4CY3A

Crystal structure of the nsl1-wds complex.
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
303
structure length
303
Chain Sequence
b'KPNYTLKFTLAGHTKAVSAVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVRTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQSKEVVQKLQGHTDTVLCTACHPTENIIASAALENDKTIKLWKSDT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN WILL DIE SLOWLY
publication title Structural Analysis of the Kansl1/Wdr5/Kansl2 Complex Reveals that Wdr5 is Required for Efficient Assembly and Chromatin Targeting of the Nsl Complex.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription
total genus 101
structure length 303
sequence length 303
ec nomenclature
pdb deposition date 2014-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4cy3A00
5HE1B 3OKWA 4H5JA 3PVUB 4J8GA 1S4UX 3SVWD 4GGCA 2H14A 4J77A 3HFQA 1GOTB 3SJLD 2CNXA 4E54B 4PC0A 3PVWB 3FM0A 3EI2B 2QC5A 4ZN4A 3KRWB 4ERYA 1SQ9A 5FQDA 4U1EI 2CN3A 2EBSA 2H9MA 4J8BA 3I8EA 3AH8B 4A2LA 4XYHA 5H14A 4YVDA 4FAND 2YMUA 2P9UC 3DSMA 4J0XA 3C5MA 4O3TB 1L0QA 2HJ4A 5H1MA 4FB1D 3I7KA 1ERJA 4JT5C 1GP2B 5GXHA 3V7DB 4BUJC 3J80g 3JROA 2AGXA 3ULEC 1NR0A 2H6QA 4ES0A 3VGZA 2YNOA 2HKRA 5HE0B 4IMMA 4O45A 3OL2A 1A0RB 3C9CA 2IUQA 4Z8LA 3UVMA 5EMLB 4A0AB 1PEVA 3KRXB 3SCYA 3CFSB 2P9PC 5K19A 4D6VA 4FA1D 5HE3B 4MK0B 3SFZA 2AH1A 2TRCB 4A0AA 4GM9A 4Y5RD 4A08B 4OZUA 2IWKA 3SMRA 2H68A 1MG3A 3GREA 1GG2B 1N6FA 4JSXC 3IIYA 1B9YA 2HJBA 2OJYA 1JJUB 2GC7A 3J81g 3MZKA 4E5ZA 3NVQA 4CI1A 2H6KA 3PSCB 4A11B 2IWFA 2AQ5A 3EI4A 4JD2C 3ODTA 3GFCA 4PNKB 5EMJB 3JZHA 4X61B 3FGBA 5CXCB 5FKSA 2BBKH 2HKMA 5AJAA 3EU7A 2I0SA 4GQBB 2AGZA 3AL8B 5FA5B 1PI6A 5CXCA 3RFGA 2AGWA 2CE8A 4ZOZA 3EI3A 2UZXB 3RFHA 2PM7B 5GXIA 3AL8A 5TDHB 5TEFA 3RRMC 4K3ID 4CY5A 2B4EA 2XL3A 4XYIA 4L9OA 4LG9A 