3SBQA

Pseudomonas stutzeri nitrous oxide reductase, p65 crystal form
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
581
structure length
581
Chain Sequence
QKIHVGPGELDDYYGFWSGGHQGEVRVLGVPSMRELMRIPVFNVDSATGWGLTNESRHIMGDSAKFLNGDCHHPHISMTDGKYDGKYLFINDKANSRVARIRLDIMKCDKMITVPNVQAIHGLRLQKVPHTKYVFANAEFIIPHPNDGKVFDLQDENSYTMYNAIDAETMEMAFQVIVDGNLDNTDADYTGRFAAATCYNSEKAFDLGGMMRNERDWVVVFDIHAVEAAVKAGDFITLGDSKTPVLDGRKKDGKDSKFTRYVPVPKNPHGCNTSSDGKYFIAAGKLSPTCSMIAIDKLPDLFAGKLADPRDVIVGEPELGLGPLHTTFDGRGNAYTTLFIDSQVVKWNMEEAVRAYKGEKVNYIKQKLDVHYQPGHLHASLCETNEADGKWLVALSKFSKDRFLPVGPLHPENDQLIDISGDEMKLVHDGPTFAEPHDCIMARRDQIKTKKIWDRNDPFFAPTVEMAKKDGINLDTDNKVIRDGNKVRVYMTSMAPAFGVQEFTVKQGDEVTVTITNIDQIEDVSHGFVVVNHGVSMEISPQQTSSITFVADKPGLHWYYCSWFCHALHMEMVGRMMVEPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Oxidoreductase
molecule keywords Nitrous-oxide reductase
publication title N2O binding at a [4Cu:2S] copper-sulphur cluster in nitrous oxide reductase.
pubmed doi rcsb
total genus 179
structure length 581
sequence length 581
chains with identical sequence B
ec nomenclature ec 1.7.2.4: Nitrous-oxide reductase.
pdb deposition date 2011-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
A PF18764 nos_propeller Nitrous oxide reductase propeller repeat
A PF18793 nos_propeller_2 Nitrous oxide reductase propeller repeat 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3sbqA02
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 3sbqA01
1B9XA 4UAHA 1BQKA 4ESGA 4LG9A 2UXFA 3AG4B 4TXVB 3TA4D 2QXVA 4ZOXA 3H56A 4KO5A 2YMUA 5IGQA 1PAZA 2EBSA 1TKWA 3IBOA 3NJFA 3JAMg 2XWZA 2H9PA 4AEZA 2CN2A 4FA5D 4A2HA 4ES0A 2IUPA 4JXMA 1JMZB 1BQRA 1PCSA 3AG2B 2PM7B 2J56H 4AOWA 3U4YA 2IAAA 1OCOB 3PE7A 4O45A 1KYAA 5TEEA 1EHKB 3NYKA 5KDOB 5GXIA 1XMEB 5FC9A 1GS8A 1L9QA 3C9CA 1GW0A 3DXMC 5D4IA 4YSSA 3FU8A 2MTAA 2EIKB 3FYIB 4JHUA 3NJJA 1JZFA 4GQ2P 1SF3A 3IKOA 4E9TA 1SHWA 1KCWA 4GYBA 1ZIAA 1KBWA 4W1TA 2WO2B 1MDAH 2GBAA 3NJMA 2J5WA 3CG8A 1NPJA 1MG2C 1PBYB 2JFCA 4UANA 1YFQA 1AANA 1IC0A 2B5NA 4P5SA 4CSPA 4CI2A 1RI6A 1J9TA 1OCZB 1VLXA 1PZCA 3MBWB 3PAVA 4A66A 3ULEC 3AY2A 2PCFA 4E9SA 3GREA 4GGDA 2W8CA 3BWSA 4A11A 5EM2A 2XU7A 2YARA 2B5LA 2CUAA 5B1JC 4CY1A 3FU9A 2H6QA 3DKHA 3EI4A 2CO0A 3I2NA 3QJUB 5JWZA 2DWSA 1NIBA 2VN3A 4EF3A 1OMWB 4M4RB 1UATA 2H14A 2HJBA 4GGAA 4GMBA 1AS8A 2YXVA 4BUJC 3K27A 2HJ4A 4GP5B 1NINA 3S3BB 1MG3A 2XV2A 2PCYA 5C9ZB 2H3XA 2QPEB 4QLWA 2YBAA 4XYIA 4E5ZB 4J86A 2I3TA 4YSCA 3IJCA 3JT2A 2J55A 3RRMC 4HHGA 2HXCA 3EH4B 4ENZA 3DWLC 4CC9A 1WS7A 2HX9A 4ZOZA 5EMMB 3T6VA 3QJTB 3GXUB 5TF2A 3HEIB 2I0TA 2FT8A 3NJHA 3T9WA 4ZN4A 1JZEA 5EHFA 4JSXC 1SDDA 4J73A 3PXWD 4KFMB 4CZYA 4QT8A 1SHXA 3CIKB 1AIZA 2IDTA 1F56A 1KGYE 2QPDB 4JKNA 1ZDSA 4DP9X 5H17A 5B1KA 3UVMA 2YNPA 3SHFA 2YAOA 2UX7A 1OCRB 2GSMB 4HIPA 4CY2A 1PNCA 2AANA 4E9RA 2GC4A 1X9UA 4A68A 5AZUA 4DP5X 5I5IA 2J55H 2P80D 1XKSA 3PXTD 5E9NA 3UVOA 4CY3A 1E65A 5SXMA 3EI1A 2AGXA 2CCWA 2PPAA 1JXDA 3KRWB 3OKYB 2AVFA 2B4EA 3D12B 1AOZA 2IH9A 1S4UX 4J84A 4DP6X 2XX1A 2YXWA 3NSFA 5F7BA 4DP2X 3HFQA 1JZHA 5I6OA 2XLLA 3SXTD 4A7JA 3X1GA 1V55B 2P80A 2OVPB 4PC0A 2HXAA 4KOCA 5FKSA 2PPEA 2QC5A 5H1MA 2N0MA 8PAZA 2DWTA 5EALA 1JMXB 3N2JA 2BO0A 3EI4B 4YSPA 2XV0A 2W18A 4CI3A 2I0SA 2GI0A 2PP8A 5I6MA 1PNDA 2CBPA 1FFTB 2H13A 1MG2A 5EMKB 3UKUC 1QLEB 2Q7QA 2P9UC 2AFNA 2Q9OA 3EH3B 3I89A 1SF5A 4NSXA 4EWRA 3E0CA 3CFSB 1U2VC 3F3GA 2UXVA 4G70B 2AGZA 3W15A 1L0QA 4X4KA 2O9KA 4X61B 3ZDWA 3FSVA 1BQ5A 5B1JA 1T5KA 1URIA 2G9AA 3FGBA 3MXXA 4PSWB 5A2Qg 1PLAA 5FKTA 4CZVA 2B08A 3ASNB 4K3JB 1RKRA 1RZPA 3X2QB 3I7HA 3I7OA 2VSKB 5HE1B 1WA0X 5K19A 4WKXA 1JVLA 4E9WA 3RYMA 4YVUA 3ASOB 3ORVD 3UVLA 1AZRA 3SMRA 4HZ1A 4ZOYA 4YL4A 3TBCA 2AQ5A 3EMHA 3L4MD 4E5ZA 4ZOVA 3L45A 4E9XA 4GM8A 5B1AB 5TK4A 1CC3A 4JSPC 1PY0A 3TBBA 1AZUA 4HDJA 3AL9A 1QNIA 3EI2B 1PI6A 3FSAA 4FA9D 4ERQA 3FT0A 4UF7C 5AFU3 1EZLA 1NTDA 2J57A 2J57G 3CFVA 3RN1D 3PXLA 1W6LA 3EI1B 2LLNA 3ZBMA 1ILUA 1V54B 3V9FA 1SFDA 3BVDB 4FAVD 4O3UB 1NIDA 1OLZA 2DV6A 1GS7A 3UKRC 3TASA 2P9LC 2HX7A 1KV7A 2YAMA 3GYRA 2HX8A 1AG0A 4G56B 1A3ZA 4FAAB 3SJLD 1SQJA 4J79A 4MK0B 3AW5A 4KOBA 3OL2B 4J0XA 1WA2X 4U7AA 2JXMA 2UXGA 2QT6A 2VMJA 2I7SA 2BW5A 1SJMA 1AAJA 2I7OA 5I28A 3T71A 2Z2OA 3PLYA 1M56B 4L1QD 4Z8LA 3F3PA 2IURA 2YNOA 4BK5C 1TU2A 4L0PB 5I5JA 4XEIC 3JPXA 3PPSA 4DP1X 4HALA 4KNTA 1AQ8A 3OKYA 3H4HA 3WNJA 3JROA 1J5DA 3SCYA 2XVBA 2E86A 4W9ZA 1ADWA 4BXSV 1NPNA 4A09A 3PVWB 2VSMB 5AFAA 1A65A 2CE9A 1GS6X 3JTBA 2PM6B 1NIAA 3OKWA 2PM9B 2P9KC 4FA4D 3FSWA 1N6FA 1JOFA 3NP3A 1JZJA 4YSAA 2Z2PA 3AL8B 3S3DB 2MTAH 4Y7RA 2P9NC 5ANHA 5TK2A 2BBKH 1B9YA 3PSLA 2HRHA 3ABGA 3QJVB 4YSDA 3JB9L 2BP8B 5PCYA 3UACA 4J78A 3PCYA 1ZV2A 4JT5C 1BYPA 3OMNB 4BXVA 3NT0A 4JD2C 3QQXA 3VA6A 3SWSD 2GIMA 1BXAA 3EH5B 2CALA 5D4HA 3NSYA 5F7AA 3PAUA 3ERXA 3K26A 1L9TA 1OCCB 1CYWA 3X1EA 3ABMB 3OQRA 3FYEB 3UAAA 1JZGA 4ERZA 2BW4A 1K8KC 1HFUA 1M57B 3OTTA 1NIEA 2QDWA 3WI9A 4N14A 3CVCA 2HKMA 2YB8B 1WS8A 4GQ1A 4H5JA 1XB3A 3FQ2A 4PSXB 2ZOOA 3KW8A 2UXTA 2W88A 3AZUA 4BWUA 3DIVA 1DYZA 3VH0A 1OF0A 1P22A 3GDCA 3B7FA 3OD3A 4HHWA 2GC7C 3TU6A 4X3EA 1R1CA 3RSEC 3SN6B 2EIJB 3I7LA 2HYEA 3SBRA 3CVDA 1A4AA 1AS6A 3S8FB 3FSZA 2I85A 