3SN6 B;  4A2M A;  5CXC A;  1S4U X;  2OVP B;  3OKT A;  2UZY B;  4FA9 D;  4A08 A;  4GZ8 A;  2YNN A;  4J77 A;  4XEI C;  1K8K C;  2AH0 A;  2Z2N A;  5KDO B;  4A0A B;  5HYN B;  4J82 A;  4ZOX A;  4CC9 A;  2I3S A;  3EG6 A;  4IA9 A;  1B9X A;  4FA5 D;  4JSP C;  1VYH C;  3MZL A;  4EWR A;  2IWK A;  3U4Y A;  4O45 A;  2YMU A;  4ZOV A;  4JD2 C;  5CXB B;  3JRP A;  5FA5 B;  4GM8 A;  3J80 g;  2P9S C;  2OJY A;  4L3G D;  4A0A A;  5HQG A;  3K26 A;  4QQE A;  4BL0 A;  4QRJ A;  3RFG A;  3V9F A;  3SLE D;  5FLX g;  3SVW D;  4CI8 A;  4PSX B;  4J78 A;  3L4M D;  1NR0 A;  3KRX B;  3VA6 A;  4JSV C;  3IJ0 A;  5CXB A;  2P9P C;  5C2V B;  4UI9 R;  4A0B B;  3FGB A;  3AH8 B;  3C5M A;  3JZG A;  1N6D A;  1ERJ A;  3VGZ A;  3RLM D;  3EI3 B;  1PBY B;  2CO0 C;  4X61 B;  3JPX A;  2PM7 B;  5IGO A;  4PNK B;  5H17 A;  2IUV A;  1PI6 A;  3KRW B;  1TBG A;  4GQ1 A;  1XIP A;  5A2Q g;  1A0R B;  4GGC A;  3PSL A;  3NVN A;  4ERZ A;  2CNX A;  4AEZ A;  2J56 H;  3EI3 A;  3RFH A;  2CN3 A;  4GGA A;  3F3P A;  4PBZ A;  3SBP A;  3W15 A;  5FKT A;  2YNO A;  5IGQ A;  2HJB A;  5HE3 B;  3MKS B;  5B4W A;  4ZN4 A;  4ZOY A;  2IWF A;  5IT9 g;  4CY1 A;  2TRC B;  2G9A A;  4X60 B;  1JMX B;  3ORV D;  2H13 A;  3IJC A;  4GM3 A;  3EU7 A;  3PVW B;  4J84 A;  3SMR A;  4BH6 A;  4XYH A;  2P9U C;  3N0D A;  2BBK H;  5IJ7 E;  5EAP A;  2YNP A;  3UVL A;  3I7N A;  4Z8L A;  5H14 A;  3RN0 D;  4YVD A;  3V7D B;  1XKS A;  2I3T A;  2H3X A;  3P4F A;  3V5W B;  3MKQ A;  3SBQ A;  2W18 A;  1TYQ C;  4OWR A;  2HYE A;  4N14 A;  4G56 B;  5TDH B;  3DXK C;  3CFS B;  2XYI A;  1GG2 B;  2Z2O A;  4U7A A;  4H5J A;  1XHM A;  3DSM A;  2H6Q A;  1NEX B;  5EAM A;  3AFC A;  4A11 B;  3C9C A;  5FKR A;  2IAA A;  4O1Q D;  2OK6 A;  3I8E A;  2J57 G;  4K3I D;  3NVQ A;  3SBR A;  3UKU C;  3RMZ D;  5IJ8 E;  5K19 A;  5GXI A;  3ZWL B;  5EM2 B;  1U4C A;  3C99 A;  4A11 A;  2I0T A;  2AGL A;  4A7J A;  2O9K A;  5K1C C;  5HE0 B;  3EI1 B;  3SFZ A;  1PEV A;  3FRX A;  1MG3 A;  2IUR A;  1K32 A;  4ESG A;  5EML B;  5EAL A;  5EM2 A;  1N6F A;  3DXM C;  1JJU B;  4LGN A;  5I5I A;  3JZH A;  4MK0 B;  4GMB A;  4OZU A;  3PXT D;  2MTA H;  4CZY A;  3UKR C;  1N6E A;  3I7K A;  4NSX A;  4FAN D;  3EI1 A;  3OKY A;  2GC4 A;  