4PBZA 3UVLA 3I89A 2I3TA 5EALA 2OVPB 4CI8A 4OWRA 5C2WB 3DWLC 3F3GA 3I8CA 3AL9A 5CXBA 2CO0A 5TEEA 4FWWA 5HQGA 4GGAA 3DM0A 4Y7RA 4FA5D 4ZOYA 1MG2A 2I0TA 3RLMD 1GXRA 3SBQA 1U2VC 4GGDA 3K27A 2G99A 4O9DA 4QRJA 3BWSA 5I5MA 3A0FA 4J81A 4JXMA 2XYIA 1OLZA 3RSEC 2OVQB 4JSPC 5I5JA 5EMKB 4D0KA 2GC4A 4J86A 3JZNA 3F3FA 3OW8A 4J84A 2P9LC 2W18A 2I0RA 3ZWLB 4FAVD 4J0WA 4FHLA 2G9AA 2CN2A 2O9KA 2PM6B 4J73A 1N6EA 1OMWB 1SQJA 2HXCA 2YBAA 3OL2B 1K8KC 3EG6A 3DXKC 2H9LA 3OKTA 2H6NA 4QL1A 5FXYA 2AH0A 4J79A 3NVXA 5IJ7E 3JB9L 2CO0C 3I7HA 2P9IC 2AGLA 2IAAA 3C99A 1FWXA 3FRXA 3CFVA 3SHFA 3PSLA 2Z2OA 2MTAH 5JWZA 4QT8A 3SBRA 4G56B 2OK4A 4E5ZB 1VYHC 5EMMB 4X3EA 3EI4B 3PXWD 4JSNC 5IGQA 3EI1A 3JAMg 5AMSA 4JT6C 1YFQA 2Z2NA 5CYKB 1XKSA 4BL0A 5CYKA 4ERQA 1SHYB 5IC7A 3EI3B 4GM3A 4J82A 4H5IA 2J56H 4ZOVA 2IUPA 5IGOA 3I7LA 3SWSD 5HE2B 2GNQA 2PM9A 4ERZA 3CIKB 4ZOXA 4A0BA 4O3UB 1MDAH 5C9ZB 4PBYA 3W15A 5IT9g 2OK6A 3I2NA 2J57G 2H13A 4L3GD 3UR4A 4FA4D 2UZYB 2XU7A 5CXBB 2QXVA 5H17A 2IURA 3N0DA 3UVNA 4XEIC 2XL2A 2I3SA 3SBPA 3I7NA 1JMZB 5C2VB 2P9SC 2YNNA 3UVOA 2P9KC 4JSVC 4TZ4A 4L3HD 1R5MA 4A09A 1JMXB 3K26A 2B5MA 3AFCA 4A7JA 2HYEA 5GSAA 1U4CA 3UKRC 3JZGA 5FKTA 4CY1A 4I79A 1PBYB 3E0CA 2P9NC 4AEZA 5EAMA 5THAA 3PXSD 3L4OD 2B5LA 3I7OA 4CY2A 5A2Qg 3MMYA 3VA6A 2Q7QA 3PE7A 4J87A 4N14A 3ORVD 3UVKA 5FKRA 5FLXg 4E54A 3EI2A 4LG8A 5K1CC 2CE9A 3MZLA 1N6DA 3N0EA 3RN1D 2H9NA 4PSXB 3IIWA 3IJCA 4UI9R 5EM2B 3F3PA 4X60B 3EWEA 1NEXB 4CY3A 4CZXA 3SN6B 4R7AB 5EM2A 5SXMA 1K32A 3SXTD 4GQ2P 4A2MA 4BH6A 3V9FA 2B5NA 3EMHA 3SLED 1RI6A 2H3XA 5GMKn 3EI1B 2YB8B 3B7FA 3MXXA 2Z2PA 4NSXA 1JOFA 4GZ8A 5TF2A 5IJ8E 3OKYB 1B9XA 2OIZA 3UKUC 4HDJA 5EARA 4LGNA 5HYNB 3OKYA 3DXMC 3RN0D 4K3JB 2H47A 3IKOA 4AOWA 3JRPA 4CI3A 1XIPA 3I7PA 4QQEA 1QNIA 3OTTA 2PM9B 4A08A 4A0BB 3JPXA 3IJ0A 3U4YA 3PXTD 