2BWDA 2RACA 1A0RB 4IA9A 4X63B 2AGWA 2FJSA 2HZHA 2CE8A 3RFGA 3ODTA 3QJSB 3NJNA 4KO6A 1JVOA 4KO9A 1SNRA 4J82A 3EI2A 3N0EA 4A2GA 1IUZA 2MRYA 1BXVA 3ABLB 3QJRB 4AKQA 4JSVC 4N4YB 4HCFA 4L3GD 4YVNA 4HCGA 3AH8B 2DYSB 2YAPA 4J77A 3NVNA 4FWWA 3FU7B 1NDTA 4YSEA 2I0RA 2PPFA 4E9VA 2CN3A 4LGNA 5TDHB 4BWTA 5FKQA 4AX3A 1JERA 3J80g 4GY4A 2IAAC 2ZONA 3H4FA 3WG7B 2XU9A 1L9PA 2EIMB 4PCYA 2FQEA 2H47C 4MFHA 3SQRA 1DZ0A 2BHFA 4YSQA 3JZHA 3OL2A 1L9RA 5CYKB 4K9JA 4A0BB 4CZXA 4DPCX 1IBZA 1XB8A 2IDSA 1ET8A 3HB3B 4BDVB 4G7QB 1PZBA 1YLBB 5EARA 2UZYB 2VM4A 4E9YA 1RCYA 2EINB 4OZUA 2IDQA 2CAKA 2PP7A 5B7EA 3IEAA 2H5UA 3X1BA 4J81A 1B3IA 4L3HD 4A67A 4TZ4A 1KDJA 2OK4A 2XX0A 3JZNA 2PM9A 3EG6A 3T6WA 7PCYA 1NR0A 4L9OA 3AG3B 3FS9A 1Q47A 5FA5B 3VGZA 3AL8A 1KCBA 3NJKA 1MZZA 1N6EA 1N70A 1XIPA 3OMAB 2QDVA 2NRDA 2IDUA 6PAZA 4KNSA 3FRXA 2YQBA 4PNKB 3CDZB 2BP8A 4PAZA 1K32A 2ZWNA 1OE3A 2CNXA 3PSCB 4H5IA 2XL2A 3NVQA 3EWEA 1GY2A 1MZYA 5IJ8E 2GHZA 2Q5BA 1X9RA 4NB7A 1ASOA 1U4CA 4F2FA 1GYCA 4E54B 4LG8A 2CO0C 4G7SB 1ZIBA 1PZAA 2AZUA 1GXRA 4O1QD 1QHQA 4M3HA 2OCCB 2GB2A 1NIFA 4XYHA 5CXBB 2R7EB 4J8GA 4Y5RD 3PAZA 3IIYA 4CI1A 1CUOA 3WNIA 1FWXA 5EAMA 4GGCA 4A09B 3IJ0A 4K3ID 3WKQA 3FQ1A 4A2FA 4X60B 1PMYA 3OW8A 5GSAA 1V10A 3AFCA 1E30A 4PBYA 4D6VA 3RFHA 5IC7A 2I3SA 3A0FA 2XV3A 2ZXWB 4YVDA 3DXKC 4FAND 4A08B 2GC7A 2BP0B 2YAHA 5IT9g 4JT6C 2OK6A 2Y1AA 4PBZA 2J56A 1E67A 3RN0D 4QL1A 1PEVA 1ET7A 3ZWLB 2XYBA 1M9WA 3T6ZA 2IDFA 3PXSD 1PF3A 2FT6A 2JKWA 1A4BA 3OM3B 3QPKA 4P5RA 4BWWA 1GG2B 3MZLA 2BWIA 4AKPA 2OVQB 4A2MA 1KBVA 3BQVA 3S3CB 4A2DA 1GP2B 3IN2A 4G7RB 3UVKA 2PPDA 3EI3B 2GC4C 1GOTB 2B5MA 2P9PC 5GXHA 4ZK8A 3SFZA 5D4JA 5TEFA 3FU7A 5B7MA 3MZKA 1NICA 2PLTA 1IBYA 2VW7A 2XUWA 2AH1A 2WSDA 1AR1B 2H9NA 1ZPUA 2UZXB 4J8BA 4FHLA 1SFHA 1MDAA 3MX0B 4WTQA 2BZ7A 2XYIA 5IJ7E 1KDIA 2H47A 5B3SB 2X88A 5CYKA 2BZCA 5K1CC 3QJQB 4A2LA 4A0AB 4A0BA 4J87A 2IH8A 4NAJA 3NJLA 1OE1A 1ETJA 3EF4A 4BDVA 4F7KA 3JZGA 5GMKn 3DM0A 5I6KA 3S8GB 1I53A 1JXGA 5AKRA 3UADA 2AGYA 3SVWD 1N6DA 1IKOP 4Q8BA 1W6WA 2IUQA 9PCYA 3FM0A 1PLCA 2OV0A 1A8ZA 4NERA 2BCJB 3BG1A 4DP4X 1OOWA 3FPYA 3CVBA 4KNUA 2GNQA 3SBQA 1PLBA 1R5MA 3FQYA 5B4WA 4DP0X 3IE9A 2IUVA 5HE0B 1OV8A 2FT7A 5IY5B 4FA7B 1GR7A 5AJAA 4RH4A 1WAEA 3DTUB 4YSUA 2H68A 3I7NA 1A4CA 3I7KA 4R7AB 3CDZA 5AMSA 2H6NA 1N68A 2FNWA 1AZCA 2OVRB 4JSNC 1ASQA 4KO7A 2TSAA 5I6LA 4GZ8A 2YNNA 3ZX1A 5B7FA 4QRJA 2AGLA 4E54A 4DP8X 3N55A 1FA4A 4E9QA 5C2VB 1BEXA 1AACA 1WA1X 3EHBB 3C75A 3X1NA 2PPCA 3I8EA 3C5MA 4Q89A 1XHMA 4O9DA 3F3FA 5CXBA 2R7EA 4G72B 5THAA 5FQDA 4FA1D 2Y69B 3P4FA 2H9MA 3IIWA 1L9OA 1E5ZA 2B3IA 2YAEA 4QKTA 5I6PA 1VYHC 2WO3B 3NP4A 3UGEA 2IWKA 1J9QA 1XB6A 3JRPA 1AS7A 2VM3A 5I26A 2HKRA 1J9RA 5A7EA 3RMZD 1AZBA 1AZNA 1OE2A 2HESX 3BG0A 4AKOA 3NSCA 1AG6A 3EU7A 5C2WB 4CI8A 4A08A 2YAFA 1W8EA 2BP0A 4N8UA 3I7PA 4UI9R 2VW6A 5B1BB 3WKPA 2FQDA 2P9IC 6PCYA 2OIZA 3OMIB 3NJIA 3U25A 3C75H 1NWPA 2Z2NA 3IJ1A 1ILSA 3L4OD 4AZUA 4CY5A 5FKRA 4YSOA 1L9SA 1HAWA 3SBPA 5PAZA 4GP8B 2G99A 5HE3B 1ASPA 5IGOA 1HAUA 5I5MA 2XL3A 2DY2A 3RLMD 2FQGA 3C99A 3N0DA 2IWFA 4G71B 3EI3A 4QQEA 1ZDQA 2IWEA 1JOIA 1BYOA 4BH6A 1TEFA 1JZIA 2CJ3A 3FPXA 4HAKA 4A2EA 2H6KA 2XXFA 3UR4A 5CXCB 4AI7A 1GSKA 4DP7X 5CXCA 3KW7A 3MKQA 3AG1B 4CSZA 4D0KA 4PXWA 3ABKB 2AH0A 5EMJB 4ERYA 3J81g 5I6NA 2FTAA 3NSDA 1CURA 2XXGA 3UABA 4J0WA 1BAWA 4GP4B 4GXFA 1SQ9A 2OJYA 4A0AA 4U1EI 1PGUA 4OWRA 1NWOA 2TSBA 3PVUB 4I79A 1TBGA 4HCIA 4JHVA 3V5WB 3UAEA 4DPBX 1ET5A 1JXFA 2PBIB 4A11B 3X1FA 4IMMA 2X87A 4GM9A 5EM2B 5HE2B 1GY1A 2DYRB 5HYNB 1E5YA 3UVNA 1J9SA 3GFCA 5FLXg 3DSMA 1NEXB 3I8CA 3NVXA 3IN0A 3G5WA 1TYQC 2AZAA 3WIAA 2YAQA 1TEGA 3MKSB 2FWLB 2PP9A 4GQBB 3MMYA 4F2EA 4DPAX 2P9SC 4YSTA 2H9LA 1MG3C 2HRGA 2VW4A 4BL0A 4FB1D 2H3XC 1ID2A 2OJ1A 4YSRA 2EILB 2A3TA 1ERJA 5HQGA 2HLEB 7PAZA 5EAPA 3V9EA 4O3TB 5FXYA 3SLED 4GM3A 1CYXA 3ZIYA 1JJUB 1J5CA 3V9CA 1BXUA 3OKTA 2UX6A 5H14A 3V7DB 2FQFA 3KRXB 3T6XA 1SHYB 2TRCB 5EMLB 1NZRA 3CZUB 5LDUA 1SDDB 3NJGA 1RZQA
chains in the Genus database with same CATH superfamily
1LWJA 5DLLA 1KIPA 2ZKYA 4NQCE 4P5TC 1LLAA 1T1XA 1S9VA 4EEEA 2DLFL 4KJWD 3UEQA 2QV4A 1I1AA 4B7IA 1ZLSL 4OLZL 2WSPA 4LK4A 3RBGA 5HY9B 2V6HA 2XTJE 4X6FA 5JXED 4Y2NA 3GLEA 4AENA 4RSVA 2FL5B 3VI4B 2EIDA 4IKKA 1A6AA 1OGAE 2P47B 4HWNA 3V4PB 1WYJA 2FGWH 3DXMC 4PUBL 4XWGH 4JANA 3L5XL 1ITCA 1X9LA 3Q48A 5CJ8A 2BOCA 5CEZH 2E74C 1W0WB 2F0CA 4UM8B 4K5NA 1IVLA 4KXZH 5FOBA 1SF3A 1UEYA 4EN3B 5GS1A 2J1YA 5HSFA 3HCVB 3IAPA 2ZCKH 4JR9L 3DV4A 4UANA 1BFOB 3FO2A 3HFFA 4HSQA 3MJ9A 4P5SA 2HPTA 5SWZE 1X5XA 3HG3A 4R0LA 4RGMC 3EBGA 1ZANL 1FLTX 2VR3A 2BH0A 4XVUC 5E95B 4TTGA 1H2YA 2CIIB 4L9LA 1EMTH 2LE9A 4R97C 1J5HA 3QJUB 3HNTL 1XCXA 2DWSA 1KELH 4LKCB 5DC4B 4EF3A 5ABAA 4LVHC 3T8XA 3GKZA 1L6ZA 3ZE1B 3AWFA 1AMXA 4XPAL 3QG6B 3SKJH 1IE4A 5DZOA 1JGUH 3STZB 1JZ7A 1YEWA 4TRPH 1SM3L 1USZA 3JT2A 4ETYA 3H2WA 3ULUF 4F3FA 4U0QB 2CJTA 5TFSH 3SDAB 1RZFH 2HXCA 1JSYA 4QTIH 2B3RA 4A39A 4U7MA 1WT5A 1KGWA 4H40A 4C56B 2WLJA 3ISRA 1QFMA 3IB4A 4ZO8A 4PGCA 4L8SB 4BH8B 1AIZA 1EK3A 4FS0A 4XTRC 2W0KA 2V8LA 2WM0A 4ODHL 5H37A 3DI2B 3UTSA 4DN3L 4HIPA 4A6YB 2OMTB 2F5AL 1KCUH 3BP7A 3P54A 1Z9NA 2XIIA 3UZEC 3LN5B 3UVOA 1TU2B 3ARYA 4WCYH 1IRAY 3NCJL 3D8MA 2AGXA 