4J0W A;  1GOT B;  2XL3 A;  3RRM C;  3VH0 A;  1GXR A;  5HE1 B;  2HES X;  3F3F A;  3IIW A;  1OMW B;  2B5N A;  3I7L A;  4FWW A;  3I89 A;  3I8C A;  4CZV A;  1YFQ A;  3ULE C;  1B9Y A;  2QXV A;  3UR4 A;  3DWL C;  2HKR A;  5TEE A;  4D6V A;  5CYK B;  2OIZ A;  3BG0 A;  2AGX A;  2HXC A;  3I7O A;  3PVU B;  3K27 A;  5FKQ A;  2CE8 A;  3AL8 B;  4LG8 A;  4ZOZ A;  3ODT A;  4AOW A;  2PM9 B;  2P9I C;  5FQD A;  2GNQ A;  4PC0 A;  5CYK A;  4J79 A;  5GSA A;  3EI2 A;  3EMH A;  2HKM A;  4L1Q D;  4Y7R A;  1MDA H;  4BUJ C;  2CN2 A;  2QC5 A;  4GQB B;  4CZX A;  4CI1 A;  3L4O D;  3AL8 A;  1PGU A;  5EMJ B;  2PM9 A;  3OKW A;  4PXW A;  5AFU 3;  1OLZ A;  2H47 A;  4QT8 A;  2OVR B;  4JSX C;  4K3J B;  2IUQ A;  3EI4 A;  2AGZ A;  4IMM A;  5THA A;  2J55 H;  2P9K C;  5TEF A;  3NVX A;  3UVN A;  3JRO A;  4E5Z B;  4X3E A;  4ERQ A;  4A09 B;  4JT5 C;  3FM0 A;  5FXY A;  4FHL A;  1FWX A;  2UZX B;  2Q7Q A;  2I0R A;  4J87 A;  4PSW B;  3C75 H;  4J0X A;  4O9D A;  3UVM A;  4L9O A;  2OK4 A;  4JXM A;  4E5Z A;  3SCY A;  2P9L C;  2AGY A;  2PM6 B;  4FA4 D;  3UVO A;  4A09 A;  3MXX A;  2GC7 A;  1L0Q A;  3RN1 D;  3OW8 A;  3SJL D;  2H9P A;  5GXH A;  3PXW D;  3BG1 A;  1P22 A;  3OKY B;  3AL9 A;  4J86 A;  5I5M A;  2H6N A;  4E54 B;  5EMM B;  4CY3 A;  3DM0 A;  3I7H A;  1RI6 A;  5C9Z B;  2B5M A;  1SQJ A;  3A0F A;  2XL2 A;  4FB1 D;  4J73 A;  1SHY B;  4CI2 A;  2CE9 A;  4R7A B;  4GQ2 P;  3BWS A;  4I79 A;  3EWE A;  5I5J A;  2B5L A;  5JWZ A;  2AQ5 A;  4GGD A;  4E54 A;  2AGW A;  3HFQ A;  4ERY A;  2XU7 A;  2G99 A;  5FKS A;  4L3H D;  2H14 A;  1R5M A;  2P9N C;  2H9L A;  3RSE C;  4FAV D;  1QNI A;  4D0K A;  5GMK n;  4J8B A;  2HJ4 A;  3GFC A;  2H6K A;  3I2N A;  3B7F A;  4U1E I;  3IJ1 A;  3MMY A;  4JT6 C;  3OL2 B;  3EI2 B;  4GM9 A;  4A0B A;  3I7P A;  3JZN A;  5EAR A;  3F3G A;  5TF2 A;  1JMZ B;  4CI3 A;  3N0E A;  5SXM A;  4ES0 A;  3JB9 L;  2Z2P A;  1SQ9 A;  3GRE A;  4TZ4 A;  3PXS D;  3UVK A;  2PBI B;  5H1M A;  3OTT A;  3PE7 A;  4HDJ A;  3SHF A;  5C2W B;  5AJA A;  3EI4 B;  3IIY A;  3OL2 A;  4CY2 A;  4J81 A;  3E0C A;  2OVQ B;  3PSC B;  3MZK A;  2BCJ B; 
#chains in the Genus database with same CATH topology