2J55H 3BG1A 3NVNA 1P22A 3P4FA 4U7AA 4CC9A 5AFU3 2IUVA 3VH0A 3BG0A 1TBGA 2YNPA 4GM8A 1XHMA 3C75H 4KFMB 2OVRB 2BCJB 4A11A 1PGUA 4CZVA 2HESX 4L1QD 5FKQA 5B4WA 3RMZD 3MKSB 4GQ1A 4PXWA 4J78A 4IA9A 4CI2A 3L4MD 4CZYA 4ESGA 2PBIB 3MKQA 5I5IA 4A09B 1Q47A 3V5WB 4GMBA 4X63B 4FA9D 4EWRA 1TYQC 3IJ1A 5KDOB 2AGYA 4PSWB 4O1QD 2H9PA 5EAPA
chains in the Genus database with same CATH superfamily
5HE1B 3OKWA 4H5JA 3PVUB 4J8GA 1S4UX 3SVWD 4GGCA 2H14A 4J77A 4BP8A 3HFQA 1GOTB 4MMYA 3SJLD 2CNXA 4NBMA 4E54B 4PC0A 3PVWB 3FM0A 3EI2B 5FFOA 4WK2A 2QC5A 4ZN4A 3KRWB 4ERYA 1SQ9A 5M61A 3K71A 3FCSA 5FQDA 4U1EI 2CN3A 2EBSA 2H9MA 4J8BA 3I8EA 2HU5A 3AH8B 4A2LA 4XYHA 5H14A 4YVDA 4FAND 1VE7A 2YMUA 2P9UC 3DSMA 4Z7NA 3IUMA 3IUQA 4J0XA 3C5MA 4O3TB 1L0QA 4MMXA 1O6FA 2HJ4A 5H1MA 4FB1D 3I7KA 1ERJA 5HDBA 4JT5C 1GP2B 5GXHA 3V7DB 4BUJC 3J80g 3JROA 2AGXA 3ULEC 3T3PA 1NR0A 2H6QA 4ES0A 3VGZA 2YNOA 2HKRA 5HE0B 4IMMA 4O45A 3OL2A 5M5UA 1A0RB 3C9CA 2IUQA 4Z8LA 3GC3B 2EIEA 5E6UA 3UVMA 5EMLB 4A0AB 1PEVA 3KRXB 3SCYA 2VDMA 3CFSB 2P9PC 3ZDZA 4D6VA 5K19A 4FA1D 5HE3B 4MK0B 3SFZA 2AH1A 2TRCB 4A0AA 4GM9A 4Y5RD 4A08B 4OZUA 2IWKA 2XDWA 3SMRA 3GREA 2H68A 1MG3A 1GG2B 1N6FA 4JSXC 3IIYA 1B9YA 2HJBA 2OJYA 3NIFA 1JJUB 2GC7A 3K6SA 3J81g 3MZKA 4E5ZA 1YR2A 3NVQA 3VI3A 4CI1A 2H6KA 3PSCB 4A11B 2IWFA 2AQ5A 3EI4A 4JD2C 2EIDA 3ODTA 3GFCA 4PNKB 3NIGA 3JZHA 1E8NA 1GOHA 4X61B 5EMJB 2VDOA 3FGBA 5CXCB 5FKSA 2BBKH 2HKMA 5AJAA 3EU7A 2I0SA 4GQBB 2AGZA 3AL8B 3FCUA 4NAAA 5FA5B 1PI6A 5CXCA 3RFGA 2AGWA 2CE8A 1JTDB 4ZOZA 3EI3A 2UZXB 3RFHA 2PM7B 4RE6A 5GXIA 3AL8A 5TDHB 5TEFA 2VDLA 3RRMC 4K3ID 4CY5A 2B4EA 2XL3A 4XYIA 4L9OA 4LG9A 4PBZA 3UVLA 3I89A 3DDUA 4AN1A 1VZ2A 3IURA 2I3TA 5EALA 2OVPB 4D9SA 4CI8A 4OWRA 4WK0A 5C2WB 3DWLC 3F3GA 3I8CA 3AL9A 5CXBA 2CO0A 5TEEA 4FWWA 5HQGA 4GGAA 3DM0A 4Y7RA 4FA5D 