3SBQA

Pseudomonas stutzeri nitrous oxide reductase, p65 crystal form
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
581
structure length
581
Chain Sequence
QKIHVGPGELDDYYGFWSGGHQGEVRVLGVPSMRELMRIPVFNVDSATGWGLTNESRHIMGDSAKFLNGDCHHPHISMTDGKYDGKYLFINDKANSRVARIRLDIMKCDKMITVPNVQAIHGLRLQKVPHTKYVFANAEFIIPHPNDGKVFDLQDENSYTMYNAIDAETMEMAFQVIVDGNLDNTDADYTGRFAAATCYNSEKAFDLGGMMRNERDWVVVFDIHAVEAAVKAGDFITLGDSKTPVLDGRKKDGKDSKFTRYVPVPKNPHGCNTSSDGKYFIAAGKLSPTCSMIAIDKLPDLFAGKLADPRDVIVGEPELGLGPLHTTFDGRGNAYTTLFIDSQVVKWNMEEAVRAYKGEKVNYIKQKLDVHYQPGHLHASLCETNEADGKWLVALSKFSKDRFLPVGPLHPENDQLIDISGDEMKLVHDGPTFAEPHDCIMARRDQIKTKKIWDRNDPFFAPTVEMAKKDGINLDTDNKVIRDGNKVRVYMTSMAPAFGVQEFTVKQGDEVTVTITNIDQIEDVSHGFVVVNHGVSMEISPQQTSSITFVADKPGLHWYYCSWFCHALHMEMVGRMMVEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Nitrous-oxide reductase
publication title N2O binding at a [4Cu:2S] copper-sulphur cluster in nitrous oxide reductase.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 179
structure length 581
sequence length 581
chains with identical sequence B
ec nomenclature ec 1.7.2.4: Nitrous-oxide reductase.
pdb deposition date 2011-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
A PF18764 nos_propeller Nitrous oxide reductase propeller repeat
A PF18793 nos_propeller_2 Nitrous oxide reductase propeller repeat 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3sbqA02
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3sbqA01
1VYHC 4O9DA 5I26A 1J5DA 5PCYA 1TU2A 2WSDA 3F3PA 3VA6A 4FA5D 2XUWA 3N55A 4DPAX 2WO2B 3I7OA 4Z8LA 2HXAA 2IDUA 2BHFA 1JXFA 4A09A 3T6VA 3TA4D 4CY2A 2FQDA 1BQRA 4BXVA 3IIYA 4UI9R 4Q8BA 4UF7C 3CIKB 1KDIA 3K27A 2NRDA 3FU7A 2HESX 3JPXA 3FSWA 2UXVA 2YNOA 2BP0B 5B7EA 4YSRA 2CCWA 4N8UA 1PNDA 3HFQA 3RN0D 2YAPA 3KRWB 2YQBA 3T9WA 1QNIA 3NJLA 4K9JA 5IY5B 1CC3A 1E67A 1NEXB 4L1QD 4LG9A 1L9RA 3ORVD 4CY5A 1BXUA 1GR7A 2H9LA 2H3XA 3CVCA 2IAAA 3AG3B 1SF3A 2VSKB 4HZ1A 2OVPB 5SXMA 5F7AA 2I85A 4A67A 2XV3A 2CNXA 3N0DA 5H1MA 5K1CC 4E9XA 3SWSD 1TEGA 1SDDA 3S3BB 1XIPA 2XYIA 3NJJA 2N0MA 4YSTA 1PGUA 3CFSB 1L9QA 1SHWA 3GXUB 2G9AA 4Y5RD 1OCCB 3ERXA 4JHVA 1L9PA 3U25A 4AZUA 4FA7B 3PAZA 4BDVA 2P9PC 7PAZA 3EWEA 1CYWA 5HE1B 3SXTD 1KGYE 1TEFA 1AACA 4GM9A 1A3ZA 4BWUA 3UABA 3JZNA 4AX3A 3NJIA 1PI6A 2EBSA 3QQXA 2H5UA 2YAEA 1UATA 3MX0B 4W1TA 1IBZA 3WNIA 1AIZA 2FQFA 2PM7B 4CY3A 3UGEA 1PZCA 1ASQA 2XXFA 3AG2B 2HXCA 3E0CA 4JHUA 4GXFA 3IJCA 3C9CA 3T71A 4J73A 4D6VA 5E9NA 3EG6A 4X4KA 1J9TA 1GG2B 5K19A 2AGZA 1GS7A 2HKMA 3UVLA 2E86A 1BQKA 3OD3A 1SF5A 4LGNA 1BYPA 4A11A 3EMHA 3SFZA 2AQ5A 1A0RB 4PNKB 1R1CA 1SDDB 4DP8X 1JVOA 4YSOA 2G99A 2DV6A 5CYKA 3RLMD 4M4RB 2UXTA 4PSWB 5EAPA 1SHXA 3EI2A 4GY4A 2H9PA 2B3IA 2IUVA 3NVXA 3UVNA 1RI6A 2XX0A 3TASA 3JROA 1GY1A 1DYZA 2HZHA 2IH9A 5B1BB 3IIWA 4O3TB 4YL4A 3FYEB 5FA5B 2P9UC 4DPCX 1PY0A 1RZPA 4QLWA 4JT6C 1V10A 2BP8B 4F2FA 1ASOA 2CALA 1ZIBA 2OCCB 3FM0A 3ODTA 2FT6A 5D4IA 1PLBA 2GHZA 2JFCA 2AGWA 4DP0X 3X1NA 4KO9A 5B4WA 2XYBA 1TYQC 4J82A 3FS9A 4MK0B 1CYXA 2W88A 1XKSA 1MG3C 5TK2A 3NSCA 3MKQA 4PBZA 1AZBA 4J78A 3FT0A 1AAJA 1E65A 2P9IC 2LLNA 3EF4A 3SJLD 3SVWD 3J80g 3EH3B 2P80A 2CBPA 4Y7RA 1HFUA 2GC7C 3FGBA 3IKOA 4YSEA 2IUQA 3EI3A 3OKWA 3SN6B 5AFU3 4A7JA 2HLEB 3FU9A 4W9ZA 3AL8B 3OKYA 2J55A 5TEFA 4YSPA 2Z2OA 4QL1A 5D4HA 1MZZA 4AI7A 1JZFA 2J55H 1NIEA 5AFAA 2BBKH 4D0KA 3S3DB 2DWTA 3AZUA 3EHBB 1ZDQA 2QPEB 5H17A 5CXCA 1SFDA 1X9RA 3CG8A 4U7AA 4CI2A 4J79A 3IN2A 2P9LC 2RACA 4UAHA 2P80D 4KNTA 4DP2X 1KV7A 4X63B 4E9QA 4BL0A 1J9QA 3FSAA 1AZUA 4WTQA 3I7LA 1NPJA 1W6LA 2XL3A 3MXXA 3SMRA 4GGDA 2AGLA 4GZ8A 2TSAA 3QJVB 4GP4B 3ABGA 1OCOB 2OV0A 1WAEA 4CZVA 3FQ1A 4CSPA 2UX7A 3JAMg 3EU7A 5C2VB 2AGYA 4YSDA 1BQ5A 1B9XA 2OJYA 2PPFA 2PP8A 3CVBA 2WO3B 3X1EA 5EMKB 5IGQA 2EIKB 1AZNA 1L0QA 3NP3A 5B7FA 1ZDSA 6PAZA 1NDTA 2FQEA 3JT2A 9PCYA 2XV0A 3I2NA 1B3IA 2YAFA 3IBOA 1NICA 2EIJB 5B1JA 2FQGA 2IWFA 3H56A 3HEIB 1GS6X 2CN2A 2PP7A 3KRXB 3QJUB 5IGOA 3RFGA 4PBYA 4FAVD 4AEZA 2J56A 3NVNA 1W6WA 2H3XC 1ZIAA 2IAAC 3DIVA 1K32A 2H9NA 4OZUA 4XEIC 2J56H 1N6DA 1BYOA 1U4CA 3P4FA 1ZV2A 1PEVA 3I7HA 4PXWA 1XB3A 2XVBA 3J81g 1WS7A 4XYHA 4GP8B 1GY2A 1ASPA 1ET7A 3DXMC 3W15A 1XMEB 2FT7A 2VW6A 3EH4B 3HB3B 3BG0A 2J57G 5I5IA 3OKTA 3AFCA 2XU7A 2YAMA 4FA1D 4ENZA 1NIDA 1ILSA 2CO0A 3ASNB 3U4YA 4CSZA 2X87A 4GGAA 5CXBB 1L9SA 3FPYA 4GQ1A 5AKRA 1E5ZA 4HHWA 4PCYA 5FKTA 3C75A 1K8KC 2VW7A 1OCZB 3SCYA 1NIBA 3C75H 4HCIA 2R7EB 3SBRA 1NIFA 4J81A 2I3TA 3BVDB 4A2MA 4DP1X 1ZPUA 4DP6X 5I5JA 3ABMB 2PM6B 4BUJC 1F56A 1FFTB 1N6EA 4XYIA 3NVQA 4ES0A 2XV2A 4ERYA 4F7KA 4FWWA 2AVFA 2GIMA 3CVDA 1WA1X 1JZEA 2Q7QA 5IJ7E 2UXGA 3C99A 3ZDWA 1NINA 2P9SC 5I6MA 3EI1B 3H4FA 2B5LA 2AFNA 2VM4A 1HAWA 3I7PA 2GSMB 4X61B 3UKUC 3NP4A 1PAZA 1AG6A 4BH6A 3QPKA 5I6OA 2I7OA 4A0BB 1XB6A 1OE1A 2ZOOA 2AH1A 2CE9A 5I6PA 1MG2A 2H14A 4CI3A 3N0EA 2AANA 1ET8A 4A2LA 1I53A 4JKNA 5EAMA 2BP8A 2OK4A 4P5SA 1RKRA 3PLYA 4DPBX 2YARA 3T6WA 1ERJA 3DKHA 4GYBA 3I7NA 2VN3A 3NSFA 3AG1B 4A08B 2GB2A 4U1EI 2AZAA 3SHFA 3PAVA 3VGZA 1KCBA 3NJFA 2H47A 2PCYA 2IDSA 1S4UX 2B5NA 1X9UA 5B3SB 3S8FB 1JXGA 3PE7A 4PC0A 4HDJA 4J0WA 5B1KA 5A2Qg 4KO6A 5AMSA 4M3HA 5EMMB 4WKXA 1BXAA 2VW4A 2FTAA 3UACA 4A2FA 2HYEA 