 5HE2 B;  2YBA A;  4O3U B;  2EBS A;  4WJK A;  3JAM g;  3IUQ A;  1GP2 B;  5EMK B;  4G1E A;  5AMS A;  1MG2 A;  4QL1 A;  4RE6 A;  4PBY A;  3O4G A;  4LG9 A;  3IKO A;  3ZDX A;  3J81 g;  4Z7N A;  5IC7 A;  2QR5 A;  4FA1 D;  3CFV A;  4J8G A;  2H9N A;  5CXC B;  2IUP A;  2H68 A;  3QI0 A;  4A08 B;  4XYI A;  4X63 B;  4KFM B;  4Y5R D;  2H9M A;  1U2V C;  3SXT D;  1JOF A;  1UTC A;  4O3T B;  3T3P A;  4JSN C;  3SWS D;  4A2L A;  2I0S A;  2CO0 A;  4H5I A;  1Q47 A;  2YB8 B;  1TYE A;  3CIK B;  2B4E A;  2VDP A;  4CY5 A;  2AH1 A;  3ZE0 A;  4BCD A;  3SN6 B;  4A2M A;  3MUN A;  5CXC A;  1S4U X;  2OVP B;  3OKT A;  2UZY B;  4FA9 D;  4A08 A;  3KCI A;  2YNN A;  4GZ8 A;  4J77 A;  3K6S A;  1UOP A;  2VDL A;  5E6R A;  4XEI C;  1K8K C;  2AH0 A;  2Z2N A;  5KDO B;  4A0A B;  5HYN B;  4J82 A;  5E6U A;  4ZOX A;  4CC9 A;  2I3S A;  3EG6 A;  3ZDZ A;  4IA9 A;  1B9X A;  4FA5 D;  4JSP C;  3ZDY A;  1VYH C;  3MZL A;  4EWR A;  2IWK A;  3U4Y A;  4O45 A;  2YMU A;  4ZOV A;  4JD2 C;  5CXB B;  4D9S A;  3JRP A;  1VE7 A;  5FA5 B;  4GM8 A;  3J80 g;  2P9S C;  2OJY A;  4L3G D;  4A0A A;  5HQG A;  3K26 A;  4QQE A;  4BL0 A;  4QRJ A;  3RFG A;  3V9F A;  3SLE D;  5FLX g;  3SVW D;  3EQ9 A;  4CI8 A;  4PSX B;  4J78 A;  3L4M D;  1NR0 A;  3KRX B;  4G55 A;  4JHN A;  4JSV C;  3T3M A;  3IJ0 A;  3VA6 A;  5CXB A;  2P9P C;  5C2V B;  4UI9 R;  4A0B B;  3QHY B;  3FGB A;  4WK2 A;  3AH8 B;  3NIG A;  1U8C A;  3C5M A;  3JZG A;  5M5V A;  1N6D A;  1ERJ A;  3IUJ A;  3VGZ A;  2VDK A;  3RLM D;  1C9I A;  3EI3 B;  1PBY B;  2CO0 C;  4X61 B;  5C86 A;  3JPX A;  2PM7 B;  5IGO A;  3ZE2 A;  4PNK B;  1O6F A;  5H17 A;  2IUV A;  1PI6 A;  3KRW B;  1TBG A;  4GQ1 A;  1XIP A;  5A2Q g;  1A0R B;  4GGC A;  4AMY A;  3PSL A;  3NVN A;  4DNW A;  4ERZ A;  2CNX A;  4AEZ A;  2J56 H;  3EI3 A;  3RFH A;  2CN3 A;  4MMY A;  4GGA A;  3F3P A;  4NAA A;  4PBZ A;  3SBP A;  3W15 A;  5FKT A;  2YNO A;  5IGQ A;  3EQ8 A;  2HJB A;  5HE3 B;  3DDU A;  3NIF A;  3MKS B;  2VDO A;  5B4W A;  4ZN4 A;  4ZOY A;  4DNU A;  2IWF A;  1K3I A;  5IT9 g;  4CY1 A;  1H2X A;  4O2W A;  3O4J A;  1T2X A;  2TRC B;  2G9A A;  4X60 B;  1JMX B;  3ORV D;  2H13 A;  2VDM A;  2VC2 A;  3IJC A;  4GM3 A;  3EU7 A;  3PVW B;  4J84 A;  3SMR A;  4BH6 A;  4XYH A;  2P9U C;  3N0D A;  2BBK