4ZOYA 1MG2A 2I0TA 1VZ3A 3ZE0A 3RLMD 1GXRA 3SBQA 4IRZA 4NC4A 1U2VC 3IUNA 1JV2A 4GGDA 3K27A 2G99A 5E6SA 4O9DA 4QRJA 3BWSA 5I5MA 3A0FA 4J81A 3IVMA 4JXMA 2XYIA 1OLZA 3RSEC 2OVQB 4JSPC 5I5JA 5EMKB 4D0KA 2GC4A 2VDRA 4J86A 3JZNA 3ZE2A 3F3FA 3OW8A 4J84A 2P9LC 2W18A 2I0RA 3O4GA 3ZWLB 4JHNA 4FAVD 4J0WA 3EQ9A 4FHLA 2G9AA 2CN2A 2O9KA 1H2YA 2PM6B 4J73A 1N6EA 1OMWB 1SQJA 2HXCA 2VDPA 2YBAA 3OL2B 1K8KC 2VC2A 3EG6A 3DXKC 2EICA 2H9LA 3OKTA 3IULA 4AMZA 2H6NA 4QL1A 1VE6A 5FXYA 1K3IA 2AH0A 3O4JA 4J79A 3NVXA 2HU7A 1GOGA 4BCBA 2JKXA 5IJ7E 3JB9L 2CO0C 4UM8A 4MMZA 3I7HA 2P9IC 2AGLA 2IAAA 3C99A 1FWXA 3FRXA 3CFVA 3MUOA 4QAMA 3PSLA 3SHFA 2Z2OA 2MTAH 4DNWA 5JWZA 4QT8A 3SBRA 4G56B 2OK4A 4E5ZB 1H2XA 1VYHC 5EMMB 4RE5A 3V4PA 4X3EA 3EI4B 3EQ8A 3PXWD 4JSNC 5IGQA 3EI1A 3JAMg 1L5GA 2XE4A 5AMSA 4JT6C 1YFQA 2Z2NA 5CYKB 2QZPA 1XKSA 4BL0A 5CYKA 4ERQA 1SHYB 5IC7A 2VDKA 3EI3B 4GM3A 4J82A 4H5IA 2J56H 4ZOVA 2IUPA 5IGOA 3GD1I 3I7LA 3SWSD 5HE2B 2GNQA 2PM9A 4ERZA 3CIKB 4ZOXA 4A0BA 4AN0A 4DNVA 1UOPA 1MDAH 4O3UB 5C9ZB 4PBYA 3W15A 5IT9g 2OK6A 3IJEA 3I2NA 2J57G 2H13A 4L3GD 3UR4A 4FA4D 3QHYB 2UZYB 2VDNA 2XU7A 5CXBB 2QXVA 5H17A 2IURA 5M5TA 3N0DA 3UVNA 4XEIC 2XL2A 2I3SA 3SBPA 3I7NA 1JMZB 5C2VB 2P9SC 2YNNA 3UVOA 2P9KC 4G1MA 4JSVC 4TZ4A 4L3HD 1QFSA 1R5MA 2BKLA 4A09A 4G1EA 1JMXB 3K26A 2B5MA 3AFCA 4A7JA 2HYEA 1U8CA 5GSAA 1U4CA 3O4HA 3UKRC 3JZGA 5C92A 5FKTA 4CY1A 4I79A 1PBYB 3E0CA 2HU8A 1E5TA 4Z7QA 2P9NC 4AEZA 5EAMA 5THAA 3PXSD 2EIBA 3L4OD 2B5LA 3I7OA 4CY2A 5M5RA 5A2Qg 3MMYA 3VA6A 2Q7QA 1H2ZA 4L1MA 1E8MA 4NENA 3PE7A 5FFGA 1A12A 4J87A 4N14A 1C9LA 3ORVD 3UVKA 5M5VA 5FKRA 5FLXg 3EQ7A 4E54A 3EI2A 1TYEA 4LG8A 4WJKA 5K1CC 1H2WA 2CE9A 3MZLA 1N6DA 4AX4A 3N0EA 3RN1D 2H9NA 4PSXB 3IIWA 1UOQA 3IJCA 3MVDK 1BPOA 4UI9R 5EM2B 3V4VA 3F3PA 4X60B 3EWEA 1NEXB 2WQ8A 2QR5A 4CY3A 4CZXA 