3A0FA 1CUOA 2CAKA 4JT5C 3AL8A 4L3GD 5C2WB 3SLED 3PXTD 1A8ZA 2AGXA 2HRGA 3GFCA 3MBWB 3V9EA 3EH5B 2P9NC 4CZYA 4ESGA 3NSDA 2GNQA 3OTTA 4F2EA 1AS7A 3BWSA 1L9TA 2GBAA 4YVUA 3JZHA 1IKOP 5HE2B 8PAZA 1GW0A 2YAHA 1GS8A 1JMXB 2H13A 3FPXA 1PNCA 4E9SA 7PCYA 3S8GB 1PF3A 5FKRA 3X1BA 1JERA 2PPDA 3PSLA 2A3TA 4E9WA 3UADA 5IJ8E 2BZ7A 4A0AB 4E54B 3CDZA 1R5MA 5KDOB 4H5JA 4MFHA 2B08A 3UVOA 4HHGA 3RFHA 3MZKA 3GDCA 2YXWA 1M9WA 2GC4A 5JWZA 1W8EA 4O1QD 4N14A 4GMBA 4NERA 1JZGA 2BW4A 3TBCA 4JSNC 3NJNA 5EM2B 2ZXWB 3ULEC 4JSVC 4YSCA 5FQDA 1A65A 4HALA 5B1JC 1RCYA 2VSMB 3RMZD 4J8GA 4E5ZB 3PVUB 2CJ3A 2B5MA 3ZBMA 3VH0A 4I79A 2J57A 3PCYA 4AKQA 4A68A 2Z2NA 2IDTA 1SJMA 2I3SA 1N6FA 1DZ0A 3CDZB 3PXLA 3DM0A 4G72B 4BK5C 4E9VA 4K3ID 1QLEB 3CZUB 3PSCB 3OMNB 3RSEC 3NJKA 2AH0A 3V9FA 1CURA 2QDVA 3UVMA 2HX9A 4RH4A 5CXBA 4G7RB 4KO5A 1AANA 1KBVA 2CO0C 1WA0X 5I6NA 3QJRB 2YNNA 4J0XA 4IMMA 4R7AB 2R7EA 2PM9B 4X60B 2EINB 3OMAB 5ANHA 3WIAA 4DP5X 1PZBA 2Z2PA 1OLZA 5AZUA 2IDQA 3FU8A 1IUZA 1YLBB 2FWLB 2XWZA 1GXRA 4O45A 1GOTB 1Q47A 1OCRB 4CI1A 4EF3A 2BO0A 4H5IA 2MRYA 3L4MD 4NSXA 3JB9L 1GSKA 3OQRA 4DP4X 5C9ZB 1ADWA 1JXDA 3QJTB 1OE2A 4GP5B 2YNPA 3B7FA 3EI1A 1J9SA 2BZCA 4ZN4A 1AS6A 4HCFA 3EI4B 1NWPA 2PBIB 3PXSD 4A0BA 2P9KC 3BQVA 3AL9A 3NJGA 1KDJA 2DYSB 4QKTA 4ZOZA 1OV8A 3T6XA 1J9RA 1FA4A 1JZHA 4HAKA 3T6ZA 3I8CA 4GQ2P 5EMJB 5THAA 4JD2C 2QDWA 1MG2C 1PCSA 5FXYA 3WKQA 2IURA 2W8CA 3X2QB 1MDAA 4QQEA 1BXVA 2IWKA 1OMWB 4L0PB 2JXMA 2HJBA 4A2DA 1NPNA 4A2GA 2QPDB 5FC9A 1MDAH 4A08A 1ID2A 3N2JA 3IJ1A 2UXFA 4A2EA 4DP9X 3L4OD 1OOWA 4HCGA 1AZCA 2GI0A 5A7EA 4FHLA 5TDHB 5GXHA 1XHMA 3ZWLB 2EIMB 1PBYB 3UAAA 2CN3A 2CE8A 2H47C 5D4JA 4KO7A 4YSUA 5AJAA 4O3UB 2FNWA 3RRMC 4DP7X 5IT9g 2O9KA 1B9YA 5FKQA 4CZXA 4FAND 1T5KA 4FA4D 3I7KA 1XB8A 1P22A 2YB8B 3H4HA 5EMLB 4J77A 3ABLB 1MZYA 2I7SA 3D12B 5I6LA 2DYRB 3V5WB 2PCFA 3JTBA 4OWRA 3IJ0A 3DSMA 4CI8A 4KNUA 2W18A 3C5MA 2JKWA 2VM3A 3OMIB 4FB1D 4BWTA 2H9MA 2YXVA 2I0TA 4NAJA 3NJHA 3CFVA 3FSVA 1N70A 2IH8A 3NYKA 4J86A 1BEXA 5B1AB 1AS8A 5H14A 4IA9A 4CC9A 4GQBB 1NZRA 1GYCA 4A0AA 4E54A 4G7SB 4YSSA 2BW5A 5FLXg 4A09B 4ZOYA 1AG0A 2QT6A 4ZOXA 5PAZA 4TZ4A 2BWDA 1OF0A 3AG4B 1AZRA 2HRHA 3PVWB 2YMUA 1NWOA 4YSQA 1AR1B 5CYKB 3WG7B 3UR4A 3FU7B 4QT8A 4JXMA 4KOBA 1SHYB 5FKSA 3MZLA 1JZJA 1VLXA 4KNSA 1FWXA 5I6KA 4JSPC 1YFQA 2YAOA 3GYRA 2XL2A 2GC4C 5TK4A 4A2HA 4FAAB 3AH8B 3OW8A 1L9OA 5EM2A 3ASOB 4Q89A 2HKRA 1IBYA 2ZWNA 1JVLA 5TF2A 4AKOA 2IUPA 1HAUA 3FSZA 2QXVA 2YBAA 4AKPA 2EILB 1QHQA 1JMZB 2H6KA 1M56B 5EHFA 3WNJA 1J5CA 3BG1A 3OL2A 4G56B 3TBBA 4E5ZA 3IE9A 3V9CA 1URIA 3S3CB 2H68A 3PXWD 4J87A 3IN0A 2I0RA 3RN1D 4NB7A 3GREA 5B7MA 2YAQA 1PZAA 5HE3B 5I28A 4ERZA 4BXSV 3DXKC 4P5RA 4J8BA 4BDVB 4KOCA 2Q9OA 2PPCA 2OJ1A 1M57B 3FYIB 4UANA 3UAEA 3F3GA 4L3HD 4G70B 3FRXA 3I8EA 1V55B 1SFHA 3AW5A 2CUAA 1PLAA 3KW8A 3TU6A 2XXGA 6PCYA 1JOFA 1N68A 2OVQB 2PM9A 2UZYB 3I89A 4AOWA 4FA9D 4YVNA 4GM8A 2XX1A 3FQ2A 4GM3A 4ERQA 4YSAA 3SQRA 4YVDA 3OL2B 2DY2A 4GGCA 2B4EA 3JZGA 5EARA 1BAWA 3OM3B 1AQ8A 2OIZA 5GXIA 1GP2B 3X1FA 4A11B 2UX6A 2XLLA 3WI9A 2PP9A 3SBPA 3DWLC 1WA2X 1KCWA 2VMJA 3NSYA 2UZXB 1JZIA 2AZUA 3G5WA 1E5YA 3JRPA 2HX7A 4LG8A 3EI4A 4J84A 1A4AA 5I5MA 2BWIA 3SBQA 1TKWA 4PSXB 4L9OA 2J5WA 4X3EA 2IDFA 1KYAA 3F3FA 3EI2B 4TXVB 5HE0B 1PMYA 3NT0A 3QJQB 1TBGA 2TSBA 4E9TA 4E9YA 3IEAA 2XU9A 1NIAA 4A66A 2MTAA 5TEEA 4ZK8A 1ET5A 1A4BA 2Y1AA 3WKPA 1PLCA 1E30A 4HIPA 1EHKB 2MTAH 1SNRA 2TRCB 2HJ4A 3PPSA 3QJSB 3AY2A 3NJMA 4JSXC 4QRJA 5HQGA 1V54B 3ABKB 5IC7A 3ZIYA 4CY1A 1MG3A 3X1GA 5F7BA 1RZQA 2FJSA 2IWEA 4BWWA 3L45A 4ZOVA 3DTUB 3MKSB 2X88A 2H6NA 4KFMB 2Y69B 5GMKn 1EZLA 5GSAA 2GC7A 2FT8A 1JOIA 2DWSA 3FQYA 5LDUA 1U2VC 2I0SA 2OVRB 4G71B 5EALA 3KW7A 5HYNB 1A4CA 1KBWA 2H6QA 2PPAA 1AOZA 4G7QB 1JJUB 2Q5BA 3PAUA 3EI3B 1NR0A 2BP0A 4E9RA 1WS8A 1NTDA 4N4YB 2QC5A 3UVKA 2BCJB 2OK6A 3MMYA 4PAZA 3OKYB 1SQJA 2ZONA 1SQ9A 4EWRA 3ZX1A 3UKRC 1OE3A 3V7DB 3RYMA 1IC0A 2HX8A 1ILUA 2PPEA 4K3JB 1ETJA 3K26A 5CXCB 2PLTA
chains in the Genus database with same CATH superfamily
2XG5A 3US0A 3F3PA 3MBEA 3L3GA 5HVHC 3B1UA 1NCHA 5JXAL 3I7OA 5GRUL 3EFDH 1XFPA 4KJQD 2WBKA 5C0BB 5HPMB 3QUMA 1JXFA 2WVUA 3RPIA 1DCLA 2OFQA 3MR9A 4XAWL 1KDIA 3CIKB 1NKOA 2HA1A 4NZFA 3WO3B 2CK0L 4IHBA 2CCWA 2VZOA 1PNDA 5DHDA 5GQBA 1X7TA 3T9WA 1QNIA 3NJLA 4K9JA 3K72A 1H3WM 5LO7A 4L1QD 1FL3A 5LHDA 4HLZH 2H9LA 3O8XC 5B1CA 1EGJA 2YOCA 1T89A 4B41A 2V7NB 3KYKL 3CVHH 4AYGA 3HI5L 3T0DA 1CL7H 2F19H 1V7NL 2JLLA 2IOOA 5EEVA 1VACA 2FJHB 4FQJH 4HUXA 4OD3H 5GGQL 4CW1B 3F3FA 4FX5A 4MMXB 3GO1L 4D7BA 3VW3H 3V4PA 4DNUA 4K94L 3RURA 4GSUA 4IHOA 3FOMA 3MGTA 3AG2B 3CPLA 3MNZB 5CIPA 1KBGL 4M5ZH 4C83A 3A4DA 4LVEA 2HUHA 3KM2A 5IQMA 3D3VA 3VFOA 1LWRA 5IMKB 2YRLA 3PL6D 1MNNA 1JNJA 4Z0XA 4KX8A 2BINA 4HJ0C 4APXA 2J1XA 3NUKA 4YZFE 2APVA 2GFBB 1BYPA 1A0RB 3A6BL 1CGXA 3TO2A 5JIIA 2VDNH 4GY4A 5DMGD 5B39G 4JE0A 4Y4KA 5DRZA 1G5GA 3O6FB 4X9HA 2VLKD 2Q10A 3UERA 2EDYA 1SDYA 4ZUSA 4LMQI 3PV6A 4TQIA 1O5DT 2XIBA 4KPHL 2XFGB 4K23H 3ARBA 5F2FA 3QUYA 5AUMB 4Y4FD 3WHE0 4ZMTA 2K7QA 1JZ5A 3GMRA 2O61A 3QJZA 1FPTH 4ZW7A 3DRTA 3W56A 5LDSA 5C0RH 1KB5A 3DUHA 2E9WA 4PQXA 3OZ9L 5LBSH 3ECQA 4J78A 2IGTA 1LP9F 3DLQR 2VDKH 3GTNA 4RMQA 4HS3B 4X4XA 1H3UA 1A66A 3WDJA 2FO1A 