H;  5IJ7 E;  5EAP A;  2YNP A;  3UVL A;  3I7N A;  2EID A;  4Z8L A;  5H14 A;  3RN0 D;  4BP8 A;  4YVD A;  5HDB A;  4AMZ A;  1YR2 A;  3V7D B;  1XKS A;  2WQ8 A;  2I3T A;  4NC4 A;  2H3X A;  3P4F A;  3V5W B;  3MKQ A;  3SBQ A;  2W18 A;  1TYQ C;  1UOO A;  4OWR A;  2HYE A;  4N14 A;  4G56 B;  5TDH B;  3DXK C;  3CFS B;  5M5U A;  2VDR A;  2XYI A;  1GG2 B;  2Z2O A;  4U7A A;  3EQ7 A;  2VDN A;  3IUR A;  4H5J A;  1XHM A;  3DSM A;  1E5T A;  2H6Q A;  1NEX B;  5EAM A;  3AFC A;  4A11 B;  3C9C A;  5FKR A;  2IAA A;  4O1Q D;  2OK6 A;  3I8E A;  2J57 G;  4L1M A;  4K3I D;  3NVQ A;  3SBR A;  3UKU C;  3RMZ D;  5IJ8 E;  5E6S A;  5K19 A;  5GXI A;  3ZWL B;  5EM2 B;  1U4C A;  3C99 A;  4A11 A;  2I0T A;  2AGL A;  4A7J A;  2O9K A;  5K1C C;  3NID A;  5HE0 B;  3EI1 B;  2HU8 A;  3SFZ A;  4WK4 A;  1PEV A;  3FRX A;  3MUO A;  1MG3 A;  2IUR A;  1K32 A;  3K72 A;  4ESG A;  4AN0 A;  1UOQ A;  4G1M A;  5EAL A;  5EML B;  1H2W A;  5EM2 A;  1E8N A;  2EIC A;  1N6F A;  3DXM C;  1JJU B;  4LGN A;  5I5I A;  3JZH A;  4MK0 B;  2EIB A;  4GMB A;  4OZU A;  3PXT D;  2MTA H;  4CZY A;  3UKR C;  1N6E A;  3I7K A;  4NSX A;  4FAN D;  4Z7Q A;  3EI1 A;  2XE4 A;  3K71 A;  3OKY A;  2GC4 A;  4J0W A;  1GOT B;  2XL3 A;  3RRM C;  4BP9 A;  3VH0 A;  1GXR A;  1GOH A;  3IUM A;  5HE1 B;  5M61 A;  2JKX A;  2XDW A;  2HES X;  2BKL A;  3F3F A;  3IIW A;  5C92 A;  1OMW B;  3I7L A;  2B5N A;  4FWW A;  3I89 A;  4NBM A;  3I8C A;  4CZV A;  1YFQ A;  3ULE C;  1GOF A;  1B9Y A;  3V4V A;  2QXV A;  3IJE A;  3DWL C;  3UR4 A;  4O02 A;  2HKR A;  5TEE A;  4D6V A;  5CYK B;  5M5S A;  2OIZ A;  3BG0 A;  2AGX A;  3O4H A;  2HXC A;  3I7O A;  3PVU B;  3K27 A;  5FFO A;  5FKQ A;  2CE8 A;  3AL8 B;  3IVM A;  1M1X A;  4LG8 A;  4ZOZ A;  3ODT A;  4AOW A;  2PM9 B;  2P9I C;  2HU5 A;  5FQD A;  3GD1 I;  2GNQ A;  4JHP C;  4PC0 A;  3VI4 A;  1O6G A;  5CYK A;  1L5G A;  4J79 A;  5GSA A;  3EI2 A;  3EMH A;  2HKM A;  4L1Q D;  4Y7R A;  1MDA H;  4BUJ C;  2CN2 A;  2QC5 A;  3VI3 A;  4MMZ A;  4GQB B;  4CZX A;  4CI1 A;  3L4O D;  3AL8 A;  1PGU A;  5EMJ B;  2PM9 A;  4MMX A;  3OKW A;  4PXW A;  5AFU 3;  1OLZ A;  1JV2 A;  2H47 A;  4QT8 A;  1GOG A;  1BPO A;  2OVR B;  4JSX C;  4K3J B;  2IUQ A;  3EI4 A;  2AGZ A;  