3SN6B 4R7AB 5EM2A 5SXMA 4JHPC 1K32A 4UM9A 3SXTD 4GQ2P 4A2MA 4BH6A 3ZDYA 3V9FA 1C9IA 2B5NA 3EMHA 5C86A 1T2XA 4BCCA 4G55A 3SLED 1O6GA 1RI6A 4Z7OA 2H3XA 5GMKn 3EI1B 2YB8B 3B7FA 3MXXA 2Z2PA 4NSXA 1JOFA 2VZ1A 4GZ8A 3K72A 5TF2A 5IJ8E 3OKYB 4O02A 1B9XA 5E6RA 2OIZA 1QFMA 3T3MA 3UKUC 4HDJA 5EARA 4LGNA 5HYNB 3OKYA 1GOFA 3QI0A 3DXMC 3RN0D 4K3JB 2H47A 3IKOA 3O4IA 4AOWA 3JRPA 4CI3A 1XIPA 3I7PA 4QQEA 1QNIA 3OTTA 4WK4A 2PM9B 4A08A 4A0BB 3JPXA 2XZGA 3IJ0A 3U4YA 3PXTD 2J55H 3BG1A 3NVNA 4AMYA 3NIDA 1P22A 2VDQA 3VI4A 3MUNA 3KCIA 3P4FA 4U7AA 2VZ3A 4CC9A 1I2MB 5AFU3 2IUVA 3VH0A 3BG0A 1TBGA 2YNPA 4GM8A 1XHMA 3C75H 4KFMB 2OVRB 2BCJB 4A11A 1PGUA 4CZVA 4DNUA 2HESX 4L1QD 5FKQA 5B4WA 4BCDA 3RMZD 3MKSB 1UOOA 4GQ1A 3ZE1A 4PXWA 4J78A 3OF7A 3ZDXA 4IA9A 4CI2A 3L4MD 4CZYA 1M1XA 5M5SA 4O2WA 4ESGA 2PBIB 3MKQA 5I5IA 4A09B 1Q47A 3V5WB 4GMBA 4X63B 4FA9D 4EWRA 1TYQC 3IUJA 3IJ1A 5KDOB 2AGYA 4PSWB 1UTCA 4O1QD 4BP9A 2H9PA 5EAPA
chains in the Genus database with same CATH topology
5HE1B 3OKWA 4H5JA 3PVUB 4J8GA 1S4UX 3SVWD 4GGCA 2H14A 4J77A 3HFQA 1GOTB 3SJLD 2CNXA 4E54B 4PC0A 3PVWB 3FM0A 3EI2B 2QC5A 4ZN4A 3KRWB 4ERYA 1SQ9A 5FQDA 4U1EI 2CN3A 2EBSA 2H9MA 4J8BA 3I8EA 3AH8B 4A2LA 4XYHA 5H14A 4YVDA 4FAND 2YMUA 2P9UC 3DSMA 4J0XA 3C5MA 4O3TB 1L0QA 2HJ4A 5H1MA 4FB1D 3I7KA 1ERJA 4JT5C 1GP2B 5GXHA 3V7DB 4BUJC 3J80g 3JROA 2AGXA 3ULEC 1NR0A 2H6QA 4ES0A 3VGZA 2YNOA 2HKRA 5HE0B 4IMMA 4O45A 3OL2A 1A0RB 3C9CA 2IUQA 4Z8LA 3UVMA 5EMLB 4A0AB 1PEVA 3KRXB 3SCYA 3CFSB 2P9PC 5K19A 4D6VA 4FA1D 5HE3B 4MK0B 3SFZA 2AH1A 2TRCB 4A0AA 4GM9A 4Y5RD 4A08B 4OZUA 2IWKA 3SMRA 2H68A 1MG3A 3GREA 1GG2B 1N6FA 4JSXC 3IIYA 1B9YA 2HJBA 2OJYA 1JJUB 2GC7A 3J81g 3MZKA 4E5ZA 3NVQA 4CI1A 2H6KA 3PSCB 4A11B 2IWFA 2AQ5A 3EI4A 4JD2C 3ODTA 3GFCA 4PNKB 5EMJB 3JZHA 4X61B 3FGBA 5CXCB 5FKSA 2BBKH 2HKMA 