4G8AC 5HHOE 2P47B 3KGUA 1EA9C 2WLLA 3VXMB 3FU9A 2V5TA 2G9HB 4F7MA 4JW3A 1NAML 3TIDB 4DCQA 5AYQA 5F88A 5BCAA 2G0KA 4YUEL 4LAQH 4DGYH 3QR1A 4Q4EA 3OKNA 1PU0A 6FABL 3FQWB 5D5MA 1DQVA 1SFDA 3PWPB 2O5YH 2OL3H 3PHQB 4PB9H 5CJXC 2AMGA 3ME0B 4XN4A 5DUBB 2ESVA 5I75C 3VFTB 4X63B 3FSAA 3U9WA 4L1DA 3BE1H 1NPJA 3D39A 5MEPA 1F11A 3D4ZA 5EG6C 5J6GA 1LLAA 3WTTA 4EJ1C 5FA4B 1UWEH 3VFSB 1FNGB 1U41A 1KIUB 3VA2C 1BM3H 2PR9A 2VITA 4Z7UF 5T33L 5D2NB 1BZDA 1DJSA 2PPFA 3M17B 5E6SB 3VJ6A 4Y4HA 2JLPA 4NBMA 4P05A 4DQAA 3IDYC 1NDTA 4IK7A 4OM0L 3WL9B 9PCYA 5LGKA 4K3EH 1A12A 5DJAB 3RWIB 3RFHA 3H56A 2PP7A 3ZL2A 3BN9D 3TXAA 1EZVX 4DZBB 4OZUA 4GW1A 4NP9A 1ZV2A 1ZT1B 4O2FB 3L1EA 2Q7NA 2XOTA 2NY4C 4POZC 3FTVA 4U1NA 1DQDL 2QQLH 5KBKA 3RWGA 3ROOB 4B97A 4G7YL 5I71B 4X7EC 5GRJH 3DO7A 3D05A 1QTPA 4HXBL 2I69A 4XWGL 3QE5A 4PBXA 3BAYA 3GHPA 1BPVA 5I74B 3CFBB 3MVDK 4JZJB 4HHWA 3BLKA 3VFMB 5I1IL 3WMQA 3N40F 4DT2A 3C6SA 3ILQC 1AXSB 5FUZL 4X5XA 2VLJA 4O58H 5HYJE 2FUQA 1WP6A 4G6JL 1HCFX 1QWUA 4LSVH 3QIBD 1U4FA 4I8DA 4O4YH 5TQ2L 1CDJA 4JG1L 3EYUL 4NIKB 3RI5F 3P3SA 2NR6A 5IQ7L 5JW3L 3ROLA 2FH8A 1KLFA 1MREL 2HJFB 3GEFA 1N8ZA 1U95A 4XMZA 2OMZB 2X6CA 3OAWA 2C9UA 3BGMB 3NP4A 2BVQB 1PDKB 3MLPA 1CF1A 4J12A 4P59H 3FONA 1FN4B 1BQLH 1LO2H 3O11A 1CLOH 3QNYB 4LCUA 5EZJB 3H0TA 4OM1L 2A73B 3LKRA 1KJ3H 3LH2H 4JAMB 4U7SA 4Y9CA 3N0EA 1BQSA 5EAMA 3C60C 2YC1B 3K46A 5CD3B 1CQYA 2RFXB 5A16B 4MB3A 3VXTB 5FFOA 3GK8L 2Q7YA 5FYKU 4J3OD 4OT1H 3VWJA 5B8CB 2OMUA 3IGFA 3RY4A 4U1HB 3NCBB 1N3NA 4MCYA 4J0WA 4JG0L 4DUVA 3O3BB 3CFKB 4JFTA 4O51A 2E8YA 3TGXA 4N2IA 4ODVL 1H2XA 2VTFA 1UJ3C 4LU5H 4TKWA 5LCVL 4DPRA 2P9NC 4GKZA 2HU8A 4X4YB 1IBDA 4X9GA 3OGCA 1L9TA 4AQ8C 2FECI 4PJ6A 4KI5E 2NSXA 5FEBA 3O81A 5ABDE 5AW0B 4JR9L 1VFOA 3MKGA 5F89B 1XCQB 3ARFD 4A04A 3UADA 1P4BH 2BNRB 3KJ6L 1UG9A 4OZGB 3V55A 2R1XA 2Q8AH 4MX7B 3AS2A 4RA0C 5IHZA 2VAAA 5HJ3B 1ZANL 2OMYA 1AO7D 1K9TA 4R7NB 3I6LD 1YJDL 2C8NA 1IMHC 1RZ8A 2ENPA 5DUPH 5CZVL 5A3IC 4JSVC 4Q4IA 4AEFA 2ZOTA 2JIXB 4KZEL 4UTCA 2X4RA 4RQQA 4J8GA 4NO2B 1TSRA 3GUTA 3WY3A 5FYJD 2F7IA 3MRCA 3QK0A 3WS3B 3CXDH 2VYRE 3PGDB 5C0DA 1VFAB 3PXLA 4ZSOA 3MNDA 2ZNXA 4P57A 5J12B 3UVMA 4NKOA 4GKNA 4WI9A 1S9VB 5JHAA 4XH2B 5H35B 1EQWA 3HC2A 5C0GA 4OAWB 1I3UA 1NEPA 3CLEL 3H9SD 3E8UL 3JWOL 5ES4B 4RAVA 2R7EA 4C56D 1BDYA 4JO3H 4M48L 5J57B 1VEPA 3GBDA 1EUUA 1ZRUA 4OCYL 4CC0A 2E3VA 5HDBA 4TVPD 2GBVA 4J27A 4AN0A 2BXZA 4ZD3L 2BFVH 2XWZA 3ARZA 4DN3H 4JQXC 4FFYL 3W9DA 5FPIA 5JQIB 1OANA 3NMEA 5GGRA 3S98A 4G6KL 3RGVB 2XWCA 2DIEA 1RZGA 2PWHA 1A2YA 3BSZL 1T5WB 5E8NA 5F1OB 5D96B 5EUOB 2ADIB 3MJ7B 1MIEH 4JFWA 4ES9A 4I0PC 1ACYH 3D18A 4X6DA 3T6XA 1G9ML 3HFFA 3UCQA 3U0PB 2L8AA 5I1HL 2X12A 3LKOA 4WHYG 1TMQA 3VRLF 1VHPA 3DI3B 2HJBA 4L0PB 4N2OA 3WYRA 1ORSA 5FC9A 1BGXL 2DQDL 4FOMA 3SDXB 4A08A 1MRFL 4U05A 2UXFA 2XWXA 3HFMH 1IGJB 4X9YA 4PJ7A 3HKFA 4Y2NA 5EPMB 5CP3A 1CFNB 2I25N 1M7UA 3KHQA 3UAAA 2ODIA 4YDKH 1SQ2N 1HXMB 4QRBA 5IESL 4CZXA 4QEGA 4K15A 3K1KC 5EU4B 1HSBB 3PWUB 4FABH 3C87A 2YB8B 3D48R 3PFQA 4V2CB 12E8H 5CLXA 1S7XA 4YPJA 1ZSHA 1N6UA 3EO0B 3QDMB 1KULA 3O4GA 1JTDB 1IEBB 5AVXB 2BSEA 3BDYH 5J1AB 1SHMA 1E27A 4LCYA 2X6VA 4A7GF 4DEUA 3C5MA 2V17H 5EUKA 4GG6B 4QT5A 4GKSA 1BEXA 4WWKA 1T0OA 3TNMB 3WTYA 3ILDA 5I1KH 2ENJA 4XMKL 3AU1A 3MCLH 1AD0A 4XN5A 2BW5A 4HPOH 5KSAA 2OR9L 4Q9QH 1VE6A 5HJGA 3UBXA 3I6LE 3CLFH 4CI3A 3JT0A 1IQWH 5FGSA 2MWCA 3G04A 3HR5B 4ZPTB 4JY5H 4JSPC 4PLJD 1YFQA 2CKBH 1MQKL 2VISB 1I75A 2GC4C 2YAOA 3VXSA 5SWSB 4WO0A 3QQDB 2G3MA 1GXEA 3N1GC 1T4KB 5FOJA 5TF2A 5FYJE 3TO4B 2J2ZB 3KPPB 3E38A 3RVWC 1URIA 5EBGA 1CK0H 4LRIA 2EYSB 4V1DD 3JV0A 5HE3B 2GUOA 1I1AD 3MV9D 2D31A 4J6RL 2EDMA 3BMWA 4Q6YA 1T2XA 1NCUA 4KRNA 5K1VA 4KOCA 2D3NA 1ZHNA 5T5FH 3WUWA 2DM2A 2BOLA 3E6FA 4G70B 4KTEL 3BH8B 4TVPE 2OVQB 1JF1B 2R23A 4UINH 2XKSA 4JQVA 1F3JB 4PTUA 3HZ3A 1FO0H 1OGSA 2Q8BH 3MOBH 3OL2B 1BAWA 5CLTA 4A11B 2G2NA 1YPZA 4YBLC 3GSNB 1X5MA 4UOW0 2C9AA 3UTPD 43CAA 4ODXB 1ZGLB 3QWRA 5IFHL 2HLAA 2DBJA 2PR4L 4J84A 5IT2L 3RN0D 3EI2B 1ANUA 1HSAA 4L9OA 4N5UA 3MHZA 1G7HA 1C5DA 5TE4H 1QLFB 4K71C 2GBTA 1K6QH 4NO3A 5H37G 5IW6B 4GH7B 4N2CA 2E74C 3EADA 2BP3A 4M1GL 4WTZG 4BSJA 3CHPA 5K9OA 4FG6C 3LH9A 5IC7A 2XXCB 2ZX9A 4CY1A 5FYKH 4Y5XA 4MXVE 1BF2A 1QBLL 3S7GA 2VDQA 3U6XS 1D6VL 4M62L 4HWBL 3IPFA 4QRTA 1AGBB 5CMAB 4K8RL 2ZOKA 2QVIA 3NACH 5LDUA 4K7FB 4G71B 5HGAA 3P4NA 1XHHA 3BUDA 4P4RA 3UPRB 1QR1B 4KAQH 3PF2A 3ARVA 5EORH 5BRQA 2WCGA 4FZEL 2CZNA 4EWRA 1FFNB 1P7QD 3P9MB 1PKOA 1G7LB 2IPTL 2A5UA 3KPRD 1BAFH 4WWNA 3K26A 3UC0L 1RVFL 3MBXH 4EE2A 5CXCB 3GI9H 1B4RA 4X4ZA 4KY1H 5K1JA 3OHMB 3GIVB 2GTZB 5DWUL 3GXNA 4FA5D 1I1YA 4KQ4L 3NIDB 1HTYA 1EFXB 1QSFD 2HXAA 4JFHD 4KRLB 2E6PA 3U83A 3WTWA 4CY2A 1F4XL 4MMYA 5C0NC 1LMIA 4MXWH 4KKCC 2KL6A 3QYNA 4NN6C 4P99A 5GJTL 3HZYA 4IRJD 4PJCB 5AYUL 1OZTG 2YNOA 4CVXB 3SPCA 5HJBA 3TBYA 3LKSA 3SYCA 5CXPA 2Y24A 1Q0YH 3HKZA 1W0YT 5F6IB 1KWGA 1C9SA 3MBED 4PBDA 3R0NA 2IMMA 3DO3A 2AAAA 2C9SA 4CGUB 8CGTA 3VMNA 1X5KA 1Q9OA 3MV9E 4L3EB 3MRDA 2Y07L 2FHCA 1XIPA 1TU2B 4YSTA 1BQUA 4AV4A 5J13B 4XMLH 3OZKA 4F7EA 3DTXA 3CHSA 3RFZC 3LKNB 4CVZB 3QHFL 4MJ5B 4AX3A 5FOBB 3F64A 4PJ5B 2YAEA 5KZCD 4R7DA 3C5ZC 3L7EA 1XGUB 3QJXA 1QAWA 5INDB 3AAZB 3GTVA 3S8WA 4M9OA 