4IMM A;  5THA A;  2J55 H;  1JTD B;  2P9K C;  2XZG A;  5TEF A;  5M5T A;  2EIE A;  3NVX A;  3UVN A;  3V4P A;  3MVD K;  3JRO A;  4E5Z B;  4X3E A;  2VZ3 A;  4ERQ A;  4A09 B;  4JT5 C;  3FM0 A;  5FXY A;  4WK0 A;  4FHL A;  1FWX A;  2UZX B;  2Q7Q A;  2I0R A;  4J87 A;  4PSW B;  3C75 H;  4J0X A;  4O9D A;  3UVM A;  2VZ1 A;  4L9O A;  2OK4 A;  4JXM A;  4E5Z A;  3SCY A;  2P9L C;  2AGY A;  2PM6 B;  4FA4 D;  3UVO A;  4A09 A;  3MXX A;  1C9L A;  2GC7 A;  1L0Q A;  3FCS A;  4UM8 A;  3RN1 D;  4BCC A;  3OW8 A;  4IRZ A;  3SJL D;  1VE6 A;  1QFM A;  2H9P A;  5GXH A;  3PXW D;  3BG1 A;  1P22 A;  3OKY B;  3AL9 A;  4J86 A;  5I5M A;  4RE5 A;  2H6N A;  4E54 B;  5EMM B;  3FCU A;  4CY3 A;  3DM0 A;  3I7H A;  1RI6 A;  5FFG A;  5C9Z B;  2B5M A;  1SQJ A;  3A0F A;  2XL2 A;  4FB1 D;  4DNV A;  3IUN A;  4J73 A;  1SHY B;  4QAM A;  4CI2 A;  5M5R A;  2CE9 A;  4R7A B;  4GQ2 P;  2HU7 A;  3BWS A;  4I79 A;  1QFS A;  3EWE A;  1H2Y A;  1I2M B;  5I5J A;  2B5L A;  5JWZ A;  2AQ5 A;  4GGD A;  4E54 A;  1A12 A;  2AGW A;  2QZP A;  2XU7 A;  3HFQ A;  2G99 A;  5FKS A;  4AN1 A;  4ERY A;  4L3H D;  2H14 A;  3ZE1 A;  1R5M A;  2P9N C;  2H9L A;  4UM9 A;  4AX4 A;  3RSE C;  4FAV D;  1QNI A;  4D0K A;  5GMK n;  1VZ3 A;  4J8B A;  2HJ4 A;  3GFC A;  4Z7O A;  2H6K A;  3I2N A;  3B7F A;  4U1E I;  2VDQ A;  3IJ1 A;  3MMY A;  4JT6 C;  3OL2 B;  3EI2 B;  4GM9 A;  4A0B A;  3I7P A;  3JZN A;  5EAR A;  3F3G A;  4NEN A;  5TF2 A;  1JMZ B;  4CI3 A;  3N0E A;  3O4I A;  5SXM A;  4ES0 A;  3IUL A;  2Z2P A;  3JB9 L;  1SQ9 A;  3GRE A;  4TZ4 A;  3PXS D;  4BCB A;  3UVK A;  1E8M A;  2PBI B;  5H1M A;  3OTT A;  3PE7 A;  4HDJ A;  1H2Z A;  3SHF A;  5C2W B;  5AJA A;  3EI4 B;  3IIY A;  3OL2 A;  4CY2 A;  4J81 A;  3E0C A;  2OVQ B;  1VZ2 A;  3PSC B;  3OF7 A;  3GC3 B;  3MZK A;  2BCJ B; 
#chains in the Genus database with same CATH homology
 5HE2 B;  2YBA A;  4O3U B;  2EBS A;  3JAM g;  1GP2 B;  5EMK B;  5AMS A;  1MG2 A;  4QL1 A;  4PBY A;  4LG9 A;  3IKO A;  3J81 g;  5IC7 A;  4FA1 D;  3CFV A;  4J8G A;  2H9N A;  5CXC B;  2IUP A;  2H68 A;  4A08 B;  4XYI A;  4X63 B;  4KFM B;  4Y5R D;  2H9M A;  1U2V C;  3SXT D;  1JOF A;  4O3T B;  4JSN C;  3SWS D;  4A2L A;  2I0S A;  2CO0 A;  4H5I A;  