5AJAA 3EU7A 2I0SA 4GQBB 2AGZA 3AL8B 5FA5B 1PI6A 5CXCA 3RFGA 2AGWA 2CE8A 4ZOZA 3EI3A 2UZXB 3RFHA 2PM7B 5GXIA 3AL8A 5TDHB 5TEFA 3RRMC 4K3ID 4CY5A 2B4EA 2XL3A 4XYIA 4L9OA 4LG9A 4PBZA 3UVLA 3I89A 2I3TA 5EALA 2OVPB 4CI8A 4OWRA 5C2WB 3DWLC 3F3GA 3I8CA 3AL9A 5CXBA 2CO0A 5TEEA 4FWWA 5HQGA 4GGAA 3DM0A 4Y7RA 4FA5D 4ZOYA 1MG2A 2I0TA 3RLMD 1GXRA 3SBQA 1U2VC 4GGDA 3K27A 2G99A 4O9DA 4QRJA 3BWSA 5I5MA 3A0FA 4J81A 4JXMA 2XYIA 1OLZA 3RSEC 2OVQB 4JSPC 5I5JA 5EMKB 4D0KA 2GC4A 4J86A 3JZNA 3F3FA 3OW8A 4J84A 2P9LC 2W18A 2I0RA 3ZWLB 4FAVD 4J0WA 4FHLA 2G9AA 2CN2A 2O9KA 2PM6B 4J73A 1N6EA 1OMWB 1SQJA 2HXCA 2YBAA 3OL2B 1K8KC 3EG6A 3DXKC 2H9LA 3OKTA 2H6NA 4QL1A 5FXYA 2AH0A 4J79A 3NVXA 5IJ7E 3JB9L 2CO0C 3I7HA 2P9IC 2AGLA 2IAAA 3C99A 1FWXA 3FRXA 3CFVA 3SHFA 3PSLA 2Z2OA 2MTAH 5JWZA 4QT8A 3SBRA 4G56B 2OK4A 4E5ZB 1VYHC 5EMMB 4X3EA 3EI4B 3PXWD 4JSNC 5IGQA 3EI1A 3JAMg 5AMSA 4JT6C 1YFQA 2Z2NA 5CYKB 1XKSA 4BL0A 5CYKA 4ERQA 1SHYB 5IC7A 3EI3B 4GM3A 4J82A 4H5IA 2J56H 4ZOVA 2IUPA 5IGOA 3I7LA 3SWSD 5HE2B 2GNQA 2PM9A 4ERZA 3CIKB 4ZOXA 4A0BA 4O3UB 1MDAH 5C9ZB 4PBYA 3W15A 5IT9g 2OK6A 3I2NA 2J57G 2H13A 4L3GD 3UR4A 4FA4D 2UZYB 2XU7A 5CXBB 2QXVA 5H17A 2IURA 3N0DA 3UVNA 4XEIC 2XL2A 2I3SA 3SBPA 3I7NA 1JMZB 5C2VB 2P9SC 2YNNA 3UVOA 2P9KC 4JSVC 4TZ4A 4L3HD 1R5MA 4A09A 1JMXB 3K26A 2B5MA 3AFCA 4A7JA 2HYEA 5GSAA 1U4CA 3UKRC 3JZGA 5FKTA 4CY1A 4I79A 1PBYB 3E0CA 2P9NC 4AEZA 5EAMA 5THAA 3PXSD 3L4OD 2B5LA 3I7OA 4CY2A 5A2Qg 3MMYA 3VA6A 2Q7QA 3PE7A 4J87A 4N14A 3ORVD 3UVKA 5FKRA 5FLXg 4E54A 3EI2A 4LG8A 5K1CC 2CE9A 3MZLA 1N6DA 3N0EA 3RN1D 2H9NA 4PSXB 3IIWA 3IJCA 4UI9R 5EM2B 3F3PA 4X60B 3EWEA 1NEXB 4CY3A 4CZXA 3SN6B 4R7AB 5EM2A 5SXMA 1K32A 3SXTD 4GQ2P 4A2MA 4BH6A 3V9FA 2B5NA 3EMHA 3SLED 1RI6A 2H3XA 5GMKn 3EI1B 2YB8B 3B7FA 3MXXA 2Z2PA 4NSXA 1JOFA 4GZ8A 5TF2A 5IJ8E 