3DV4B 4LCIH 1UXSA 4OUOA 3OD3A 2ZG2A 3DNKA 3E9UA 4KMQA 4LGNA 1BQHG 3MLSH 4AGNA 1PKQB 4TLSA 3EOTL 2UZXA 3NJXA 3GMPB 3HS0B 4KRPD 4EIZC 5F3HB 2ATAA 1IZJA 1YN6A 3ULVC 5I30L 4HOMA 2WYIA 2B3RA 3CDYA 4J3OG 4JM2C 2WQUA 4PJXE 3D3VD 3SPIA 3ZE2B 4Z23A 5GS0L 4OKVA 4JMXA 3JROA 2B16A 1ZY9A 3T4AB 4YBQC 2F9BT 1INDH 1PY0A 1SUJA 2QSCH 1NEZG 2IAMC 4S1RH 4ZO8A 1AGEA 1E6JH 4PJIF 1DDHA 1UB6B 4JO2H 4M6OL 1B2WL 4PLKD 5I23A 1TYQC 1CICA 4NT6A 4NUPA 1ZSDA 2XWDA 2YKLL 5FYLL 2OAAA 3I9GH 1MG3C 2BS9A 2IPUK 1RZKL 2Y1YA 2O6CA 4LLYB 1U2YA 3BWAB 2LLNA 3X12B 1OY3B 3SVWD 3CXHK 5HHQA 2R8SH 2IOIA 5ECGA 2IUQA 4GSXA 3CMGA 5DO2C 2WB7A 2W60B 3IFOB 3ARBD 3QUYD 1HI6A 2ZXDA 1GC1C 3KPRE 4M6NL 3B3IA 2MEJB 4FQIH 1IC7L 2NY2D 1YEEH 1D9KB 4X6EA 1D5XA 3OBAA 2PW2B 4C4UA 2HMIC 4JFHE 3MDJA 1AHKA 3EOYG 4GI9A 1LQBC 3BVWA 5C0BA 2KZKA 5HPMA 1OKEA 5I1GL 5D8JH 4Z7OB 5K33A 4YDJB 4LIQH 2R83A 2TSAA 1QVOB 1UZ6F 3BCFA 3IDUA 4NUJB 2L4OA 3FQ1A 4KMTH 2DQIL 1CI5A 4OCLC 7TAAA 4PJGF 1P4IL 1J8SA 3GMLB 1R3JA 2JTDA 4QWWD 4Y2DD 3G9AB 3QQ9D 4GSDH 1QABA 2E9IA 4HQQL 5B1JA 2ESVD 2NNFA 4HKZB 4MMZB 4X7SH 4R6UA 3D39D 2VC2H 3N0AA 3QJUB 2V7NA 4FTVD 4J3TA 2H3XC 4PU2A 5L0QC 2H9NA 4B9IA 2ZAIA 2J56H 3RB7A 5DJZB 1U4CA 3ZRFC 3D30A 4HGMA 2YD3A 4YBHA 5C0FA 2VZ3A 2FJHA 2VXUH 4CW1A 4W9IC 2DQUL 1CD0A 4MMXA 5D2LE 3CFIC 5E6IA 1FGVL 5IMLA 5E08H 1E4KC 2FT7A 4ZI8A 4M43L 4FFZL 2NOYA 5A2JH 3ISWA 5I19H 1MCPH 2N1KA 2WQAA 1CDGA 3LNGA 4RVBA 3IB4A 5CXBB 2NY5L 3WSQL 1GJIA 1L9SA 2ZSVB 3FPYA 3U0WH 4GGAA 1E5ZA 3MNZA 4XPHL 3SE6A 1X4ZA 2AEPL 3OLIA 5BPPA 2ZUVA 5IMKA 1JV5A 1DO6A 4EOWL 4N68A 5L2KD 4PJHF 3WU1A 2VDML 4LVNC 2GFBA 3A5VA 3E1ZA 3SIKA 2WUBL 3EAKA 2Y25A 1XXFC 2AVFA 1HL8A 2VR8A 5KTEL 1WA1X 1JGUH 2GI7A 3KBFA 4IGBB 5BJTB 3O0RH 2FGWL 3O6FA 3BAEH 2VLJD 2AW2A 1I53A 5HDWA 1YEFL 1JHKL 1BBJB 5FGRA 3BT2L 4LNRB 5DMKA 4EDWL 15C8L 5CEZD 3H2PA 1P6AB 5AUMA 5BS0E 2Y6SC 1TTRA 2VQTA 2NR6D 4NKIH 4QHMA 3I7NA 1VRSA 4BFNA 1QD0A 2BJML 5JDJA 2AEQL 3DHPA 5D1ZD 2N1TE 1G0DA 3IUMA 1IQDB 1QNZL 5E7FA 4HJTA 4YWGL 4HS3A 1FYHB 2YD1A 1AI1L 4WKXA 2VW4A 4XE0A 1BG9A 3VXMA 1BZEA 1V7ML 1TPXB 2G9HA 4G8IB 4MCNA 3TIDA 1A8ZA 3MRNB 1AY1L 1QBML 5JHBA 2I9TB 1ADQA 1MI5B 2BXYA 2FX8L 3QB7C 4NKMB 3K74B 5GRZA 5DVMA 3VWJD 1JGVL 4ZTOH 3FQWA 2VDRL 3PWPA 4IOSA 4MS8C 3RY6C 3PHQA 3WIIH 2GBAA 5F7UA 2JKSA 3VQLA 1XAUA 4G1EB 3ME0A 3LZOA 5DUBA 3VFTA 3SYAA 3CZEA 1T5XB 3X1BA 3VFWB 2PPDA 5FA4A 4WKZB 2IADB 3VFSA 3L9BA 4F58H 5BW7A 1R5MA 2DDQL 4HF5L 4UT7H 4HA1A 1FNGA 4Q14A 1YHPA 1DR9A 4ZXBB 1BBDL 3S2CA 4JO8A 3BVVA 3MLWH 5D2NA 1G7MB 2YXWA 5E6SA 4YHZL 3M17A 2ESVE 2NUTB 3N1FC 1RZ7L 4FNSA 3WL9A 4FTVE 5DJAA 2C1PB 3RWIA 2KMWA 4PJ9B 1Q94B 2WXFA 1A65A 4G3YL 3WTUA 2ICEB 4DZBA 3PVUB 1ZT1A 1R34A 5B3JF 1S3RA 4BFRA 3I50H 4JN2B 4WJG3 1CFMA 3ZKXC 3UEZA 3KWXA 1H3PH 4JK0D 1CDBA 3D4GA 3ROOA 1M71B 3C09C 4DTGH 4OLUH 5DD6B 3S34L 3ML8A 1DZ0A 1P6WA 3ULVH 1N6FA 3LQAL 1D5IH 2WWNA 2XKNB 3K6IA 4WDIB 1R3IH 3OVUB 3UDWC 4LLWB 2XQYG 3LXCA 1T20B 5EFIB 4YHML 3CFBA 4ZUUB 4JZJA 1VENA 3TEUA 5L2KE 1F8TH 3VFMA 4M6ML 1HJBC 2YNNA 3EBAA 4A6YB 3DVIA 1AXSA 3QRGH 3BUQA 2IDCA 2J43A 3L4XA 4J23A 5IHWA 1GOFA 2L0DA 2FWLB 2DJMA 1L7IL 2HG5A 5F21B 2BSDA 2UWEF 5EDSA 2XWTB 2HJFA 5G5DB 2OMZA 1BZ7A 1TQVA 3K2UH 3BGMA 2VLJE 5EZLB 2BVQA 1PDKA 1HYSC 1UM4H 4X5PA 3QNYA 4ZOZA 1WFMA 1UUNA 5EZJA 2A73A 4JAMA 2J12B 5AW1B 2YC1A 1A7QH 5CD3A 4QQEA 2RFXA 4NSKB 2ZP8A 2HLFC 1GGBH 1NPNA 3VXTA 3ZE1B 3RJQB 3FTGB 4PGDB 1Y1UA 4ODHL 5SWZB 4A2EA 4AYEC 5EC2B 5B8CA 4HCGA 1YUHB 1UM6L 5HVGB 4ABWA 2AJYH 1MCLA 5E6ZA 1U42A 3NIFB 4D7PA 3O3BA 4WNSA 2EXTA 2Z65C 4F15B 3WV0A 3CFKA 4WJ5B 3POHA 3I7KA 3L3JB 1F86A 2QVMA 4KZDH 1BXXA 2KYIA 1LE9B 4U1MB 5E2TL 3D12B 1WT5A 2DYRB 4KJPD 4NNXB 4AMXA 2UZIH 4UM9A 4KNUA 3BW9B 4X4YA 1F97A 3RG1C 4FL4C 3BVUA 1I8KB 4GXUM 1IC5L 2YFNA 4PVBA 2EYTB 5F89A 1XCQA 2ZT9C 3M8OH 4JO1H 4XPTH 4YDIL 4G6FB 3MLUH 3AREB 5LXGL 4GQBB 2BNRA 5AWNH 3BDBA 2DIJA 4OZGA 1UD6A 2WZ0A 4MX7A 2PTTA 3SD2A 2BWDA 2VDLB 1AZRA 5CR8A 5DC9B 2BSED 1J0JA 5GS2D 3AJ7A 5HJ3A 4P2RE 4R7NA 4ZS6C 3VG9C 3I6SA 1SLXA 3QJOA 4D8OA 4DEWA 3SPHA 3AT0A 4WWKD 4ZTPL 2JCWA 1T7XA 3ASOB 4XO3A 4OLWL 1QA9B 4UI2A 1KN4L 1JVLA 1IJ9A 1YQ2A 2DQJL 2QXVA 4NXKA 4P06A 5KSAD 4NO2A 5DJ2B 2P46B 4J87A 2J1WA 3M1CA 3A6CH 1WUZA 3BRDA 2OM5A 4J6IA 3PGDA 3CFNA 2R2CA 4BXSV 4J8BA 1VFAA 3FUIA 3IT8D 3B8SA 4OU3A 1P5UB 3VXSD 3TJEL 1UKTA 1M57B 1TXKA 1JGLH 3K91A 4I7ZC 1TVDA 4XH2A 3GJFB 4OAWA 5ICYB 5E8OB 5AKSA 1JI2A 4N25A 4KK5C 3SYOA 3MLXH 4PB0H 4AEIL 3AS0A 5H94B 3UJTH 3EJJX 2HTLC 4W6YB 3L5XH 1HIMH 3WD5H 3HTLX 3NCMA 3EDFA 2ZKMX 5M7QA 3F05A 5AL0A 5IBUG 4Z3IA 2WVSA 3D2UB 4G6ML 1KEGH 3VB8A 4GAGH 1NSNH 3AB0B 4H5JA 5M95B 1OZUA 3RGVA 4I88A 1T5WA 4UT9H 2B39A 3FQTB 5EUOA 3MJ7A 1T03L 1G7IB 3BP4B 3ZMNA 1XX9C 5GRVL 3IGKA 3QJQB 1J1XL 4KJQC 3N42B 4K7PY 2ALWA 4K3JH 2R0KH 1QFUH 1E0OB 2ZWLT 3O4IA 3SDXA 3ABKB 3LOWA 1EXHA 1IGJA 3TWCL 3QWRD 5HYSB 5EPMA 3ZHNA 4FQ2H 1CFNA 4M7ZB 5BNXD 3MOQA 4XNUL 2R56H 3UTSB 1Q8MA 3KWUA 2OVRB 2FT8A 3FQYA 2WCPA 3MLTB 1HXMA 2BSRA 4JLRA 4XVSH 1RURL 5EU4A 5HDQH 3ZZQA 2AV1B 3PWUA 1ZLUK 3OX8A 4PAZA 3HRZB 3H3PH 3EO0A 3QDMA 1IEBA 5J1AA 3J07A 2VDOH 3KCPB 5JW5B 5KSBB 2VN4A 2D0FA 1CWVA 2D9CA 1KGUA 3UMTA 3U82B 4AZ8B 1S7QB 5C7ZA 1IGTB 4GG6A 3TNMA 1ITCA 3VA6A 3LEXB 