3SOBL 1WC7A 3L3JA 3D12B 3ML9A 3VH8A 3V0IA 1S4UX 4I9WE 1UENA 5DVKA 1C9LA 1QX1A 4ZMLA 3KM2A 3LTVA 2NY2C 2XLLA 3CFNA 3TFKC 5SWSB 1DE4A 1GYWA 3B9KC 3T0XA 3LD8C 3MBED 1FNFA 3CN2A 1V3KA 4YE4L 2QC5A 1M6OB 1H6EA 4X8GA 3V0HA 5LXGH 1TJXA 2DL2A 3N2JA 4WI0B 2Z7WA 4K5MA 5F3HB 3H2QA 5D6DC 4FFYH 4B3VA 1NAMH 1CICC 1YY8B 2X1PA 3L2NA 2AGJL 4PWGA 5T5NG 2C9UA 5EMKB 2Q87A 4DQOH 2Q7QA 4PRPD 4JLRB 2ITFA 3P40A 15C8H 4AQAB 4NSXA 4KUCD 2AQNA 1OSYA 4C57C 1EEZB 4JY4A 4WKZB 1Z3RA 1O9ZA 1RHFA 4L4VA 3DIFB 3BSZH 4JDVA 1URIA 1ANUA 5HDLA 5D8JH 3RAJH 5A2Qg 3NIGE 1MI5D 3MCG1 5L0QC 1HYSC 1NCIA 1BVLA 1EZVX 4QHLB 3AAZB 4W9HC 2WYTA 1JVLA 3PDOB 1A6UL 4LNRB 4LPCA 1E6JL 2VXSH 2AQ5A 3L4MD 1Q0XL 4FKHA 3SE3A 4E5ZA 4M03A 3L45A 3AMLA 4NWUH 1CC3A 5EBWB 3VXTA 1J8HB 3Q6FB 2P5EB 4DN4H 4Y4HC 4Y2DD 3T0AA 2MFNA 4DUVA 1HIMH 3SHSA 4P3DB 5AW1B 3QXAA 3VWKA 5AVUB 1A4KA 4NS0A 1RZJH 3FT0A 5FW6A 3B2UC 3SJVA 1KBPA 5I71C 3RY4A 1BJMA 1ZD6A 3R1GL 5LCVL 3FQRB 2PXYC 4Z1PA 3IXAA 5B38G 3AJ7A 1ED3A 5E7FA 1MRFH 2O26U 2AABH 1P7QA 4MWFA 1KV7A 1B2WL 2F54B 4P9MH 1HH9A 1HNFA 1NCWH 1ZE3H 3KJ6L 3W3BA 1MH5B 4Y19E 2NUTA 4IIQB 1L0PA 3T71A 4DGIH 3KWWA 5DHEA 4B95C 2YA0A 4OAWB 4FQLL 5F9JA 2F1AA 4E42A 4IKLA 4KNTA 4I1PA 4PJGE 5F7LB 2FATH 4WO0A 5C3LD 1BZ7A 2NZ9D 5DD5L 4UM9D 3TO2B 4FFVD 4YHIB 2CE9A 3PL6A 1FAKT 1GGIH 3QS2A 3MRFB 2EXYD 3HHSB 4YSAA 2D7OA 4FI6A 5KVGL 5DJZA 3AS1A 5EU4A 5TK2A 1EV2E 4HUWB 2HRHA 4L3EE 3TNNA 4HK0A 3WJJC 1OOAA 3PCYA 2ZOTA 4I5BB 3HG1E 2IF7A 3VRJB 3WIFB 4MMZB 5E9DE 5DHYA 4R4NC 4OD2B 5JW4N 2YSSA 1WG3A 4GINA 4LP5A 5CLTA 1OW0C 2VL4A 1WGVA 2XC8A 3FO9B 2O5XL 3QG7H 3MLZL 2B59B 2QGEA 2R29H 2O6DA 3UAAA 1YMMA 1SJEA 2AQPA 1HFUA 1M57B 1E8ZA 1GSMA 5EZIL 1ZTXE 5E8EA 4C47A 3C6SB 4Z7IA 3H55A 4NKOB 4S1SH 2XBDA 1T03H 1DVYA 5T3XL 3L9RB 4M6NL 4PJAE 2GC7C 5I1KH 5MHSE 2DWYA 1MCJA 4L8CA 4N5EC 4YQXL 2NY0B 5KVDL 1A4AA 3NIFF 1NFKA 2N59A 1XVSA 4KRMB 4WHYG 3RFGA 2EZ0C 1G4RA 3H3KA 2OMXA 2YGNA 1I85A 3BT2H 4X5WB 2Z93A 4F9PA 1S3RA 2IOMA 3KBEA 4A38A 3WUWA 3F83A 3V52H 5DC9B 2A74B 4ELKA 3NOIA 4FWWA 1P53A 3L9EA 1JGDA 4PVNA 4GXVH 2KPNA 2EYSB 1IEAB 4B9KC 3WG7B 2QADC 4GIOA 3ILQC 1MNUH 4WHYH 2G3ZA 4PV8A 5F9DC 1COBA 4PI0A 4WFHD 4U6HB 5C0IB 4OB5L 3SDDC 4V1DE 2YXFA 3ESOA 3PAYA 3QZOA 5E1QA 5BXFB 1M05A 4J3OD 5KSBF 5EARA 4E9YA 4FD0A 1T0OA 4IOIB 2GBUA 2QELA 3C60B 4ZMZA 4MNGA 2LGNA 3IEAA 4CN6A 1FGVL 5DD6A 5F9AC 4I3SH 5BS0B 4LLWB 5D1ZA 3TJHD 2VE6B 3AM8A 4XNYH 4ZAKB 3HG1D 3V6ZA 3WD5L 5DO2D 5E9DD 5JHDB 2WIIB 4XNMA 3IFLH 4OZIB 1N6EA 4AMWA 1JZ3A 2JTDA 1R19A 2CHNA 3S88H 3S35H 3MFFB 3QDJA 1RUAH 4HSAC 4K8RD 1K32A 4Z0BL 4OBRA 4G7VL 3HW7A 3QJOA 4EN2A 1MELA 2QZ5A 4FYRA 3L3GA 3P2TA 5GGVL 5D7JA 4EUPG 3C6LB 3FT9A 4Q9CA 1ZIBA 5TDNB 4O1QD 2O93L 4P9HL 1DVTA 4NBXB 1TQBB 2Q6WB 2OXGA 2ICCA 3GSQB 4PRDA 3TLRA 2BC4B 1N7ML 3TWCL 4JHNA 1A21A 4RAUB 2EDHA 4UTBA 4Z3TA 2O6CA 3BUQA 1Z9OA 4R6UA 3TYGH 4GGCA 4QRTB 4X60B 4HIIB 4AQEA 1MJ8H 3I74A 3RFHA 3GRWL 4JG0H 4AEIL 3QNXB 4Z7VE 3SY6A 5KVFL 2OJZH 4EUPH 3BGAA 3QUXD 5CZXC 2WB7A 2OK6A 1AD9B 4OZFG 3V0WH 4YAQB 4HU8A 4JO3L 1P1VA 3UROR 1C5CL 1W72B 2UY6A 4PLKD 4I79A 1ADQH 3IJ9A 3U79A 3UBFA 4L4TE 5FW7A 3MJ6A 3K6FA 4A2MA 4A2DA 4BBWA 5JHLH 1GP2B 1KB5H 3D1MC 1XR9A 1OWWA 5DMGD 3UTOA 1RSFA 1EXHA 4PW3A 2XIBA 5CUSH 3HRZA 2FWUA 5DJ6B 1RZ8B 1G43A 4OZFH 4AY0A 2YWYA 4LSUL 5DMKA 4DCQA 1S7TB 2CPUA 1SN2A 3J07A 2ESVA 4BZ1L 1UM4L 4MLSA 4MNQE 3PWPA 5TTRA 5J13B 5E6SA 1CLZL 1IILE 4Y5VA 4ESKA 5IFAH 3C5XA 5E08H 4NO2A 5GMKn 4LSTH 4IU2B 2APFA 3MLYH 3QIUB 5AKRA 2K3HA 3U83A 4I0PD 1RURL 3QFJD 4CKQA 3MNMA 1HHIB 2GJZB 2OV0A 1DJZA 2H6UA 5KSVA 3VTMA 3QDAA 3IXTB 3AY4A 3HC4L 5K5YA 1HDMB 4KRPB 2IUVA 5HE0B 4K71B 4PRBA 2XBTA 2WANA 4U1NA 3MYZA 2WLIA 1QBAA 4JRXB 2PWHA 4R7AB 5AL0A 3RIFK 3KYNA 1RHHA 4N2LA 1G7PB 3O6KL 4IEFB 2YPKB 1M71A 3OZLA 5K1VA 4BUHA 3T2LA 5HPMB 3QXDA 5EU6E 3PJLA 3EHBB 5IHUH 3PWNB 4ZOEA 2L8AA 1RJLA 2ARWA 3KLLA 4WSKA 3RWGB 1U8KA 4Z7OA 2HU5A 1F4YL 3MJGX 2WO3B 5CIPH 1J9QA 3FQUB 1V7MH 4MQXC 4GG6E 5IB5B 3CXHK 1AZBA 4CNIB 2VLRE 4PRHA 1E4WH 2KZWA 1I1AC 4ENEC 1DQJB 4UT9A 4U7KA 2X9XA 5E99L 1DSYA 3CFKB 2BS9A 4Z78A 3WELA 4WEUD 4X7CC 4PJXB 4N2EA 1MNNA 4F91B 4GBXD 4ZNCD 5HVHC 3FT4B 5FCSH 2A1WH 4MDRA 1IM9A 4BRVA 2EE3A 5GS0D 5E6UB 2UYLB 3JWDH 1FSKC 1ZV5A 4OF8A 5I5MA 3C99A 1DHKA 3OLDA 4UZGA 1L3WA 4X6EA 4B9ZA 3N9GL 2FZ3B 5EOQH 3FB7A 5FX3A 5GS1C 4DO5A 3QUZD 4CSZA 2XN0A 2VLKD 2CU9A 3ULUL 1T20B 2YPLD 4XP1H 3NSDA 4LCWB 4XXWA 1I3GH 2DM3A 4GI8A 3SOTA 1F6AA 3IDIB 4R0LC 3LEYL 1T04B 4GMSL 4M7LT 2IAMA 1ZLWH 1JGIA 2A6DA 5EC1A 3UAEA 2MIZA 2OPCA 3HAEB 5HE2B 4L9LC 3VGHA 1LEIA 2XN9E 3SQBB 4NM4H 4IOFD 4RCAA 4Z77A 5ICYA 2AZAA 1PZUB 1TEGA 4DGVH 1OZTG 1W80A 4ISVA 5GS0H 3VW3H 4F2EA 4KPHH 1LM8V 2X4NB 4RGNE 2RGSA 3EFDL 4FQCL 2X3AA 4LCUB 1JV2A 4NWTH 1N64H 4GAJL 2F8VA 2V7HA 4O58L 2RBLA 4PJBE 3P2BA 4FZ8H 4MAUL 1EO8H 1G87A 2JIXA 3TF7C 2E56A 2DF3A 1OB1A 5CINH 4KXAA 2B15A 1WT5C 5C8JA 4KKCC 5FLVA 1RH8A 3ZIYA 4G1MB 3MV9E 3ZRFC 3OLEA 2OSYA 3JYBA 3GJFB 4KMTL 2FCBA 1YJDC 2QXVA 3UJIH 3NJXA 4U1JB 3Q9PA 3KYOB 1KN4L 2F1BA 3DO7B 1DQLH 1RIUH 2VDRH 1PD1A 1UB6A 2W9DL 4PG9B 1E9QB 1TKWA 2D03H 4OFYA 3E8VA 1JFQH 1BM3H 4A2HA 4FFZH 1EGJH 3EJSA 5FIEA 4XCEB 2IQ9H 5C6WH 4BFBD 5A3ID 1R4XA 3RGVB 3A5VA 3RY5A 2GSGA 4YGVB 1MLCB 1U3JA 5JW5B 