3OKYB 1B9XA 2OIZA 3UKUC 4HDJA 5EARA 4LGNA 5HYNB 3OKYA 3DXMC 3RN0D 4K3JB 2H47A 3IKOA 4AOWA 3JRPA 4CI3A 1XIPA 3I7PA 4QQEA 1QNIA 3OTTA 2PM9B 4A08A 4A0BB 3JPXA 3IJ0A 3U4YA 3PXTD 2J55H 3BG1A 3NVNA 1P22A 3P4FA 4U7AA 4CC9A 5AFU3 2IUVA 3VH0A 3BG0A 1TBGA 2YNPA 4GM8A 1XHMA 3C75H 4KFMB 2OVRB 2BCJB 4A11A 1PGUA 4CZVA 2HESX 4L1QD 5FKQA 5B4WA 3RMZD 3MKSB 4GQ1A 4PXWA 4J78A 4IA9A 4CI2A 3L4MD 4CZYA 4ESGA 2PBIB 3MKQA 5I5IA 4A09B 1Q47A 3V5WB 4GMBA 4X63B 4FA9D 4EWRA 1TYQC 3IJ1A 5KDOB 2AGYA 4PSWB 4O1QD 2H9PA 5EAPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HE1 B;  3OKW A;  4H5J A;  3PVU B;  4J8G A;  1S4U X;  3SVW D;  4GGC A;  2H14 A;  4J77 A;  3HFQ A;  1GOT B;  3SJL D;  2CNX A;  4E54 B;  4PC0 A;  3PVW B;  3FM0 A;  3EI2 B;  2QC5 A;  4ZN4 A;  3KRW B;  4ERY A;  1SQ9 A;  5FQD A;  4U1E I;  2CN3 A;  2EBS A;  2H9M A;  4J8B A;  3I8E A;  3AH8 B;  4A2L A;  4XYH A;  5H14 A;  4YVD A;  4FAN D;  2YMU A;  2P9U C;  3DSM A;  4J0X A;  3C5M A;  4O3T B;  1L0Q A;  2HJ4 A;  5H1M A;  4FB1 D;  3I7K A;  1ERJ A;  4JT5 C;  1GP2 B;  5GXH A;  3V7D B;  4BUJ C;  3J80 g;  3JRO A;  2AGX A;  3ULE C;  1NR0 A;  2H6Q A;  4ES0 A;  3VGZ A;  2YNO A;  2HKR A;  5HE0 B;  4IMM A;  4O45 A;  3OL2 A;  1A0R B;  3C9C A;  2IUQ A;  4Z8L A;  3UVM A;  5EML B;  4A0A B;  1PEV A;  3KRX B;  3SCY A;  3CFS B;  2P9P C;  5K19 A;  4D6V A;  4FA1 D;  5HE3 B;  4MK0 B;  3SFZ A;  2AH1 A;  2TRC B;  4A0A A;  4GM9 A;  4Y5R D;  4A08 B;  4OZU A;  2IWK A;  3SMR A;  2H68 A;  1MG3 A;  3GRE A;  1GG2 B;  1N6F A;  4JSX C;  3IIY A;  1B9Y A;  2HJB A;  2OJY A;  1JJU B;  2GC7 A;  3J81 g;  3MZK A;  4E5Z A;  3NVQ A;  4CI1 A;  2H6K A;  3PSC B;  4A11 B;  2IWF A;  2AQ5 A;  3EI4 A;  4JD2 C;  3ODT A;  3GFC A;  4PNK B;  5EMJ B;  3JZH A;  4X61 B;  3FGB A;  5CXC B;  5FKS A;  2BBK H;  2HKM A;  5AJA A;  3EU7 