4U7MA 1UZGA 3N1PC 2IDUA 2YSTA 4X0NA 4M9PA 3QO1B 3TA4D 2RAMA 3IIYA 4QTIL 4GG8B 4JGJA 3BPNB 5C0CB 5HXMA 1J8KA 3TF4A 3OJ2C 1IC4L 1SBSL 4JPWH 3HR5A 1P53A 4XODA 1ONQB 4ZPTA 4JY6A 5L4FA 2VISA 3EGSB 4U1LB 2FH6A 4XNYL 5SWSA 3S36L 3O2DL 4MKMA 1PLGH 3QQDA 4ZAKB 5KVFH 5DMGC 4WTXA 1UOLA 1HINL 1T4KA 4QHKJ 3F7KA 1A6TB 3GM0A 5HI5D 1KF9B 2N59A 3BQUB 3TO4A 2J2ZA 4OFIA 3HN5A 4E9XA 1AE6H 1JPTH 2VXQA 3KPLB 4PGCB 4O02L 5T1JA 3IJ8A 3CFSB 1L9QA 4Z0BH 3NFSH 2I60L 4OI7A 1LO3L 4AZUA 1OSPH 5BV7L 2F58H 3QORC 1OK8A 1PQZA 2W0PA 3Q2LA 1EBAA 4FTDA 4G8GE 5EZIH 3D0VA 2WZPA 3RUGE 4FMFA 2VLRB 1N9PA 1IGYB 2EE2A 1GZQB 2NW3B 1WK0A 3O2WL 2QVTA 3JVGA 4JG9A 4CY3A 3HC3L 4RZKA 1JF1A 1O75A 5JIHA 1WZ1H 2SEBB 3IDXL 1EXGA 3CVHB 3UVLA 2E86A 1CE1L 1UA6L 1DBML 3LPWA 2ZOUA 4A11A 1E6OL 3AMLA 3GSNA 5D72L 4Z7NF 4ODXA 1ZGLA 4U0RC 1HL5A 3EI2A 1XR9B 5FV1L 5BQ7B 2YMTA 4KI5C 4B9KC 1QLFA 2FCBA 1LXMA 2Q76B 3FYEB 3KWWB 5IW6A 1ZD6A 4HFWA 1MRCL 5E1IA 4DPCX 4QLWA 1ED3B 1AKJB 1HHKA 2QQNH 3WFBH 1Q1PA 2AGWA 5E8DL 5FHBH 1RUKH 3MUHL 5KVEH 2E56A 2XYBA 1N12A 3QEGL 4EI0A 1AGBA 5L88H 2F8IA 5DRWB 1CGWA 3QR0A 3QULB 2X42A 3FTWA 3HBGA 5JIPA 3B7RL 4HCRH 2YZ8A 3UPRA 4QDGA 2VDNB 1Q0XL 1C1EL 4CSSA 3QUZB 2BCKB 1FFNA 3P9MA 4OFQA 3QWNA 2H7WA 4J3WA 1CICD 1G7LA 2ICWJ 3O4HA 4LDLB 1ULVA 2G60L 4OFPA 1ZKAA 1QW9A 5CXCA 1BEYL 2XE4A 4BD4A 1A6UL 5D7KE 2Z8SA 1O7SA 2IC2A 2GTZA 2X10A 3R4RA 4DP2X 4QRRB 4K5NA 3NIDA 4MHHG 1U3JA 1EFXA 1CVRA 2YGVA 2VDKB 1U8IA 4OLEA 1F41A 4A63A 3QIBC 3T0BA 3FB6B 1OCOB 2OV0A 4PSRA 4CSPA 3SE9H 1LEGB 5HTSA 1JVKA 4PJCA 4CVXA 5AB0A 4EN2A 1BQ5A 1G6RL 3VCLB 1QO3B 2OJYA 3X1EA 4M8QB 4X80H 3I2NA 1CXEA 2CD0A 4L4VE 2XV0A 1YEIL 4N3UA 4OFDA 3S35L 1G84A 5C3IA 5I0VA 1N0LB 5C0BD 4G7VH 3H1ZA 2OL3B 4A37A 5CBAB 4XN2A 1QBAA 4L3EA 1AGCB 4JBSA 1U6AL 2XN1A 2W65B 3RE0A 2XXMB 2VM9A 1IAIM 3CX2A 4KTDL 1MJUL 2OXGB 4Y8AA 1DN0B 2XRAL 3LKNA 4I48B 2XNAB 4JN1L 4JFDE 4CVZA 2ZF9A 3AFCA 2XBDA 3APDA 1JK9B 4MJ5A 4QLRA 5FOBA 1G0YR 3P11L 2CO0A 4PJ5A 3K2MC 4YIQA 1TETH 2N0KA 3K6SB 1O0VA 4LLMB 4XBEL 5K9QG 4NNYA 3RZCC 1XGUA 3L4UA 1P2CB 2YK1H 4M5YL 4J3OF 1H0DB 2W59A 3F58H 5INDA 4DP1X 2D3LA 2OK0L 3GQFA 4JM4L 4I3GA 4PUBH 1F56A 5J6SA 4N8PA 3RILA 3NVQA 4JM0A 2OJEA 1N6EA 4XYIA 3QAZC 4FHKA 2F53E 1PKQA 2BVYA 5KJRH 3K1DA 3HS0A 4DZ8A 1O6FA 2LFEA 4MDJA 5JORB 1JNLH 3NSXA 5F3HA 3TPKA 1KTDB 4TRPL 1XB6A 3ZE2A 3HUJF 1XTLA 3T4AA 5BOZG 4W9JC 5CGYD 3MO1B 4DPBX 1T0PB 1MFCL 1UB6A 1NBZB 5AEAA 5DZ9A 3KD4A 1NFIB 2HFEB 1TLKA 2IANE 3T2OA 4XNXH 2X7LB 4ATWA 4MA7L 1JNNL 4LLYA 3BWAA 2AJVH 3FN0H 3X12A 3O6FD 3ZO0A 3D2TA 1MKFA 3B2MA 1LO0H 4YS4A 3PJSB 3ZDZE 4PRHB 2V4LA 5HDOA 4XP1H 1Z5HA 3MV7B 5IB3B 2W60A 4JFYB 1EJ6A 3B6SB 4YXKH 1UVQA 3IFOA 1TITA 1YYCA 5CBEA 3T8MA 3SLED 1OAXL 2P8LA 4ZUWB 3TZVC 3T2NL 2X4UB 3KCWA 3F01A 5IBLD 2M2DA 4M3KB 2PCFB 4LE8A 5EBMB 1D9KA 1NC2A 3NCXA 4K9EL 2FEJA 4GIOA 3CLWA 1X7SA 3WEOA 3D0AA 3IU4H 3BP5A 4RGMC 3T0WA 5HVHB 3IUQA 4WI7A 1PNCA 4P4KA 3UZEC 1BWWA 7PCYA 3VXMD 1PF3A 1OAZL 4Z76B 1E5UI 4Z7OA 4YDJA 2IQ9L 1B0GB 1QVOA 4NUJA 3ZDXF 5FLXg 2NQ3A 4FA8A 1XSOA 4JRYB 4H0IA 1YC8A 1JGEB 2NQDA 1THAA 2ZX7A 3KYAA 4HHGA 4DERA 3BXNB 1UWXH 3GMLA 3OMZA 3PWPD 4IOSD 5AYTA 3UBXG 4RAUB 3STBA 5GGUB 5JDSA 4HKZA 1UOWA 3O8XB 3CHRA 4MMZA 2B9AA 2KDYA 2ZIDA 5TDNB 1WIUA 4OGXH 1DFXA 5DJZA 2CRZA 3ZMRA 3X3GL 2AITA 5CXBA 2OLDA 4NC2B 3ES6B 5KOVC 1KBKA 2COVD 3CBKB 1JPST 3ASWA 2MH4A 2QHRH 1SJMA 1HEHC 1YEWA 2E9BA 4ZQKB 1WDAA 3U4EA 2GIYA 2B5IC 2FWOB 4RH4A 3M1BB 4G7RB 4NI6A 2ZSVA 3ALXA 2AP2A 3D07A 3AWEA 2YD7A 1FL5B 5C0AA 2NNCA 3T04D 3QEHB 3CUPB 1WH0A 2Z3FA 2Y2WA 4X60B 1CTNA 1QHOA 3OB8A 3U30C 4LARL 4ALAL 5I1AB 2P45B 3F04A 1EVTC 1CLZL 1WG3A 2E7LA 3IDJB 2NDFA 3APMA 4L23A 1KXTB 4XPFH 3OQRA 3L4MD 3EOAB 1SXAA 3FZUD 3CFCL 4IGBA 1J5OL 1PG7H 2JWYA 3NGBC 4MA8L 3U7YH 5TF1L 5BJTA 1MCIA 1IFRA 1PIFA 4NGHH 4DSYA 3AWGA 4C8XA 3AC0A 5T3XD 2P7TA 3WE6B 1JZHA 4HAKA 2A9NL 2QL1A 1BBJA 4LNRA 5KG9B 4MRBA 1JK8B 2Z35B 4I2XE 4JUTA 4ELKB 2Q3ZA 4A2GA 1H2YA 3MXVH 5E9AA 1V27A 2QKIB 1T1WB 5F6HJ 2GI0A 5A7EA 1NBQA 1INEL 1X5AA 2CPCA 1TG8A 1XF2B 5I0ZA 1PD1A 2VWEE 4KK9D 2GPZA 4P5TC 1T5KA 3BP6B 1T22B 4G8IA 2IFFL 1WVZA 2I9TA 1DL7L 1MI5A 2Y1VA 4NKMA 5IROA 2IH3A 5FO7B 1I3GH 3IJ0A 4JFEE 4LGPB 4K5OA 5GGTH 1KT2B 2CO1A 4G6AC 4FB1D 5FYLE 2CMRL 3BFQG 3KS0H 2I0TA 4G1EA 1FYTE 3TEWA 5I75B 2K9FB 3RVUC 1IAIL 1WAAE 4LQ1A 1U8MB 3B2VH 1T5XA 3SQBB 1K5WA 3VFWA 4Z7WE 5AG9A 3KE0A 4WKZA 2IADA 2XVGA 4UBDD 2C3VB 3BUBA 1G7PB 5IQOA 4OF7A 5SWQB 2P28B 5CD5C 3PY9A 4JPKH 5DQJB 2N7BA 3W82A 1ZLVH 4ZXBA 4TZ4A 3FTXA 1KYOK 4YSQA 1QYGH 1G7MA 2YHGA 1BJ1J 1A4KA 3OLDA 1FWXA 4JL2A 3IDYB 4IBTA 2ZWSA 25C8H 3UTQB 3BZ4B 4PJ9A 1Q94A 1RIUL 2ICEA 4PVNA 3QZNA 4P9MH 1YYLH 2YBAA 2BNRD 1AXTL 2XIIA 2H6KA 1OGAB 1OIOA 4LBEB 1EAJA 4WIQA 3OHXC 1GAFL 4JN2A 2NY4B 4FXGC 4NB7A 4UT6H 5AVRB 1M71A 3RU8L 4ONHB 2V5SA 3HPJB 5DD6A 1T6WA 5B21A 3V8CA 1LL1A 5LN8A 2XKNA 5T1LB 4WDIA 3N40P 3MSPA 3QZLA 4LLWA 1T20A 5EFIA 1VESA 3U7WH 4WI2A 2JIXD 4ZUUA 3S5LG 1IGMH 3UJIL 4S1QL 2CKBB 5CILH 2R0ZH 5AVVB 4A6YA 3RVVC 2W38A 3GKWL 3OJMB 3B83A 4ADJA 3GXDA 3QC6X 4WI8A 1B0RB 2BVOB 5L8JB 1YVLA 1JPSH 2DY2A 1QLEL 4MASA 1MFAH 2OULB 3NA4A 5G5DA 4QYAA 2VMJA 4LEOB 5EZLA 3T8XB 2APTA 4KK6D 4FYQA 3BI9X 1WISA 5T3XE 4PSXB 2BWIA 3SBQA 3SGJC 