4IS6A 4CKVX 1FVEA 1LO3H 4FYTA 1KG0A 4RFOL 5JXEA 4PJHB 3CXHJ 5IMOB 3IU4L 3HZVB 4W1TA 3FUFA 1GJUA 5LGJA 1MDAH 4JFDB 4R7DA 2ZUSA 1BZ9B 4OJAA 1UD4A 2G0LA 3FF8A 3DYPA 5FFLA 1E5TA 3KS0J 1QFUH 2NTFB 4HEPG 4UINH 4RGND 2C7UA 1A0QL 1WICA 1OAXL 1HS6A 1TLMA 2AJZB 1HQRB 4HWUA 4YHOH 4CVZA 4QJ5B 2WUCH 4QHPA 2A6KA 4ODSH 2I32A 2EDYA 5I9QB 1LEGA 1K9TA 3CFTA 4NNYB 1U36A 3QORB 2JF1A 2NXZD 1G7HA 4FQHA 1L7IH 4LF3A 4MCYB 4WFFD 3SE3C 4J86A 3CSYB 1EH9A 4GFTB 5EEXA 2W0PA 3TN0B 3L1EA 3MLSH 3QUYB 5LXVA 4HHGA 1YDPB 4WIQA 1H8LA 1OK8A 3KH4A 4LLYA 3VWKC 1DLFH 1NCAL 2C1PA 5D1XE 1MHPH 5KBLA 2I0TA 3W5MA 2ZJSH 4LMQE 4HIQA 4YHYC 2NY6C 2ITCB 3OKKA 1K6QL 3O2DH 5B1KA 2YAOA 4X4XA 1NAKL 2ZUXA 1ZVNA 3SY0A 4DP5X 3I3EA 2KS0A 3FSOA 3OAYK 2R51A 4L3FA 4WI7A 4EN3D 4GAYB 2GK0A 3BISA 43C9A 4FFYA 3DHUA 1NAMA 4L1BA 3GMMA 4QR7A 5BRZE 1LD9A 2OAAA 2YXWA 4ZFOA 5I0ZA 2YUZA 1M2OA 1JZHA 3PL6C 3ZOAA 4DKEL 3SXTD 5D96C 2OVPB 2BOBB 4V33A 4LBEB 4N2NA 3BSZA 2WLZA 5C6TH 3DPDA 3VO0A 3ECBB 5JUEH 3U30C 4A7GF 4KXCA 4LLUA 5K39A 4A7QA 4G6FB 4N1EA 2W18A 4JPIA 2GI0A 5GGQH 3WSQH 2I69A 5C7XH 4C54A 2ROXA 4RDBA 4EI5C 1UFUA 3EH3B 1IGCH 2W60A 1JTPA 5ADOH 3MBEA 1VPOH 5CJBA 2L3BA 4LP8A 1KJ3L 2N7SA 3QH3A 1XGRA 3Q0HA 5F1NB 5JIDA 1S9YA 3GUTA 3SDAD 5FKTA 1MF2L 2GK2A 3VG9B 4M4RA 4PRPA 2G60L 3ZHDA 1S3KL 4YVUA 3GXMA 4C56D 5IROD 1N6QL 2B2XL 3WFHB 1UXMA 2NNXA 4OVUA 5D1XD 5E24E 2FEJA 3CZJA 4O2EB 1CBVL 4AUUA 1I85C 1MFCH 4FNSA 3H54A 4OCXH 2J7LA 2HAZA 4EQ3A 4F9PC 3LIUA 2NSMA 4QTHB 4X9GA 4HISA 4NUMA 4ERQA 2MSPA 3VFVB 1PZ5A 1A7PL 4YDNA 4UOJA 3DHPA 4J2XA 3UIZA 2H45A 3SE9H 2Y5TB 5E6YA 2H6PB 3CVIH 5B38A 1OLZA 1UH4A 4L2LA 4RBPK 3CZEA 1H6FA 1A3ZA 1TCRB 2IH3A 3PPEA 4Y2DA 3HFML 3OL2B 5AB1A 2JXMA 3BZEB 3IGFA 5SWSD 3IFOA 3PUCA 1KPVA 4UMSA 1GGCL 4JZJC 4OFQA 4FJ6A 1ZS8A 3ZR6A 4OI9A 4DP1X 1GHFH 1GZPB 4HALA 5EUOA 5HYJE 2R23A 3PDDA 2XVBA 3WKML 3ARVA 4DGYH 1C9SA 1KB3A 4J8RB 4BP9A 5D1ZC 3WY2A 5D2LF 2YOAA 2XPZA 1CGSL 3FSWA 2R29A 5D71H 1SYSA 1Z6JT 4NQUA 4M1GL 1ZWIB 2AJSL 1QASA 3BO8B 2VWEE 3VXQA 5ANHA 5EPMB 4HJJL 4Q0XL 1NMBL 4P49A 3QS3A 3GO1H 3GBLA 4WWNA 2H1PH 3QQXA 2AI0L 3IETB 5D7JC 4HWBA 1CZ8H 5E1GA 4CDHA 3SWSD 4I85A 4U0RB 2V4LA 1I3RA 2EVHA 4HD9A 4ZQKB 4A63A 2Y07H 2UWEF 1H6UA 3ZTJG 5AB2A 1NIEA 3BKJL 4M29A 1J8HD 2GG1A 2DICA 2P5ED 3FQ2A 4DVBB 4NQEB 3SGJA 3CHXA 1SBBA 3REVB 1KBBA 1R1CA 2YHGA 2G5UA 1SN0A 5DRZA 3OAYH 2X0VA 4X6CF 1CLOL 1AR2A 1CCZA 1X5KA 2YIHA 1J12A 5CCGE 5G4OA 2CE8A 1MCOL 5C0BE 3RVWC 3VD5A 3GBEA 2F54D 2FD6H 4H8PA 4PIBA 2LOEA 4P3CL 5CMAB 3NTCH 1H6TA 1QOKA 5F6HJ 3WE6B 4OGAC 4TUKH 3ZKNC 4AKQA 1KFAL 1MOEA 2QQKH 4PJ7A 3WNOA 5CD3A 3HRZC 1AQDA 2NNRA 2VZ1A 5M61A 4ZDHB 4G2AA 3ZHFA 5DZNA 5DHVB 3X12B 4YSQA 3C5JB 2YBRA 3T3PB 3L4ZA 4DOHB 4Y5VC 2HWZL 3BAEH 3KM1A 3LRMA 3U4BH 4PYHA 3LQMA 4X4ZA 4ERSH 1D5ZA 2IPTL 2OA9A 4GT7A 4OU3A 4DWHA 3QRGH 2PP7A 4ZFQA 4LSDA 2H5UA 1X5HA 3AY4C 2GJ6E 4RQQA 2PM9A 3T6WA 4WHTA 2DRUA 3DMMD 1KCBA 4XVJL 4R9HA 2JJTC 5I74B 3K8MA 2YBGA 4TYUA 4M6OL 1OARH 2WNXA 1O75A 4B9YA 1S9WB 2F15A 3RUGA 1OTUC 5IJ8E 2OMNA 1HEHC 3NFNB 1X9RA 3VMNA 1U4CA 1A7NL 4Q6IA 4XR8C 3RL1A 4EDXA 3C9NB 4XBGB 5C2BL 4EOWL 2WLMA 3S36X 3S5ZA 5F1KC 1UOQA 1GW6A 1NC4B 4HCRA 1NLDL 3LDBC 2NY0D 4HA1A 3VXUB 5FYKU 3WMQA 1ADQA 5EAMA 1U8PB 2X4OB 4P2RE 3CMOL 1AJ7H 1UWYA 4XNXH 4NQCB 5JHLA 1KB5A 3GTVA 4PBYA 4HIJA 4JFFB 1U8IB 2EDNA 4XH2A 3L4UA 4F5CE 2BP0B 4JHZA 3EDEA 1NSNH 1E9OB 5FCUH 5F7UA 3HMXH 2WYHA 4OZFA 5EMYA 4HG4K 3IPFA 3RN0D 3OGOE 1H3WM 2AKRA 2XYBA 1W15A 3ZZ1A 4P5RA 2ZKHH 4QOKE 3E3QC 1MCEA 1RSYA 4TLSA 3ZHNA 5AENA 3QUXA 1XGTA 2R2CA 1SXCA 2EEFA 4AIOA 2UZXB 4ZW3A 1S7QA 1XBRA 1L9NA 5GRWA 3C60D 2EYRA 1JV5B 4XXWC 1HNGA 2XYIA 4N86A 4FNPA 5BZWA 3O4GA 5JHDD 4IDJH 1EJOL 3WAJA 5DWUH 3IT8D 1AXTL 1BGXL 1ETJA 1OE1A 1QA9B 4MD4A 4HIHA 3KCWA 4OIFA 4R4FH 1OSEA 3EO1B 3PABB 3W0WA 5DYOB 3CZLA 3ZDXB 4NHUA 1CFVH 4JFZL 2G9KA 4WWKB 3P0VH 1NDGB 2AQTA 2MHAB 3C6LD 1PLBA 3PF2A 4PVMA 4L5FH 1DJYA 1OV8A 2GCYA 5E8NB 3VGDA 3IUMA 1KTJA 5CIPA 1L0XA 1M7XA 3I7NA 5GS2H 2FYVA 4WF7A 4I0PA 3QFJA 2EYTB 2R0KL 4O00A 2R0ZH 1D5BA 3VAEA 4MRBA 1B90A 2XWBA 4I1RA 5C2VB 4PYGA 3ZDYA 3OWEA 2X4SB 3P77A 3UDWA 3LIZL 5BZXA 3P9LA 4X6BB 3MGTB 3EGXA 5EOCL 3VFPA 3U4EA 3WHE1 1T80A 1INEL 1DBKH 1FFPA 5E2UH 3FW6A 1WQVT 1I82A 1CFBA 2PWEA 1A1NB 2AXJA 2X7LA 4K7PX 3FFCB 4RZCA 4F8OA 1RZKL 2EECA 1Q94A 3BZFA 1EO5A 4XPHH 4ODTL 3UOAB 1JUFA 1UXWB 1JHTA 4X6DB 2NNFA 5KVGE 5L9DH 5C0EB 1B0GA 4YLCA 3U9PH 5E6RB 2E27H 1HAWA 4XMKL 1P4BH 3I9PA 2VERN 4KJWC 4U6TA 2IGFH 3M88A 5ERWB 1AFVH 3D48R 1B9ZA 4A2EA 3UTZA 5JXEC 3QIUD 3WS3A 1GSKA 4GBXA 3MKQA 1UA3A 1D9KB 2CBQA 3MX0A 4ELME 5I1HH 2WLNA 3LKSA 1BAWA 1W72H 4D0CA 1ZOXA 3IFPB 4L37A 4HIXL 4KRPD 2FO4A 2YD7A 3ROOB 4QO1A 5T3XE 4YBQD 3WTYA 3VFNA 4HDIA 1S5HA 3LPOA 3QUZA 5KVDE 2CGRH 4DPBX 1JXFA 5DMIL 3GJFK 2IGLA 4NXSA 4M8QB 2VLKA 2YPLA 4XAKD 1E5YA 2XQ0A 4XCCL 2D7PA 1NEXB 2W07B 3BIBX 3BJ91 1PAMA 2EDXA 3EHBD 3LKRA 3O6MH 4MAYA 4ZMNA 4MXVF 3R0NA 1CD9B 3FB6A 1S7XB 3EDFA 5G4MA 5DJCA 1DVXA 5LBGA 2VDRA 4ZTOH 2CR3A 3WEMA 3GMLB 4LSSH 3UYPB 2CA3A 2QR0B 5IGXL 3SLED 4D8PB 2ZYRA 3RWFA 5GHWH 3D34A 3T0VA 4FFZA 3K72B 3LXBA 1YEHH 1EGJA 5HVFB 1D5MB 2UX6A 3G04B 3V6FA 1Q9OB 4ESGA 5EMLB 3DTXA 3NN8A 4HETA 2GFBB 1XZWA 2QMJA 1QSEE 2WVVA 2SEBB 5JA8B 