1Q47 A;  2YB8 B;  3CIK B;  2B4E A;  4CY5 A;  2AH1 A;  3SN6 B;  4A2M A;  5CXC A;  1S4U X;  2OVP B;  3OKT A;  2UZY B;  4FA9 D;  4A08 A;  4GZ8 A;  2YNN A;  4J77 A;  4XEI C;  1K8K C;  2AH0 A;  2Z2N A;  5KDO B;  4A0A B;  5HYN B;  4J82 A;  4ZOX A;  4CC9 A;  2I3S A;  3EG6 A;  4IA9 A;  1B9X A;  4FA5 D;  4JSP C;  1VYH C;  3MZL A;  4EWR A;  2IWK A;  3U4Y A;  4O45 A;  2YMU A;  4ZOV A;  4JD2 C;  5CXB B;  3JRP A;  5FA5 B;  4GM8 A;  3J80 g;  2P9S C;  2OJY A;  4L3G D;  4A0A A;  5HQG A;  3K26 A;  4QQE A;  4BL0 A;  4QRJ A;  3RFG A;  3V9F A;  3SLE D;  5FLX g;  3SVW D;  4CI8 A;  4PSX B;  4J78 A;  3L4M D;  1NR0 A;  3KRX B;  3VA6 A;  4JSV C;  3IJ0 A;  5CXB A;  2P9P C;  5C2V B;  4UI9 R;  4A0B B;  3FGB A;  3AH8 B;  3C5M A;  3JZG A;  1N6D A;  1ERJ A;  3VGZ A;  3RLM D;  3EI3 B;  1PBY B;  2CO0 C;  4X61 B;  3JPX A;  2PM7 B;  5IGO A;  4PNK B;  5H17 A;  2IUV A;  1PI6 A;  3KRW B;  1TBG A;  4GQ1 A;  1XIP A;  5A2Q g;  1A0R B;  4GGC A;  3PSL A;  3NVN A;  4ERZ A;  2CNX A;  4AEZ A;  2J56 H;  3EI3 A;  3RFH A;  2CN3 A;  4GGA A;  3F3P A;  4PBZ A;  3SBP A;  3W15 A;  5FKT A;  2YNO A;  5IGQ A;  2HJB A;  5HE3 B;  3MKS B;  5B4W A;  4ZN4 A;  4ZOY A;  2IWF A;  5IT9 g;  4CY1 A;  2TRC B;  2G9A A;  4X60 B;  1JMX B;  3ORV D;  2H13 A;  3IJC A;  4GM3 A;  3EU7 A;  3PVW B;  4J84 A;  3SMR A;  4BH6 A;  4XYH A;  2P9U C;  3N0D A;  2BBK H;  5IJ7 E;  5EAP A;  2YNP A;  3UVL A;  3I7N A;  4Z8L A;  5H14 A;  3RN0 D;  4YVD A;  3V7D B;  1XKS A;  2I3T A;  2H3X A;  3P4F A;  3V5W B;  3MKQ A;  3SBQ A;  2W18 A;  1TYQ C;  4OWR A;  2HYE A;  4N14 A;  4G56 B;  5TDH B;  3DXK C;  3CFS B;  2XYI A;  1GG2 B;  2Z2O A;  4U7A A;  4H5J A;  1XHM A;  3DSM A;  2H6Q A;  1NEX B;  5EAM A;  3AFC A;  4A11 B;  3C9C A;  5FKR A;  2IAA A;  4O1Q D;  2OK6 A;  3I8E A;  2J57 G;  4K3I D;  3NVQ A;  3SBR A;  3UKU C;  3RMZ D;  5IJ8 E;  5K19 A;  5GXI A;  3ZWL B;  5EM2 B;  1U4C A;  3C99 A;  4A11 A;  2I0T A;  2AGL A;  4A7J A;  2O9K A;  5K1C C;  5HE0 B;  3EI1 B;  3SFZ A;  1PEV A;  3FRX A;  1MG3 A;  2IUR A;  1K32 A;  4ESG A;  5EML B;  5EAL A;  5EM2 A;  1N6F A;  3DXM C;  1JJU B;  4LGN A;  5I5I A;  3JZH A;  4MK0 B;  4GMB A;  4OZU A;  3PXT D;  2MTA H;  4CZY A;  3UKR C;  1N6E A;  3I7K