1DSFL 1MFDL 1UWYA 3MN8A 3FTYA 3I74A 4FS0A 3GIZL 3S5YA 2CO4A 3L4ZA 3C60B 2X53A 4KKAC 1SN0A 5AZEL 2CM5A 4HIPA 4NSKA 4IIZA 4U31A 4HJSA 3RZWA 5E5UB 5MEOB 3ZE1A 3FTGA 4PGDA 4Z7QB 4YE0A 4WNQB 5EC2A 3MLZL 4MS6A 3RGVD 1FO0B 1YUHA 5C0JB 1NCOA 1EHLL 2WZ6A 2Q86B 1IEHA 4NZJA 1X5FA 1YO4A 4PR5B 4BQ6A 4FNLH 2A6JB 4AUJA 4BCCA 1GPOL 4WJ5A 2OZ4A 3L3JA 3BZEB 1NTDA 1XGTB 2YN3A 4XCCL 2VKWA 4A7TA 1LE9A 1UJ3B 4N0CC 4XXDA 1CVSC 1RMFH 4CILA 4NNXA 5FGBC 2BMKB 3QAQA 3BW9A 1ILUA 2PPEA 4XXCA 5EBWB 3HI6L 3MREB 3F7YA 1OSEA 3QWOB 1SM3H 4DOHB 1VSCA 4YK4C 2R2BA 2WSDA 2EYTA 4E2OA 4DPAX 2WO2B 4DVRL 3RTQA 1R4XA 4FP8H 3I84A 1UCBL 3QDMD 4BFJA 2VDLA 2XY1A 2X2UA 1MF2H 5A2FA 3JPXA 4AIZB 3WTXA 3OG6B 4S10A 4N8UA 1QSZA 3VRIB 3C6EA 4HW6A 4AYSA 2YQBA 3TEYA 4AG4L 3KBEA 4LOFA 5DR5L 3W9EB 1QA9A 4BFIB 3RIFF 5IREA 2IAAA 2R0WL 1AQMA 2LVCA 3U9PH 1BYNA 1DJWA 5DJ2A 2NCEA 3KVQA 3SE4C 1QSEE 1XH0A 3LQZA 3D25B 1MEXL 3D8MA 3RI5K 3T0AA 4ATTA 2JF1A 3HN3A 2W07A 2DWDB 1OARL 3DK0A 3M86A 2G3ZA 5EU7E 1RPQA 1P5UA 2BIOA 2BWQA 2V3DA 1A3ZA 5SWSD 3VGGA 1E8NA 3MLRH 4FD0A 4PV8B 2HAZA 5AVUB 3GJFA 3QYMA 5ICYA 3TO4D 5E8OA 3WNIA 2PXYC 4KXCA 1ASQA 2XXFA 5HDLA 4JHNA 2VR7A 4X6CE 5H94A 3LS5L 4QHKI 1QWHA 5BQDA 1HH9B 2IPKB 3WCYA 1LDPH 4LHUB 4ZFGH 3NDYE 1NLBH 2NY2C 5HSFA 5KS9B 2L7UA 1X5YA 2B1HL 2WZPD 4Y9FA 2Y7MA 1SDDB 5DK0A 2EDJA 4X8JB 2ITCB 2ZAHA 4UDUB 4BIKA 4E41B 2WLMA 1NDMA 3FQTA 1G7IA 3BP4A 1IGIH 4I0PB 4DKEL 1RJZB 5LKNA 4Y19B 1QQDA 4AVKA 1UH4A 3ORJA 1M7DB 5B4MC 3EFFB 4OF8A 5DHVA 5D4IA 4X2UA 5TDOB 2WGNB 4AQOA 4J3XA 2CBQA 4Y2DC 5HYSA 4GS7C 1LILA 3FS9A 3QQ9C 1JZ2A 3KEHA 1NOAA 3P40A 3UTSA 5IB4B 4LSPH 1MCQA 4JJ5B 2JE8A 1CDHA 3I02B 5E7BA 4ZNEA 2DOCA 3SOTA 2ZJSH 3QDGE 3QG7H 5D5MF 3IKOA 1KCRH 3DJ9A 5FIEA 4ONFL 2AV1A 4D94A 2FUTA 1H5BA 3HRZA 2AEIT 5KVDH 5ADPH 1MZZA 3ZTCC 3L9EA 1NIEA 3LB6C 3RKDD 5FXCH 1GSMA 3KCPA 9CGTA 4FNTA 5KSBA 4H0GA 2QPEB 3QQNA 2YGQA 3CPUA 1FVDB 1S7QA 2W95A 1A7OL 1OAYL 2HKHL 3LEXA 3CN0A 4HT1H 4PS3A 1QX1A 1AZUA 1F58H 5C3TA 4JO4L 1JSYA 3QO1A 2DICA 3OB0K 5HI4D 1JP5A 4ZO9A 4GG8A 4P9HL 5KAQG 5C0CA 3Q13A 1WAEA 2UX7A 3UO1L 3F2LA 3UG5A 1ONQA 1TJHH 3EGSA 4U1LA 2WQXA 2X6UA 3MRIB 2DLHA 4XTRD 4ZAKA 2FSEA 1HOCB 3RBSA 3EJSA 1JWUB 1A6TA 2F7RA 2ICWI 2IWFA 4ZJ9A 1EFXD 1TJIH 3HEIB 3N43B 3BQUA 4K94C 1EJOH 4Y2LA 3QDJB 3N0PB 4BE5A 4R4NC 3S37X 4NPYB 3WY1A 1DBAL 3KPLA 4PGCA 3WDIA 3E7JA 1WD9A 4LPWA 3UYRH 4BJLA 1ET7A 1OPGH 4WCYH 4ZMYA 1KWKA 4FGMA 3ECWA 4LASL 5D1ZC 5FKAB 3FFCB 3MCYA 4JHWL 2VLRA 2TAAA 3ASNB 1IGYA 1U3HA 1GZQA 3ATDA 4L3ED 4WI4A 2SEBA 2ZYIA 5EU6D 2VC2B 3GRGA 2EO7A 2VXVL 3CVHA 2ZUYA 4F37F 5FWQA 2XV2A 1XF5B 4YBLB 4ERYA 2HT4C 3WIHA 4L8CA 3HBZA 3IJ9A 4PJ5D 2CJUH 2P9SC 1KCVL 2QMJA 2RD0A 4F9PA 3EI1B 1HAWA 1RIHL 1XR9A 4PLOB 5BQ7A 5J06A 4L4TB 3MRRB 3DGDA 2DQMA 2Q76A 4K71B 3VI3A 4WGVB 2AANA 4AL8C 4B7LA 3H2WA 4BUHA 1ED3A 1AKJA 1RKRA 4EXKA 2O4EA 3NAAL 4ZUTB 1MXGA 3M46A 4YQXH 3NSFA 5ACMA 4S1SL 4AJVA 1RLWA 4EDXB 5CINL 3ATBA 5DRWA 3QULA 4L1BA 5A2Qg 1CFTB 5EMMB 3HZVB 5A2KH 2VDNA 1H9VA 3ZU8A 1OAKL 3QUZA 3RJOA 3ZT7A 5HGHB 1SQMA 2BCKA 5F9JA 4J82A 5MEND 4OQTL 2NZIA 4XT1C 4B9YA 4TLUA 3V9EA 3VWKB 4JO5A 2FNBA 4MAUH 3ZT5A 4B9FA 3V4VB 3RIKA 3IMBA 3SDAC 3OAUL 3V5KB 3NZHL 5C09B 4Y7MA 4F8QA 5C2BH 3LZFL 4KDWA 2Z31D 3VX0A 1W8NA 2BHUA 4QRRA 4G2AA 2RCSL 5LBSA 5E6RB 3KVDD 4A0AB 3CDZA 3GSWB 5ITBL 2J1YA 3FB6A 4NN6B 4PJEB 5C9JB 2EDRA 1LEGA 3ZO9A 1AR2A 1MHCB 2JCCB 1D9KD 5DSCB 3UAJA 4ODSL 4LCWE 5GIRB 3VCLA 4S0SD 3LSOB 4M8QA 2H0FA 2ZCKH 1PEWA 3H55A 5JWZA 3QH3B 2WK2A 5TD4A 1KCUH 5TQ0L 1N0LA 5L9DL 1HDMB 4I3RH 2OL3A 5CBAA 1QKZL 5IVXB 3FT4B 4E5XB 4MQXC 4PJCE 4HZLB 1AGCA 2JQMA 5FR3A 2NPLX 4OJYA 2AMUA 2W65A 4IKJA 5I1CL 2O6DA 4KUCD 5AVYB 4P2QA 1QI5A 2P5WB 4AMKH 3RFZB 3T65A 5ISZE 4I48A 2XNAA 3DTDA 1YEDA 3TYGH 1ZOXA 3UOAB 1NMBH 1JK9A 1AVAA 4BK5C 4AJYV 3WTVA 2NUPB 3K6SA 4LLMA 2K8QA 2YXMA 3C5ZB 5EU6E 3IKKA 1P2CA 1LVEA 5IGXL 4WV1B 1CXIA 1H0DA 4B9PA 5KUMA 1HKLL 1JYNA 4KDTA 3TESA 1H8NA 1QLRB 2Y36L 1QRNB 1YMMB 5FM5M 4KJPC 1RHHB 2P8MA 4X6DF 5FX3A 2A9ML 1LK2B 3HS8A 5KSVA 1E9QB 1JXDA 5JORA 4NC4A 1KENH 4CKQA 3GEWB 2P49B 2B4CL 4JM2B 1KTDA 2NSMA 5JXAH 5GRUH 1V3LA 1BSIA 3JSSA 2ZZUT 4MNQB 2PW1B 4EQ2A 2EDKA 2IAMB 4ZMVA 3V0IA 4XAWH 3ULAB 4IJ3C 1OMWB 1EEQA 2PF6A 2CK0H 3SPGA 5DU7A 3W57A 1NFIA 2HFEA 3VXOB 2X7LA 3QI9C 4IGBD 3UAFA 3ZVVA 5TDHB 5F7MC 2XQ0A 3F12A 4YSUA 3PJSA 5AJAA 2FNWA 2ZUWA 4PRHA 2O9KA 4WK4A 3MV7A 3KYKH 5IB3A 4JFYA 3HI5H 3B6SA 5MENE 3JVFC 1IAII 1V7NH 4ZUWA 4D9QD 2X4UA 1ZHBB 2I7SA 5GGQH 5EBMA 2PCFA 1XGPB 2BERA 3GO1H 1QASA 4MNGB 1SN2A 4K94H 5AVQB 3WEBA 4LPTA 4LO9A 4WI3A 4JPVL 4Z77A 3DOSB 3IFLL 1U3ZA 4J86A 2AK4B 1Z1WA 1TJGL 1YJDC 4X5WA 1ZV9A 1KJ2L 2GABA 2YN5A 4Y89A 2HKAA 2YSSB 4N1EA 1KBGH 1NZRA 4Z76A 5F6HI 3LN9A 1B0GA 2ARWA 2W5PA 1MI5D 1LEIA 2KQMA 3OKLB 5PAZA 1JRHL 4JPQA 4WW2C 4JRYA 2ISDA 1J0KA 1NWOA 1RUAL 3KPSE 3A4EA 1SHYB 3A6BH 1JZJA 5E8PB 4RAUA 4DO4A 2XL2A 3LZPA 3BKML 5GGUA 4TLTA 3N41B 5DDHB 4I1PA 1GYUA 1TTCA 5EIQA 5TDNA 1U2CA 5L0QB 2BSBA 3B7TA 2JKTM 1J5CA 1VZIA 3DV6B 4XHJD 2EADA 2H2PC 1ZV5A 4NP4L 1IV8A 4KPHH 1C16B 4EVNB 3ES6A 4FQCL 3JWOC 5D7IE 2JB5L 1Z7JA 3PU7A 4ZQKA 35C8L 4D2NA 5J56B 4PJ9D 4L3HD 2FWOA 1AP2B 2PYEB 3M1BA 3OZ9H 3D1MC 3EW3B 2Q87A 1FL5A 1OAQL 3V5DB 3QEHA 