3KBHE 1KLFB 3L4VA 2EXWD 4HPYL 2CMRL 4NZFA 3HOGA 4PVBA 4LLQB 3D18A 2IMMA 2XWZA 2JCCF 2ATKB 4TLTA 5CEYA 1RJZB 2F8OA 4M93C 2QSCH 1PCSA 3U4YA 1D5IH 3MO1B 43CAB 2NY5C 5MP6L 2Y3AA 1TZIA 4UV7L 2ZXGA 1O0VA 4B9GA 3RZWA 3NYKA 1MFNA 1YECH 1YEDA 2UVEA 4XBMA 2Z91A 2H3NA 1FH5H 5LBSH 4Z0XA 1IAOA 2CKBL 4AM0B 1SYVB 3GTTA 5T3ZL 4UDTA 2PMZA 3NCYP 4Z7QB 1S46A 2BSRA 3IVKB 3CPLB 4DT2A 2IH1A 3LRHA 4CSSA 1UXSB 4LL1A 1JWSB 3B6SA 4K15A 4LVNC 4X8CA 5ILTL 1FNHA 2HH0H 2J5WA 2N1TE 2ENJA 2OP4H 2Z1KA 5ITFA 1JGLL 3IUJA 3CDCA 1NBZB 1EHLL 1FUNA 2HTKD 1H5BB 1Q72L 1N4XL 1WZKA 1DL7L 1PZCA 2J71A 3BDYL 3MBEC 3MBWB 3PAVA 4G8FB 5KVFE 4HEPA 4KK5D 3MMEA 1OAYH 4NAAA 1ZRUA 5EM2A 1T6VN 5MENE 3GQFA 2CUAA 3HAEG 3MLVL 5I2IA 1B88A 1AE6L 3CDYA 3DKHA 4MAZA 4JM4L 4X7EC 4CMHB 5JOFA 3BP4B 1RY7B 3FRPB 1A7OH 3IBEA 1E8YA 3QVAA 4X5LA 3MNWA 1RIHH 3R19A 1M2VB 3MZGB 1XXDC 4ZTEA 2AEOA 3W9EB 4APXB 5IFHH 2P5PA 35C8L 4QLWA 2PR9A 3AXHA 1ZE3C 3H7LA 1FZMA 1XCQB 4OCYL 3RRMC 4YMPA 2Z8SA 3B5TA 3HAEH 1WP6A 1JF1A 5A16A 4IMKA 1HXYB 1DEDA 3GXUB 4K3DH 3MRRA 3IS1X 2XZCL 1OT1A 1I1YA 4HEMA 5EHFA 1DVUA 2O72A 1HZHH 2PF6A 5GRXG 5LN8A 1VZ2A 3RGVD 4DP9X 3WJLA 4Y2DC 4KKAD 3VA2C 1DSFH 4KUZL 1I9JL 1KC5H 2GC4A 2WHVA 4FL4B 4URTB 4O2CB 4JL1A 5HY9A 4XMLH 4L8DB 2EO9A 3L3HB 1EAQA 3LX9A 1QPXA 1WAPA 3H9SE 2CCWA 1OXYA 2L7UA 3BQUB 4HD5A 3K6NA 1OM3L 2C3HA 1A7RL 1IV8A 2F6AA 2FL5A 5D7LE 3VI4A 3UPRB 2B4EA 3GJFH 3UG3A 3RJDA 4Y9FA 3V4PA 2BXZA 1QG3A 2NZIA 3ZHLA 2NCMA 1GOFA 1P4IH 3DVNB 2X2UA 4N2AA 2P5WE 4PC0A 5INDB 1W0WA 4UM8A 4XP5L 3DRQB 4OIBA 4EN3A 5GRJL 2CR0A 2V17L 4G6JH 1AHKA 2XV0A 4ATWA 3KLHD 1NOAA 2NZ9C 3LHPH 3HCVA 4FFVC 5TE7H 1YEFL 4HT1L 4PJ9B 3VWJD 3ZRSA 1BFOA 3EZJB 3H42L 2EXYC 1AXIB 1OTSD 5AL8A 1I9EA 3QORD 3ATDA 2X10A 4AYFB 4P4RB 3D3VE 1YQVL 3DROA 1I8KB 2P45B 5JIKA 1A6VL 1MCSA 4M7JH 4HBCH 2CIIA 1ZK9A 3TN0D 2R8SH 1MVYA 2E7HA 2OYMA 3SGJC 1E27B 1VFBA 4Z7VB 4LKCA 3U48A 1FDLH 3PQYE 4CGUB 3ZE1A 1BZQK 5ESAB 1MKFA 2Y1YA 1G7LA 3UO8B 2PTUA 2Q0ZX 5G5DB 3STZA 3WL9B 4KROB 2DI9A 1NUFA 1R3IH 5E23A 6CGTA 4L4TB 3A4EA 3KVPA 3W9DB 3SDAA 3ULUE 3HBGA 5IROA 4C56A 4U1MB 1RQ5A 4KI5E 4NIYE 4P2QE 5HHPB 4BH8A 2LTQC 3RPBA 1Z9PA 1ROWA 1TZGL 2HX8A 3GYRA 1L7TH 3PJNA 3GXIA 4L3CB 3EBIA 1WA2X 2Y36L 1FNSH 3RBSA 1AQKH 3A6BH 2OMTA 2W1NA 4A6YA 4OT1H 2WBWB 4GSUA 1YRKA 5E1HB 4KTDH 3TT3L 3LN5A 4JE0A 1EAOA 1TU2A 3MDJA 1HU8A 2NTSP 1NMAL 1ROCA 3OPUA 2B5IB 4MYWB 4PJ8B 4W9ZA 5EF0A 4G6FD 1ADWA 3TBTB 2G30A 3DGDA 5T5FH 2X2YA 4FA4D 4AGLA 2VLMD 5SWSA 4FQJH 2OMVB 1OANA 5FV1L 1ZVYA 5E5LA 4J3OC 1M6OA 1DEEB 2MMXA 4LEXL 3LVEA 3JB9L 1T66D 4F9LA 2ROYA 4WI0A 1BYPA 3MV7B 5F3HA 1SLWA 3BLBA 3NT0A 4S1QL 3TJHC 1GJWA 1YY8A 4PD4J 4Q6IC 1VEMA 3BKMH 3IF1B 4J3SA 4GO9A 4ODXB 5DO2C 5L8LB 2ZX9A 1OCCB 2HJKB 4HH9A 1NMCC 1CGWA 3TP4A 3BPLB 3EO0B 3GHPA 3B2XA 1EEZA 4K8RC 3OTTA 4WKZA 3DIFA 3HNSL 2I26N 1XB3A 5DDHB 1JIBA 1M1SA 2VLRB 4QHLA 1HTYA 3D4ZA 3AAZA 5D4QA 2W0LA 2G3XA 1IAKB 1TPXC 3B7FA 2HN7B 1J0HA 4ZMWA 3PDOA 4LNRA 3I7LA 2H0EA 3OJDB 4U6YB 3OMZA 4XVSL 2BWDA 4OKDA 3CQPA 4RWYH 2YMTA 1CGTA 1SJHA 4IK6A 5FKAB 1TTCA 5EBWA 1J8HA 3Q6FA 4KI5D 4XB3A 4WAFA 2P5EA 2XZAL 4RMUA 1UM5L 1WZAA 4FQIH 3ABLB 4P3DA 4O4YH 2Q3ZA 1PG7H 1J1PL 1YPZF 3QUXC 5E5MB 4AL8L 5F7HA 2DYSB 1DCLA 4GQRA 2K3TA 3BEWB 3L4CA 4JX0A 5E2WH 2KZKA 3FQRA 2XQBH 3JZYA 5JTWA 4E9VA 2YGVA 4AMYA 4PLKC 5FM4A 4JM2F 2F54A 2EIMB 3QO1B 2ZAGA 1OAJA 3JZHA 1KY6A 1MH5A 4IIQA 2VN7A 3O3DB 1IC7L 3HB3B 3VD2A 1XSIA 5DMGC 4OAWA 2NQDA 1WAAF 2IDQA 1FNAA 5HXMA 3MLWH 3HZMB 1LL1A 3GZQA 4LIQL 1THAA 5JZ7D 3TO2A 4YHIA 3LJ3A 2JKNA 2NMSA 4PS3A 1PZDA 3MRFA 4XB8A 2QDVA 3HI6L 3KBPA 4HUWA 1BQHB 4FI7A 3T0EE 1D7DA 4I0PC 4PJBB 1UKQA 1DQML 4I5BA 4XZ4A 3PSCB 1U3NA 1HSBB 5DGRA 3VRJA 4AMKH 4JBSA 4MMZA 2XL2A 1RV6X 1HE8A 4PJCF 4NQED 4XP6H 4OD2A 4TOYL 1U91B 3BRFA 4G7SB 3HMXA 3FO9A 3MV9B 1VZGA 4GRWB 4JJ5B 4TVPD 2GB2A 5F0LB 5F96L 3UDWC 1SY6L 4YHZL 4D9RE 2AAVA 3Q8AA 2B59A 4WEBL 1U93B 3JWDC 4HKJB 1M6UA 3C6SA 1NEPA 2Y7QB 4YC2B 1XR8B 3DVGB 3L9RA 3O6LH 3DXKC 5F7YC 2BLFA 3J7HA 5BNXD 2G5RA 1BECA 3P0YL 3ZMRA 2J56A 12E8H 1UEMA 2VABB 4K7PH 1T3FB 3N43F 4QL1A 2ZNXA 3GXDA 3SIKA 4Q9QH 4PJFF 3S8WA 4H20H 4PW9A 4X5WA 3IMVA 2JJSA 1CGUA 5E2TL 4C4BA 5FYLD 3B2PA 1ECYA 3U0WL 4YO0B 2A74A 2K78A 3QWNA 3ZR5A 3PP4L 1D5RA 3OG4B 4J3TA 4TVPH 3MN8A 2GTWB 3RIFF 4G80B 4GBXC 4NHCL 2EYSA 2H9NA 1IEAA 4MA8L 2EKJA 4X7DC 2BZ7A 5GS0C 4A2LA 2H47A 5K1CC 2EIBA 4ZRGA 3VGEA 3UO1H 4LOVA 4U6HA 5C0IA 3LXAA 2J2ZB 3IDYB 4NC4A 3MLRH 5BXFA 1TDQA 4AGOA 3OJVC 3CZNA 3QUZC 3UADA 3ZKQD 1N6VA 3WXWL 4CSTA 5LGHH 2DMHA 2J4WL 3LMJL 4A7TA 9PCYA 3C60A 2FLMA 4YDLC 3BG1A 4HZAA 3FPYA 4LLWA 2VE6A 4GXUM 4ZAKA 5JHDA 2WIIA 3PWUB 4XNAA 3DX4A 1NC4D 4U1IA 4OZIA 1H15B 4X5XB 5CXPA 2WTPA 1DQTA 4KKLD 2C7FA 3L4TA 3MFFA 3VXUD 2HLAB 4X0NA 4PWFA 4XPFL 2F53E 4D9RD 5HYSB 1AZCA 3D2UB 2FLRT 1ASQA 2HLFD 3MCKB 4XAWH 4PY7B 3WIHL 4IOFC 5KW9H 4JFFD 3C6LA 4I89A 3HR5B 1R5WB 5TDNA 2WXFA 1PGRB 5HGAA 2Q6WA 3D25B 3C5MA 3GSQA 3HI5H 5ESQA 2BC4A 4RAUA 4EIUA 2HRPH 4DJMA 1X3DA 3Q01A 2ERJB 2B1HL 4QKTA 4QRTA 4HIIA 2ED9A 5JA9A 2WXJA 5HGHB 2WWNA 1NANI 5FYKH 3RVXD 5LO7A 2OK0L 3ESPA 1BF2A 3QNXA 3FO0H 3ZYOA 5K9JL 3DSFH 1AD9A 1B0WA 4YAQA 1E42A 2AJVL 2BNUB 2R59A 3T5WA 3JUYA 5GRUL 3D87B 1LO2L 2R83A 3WEOA 1KSRA 1C5BL 