A;  4NSX A;  4FAN D;  3EI1 A;  3OKY A;  2GC4 A;  4J0W A;  1GOT B;  2XL3 A;  3RRM C;  3VH0 A;  1GXR A;  5HE1 B;  2HES X;  3F3F A;  3IIW A;  1OMW B;  2B5N A;  3I7L A;  4FWW A;  3I89 A;  3I8C A;  4CZV A;  1YFQ A;  3ULE C;  1B9Y A;  2QXV A;  3UR4 A;  3DWL C;  2HKR A;  5TEE A;  4D6V A;  5CYK B;  2OIZ A;  3BG0 A;  2AGX A;  2HXC A;  3I7O A;  3PVU B;  3K27 A;  5FKQ A;  2CE8 A;  3AL8 B;  4LG8 A;  4ZOZ A;  3ODT A;  4AOW A;  2PM9 B;  2P9I C;  5FQD A;  2GNQ A;  4PC0 A;  5CYK A;  4J79 A;  5GSA A;  3EI2 A;  3EMH A;  2HKM A;  4L1Q D;  4Y7R A;  1MDA H;  4BUJ C;  2CN2 A;  2QC5 A;  4GQB B;  4CZX A;  4CI1 A;  3L4O D;  3AL8 A;  1PGU A;  5EMJ B;  2PM9 A;  3OKW A;  4PXW A;  5AFU 3;  1OLZ A;  2H47 A;  4QT8 A;  2OVR B;  4JSX C;  4K3J B;  2IUQ A;  3EI4 A;  2AGZ A;  4IMM A;  5THA A;  2J55 H;  2P9K C;  5TEF A;  3NVX A;  3UVN A;  3JRO A;  4E5Z B;  4X3E A;  4ERQ A;  4A09 B;  4JT5 C;  3FM0 A;  5FXY A;  4FHL A;  1FWX A;  2UZX B;  2Q7Q A;  2I0R A;  4J87 A;  4PSW B;  3C75 H;  4J0X A;  4O9D A;  3UVM A;  4L9O A;  2OK4 A;  4JXM A;  4E5Z A;  3SCY A;  2P9L C;  2AGY A;  2PM6 B;  4FA4 D;  3UVO A;  4A09 A;  3MXX A;  2GC7 A;  1L0Q A;  3RN1 D;  3OW8 A;  3SJL D;  2H9P A;  5GXH A;  3PXW D;  3BG1 A;  1P22 A;  3OKY B;  3AL9 A;  4J86 A;  5I5M A;  2H6N A;  4E54 B;  5EMM B;  4CY3 A;  3DM0 A;  3I7H A;  1RI6 A;  5C9Z B;  2B5M A;  1SQJ A;  3A0F A;  2XL2 A;  4FB1 D;  4J73 A;  1SHY B;  4CI2 A;  2CE9 A;  4R7A B;  4GQ2 P;  3BWS A;  4I79 A;  3EWE A;  5I5J A;  2B5L A;  5JWZ A;  2AQ5 A;  4GGD A;  4E54 A;  2AGW A;  3HFQ A;  4ERY A;  2XU7 A;  2G99 A;  5FKS A;  4L3H D;  2H14 A;  1R5M A;  2P9N C;  2H9L A;  3RSE C;  4FAV D;  1QNI A;  4D0K A;  5GMK n;  4J8B A;  2HJ4 A;  3GFC A;  2H6K A;  3I2N A;  3B7F A;  4U1E I;  3IJ1 A;  3MMY A;  4JT6 C;  3OL2 B;  3EI2 B;  4GM9 A;  4A0B A;  3I7P A;  3JZN A;  5EAR A;  3F3G A;  5TF2 A;  1JMZ B;  4CI3 A;  3N0E A;  5SXM A;  4ES0 A;  3JB9 L;  2Z2P A;  1SQ9 A;  3GRE A;  4TZ4 A;  3PXS D;  3UVK A;  2PBI B;  5H1M A;  3OTT A;  3PE7 A;  4HDJ A;  3SHF A;  5C2W B;  5AJA A;  3EI4 B;  3IIY A;  3OL2 A;  4CY2 A;  4J81 A;  3E0C A;  2OVQ B;  3PSC B;  3MZK A;  2BCJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...