2G0LA 3CUPA 1YPZF 2DQFB 1B9KA 5HYFA 1N68A 3EQ7A 4U1JB 4HMDA 1A02N 3KMDA 4NEHB 4TQPA 4LVNB 4X7DC 4PJFE 1NAMH 3T1WA 5I1AA 2JI2A 2XZAL 4YVDA 1BVNP 4S0HA 4YUEH 1G9MC 3O6ML 4RMUA 3Q3GB 2A0LD 3CQQA 1KXTA 2VR6A 2VQ1B 4JUSA 2VQ4A 4X9FA 1FGNL 3EOAA 6FABH 5JIDA 1VF5C 1R46A 2J6EL 4U1GC 4UNTA 3STLA 3EFOA 3HG5A 3ZDYE 3WE6A 1IBBA 1KGXA 4E9TA 4W9FC 5KG9A 2WLYA 5F1KC 1I9RL 2JVUA 1URZA 1ET5A 1JK8A 4ELKA 1EHKB 1H3TA 1UWFA 4DHLA 1I8IB 5T33H 1TF4A 1T1WA 3I9PA 4UILL 3CVIL 3DHJA 4DGIL 4EO5A 4OM0H 1MOEA 1XF2A 3U2SA 2CBMA 1S78D 1KXHA 3VH0A 2EQDA 3QPQC 1R5IA 3BSGA 2CO7B 3BHBB 4D9QE 3BP6A 1UC6A 1X4YA 3U46B 3FMGL 5CGBA 1HCZA 1TNNA 2DKMA 4P5MB 3T77B 3FTZA 1FFPA 1DQDH 2CHXA 5D6DC 5SWZD 4K3JB 4G7YH 1KT2A 3H8NA 2DLEA 2JKNA 4HXBH 4XWGH 5HHPA 2GT9B 5CJXA 2I27N 1G43A 3IBEA 5I26A 1PZ2A 1U8MA 3SQBA 5I1IH 3VXUD 5DEFB 2XUWA 4OTXL 5FUZH 3FNKA 2EDDA 5SWQA 1WFNA 4G6JH 5DQJA 1P6FA 3WGVB 4AQAA 5EF0A 1XCWA 2NRDA 4A7QA 5TQ2H 4JG1H 3EYUH 3O4LE 1ZS8B 1MAML 5IQ7H 2VJ8A 5JW3H 1MREH 4M00A 5CZXD 3UTQA 1RY7B 5CZKA 3BZ4A 2VDOB 2XVLA 4G6FD 3ARED 5FAAA 3AG3B 2X89A 4LBEA 4KJYB 4OM1H 2J8UB 2EXYD 5H1MA 4FFWD 4Z7VB 3ZKXB 3SWSD 4IRSC 3S3BB 2ZKWA 4ODBD 1DBBL 3C09B 1MLBB 1YR2A 4ONHA 3HPJA 1OB1B 2AXGB 1L9PA 5HE1B 2Z34A 5AALA 4PFEA 5JXEC 3SXTD 5T1LA 3GK8H 1KGYE 1TEFA 3RY5A 4QR7A 5E4IA 2H32H 3NJIA 3UBXI 1IE4A 2BM3A 3U36B 2CKBA 2C7UB 4JG0H 3FB8B 5ESQB 3UGEA 2EDQA 3WKYA 5L2JB 3MJWA 5E9NA 4IKKA 1E5AA 4ELME 2Z7YA 1B0RA 2BVOA 3L2MA 4ODVH 1CDYA 5LCVH 3FH8A 4PJDB 2HN7B 4U1IB 3FU5A 1EEZB 3LHAA 2MNWA 3LVEA 1E9OB 3RLMD 4Y16C 4HBCL 4LEOA 1BFVL 4NQED 4I18B 1BVKB 2ZCZA 2H9PA 3P0GB 4I77L 3N9GL 1MSPA 4GJTB 4R0LC 3P73B 4JR9H 1MFVA 5F0PB 4Z3EA 2VGLM 3C60A 1E43A 1S7VB 4K8RC 2CDEB 3B37A 3KJ6H 2P9UC 2VO5A 3L3KB 5DVOA 4MWFB 3THML 2OCCB 4HMEA 4NO5B 4M6AA 1Z2KA 3D2UD 3I6KB 5MEOA 5ETUB 4KNQA 1ZANH 3P4OB 1FQ9C 3ENEA 3MA7B 4WNQA 1H6FA 4QRQA 1YJDH 1FO0A 3DIFB 4WEUD 1VE7A 2FEDC 5C0JA 4WNJA 5CZVH 4AV0A 2WWOA 3ARUA 5E1HB 4PR5A 3ZYOA 1LO4L 4KZEH 3CD4A 2CBPA 3ATAA 1TQUA 2WLKA 4JE4B 4FCHA 3FGBA 2WIMA 3BZEA 1XGTA 4W81A 5SWZE 3AL8B 3L6FB 1UJ3A 2BIIA 2J55A 4M5SA 2BNQE 4WFGE 2OXHB 3MODL 4XNAA 2F08A 3VFPB 1A3LL 3JWNE 3ILEA 4FL4B 4NLAA 3FDWA 5EBWA 4AQ8A 1IILE 3NIFE 5H17A 1IAOB 2JQAA 4YXHL 3UTSD 3QWOA 4CI2A 2VERA 3B2PA 4QHNB 3VXUE 1YRKA 3Q2CA 2P9LC 2A6DB 2O5ZL 5AVWB 1ZTXL 4PM1A 3C6LC 2O26U 1QPKA 5DEGB 1KV7A 3JWOH 3CLEH 3E8UH 2DJUA 4HAGA 4M48H 5DJ6B 5A40E 3MOAL 4OCYH 4X6FB 2PWGA 4S1DD 1NANI 4GP4B 3I6GB 4XN8A 5DS8B 4AC4A 4ZD3H 2W81C 1KGCD 1XH3B 4AIZA 3VG9B 4FFYH 2AGYA 3VRIA 4YSDA 1C8PA 5J5EA 4R9HA 1S2EA 3NH7L 4G6KH 2WQRA 3NP3A 3W9EA 3BSZH 2CR3A 3IVMA 1NICA 2CDGB 1SXSA 3KRXB 4WENB 4HPYL 1L7TL 3RFGA 3AUVA 4L8SC 1DFBL 4QOKE 1G9MH 4XEIC 3DIVA 3FT9A 3N1QC 1UHVA 1BYOA 2VL5B 4D9LL 5I1HH 5C0CD 1ACZA 3D25A 1D7CA 3J81g 5K9JL 4FKHA 1BGXH 2DQDH 4M93C 3KLHD 1HWHB 1MRFH 2DWDA 3I3DA 4FQPA 5I8KL 4ONGL 3SKJL 2JKIS 4BFOA 2GSGB 4J8QA 4YL9A 3BQUD 2P3YA 1TYRA 1IM3B 5IESH 3KLLA 2DYPB 4FDWA 3DROB 4NUGL 3K2KA 2VWEC 1OCZB 3C75H 1TZIB 4KKNA 1KNOB 3ESNA 2YMXL 3LS4L 4A2MA 1HH9A 3FT2B 3T3PE 1AGDB 4JQXA 4UU9B 4LHUA 1EDQA 1J1OL 5IBLC 5GS0C 1I1CA 4NQEE 4WUUB 5KS9A 3IJYB 3GSVB 3PABB 1AR1D 4X8JA 3U9UB 2ITCA 2VLRD 2AQ1A 1CZ8L 1NINA 2H9GB 1KY7A 3MUZ1 3NIGE 4UDUA 5I6MA 1NA8A 5CJQL 1KACB 1MCWM 2WWMD 4I0PA 1OTTC 1RJZA 2Y4SA 4Y19A 4L1SA 4XMKH 3UO8B 4YHLL 5H2BB 4H8PA 2OR9H 2DIBA 3EFFA 4MVBD 4YR6B 3CZFB 5HD8D 4ZDHB 4Y9BA 1CS6A 3L3HA 4OIBA 2VXQL 4UQDA 5KANG 3TURA 3NQIA 2MSPA 1J12A 1MQKH 1JUFA 3HCVA 2D7NA 1M4KA 2B5NA 1ITBB 3I02A 2YGOA 4GIPD 4OGAC 4AT6A 4ZTEA 2NT1A 3FRUB 4XB8A 5D7JC 4PYHA 2J6WA 2LR4A 2HYEA 4OKDA 3IJ7A 1AKJD 1QTYT 3EO1B 4GEJA 4HK3N 3NFNA 4TSCL 5CO1A 5TH2B 3SJVB 4J6RH 3CXHJ 1PZ5B 3F5WB 1CDIA 4RRPG 4ZMNA 2FZ3B 3VGBA 1NCDL 3HI1B 1EFQA 2NX5A 5DZNA 4KTEH 3DURB 4AYFB 2FLRT 2DEYX 2F61A 4LKXB 1G9EA 1LQSR 4ESKA 2B0SL 5DRNB 1KGCE 4XRCB 3V6BR 1MVUB 4KXAA 5DI8B 4E54B 5KSBE 3AT9A 5HYJB 3ESMA 3PHSA 5IG7B 1BLNB 5I71C 1HC1A 1ERNA 5FW8A 3S5ZA 3D7PA 4FI8A 4CVUA 3A3YB 5JW4R 2GC4A 4N0FB 3LEVL 3MRIA 3NZ8B 5HHMB 5IFHH 3ULUD 1HOCA 2CJSA 2PR4H 3TBCA 5MI0C 5IT2H 4G8EB 2WLZA 4QRRD 3K8MA 3ULEC 5ANME 2ZXQA 4AVHA 1JHLL 1PD0A 1VFBB 1QHPA 3QDJA 2BZDA 3GLEA 4X5LA 4X50A 4NPYA 3Q7JA 2CIKB 2CU9A 2NY5C 5E24E 3OJVC 4XP9L 1Q1JL 4M1GH 2VZTA 4W9CC 1EBPA 4OY9A 3UAJD 1DE4B 4A68A 2EVFA 3TFKC 3QORB 3LZRA 5LBVA 5AQ0A 3LRKA 2I3SA 1QBLH 5FKAA 2O6FA 3FFCA 1D6VH 1L0YA 4HWBH 4M62H 3NJKA 3REWB 2I32A 4K8RH 2GY5A 2JSFA 3SYQA 5EOCJ 1U8KA 2EXWC 4WK0B 2FLMA 2QR5A 1CMOA 1LO5A 4NOFA 4IMMA 4ZO6A 2CGYA 1J1PL 1JWSB 2VC2A 5ANHA 4FZEH 3SE8L 5E23A 3HZMB 1RK1B 2FHBA 4KDVA 1XF5A 2IPTH 1OCRB 1QEWB 1WJ3A 5DT1L 4P3WA 4U0RB 2D2OA 4NO0B 3WY2A 5DC2A 1RVFH 3UC0H 4AEHL 3H7BB 3IRZA 4NQVB 3EI1A 2BZCA 2WQ8A 1ETB1 2XBZA 4UV4L 4L4TA 3MRRA 1TKWB 5I6XC 5DWUH 4KKRA 4KQ4H 3BAIA 1FA4A 1T21B 4DIXA 1F4XH 3GJEB 1NGPL 1OTUC 5K69A 2X0WA 2E6QA 4UI9R 5GJTH 5IHBA 4F27A 4ZUTA 3ATEA 5AYUH 1BPOA 3VVVA 4U3XA 1SRDA 1BREA 2NXZC 5BOJA 5C92A 2X1XR 5C3LD 4PCTA 4PJBB 1CFTA 3HZVA 2JELL 5D4JA 5E5LA 4QRSB 5EOCL 4NZTL 2Y07H 5J8OA 5IJVB 4DJMA 5EMLB 1RJLB 1VB9A 1UXWB 3V4VA 1ZLEA 1JRHI 1QOKA 3V5KA 2X41A 3BAWA 2JKWA 3QHFH 4OZGF 5C09A 1JMZA 3BEVB 3U79A 1H8SA 5EU7C 5JOEA 2YXVA 4KK8D 