2O1AA 3VI3B 2W9LA 1NGQL 4IRZH 5CR1A 3MRJB 5JPMB 5LQBH 2EVJA 4YPGB 5CEXA 2FQGA 4N28A 3PGFH 3E9UA 5HJDA 1TEFA 4HAKA 5HHOE 2VDOL 4A7UA 2V9QA 3MXWH 4G8GE 3KPSE 1VGEH 3K81A 5DJ6A 1RZ8A 3O4OB 4ES8A 3QYNA 3REWB 3IURA 1WBZB 3CGTA 4WWKD 3WFDL 5A3IC 2QR5A 1S7TA 1TYJA 3QEQE 4N2FA 1SQ9A 4H0IA 2DD8L 2FEEL 2W59A 4J6RH 1A6WL 2ZCLH 3F7VB 5E4EC 3X14B 4MZ3A 2NY4B 1TQVA 4IU2A 3I9GL 3T8MA 3QIUA 4NC1E 4KGJA 1I8IB 1MUJA 1LO4L 5C0RL 3IE4A 2GJZA 4IBQA 5I6XB 3QHYB 3QI9B 3IXTA 3DSMA 5JNYB 3APNA 1LVEA 1OAQL 1QZNA 3KBFA 1HDMA 2PETA 4LVOB 5JIIA 4GQBB 1UJ3A 4H13C 2YUXA 2FB4H 4JRXA 1W8NA 4F7MB 4RMSA 4RGNC 4Z7NF 4P2OB 3ALWA 3D0LB 1G7PA 3GBML 4FERA 1K8DB 1P6WA 4IEFA 2YPKA 3LQZB 1THCA 4LPYA 3WBDA 4OCSH 3MNVB 2WPGA 4UYPA 4XVTH 3FFCD 3F01A 4PSPA 4OZGF 3PWNA 4IMKC 3MV01 5B3JF 2YD4A 2NXZC 1QNZL 4KMQA 2LV4A 4HJGB 1KYDA 4ZX6A 3P73B 3FQUA 3IKKA 4WI6A 1E4JA 5LBSA 3WJLC 5IB5A 3AG4B 2EIEA 5CP3H 4CNIA 1Q0EA 1DQJA 4IMLB 4KO5A 2EBSA 1QATA 2VGLM 4XCNB 4CUCA 1KY7A 2H9PA 3CFKA 3MUGB 2A9NH 3KPTA 3TEUA 1QAWA 3HS0A 3QJHB 1NFIB 1KCRL 3FT4A 1HHKB 3KYAA 3SGKA 1XGQB 1EEQA 1D9KD 3I6KB 5AOLA 3VXMD 5GXIA 1L9QA 2L7JA 1YAZA 4QYAA 3HMWH 3FYIB 4YZWA 2FZ3A 4HF5L 1F90H 4OGXL 4EN3C 3VQ2C 3NABL 4DO6A 4JY6A 1T2QL 2Y7SA 4HKBB 3B7UX 1T20A 4NM8H 5JHMA 1R0AL 2ARJQ 4DTGH 1KFGA 1T7VA 3OVUB 1I7TA 5A6IA 2B5NA 4H44C 5DUMH 1XGUB 3IDIA 4MYPA 5F88B 5GGRB 1CF8H 1MFMA 1BVKA 1T04A 3H3PH 4HFUL 5I8CB 4OD3H 4Q2ZB 1OAKH 3V7AE 5L6YH 1NCJA 4B53A 5H4ZA 3HAEA 4FFWD 4N22A 1BM7A 5C86A 2H6QA 3EI4A 3SQBA 2FSDA 5IJVB 4I8DA 4GGAA 1BMZA 3MGAA 2VJ0A 3LRLA 2UV3A 2X4NA 1D2OA 4D0BB 3FRUB 3K2KA 2P8MB 4KBPA 2W94A 2VT0A 5C0BB 2IGTA 1J0ZA 1CFQB 2RR3A 3VB9A 1BG9A 1BZOA 4YDZA 3GC3B 1MCWW 3IPBA 3SDAC 1DN2A 2F2HA 4ZYKB 3NZSA 4D0DB 4FP8H 1QSZA 4X9HA 5IBTH 4P5MB 4G1MA 5IROC 1J88A 1A4JB 4MDIB 3VXSB 4QRQB 3GJFA 4JFEE 5D1XC 3KCPB 2DAVA 2MJWA 3QHFL 4U1JA 2Z35B 3KYOA 3WOVA 3DO7A 1FPTL 4AIEA 1J86A 4PG9A 1E9QA 5JOPE 4JM0A 1JPEA 4X5RA 1AXSB 3BMWA 1QUNA 2G2NA 1J5OH 5M5RA 4YHLH 2WY3B 4UMGA 1X5IA 4OZHB 4NDMB 4DK6A 3A4DA 3MUHL 4XCEA 2OJEB 3IDJB 3A67L 1WH0A 2NXYB 3RGVA 3TV3H 3RDTB 3NBNA 4YGVA 4EI0A 1MLCA 5JW5A 4GAGL 2VIRB 4I18B 1VIWA 2GEQA 4PJHA 4M6MH 1IU1A 5IMOA 1EXUB 3B2VH 5FFGA 4IDLA 4XN4A 4F9LC 2TRHA 3HZVA 3SD5A 3PWJB 4O5LH 5DTFB 4JFDA 1BVZA 1N8OE 2CBPA 2AJUH 4IGBB 1BX2A 1BZ9A 4PREB 3RIAK 4Z7AA 1HJBC 1N19A 4G5ZH 4TSBL 2NTFA 4PB9H 1NQBA 3RX5A 3F3GA 2MEJB 2O9KA 4X61B 2AJZA 1HQRA 1UADC 3MXXA 5EO1B 3IJSB 4A04A 3OKOA 3P69A 3A3YB 1FO0L 3HJ0A 3VWJA 5HE1B 2Q7NA 3DARA 4FEIA 3RYMA 5ACMA 2XOTA 1E4XI 4NNYA 3ORVD 2IG2L 3QORA 1AZRA 1YEJH 4G8IB 4MCYA 3D7PA 4H25B 4GM8A 3CSYA 4JSPC 5JMRA 3TN0A 3FTGB 3OC8A 3QUYA 2MNJB 4LNVA 4TNWK 4ZXBB 5HVGB 1YDPA 1E43A 3FSAA 4ODVH 3WY4A 2K7PA 4GKNB 4U3CA 1EZLA 1SDAB 3LQAC 3NDYE 3CFVA 2M1KA 3CK0L 2KYIA 1MCWM 1XV8A 3ZBMA 5GQBA 4KQ3L 4PEEA 1RFDL 4BFEA 5EO9A 2F61A 1PG7W 2ITCA 5T5FA 2ADFL 5I73C 4GS7C 4XPTL 2FJFB 3AW5A 3BVUA 3X13B 3B9AA 2QT6A 3RDJA 1OK0A 5DMJB 5LAXB 4DKFH 1M56B 5I8OL 5I5JA 1T4KB 4GAYA 3PPSA 1YEGH 1AQ8A 3HG2A 4FULA 4HGKC 3K5SA 4M5YL 4NYLA 4Y9EA 3MRLB 4LCCB 3O4LE 1WTLA 1BZDA 1FN4B 1S7WB 4P99A 5JQ6H 5IB2B 3TEZA 3UJTL 4PJ9D 1L6PA 2UY7B 3ISWA 3UX9B 1XTLA 2VDLB 3QXWA 1VHPA 2BOBA 4LBEA 5ADPH 4JVUA 2P26A 3QWOB 2BBKH 3ECBA 2OX5B 5BO1L 5F0PB 3L6FA 2HJLB 4MMZC 1TTFA 5IZ7A 3NSYA 3DMMC 5FUOH 2EXSA 3ENEA 3PFQA 4APQB 3UPCA 3BESR 3HS9A 5DZVA 5F1NA 2CDEB 4BKLB 3VH0A 1P22A 2MQ3A 3RLSA 3ZE0A 2NY0C 3S8FB 5DRWB 3WFHA 4LRIA 2G2PA 5T3ZE 2AGWA 4WZ9A 4K9EH 4O2EA 1PCXA 3UYRH 2Y6SD 5I1DB 5AVRB 5IK3B 3TIDB 4HZLB 4CBZA 4DAGH 1E8NA 2XKUA 5CZRA 2IV9A 2QLVB 4N4YB 4QTHA 5GS3A 4XZUA 5GJSL 3L1FA 4FLOA 3VFVA 1PKQE 3WIIL 4FJZA 1ZHBB 4UIKL 1BBDL 2PPFA 2Y5TA 3A6CL 5TDHB 4PJ8D 3AWEA 3ZU8A 4AMXA 1CDYA 1OPGL 3MOAH 4ELMB 3CV5A 1TCRA 1E4XH 2H47C 4WV1C 3OL2A 2ZWKA 3H2PA 5DI8B 1WITA 4QJ3B 1N18A 1KTBA 1LP9B 4ATTA 1GZPA 3LXCA 4CRPA 3C60C 3MV7D 3NCCB 4J8RA 1A02N 3EG6A 2DQIH 1K8IB 4QWWD 3CFBB 1Q47A 5FA5B 1ZWIA 3VGZA 3BO8A 4H8VA 1TQUA 5AVZB 5EPMA 3A6OA 4PAZA 3DHMA 5FPIA 4Z5RB 3DWTA 4YHKL 3WAKA 4FE9A 3IETA 4QXGH 4UILH 3C6LC 4BKTC 4LG8A 3WYRA 3H3BC 4ZFZB 3O11B 1F13A 3VRLE 4KTEH 4C58B 1NIFA 4PJDB 1IJ9A 1KTDB 1MAMH 4ZQKA 5IP4A 4NO0D 1TITA 1DQDH 2RCSL 5EF2A 2UWEE 2ZIDA 4NENB 3ZO9A 4O51B 4DVBA 4NQEA 4NPJA 1MJ7L 3NIDB 3F12B 4AE1A 3REVA 1DLHA 4WWPA 1OHQA 2Z31B 4B6ZA 1NLBL 1G9HA 3SQOL 1VFMA 2D3VA 3UGXA 5D2NA 3EJUA 3MRQB 4MCNA 5CMAA 3B34A 4XNBA 3WE6A 5IF0B 4N2HA 4GB9A 4LRNL 2PO6B 3IWUA 5E8DL 3FFDB 4EDWL 4Y7OC 3QHTC 2FHBA 4N3UA 5FHAH 4WNSA 2VKWA 4M7LL 5D4JA 4M7ZB 6FABL 5L88L 1CS6A 2WLLB 2GTZB 1IARB 5I1EH 2E9IA 4PJIF 4OSUH 4ZDHA 4PJXF 2HJFB 4N8PA 1O7SA 3WNPA 4AYID 5DHVA 3X12A 1S6NA 2DLEA 3C5JA 3QJQB 3T3PA 5E8PB 2EVFA 2JKJA 2DLGA 2RFXB 1A64A 2XPYA 5ECJE 1RULH 3S8GB 3QIUC 3DX7B 5MENB 2IUQA 4RA0C 1PLCA 1GGBL 1EHNA 3SCMD 4KNUA 2X38A 3ILPB 1NFDB 5T1LD 4KRPC 2XHNA 4K71C 2WLYA 1UJ3C 4YBQC 1BAFH 4NPKA 5DEGB 2YLHA 2GJRA 2Q76B 3LZQA 1BQHG 5EIQA 2FJUB 5AMSA 2WMPB 3HUJE 1S9WA 3A21A 3QQ4B 5IJBC 3IDMB 5I6LA 3NFNA 4JO4L 3UAJD 3CFEB 4QRJA 2AGLA 1U6AL 5ALCH 1A14H 3C9NA 3MXVL 4KY1L 3QBTB 4KHTH 4XBGA 5GGUB 3EHBC 1BFVL 5TH2B 1NC4A 2WXHA 3NK4A 3ZSSA 1U8LA 2DMBA 3WKNA 3SDCB 5IJDC 5FQDA 3VXUA 3EYOB 4KQ4H 1F42A 1U8PA 2X4OA 4M5TA 4IRZA 3UZQB 2AQSA 4Y2OA 5C0JB 3HHRB 1KCSL 1AS7A 1C16B 3M8OH 5I26A 5AKVA 4JFFA 1U8IA 2HESX 3FCSB 3UTTB 3V5DB 1E7VA 2BP0A 4KVPA 3WKPA 1E9OA 1ZT4B 4OLWH 1H9VA 4GSQA 3H9SB 4GRWH 3NJIA 4GKOA 5HHVH 3TXAA 3HS0C 5GGSB 3VDBA 5BV7C 4KKPA 3L4OD 1ULVA 2CRZA 3SGKC 3WO4C 4YSOA 5AVWB 5HE3B 2G99A 5AW9B 2CLZB 2EXWC 2DY2A 4Z7OE 1XF3B 4G71B 4ABQA 3U2SB 2MOGA 3MRGA 4DEWA 2YMXH 3RIKA 4Y4FB 2V7NB 4HUNB 2EUZA 4JKKA 4DP7X 2UZXA 1JV5A 3I6SA 3FH8A 2FTAA 2Y06H 3SPIA 5A2CA 3BXNB 3MLPA 2OJYA 3HZKA 1XD0A 4N6RB 3S98A 1QA9A 2VR7A 2JI1A 3EO1A 3PABA 3ZY7A 3C12A 3D3VB 1HXMB 5DYOA 3O4HA 3ZDXA 4F8QA 5FKPB 1KGJA 5CJOH 3D2UD 3W81A 4WWKA 2DDQH 1QTSA 4ETQB 4XGZB 1NDGA 2CLVB 4FG6D 2MHAA 4OKVB 5TDPA 3P30H 4RZKA 4BIKA 2FWLB 5E8NA 2HTKC 2Y2YA 4GQ9H 1JYXA 4UQBA 2P9SC 1OZUA 5HDRA 4KK5C 5HYSG 4U33A 2VL5B 2EYTA 1D5XB 5CP3A 2EH8L 4OF3A 5DZPA 2ZUUA 2NUPB 2FLBT 1DSWA 5ISZE 4M8UA 2BHZA 4HH8A 2WBJB 3KXFB 2PN5A 3F58L 2X4SA 1Q9LB 5D7SH 3V9CA 4X6BA 1OKEA 5MEPB 3RX9A 3ARWA 3ZT6A 1FIGH 5LDUA 2OZ4L 3KG5A 4FQ2H 4EBQH 2DLIA 1R34A 4DO4A 2CH8A 4XMXA 4PHZA 4LIQE 3FFCA 6TAAA 5DK3A 1HWHB 1UQSB 1UTDA 2OR9H 5D93B 4KZEL 1UOKA 3L4YA 1AGDA 1QSFE 1T21B 1UXWA 3UIYA 4X6DA 4HXAL 2WZ0A 3AG2B 4JHAH 3U46B 4Z7WF 5CLWA 1YNTF 2J6WA 1LNUB 3RGVC 4KKAC 1KTLB 5ERWA 2BXYA 3OC5A 3ME0B 3LY6A 4JFVA 5CBEB 4JDTL 2NY4D 4UUJB 4F57H 3KZ8A 4WFGD 1JZFA 2ZWZA 5E1AB 2CHWA 2BNQB 2NT0A 5DQDH 2E8ZA 4HAFA 1D9KA 3PNWB 5SX4H 1SLXA 4KQ0A 2JI3A 3QI9D 4K3HA 2GBAA 3UPAA 1KBGH 1FC1A 1MY7A 3S48A 1RD6A 2PYFB 3IFPA 4KC3B 3SDYL 4L2YA 3ROOA 4ZS7L 1IC0A 3NAAL 1HXKA 4KJYB 3BN3B 4N8VB 1JNHB 4A66A 4WU7B 5G4NA 3G9VA 5I1JL 4LU5L 4Q9RL 3F65A 4LOFA 1YNKL 4M8QA 2DQTL 3DYOA 4PWIA 5DFTA 5BQ7B 3KLHC 2DQDL 5E5RB 4JFSA 1CJYA 3VFTB 3VFGL 3VWJC 2W07A 3H6AA 4M48H 2AQ2A 1UCBH 2W81C 1OTSC 2Y6TE 3VACA 3MRNA 2OMYB 1F2QA 3QORC 3OKLB 4MJIE 1AGEB 1S7XA 2G4EA 4R7XA 1X5JA 4TPRL 2N1KA 4WJG3 3ECVA 3CLFL 3GMLA 3QDMB 3TN0C 4BZYA 3UYPA 3HC3L 2QR0A 1KGUA 4DUXA 1KTKE 3MJ9L 4D8PA 5F1SA 3PWLB 4CC9A 2MH4A 3K72A 1EAJA 2H0PA 4Y8AA 1D5MA 5JYMA 3VG0L 4JRYB 3G04A 5IHLB 1Q9OA 2VLJD 4L05A 3NJHA 1VADB 2GFBA 3QZWG 4PS8A 2F5BL 2VN5A 5BRQA 2VDQL 4ZX5A 2YNPA 2SEBA 1WLHA 3ZTEA 1KLFA 2RQEA 2J8UE 5DVLA 4HOXA 4LLQA 2VJXA 3Q43A 4AYSA 1XH1A 1F3DJ 2ATKA 1RJZA 4WTXA 2W38A 3VU2A 3PREA 1IKNA 3MO1A 3WN6A 43CAA 3KRWB 1SUJA 2B77A 4G8EB 4LPUA 4DP2X 2EP6A 2YD6A 4JO1L 3ULVD 1UA6L 3IDXH 4QHKJ 2BJMH 2WAHA 1SYVA 3BVVA 3DNKA 5E00B 4Z7QA 3JWNG 1YJDL 3T0EB 1NBVH 2N0MA 3IVKA 3PV7A 4NQVB 5EALA 1DFBL 2A77H 5IEHB 5JMOC 1FL5B 1UXSA 1JWSA 5EA0L 3MA9L 3VRIB 1FYTB 1UTCA 1AQHA 1XD1A 3RNKB 1BBJA 1N2RB 1NBZA 3GPSA 1H5BA 1SF5A 1I1FB 2X4TB 3MBWA 3OG6B 5KVEL 3CHSA 1MFDL 4G8FA 5J11B 3CFSB 4X7FC 2X12A 1T66C 3HR6A 3I50L 3JWNH 5AKSA 2DTMH 4TN9A 2G9AA 3T77B 4M5ZL 4L1HA 1QRKA 5H2BA 3BP4A 3FRPA 2ZPKH 3VG9C 4C4UA 4ECNA 1ND0B 4N2GA 3M07A 2CM5A 5A2JH 3K4ZA 2OM5A 2VZOA 4OJYA 3ULVH 3W9EA 4KJQD 1QR1B 3SMRA 3NIFB 4LRIC 1FBIH 3VXSD 4APXA 1VCBC 3H9ZA 5D7HA 1RUML 3WXVL 1XCQA 1VJSA 3BGFB 1MXGA 3NEOA 3VCLB 1PI6A 1W0YT 5F1IB 1YUKB 5HHME 1W9XA 1I8LA 1NC2D 1HXYA 1Z3GL 2XG4B 5GISH 2EE0A 1SXZA 1OAUL 1A6PA 3G6AB 4BM7A 1UD5A 3V9FA 4ZMXA 4F37K 5M5VA 2AK4E 4KI5C 3TH4T 3BKYL 4XMZA 4PJEE 3FT3B 4LSVL 2HVBA 1AAJA 1CFSB 4O2CA 4L8DA 3L3HA 5KYXB 5KSBB 2DMKA 2XETA 1RMFL 3BQUA 1DDHB 2CK0H 3JROA 1CR9H 1J5DA 2HKAA 1NPNA 1TETL 4ZTPL 3V55A 5E6IB 1FCCA 3UG4A 1ZANH 2H32B 4IGBD 4WU5A 3G08B 2N7BA 3G6JE 1XH0A 3RWDB 2Z2PA 3DVNA 5INDA 3QWQB 3DRQA 4ZPVB 1PLGH 1LTXA 2F53B 4TV3A 2WAQA 4JKWA 1LDPL 2DQUH 4KK8D 2ID5A 4XPAH 3K6OA 3RILA 5JZ7C 3WNKA 3KYMB 4PJ9A 3ALXA 3BP6B 5LNEA 4U0RC 3T3MF 2X0UA 5CJQH 5I1CH 1E5CA 3KPRB 1U9KA 3U36B 5B39B 5IMKB 5ITBH 5J56B 4AYFA 3FYEB 4P4RA 2DM2A 4MJJA 1PFCA 1I8KA 4OIAA 2QDWA 3EW3B 1XT5A 1VB9A 3TBSB 3FK3A 4ZXBD 1E27A 3MCLH 1BXXA 3IWVA 5BUAA 4TTDD 4TL4A 3DC0A 4NP4H 5ESAA 3MRCB 3SN6B 2WXPA 1LGVA 3AU1B 1BSIA 3WL9A 5G5DA 5HGDB 5KS9A 2RACA 4W68A 3AITA 1DO5A 2O5ZL 5DSCA 5D2NC 4EIBA 3CSGA 1BLNB 3W9DA 1M7IB 4A2GA 2EIZB 4C55A 1VDGA 3IYLW 1O6SB 3NCEB 4U1MA 4B0MB 1L6XA 3ROLB 4J77A 3CHRA 3FU7B 1WD9A 4YHPB 5ACZB 5HHPA 1MXDA 2C8NA 2XN2A 1R6VA 2J88L 1JZ6A 4I2XB 4MFHA 3CDFA 2BHFA 4L3CA 1TJHH 4UQ3B 5DLML 2VQTA 3U0PA 4Z3EA 2CBTA 2MOQA 1ZLVH 2AGJH 1NCNA 1P9MC 2C9XA 2KC0A 4OTXL 4OUOA 4AYDC 4ZSOB 3AT9A 4FA6A 3FQNB 3P4NB 4PJ8A 5EULV 1CFTB 4GJTB 2KLRA 5DWPA 3TBTA 4ZMQA 5L7XL 3L13A 5T33H 2CGZA 2V3FA 2OK4A 5AW0B 2XX0A 1KJ2B 4PMEA 2NLJA 1BDYA 3FS9A 2OMVA 3K1DA 4YXKH 1UB5A 2H9GB 3AS0A 1N70A 4M7KL 1OP3K 5I74C 3BAXA 3SKMB 4LGPB 3DO4A 3EYFB 2AXGB 5KG9B 5KWYC 1SZNA 3MV7A 1FRGL 1GGTA 3DETD 1E6JH 4KAQL 1MZYA 5FUZH 1FAIH 3IF1A 4ODXA 5I0WA 4PU2A 2A83B 4JRFA 1HH6B 4NBZB 3B1UA 4HVBA 3MLTB 4DKAA 2R7EB 4KKLC 4KZCA 4J8GA 3EO0A 2IAND 1CUOA 2VDLH 5JIPA 4X4ME 2HLFC 3R1GH 5LCVH 5DDHA 3AFCA 2VLRA 3QHZL 4O9HL 5BCAA 2I3SA 3A0FA 1IAKA 2DLHA 2ENPA 2HN7A 5IQ7H 1AVAA 5BOPA 3OJDA 1XFPA 4U6YA 2FX9L 4I0KA 5FKAA 3UP1A 1QQDB 1MCRA 4RGOH 3K0YA 2JKWA 3J2PA 4FQLH 5ID0B 4OCNC 4BWWA 3MZLA 3RVXC 2WZAA 2WXLA 3QFDB 1N5YL 3K3QA 2NYYD 1ML0A 5DD5H 3C08H 4UTBL 5E5MA 2P9PC 3SFZA 2VB5A 4IBVA 2RHEA 3BEWA 5TEFA 3MZKA 2BERA 4PJ6A 5CM1A 5C07E 3MI6A 3CC5B 2AH1A 4RMWA 1RPKA 1NUDA 4FHLA 5GRYA 3QO1A 2CGYA 4S1RH 4H0LC 3S37H 