1UWGL 4PRHD 2A77L 3B43A 5C07E 3T2QA 2XTJE 5E6RA 3K5SA 4HH9B 3NCYP 1GYCA 3QIBB 4A0AA 3GSWA 4PJEA 5C9JA 1HHJB 1XCTB 2WP3O 1MHCA 2A6IB 2JCCA 5DSCA 3S0PA 1F2QA 3AG4B 4LK4A 4Q2ZB 3RB5A 1MHHB 3CQFA 3PWVB 5FGCE 3OLEA 5GIRA 5FKSA 4YE4L 2DQGL 3LSOA 1GOHA 2WYHA 3EOTH 3VTMA 3MJ8B 3KL5A 4EBQL 1D7FA 5IUSA 4U6VL 4UQIM 1B4TA 3GM8A 1T80A 2AV7B 1HDMA 5I30H 3RQ3A 3FT4A 4E5XA 4AKPA 3GKZA 2JKRM 5GS0H 1M56B 5I76B 1KFAL 4JRYD 2I0RA 2NQCA 3VD5A 3RFZA 5IF0B 4M6OH 3N85L 1B2WH 4OF3A 5FYLH 2YKLH 4KH2A 4WI6A 3U48A 3ELAT 4H2CA 3O8XD 1RZKH 3CU1A 3C2SA 4QAWA 3C5ZA 2HPTA 3WMSA 3HG1B 3RZCB 3HG0A 2XXGA 4IRZL 4NUQA 3T3ME 5ALBL 3TEZA 3HC4L 3RVXC 3UBGA 1QLRA 4HEMA 5F7LB 2ZXEB 1QRNA 1YMMA 4M6NH 5EUOF 1RHHA 3QAZB 4QF1B 1SJHB 4B3EA 1IC7H 1LK2A 1AQ8A 1J9CT 1WGVA 3ESPA 1NCCL 2IBZX 3FQUB 1E9QA 3WJJC 3L95B 1JZIA 1MVYA 1RZFL 3SDXF 3WFHB 4JM2A 1C12A 4TV3A 3TX4A 5I5MA 3VNZA 4BUGA 4JPIB 4PWEA 4AIXA 1YSOA 5I1GH 4HJ0D 2PW1A 4MNQA 5A2IH 5I0YA 2IAMA 3SKNB 2YS4A 1F4WL 1E30A 3L5HA 4L9LC 3V7AE 2DQIH 1KMGA 2ZQKA 1KIPB 3QJSB 3AM8C 1P4IH 3VXOA 3ZIYA 1MG3A 2NZ9C 1AQDB 3X1GA 2FJSA 3GRWL 1LE5B 4HLEA 5HDRA 2PWEA 5JMOC 4Z3FA 4PRAB 4HQQH 4XP5L 5HYSG 4KFMB 2DWSA 1BFSA 4F5CA 1CFBA 3B56A 1U92B 4NXSA 3SY0A 2GEEA 1OPOA 1JJUB 3MJ9L 3G5YB 4GG6F 4N4YB 5DVKA 3TZVB 1OWRM 4JVUA 2OK6A 1DUZB 3MMYA 1ZHBA 2DQUH 4OCWL 3WENA 1FGVH 4MNGA 1OE3A 2K6YA 2H0PA 3RYMA 4OI8A 4M43H 4FFZH 4C59B 1M2VB 1S7WB 1WFOA 4PRHE 2Y5QA 1G9NC 2BY1A 3DOSA 4RGMB 1UADC 4PJGA 2NY5H 3WSQH 4WFFD 3OPZL 4O9DA 5PCYA 1F1GA 3F85A 1S9YB 4XPHH 4HX1B 2AEPH 4B0MB 2M8XA 1T1ZB 4EOWH 3HRPA 4QO1B 2VDMH 3M1OA 3IURA 5TGBB 5DMYA 1DZBA 2WUBH 3K27A 3IETB 2WC7A 2UXVA 1NCAL 3R06B 5KTEH 4Q56A 5B7EA 3FB5B 5E9DE 5E8PA 2OTUA 3NCWA 4GRLC 5DDHA 4ZX5A 4AC2A 4XPBL 3MUUA 1G87A 2FGWH 5DUJA 1WYJA 2H3XA 1O9WA 4W9KC 2C3HA 4GSRA 3DV6A 4Y2OB 5C7XL 1NCTA 2I85A 1YEFH 1JHKH 1KJVA 4K3DL 3BT2H 4EDWH 4ZZFA 15C8H 5B39A 1C16A 4EVNA 1SHWA 1E4KA 3FCGA 1WE5A 4H20L 1CXHA 2P9PC 2BJMH 2AEQH 2E4TA 4GM9A 2B5IB 3JZNA 1QNZH 2PYEA 4KU1A 4PW3A 4YWGH 4DF9A 2TRHA 5DQ9B 1SMAA 1BW8A 1BIIA 3HE6C 5AB1A 3V5DA 1OGAD 2X89D 1AI1H 2DQFA 4O5LL 3P4LA 4U1JA 2NY4D 4POZD 3U30B 5IHHA 1V7MH 4DNVA 5E00A 2DQCL 4X4KA 1GG2B 1AY1H 1QBMH 4HLZG 2FX8H 4XNZC 2BIQA 2L7JA 4FMVA 5T1LD 2Y5TB 3Q3GA 4AMZA 1JGVH 2VQ1A 5DYFA 5IB2B 3NGBB 4KKPA 3TT3L 4M4RB 4UTBL 4DW2L 4Y9GA 3VACA 3ILQD 2B3IA 3B2UC 2FL5B 3MRLB 4OLVL 4C4KO 2DM3A 5EEYA 1TNMA 4F2MA 1WV7T 2DDQH 4HF5H 3GFUA 4TNFA 4F20A 4HIQA 1ZIBA 1BBDH 1I8IA 2ZWZA 3JXAA 1U93B 4LCCB 7FABL 5DRXB 4Z5RB 4YHZH 5B4WA 1X6NA 4JGNA 1U8PB 2AQNA 4HGKC 4KHTL 4PS7A 4H88L 4Y1TA 1RZ7H 2RQEA 4CMHC 3PWJA 1BMZA 4P5TB 5AZ2L 7CGTA 4G3YH 2NTSP 3VFGL 3C60D 5JYMA 3BHBA 3EYQC 4UT9A 3OKWA 3U46A 1Z0MA 3GSRB 3FQRB 3WLWD 4P5MA 4DAGL 3T77A 3CDGB 1J0ZA 4YSPA 5TEFA 4QL1A 2XN9E 3NIDF 4Q9RL 2BBKH 3S34H 1K3IA 3RY6A 3LQAH 4WFFE 2BSTB 2GT9A 5JOPD 1HE8A 5F70A 1IBFA 1MCOL 1MCBA 3CG8A 4YHMH 4IQHA 4PJCF 2HPOA 2VR3A 3FKUS 4ZOBA 3Q6GL 4M6MH 4H8QA 3MNMA 4WTQA 3GWJA 2BRRL 1MAJA 3IPBA 1YMHB 3FC8A 1L7IH 2YRPA 5HHNB 3U2JA 4TTGA 5M5SA 1CI3M 1ZS8A 2WOBA 1XIWC 1RQ5A 5FYKD 2MOVA 5KYXB 5IGQA 2VDOA 2XPGA 1XAKA 2J72A 2G4GA 5BV7C 3DIDA 2ZKHL 3D52A 3SODB 4KJYA 4FAND 2R2EB 3OHXB 4PJXB 4Z7VA 4K5PA 3V4LA 2YA0A 3VM5A 1MLBA 3FUFA 1OB1A 2AXGA 1OT2A 3I9AA 4AYBA 3DXMC 4ODHH 5C71A 5A3ID 1IU1A 3UDWA 2DKSA 3CH1B 1OGAE 1UM6H 2KLRA 4GLRI 4UOJA 3RNKB 3GTTA 1SYVB 2E9JA 2XU7A 3U36A 3GZOA 5M5UA 2WXNA 5EIIB 1EZSA 5ESQA 3FB8A 3D9AL 5AKRA 4OBRA 5L2JA 1GW6A 1PSKL 4DVBA 2TRYA 3MPCA 3QPXL 4H13C 4HSCX 3V0WL 2P4AB 1NIFA 2R0LL 2Z1KA 3V0DA 1GGCL 5E2TH 4PJDA 2HN7A 4U1IA 4RGOL 2G2RB 3ZE2F 1EEZA 1VIWA 3LXAA 3CWGA 3GGWB 4UV7L 1E9OA 3MNVB 3TONA 1R9FA 4U1SB 1UYWL 4QHLA 1BVKA 1IC5H 2VM4A 5C97A 4ZMWA 1LGVA 3U0TB 2Z31C 1WWCA 2D7QA 3DX7B 1OP3K 5LXGH 1OE1A 1FAKT 4YDIH 1HZKA 1S7VA 4XAKD 2CDEA 3S2AA 4A2LA 1G5AA 3L3KA 2ARJB 3ZTJH 4MWFA 3R4DA 4LHUD 4NO5A 3WMPA 4C54A 3I6KA 5J0BA 5ETUA 2EEBA 3T6WA 1AHWC 3MA7A 3P4OA 3DKHA 4PWHA 2VN3A 3UPCA 4E41D 2AZAA 2X1OA 5INCB 3PAVA 4OV5B 3ETBJ 3GD1I 1S3KL 4GT7A 4RBPK 4ZTPH 2CIIB 4OLWH 3S8FB 1KN4H 3GMNA 3HPLB 2DQJH 2W0LA 3V79C 4KO6A 2VL4A 4Z7QE 3SDCD 2AC0A 2CAKA 3AL8A 3L6FA 2YWYA 3AQZA 4L8BA 4WEBL 2OXHA 5A43C 3GFCA 4G9FB 4QIRA 1XBRA 1W72L 1SN5A 2EICA 3AROA 3WNKA 4Z7OF 4IBZA 5D2LB 3NCJL 2ZICA 3TJEH 2ZP0T 4F2EA 1AS7A 2VMEA 4YK4B 2XQYK 2A6DA 2DPKA 3CFUA 4KUCF 2KT6A 4UIKL 4QY8B 3HG2A 2H13A 5DEGA 1SXBA 1ZEAL 1YDPB 5CKAA 1SZNA 5DJ6A 4AEIH 3ZHDA 1KIRA 4NI3A 4X6FA 4IOIB 3TTSA 4ERSL 3VD2A 1XGQB 4HCRA 3HNSL 3I6GA 1U91B 2AQ2A 4K73A 4R97C 5DS8A 1XH3A 4MGXA 4NRXB 4DOHE 5FYKE 2Z92B 4W6XB 1S4IA 4G6MH 2RH0A 4NERA 4FEMA 1NDGB 2CDGA 2VXTL 5CEYB 2ZXWB 1T03H 4G9DB 3KBHE 1J1XH 1RCYA 1EX0A 5IQ9B 1UKSA 2WXRA 2Y3AA 2VL5A 3MMEB 4HIEB 2CJ3A 3IMRA 3EJCA 4TSAL 5E4EB 4QCIA 5LG6A 2J57A 3EBHA 3LV3A 4AKQA 5BS0B 1ZA6B 3TWCH 3DGGA 3CSTA 4JZNB 3WIFB 4YAQB 4QHPA 3SHSA 5F7HA 5K59F 4XNUH 3S6CA 2DW5A 2AH0A 3VD1A 1QEXA 2GSGA 4F7CA 2PXYB 3BKCL 2NYYC 2VUKA 3FTSA 1IM3A 3KPTA 3QDJD 3K71A 1VKXB 1J8HE 3DROA 3GMQB 1RURH 4WWID 5CNHA 1TZIA 5HHOA 1KNOA 1PPIA 3UGXA 3KLKA 5I2IB 1A7RL 1CIDA 3FT2A 2P24B 2IDQA 3FU8A 1AGDA 4UU9A 1G0XA 5F8RC 4WUUA 1R3LA 1AGFA 1F1DA 3IJYA 3AQDA 3H3BC 3FFCD 3GSVA 1KYFA 1TTGA 3PABA </