2X88A 4YHNB 1TO5A 1SXBA 3FB5B 3KLQA 2BP5M 4AVIA 4DKTA 3O3DA 4A0AB 1F18A 1JGVL 4H0GA 1FZKA 3B2MA 5IVXE 1R3HB 4Q8BA 2EH7H 3MUY1 1AGBB 1NOFA 2V33A 4WNQB 3MLZH 4WWKC 4JB9H 4WI8A 2BCJB 1A8ZA 5I19H 5IOPB 4TVUA 3MKGA 5EZIH 1VAHA 2YKLL 4LLAA 3UBXB 4TQPA 1GYVA 5CSZA 1C7SA 1KT2B 4MTMA 3TONA 5IEKB 1BQHA 5EZOL 2W65B 5K59E 3JVFC 3K80A 2X3BA 4YQXH 1NKRA 1HSBA 4ANKA 3O8XB 4GZ8A 1NBCA 3SCMA 5E4OA 4OCLC 3NIGF 1JHLL 5T1LA 1DBAH 1U91A 1U8CB 2OW7A 2BS8A 4DIXA 1FA4A 3MV9A 4JJ5A 1CTMA 4QXUL 4G1EB 3WFBL 2AQ3A 3DGGB 3OPZH 2VXVH 3Q3GB 4CN4A 1BD2E 4DZBB 4XN2A 1XH2A 2DQGH 4RA3A 4U3HA 5K1NA 1X6LA 4FTVD 4XX1G 1E5ZA 1FORL 5D7IF 3BOVA 2Y7QA 3FJTA 4I77H 3UAJA 3ARFB 2RQ8A 4I1NB 3S3PA 1XR8A 3DVGA 4DK5A 3ABZA 3LKOB 3NSCA 1BHGA 1TTAA 3K6DA 2BSSA 2ETWA 2DH3A 1T89C 2FWSA 1W0VB 4GSDL 4W9EC 3NCBB 3LRKA 2VABA 2YA2A 1T3FA 4NUGL 5F7FA 2AITA 3S36L 5HHXL 1C12B 5DUPH 3ZE2E 1ILSA 3WS6A 2BVPB 1F97A 1TG8A 2P48B 1I8UA 3B5GA 4G6ML 2BY1A 5BMFL 1OD9A 3MGOB 1CD8A 2IWFA 4A37A 3AS3A 1FGVH 4YO0A 5D5ME 4LKXB 2ZP0T 4PSRA 1KGCD 4NC2B 4G80A 4NOBA 2ZG1A 3AG1B 4OD1H 1FQ9C 4PJGF 1D9KC 1C8PA 2VR4A 1CURA 2VLLB 4TUJB 4UT9L 4LQ1A 5IV2B 2J2ZA 3NACL 4JG5A 3SYQA 1P2CB 4J3OF 4KHXL 5EIIB 4AGMA 3QQNA 2Z92B 2JMRA 1ZSDB 3V5WB 4P9HH 5F6IB 2AEQL 3MV8E 3MOQA 3UVNA 1CGXA 3VMPA 2YQ2A 5L2KB 3WIAA 2HVKB 3CDGB 3PWUA 3I2CH 1H15A 4X5XA 1LWRA 1TJGL 1G7QB 2HRGA 5KVFH 5HYSA 2EEBA 4M8VA 4ZMOA 1A12A 1OO2A 1O7VA 3D2UA 4FFWC 3NGBC 3MCKA 3AMKA 2QQNL 2WQXA 4PY7A 3RZCB 4JO3H 4ZD3H 1F4AA 2MPVA 1IQWL 1C5CH 3HR5A 3MACH 1R5WA 4JGUA 1X5YA 3ZL2A 1PU0A 3ZDZF 3D25A 4PJAF 3OKTA 3V6OA 3N91A 1BPLB 1SDDB 4YHML 1EXGA 5ECGA 5KJRH 5HGHA 2BK8A 1FH2A 3FTSA 3APMA 1KTCA 1KUMA 4P23D 5EC2B 4J3XA 4XNQB 1T5WA 1IO4C 4LE8A 5KANI 2V2WB 1JZ5A 1IKNC 3VTAA 2IAAA 1OCOB 1UC6A 3PE7A 3O4LB 5TEEA 4JCMA 2ZOWA 4GSRA 3VI3A 4U05A 5JPMA 1RURH 4YPGA 5JIHA 1G5AA 4G5AA 3DX2A 3Q5YA 4IW4C 3BFWA 4HU2A 1QLFB 2CRYA 3C87A 4EXPX 1F4WL 4R7NA 2FGWL 4G6KL 4Q6YA 1SHWA 1BLIA 4NKDB 3REWA 1WBZA 1AKPA 1Z5LB 4B50A 3QNYB 1KBWA 4WSGA 2ICWB 3SODB 3CG8A 5DJAB 1HZKA 1J0YA 1PL3A 3O6KH 3QAZC 3VSTA 1T7WA 3F7VA 4IU3B 5DZAA 3VD4A 1H5BC 4R90H 3X14A 2EDOA 3KYKH 4IBSA 5FUCC 2KBGA 2ZCKL 1QBMH 2R0WH 3MRHB 2VDPB 3AQYA 1CXIA 2VITB 1N10A 3BWSA 3CUPB 1WBXB 3HVDA 4QRPB 5AEAA 3QI9A 4CMHC 3I2NA 1U4EA 5JNYA 1F4YH 2WBJD 5GRVL 5AZEH 3KXFD 3TF4A 1PFOA 1A3RH 1I9IL 3FUHA 3SGDI 1EMTL 4BUJC 3UTQA 5KYNA 4F7MA 1YCSA 1MG3A 4P2OA 3D0LA 4Z7NE 2QPEB 1K8DA 1CL7L 2LW3A 1XAKA 2WTOA 5E99H 3LQZA 2IALB 3CZKA 3MNVA 3AWGA 3INUH 1J1XL 1JGUL 3UCQA 5CSBA 2FH6A 3UH8A 4J1UB 4TRPL 3IFNH 4Z7VF 4BCZA 4MCZB 3QJTB 1A9VA 5HJBA 3KWUA 1Z5YD 2DYPB 1RZFL 3P0GB 4KFMB 5ESVB 4CZYA 3CFCH 4HJGA 1OF2B 1WWWX 3N9GH 4QTIL 4RISL 5C1MB 4J73A 3P73A 3DXAD 1ZDSA 5F3BB 1MWAL 3SHFA 4JHBA 4IMLA 2GSMB 2CK2A 3F7RA 1U42A 3ULUH 4XCNA 5AZUA 1NGYB 3RIAF 2P80D 3MUGA 2CQVA 4NO5A 1PTZA 1E5AA 4BFRA 5DEZA 3GMNB 5FECB 1X5MA 4W4NA 3K71A 3KDMB 1HHKA 3GSWB 3NFSL 1KCUL 1XGQA 5KANG 4CW1B 3I6KA 3GSNA 4J84A 4HQQH 1R9FA 4WCYL 5D2LB 3LN9A 4X8JB 1LE5A 1QLRB 1J1OH 3X1GA 1V55B 1LO0H 2DL9A 4Y2LA 4HFWB 4D3CH 4RSYA 4POZD 3LPFA 4W6XB 4HKBA 2FYYB 3ALPA 4JFHE 4NCC1 4FQCH 3LH9A 1TTUA 4GAJH 2I0SA 4PJ9C 4O58H 3SE8L 1MW0A 2YSTA 1FC2D 4ONGH 1XGUA 5CCKH 2EEDA 4K9EC 4TUUA 1QWUA 5F88A 4FFYL 3E0CA 1F1AA 1NAML 2NY5L 5I8CA 4G70B 2UWEB 4Q2ZA 2IV8A 3W2DH 4KK9D 4UI2A 3FSVA 3QDMD 5DJ0B 3P9MA 4KMTH 3QIBB 3KJ4B 3E9TA 4U6XB 2GIXA 3BSZL 1R17A 4JRYD 5D8JL 5DVOA 4D0BA 3FRUA 2W9DH 4X6CB 1G0YR 4F7PB 2P8MA 2MNWA 3M1BB 5C0BA 4R26H 1Q9KB 2VXQH 4UAOB 1CFQA 4HX1B 4XMPH 3GC3A 4U3SB 1H2WA 2C1OB 5M95B 4HDJA 2XDWA 3LH2L 1KN2H 1INDL 2VXSL 1OSZB 3GLDA 4NZ8A 3VXPB 4ZYKA 5E9AA 5C09E 2VQUA 4YDJB 1A4JA 2ZKWA 4MDIA 4DN4L 4E68A 1RPQA 3VXSA 1T83A 4QPEA 1HIML 3T8VA 2Y6SC 3ARGB 2CR6A 2HX7A 2Z35A 3JWOH 3SGDH 2JKLA 4Z7UE 2BY3A 4N0UE 5HBBA 5I28A 1QBBA 2I7SA 3RWHB 4B27A 2AABL 5FO8B 1RK0B 2N7AA 1AXSA 1MWOA 3QYCA 2DJUA 4P9ML 2IURA 4W9KC 2YNOA 4OZHA 4NDMA 4J6IA 4PJ8C 2KKQA 2OJEA 3IDJA 5F21B 4NNPH 2DEYX 3VGBA 4DGIL 4PJ5B 2GI7A 3RDTA 1CT8B 1FYTD 2J5LB 1IGFL 3HI1B 4GW1B 1OAXH 3AGVA 2Z7UA 2VIRA 4N2DA 5IBUG 3DJZA 2FATL 3NP3A 1JZJA 2P42B 4TQEL 5CILH 5C92A 2WLKA 5JXAL 4QRRE 1C08B 1CIUA 2YOCA 1EXUA 1GGIL 1NA8A 1YNLL 4J78A 3MRMB 3VYOA 3PIQB 3PWJA 4UOQA 5DTFA 4V2BA 3VA6A 3QPXH 5FB8B 3LPPA 2JLLA 4KXBA 4IGBA 3SPVB 4QWWC 4PREA 3PAUA 4JPVL 4I48B 2DQCH 3RGHA 3BPLC 3EGDB 4XT1C 1F5WA 4DUWA 5HDBA 2BW4A 5DD0H 3V4UH 5EO1A 3IJSA 3HG0A 3QG7L 4PJBF 1I2MB 1URZA 2R29L 2W88A 1TYRA 2VQ1B 3OJMB 4HOWA 1I9RH 1WUNT 3WJMB 3GDCA 1K6QH 1FLRH 1RIVL 1QRNE 3VYNA 2HFGL 2XRAL 5F1OB 1NAKH 4G8IA 3HZYB 4S1SL 4HWEH 3FSZA 5G55A 1RJCA 1T03L 5JLZA 5KS9E 3LZOA 4H25A 2YZ1A 5I1KL 2QTVA 3BHBB 4IBYA 4AK1A 2Q2LA 4HWBL 3FTGA 4ZXBA 1QTYT 4Z7OB 1U8QB 2CUIA 4WW2F 4X2UA 5TQ2L 5AG9A 2ZOLB 5KYUB 1RL1A 4LGNA 2IIJA 1JL8A 1BMGA 2QHRH 3TO4B 2KZBA 4NNXB 1SMOA 5IW3A 2XU9A 4PCYA 2FJFA 5E6ID 3D39B 1UD3A 4D94A 3BH4A 3X13A 5J1SC 4K9JA 2UZPA 3ZW3A 2D0HA 1PYWA 1ET8A 4K73A 2HG0A 1HCVA 1MNUL 1T4KA 3DHJA 2I9LB 2WW8A 1JYVA 5IMMB 4JRLA 4HJ1A 2XE4A 5AOMA 5EZLB 4NBMA 1T6BX 2MNUA 3MRLA 4LCCA 2FO1A 1FN4A 1S7WA 2FIKB 5IB2A 5HI5D 3CCHB 5C97A 5IMLB 1WEJH 1E2WA 2XSKA 3L3IB 3KPRD 3PXHA 3L54A 2FX8H 4JN1L 2VDLA 3KAAA 4KH9A 2C4FU