A;  2I0S A;  4GQB B;  2AGZ A;  3AL8 B;  5FA5 B;  1PI6 A;  5CXC A;  3RFG A;  2AGW A;  2CE8 A;  4ZOZ A;  3EI3 A;  2UZX B;  3RFH A;  2PM7 B;  5GXI A;  3AL8 A;  5TDH B;  5TEF A;  3RRM C;  4K3I D;  4CY5 A;  2B4E A;  2XL3 A;  4XYI A;  4L9O A;  4LG9 A;  4PBZ A;  3UVL A;  3I89 A;  2I3T A;  5EAL A;  2OVP B;  4CI8 A;  4OWR A;  5C2W B;  3DWL C;  3F3G A;  3I8C A;  3AL9 A;  5CXB A;  2CO0 A;  5TEE A;  4FWW A;  5HQG A;  4GGA A;  3DM0 A;  4Y7R A;  4FA5 D;  4ZOY A;  1MG2 A;  2I0T A;  3RLM D;  1GXR A;  3SBQ A;  1U2V C;  4GGD A;  3K27 A;  2G99 A;  4O9D A;  4QRJ A;  3BWS A;  5I5M A;  3A0F A;  4J81 A;  4JXM A;  2XYI A;  1OLZ A;  3RSE C;  2OVQ B;  4JSP C;  5I5J A;  5EMK B;  4D0K A;  2GC4 A;  4J86 A;  3JZN A;  3F3F A;  3OW8 A;  4J84 A;  2P9L C;  2W18 A;  2I0R A;  3ZWL B;  4FAV D;  4J0W A;  4FHL A;  2G9A A;  2CN2 A;  2O9K A;  2PM6 B;  4J73 A;  1N6E A;  1OMW B;  1SQJ A;  2HXC A;  2YBA A;  3OL2 B;  1K8K C;  3EG6 A;  3DXK C;  2H9L A;  3OKT A;  2H6N A;  4QL1 A;  5FXY A;  2AH0 A;  4J79 A;  3NVX A;  5IJ7 E;  3JB9 L;  2CO0 C;  3I7H A;  2P9I C;  2AGL A;  2IAA A;  3C99 A;  1FWX A;  3FRX A;  3CFV A;  3SHF A;  3PSL A;  2Z2O A;  2MTA H;  5JWZ A;  4QT8 A;  3SBR A;  4G56 B;  2OK4 A;  4E5Z B;  1VYH C;  5EMM B;  4X3E A;  3EI4 B;  3PXW D;  4JSN C;  5IGQ A;  3EI1 A;  3JAM g;  5AMS A;  4JT6 C;  1YFQ A;  2Z2N A;  5CYK B;  1XKS A;  4BL0 A;  5CYK A;  4ERQ A;  1SHY B;  5IC7 A;  3EI3 B;  4GM3 A;  4J82 A;  4H5I A;  2J56 H;  4ZOV A;  2IUP A;  5IGO A;  3I7L A;  3SWS D;  5HE2 B;  2GNQ A;  2PM9 A;  4ERZ A;  3CIK B;  4ZOX A;  4A0B A;  4O3U B;  1MDA H;  5C9Z B;  4PBY A;  3W15 A;  5IT9 g;  2OK6 A;  3I2N A;  2J57 G;  2H13 A;  4L3G D;  3UR4 A;  4FA4 D;  2UZY B;  2XU7 A;  5CXB B;  2QXV A;  5H17 A;  2IUR A;  3N0D A;  3UVN A;  4XEI C;  2XL2 A;  2I3S A;  3SBP A;  3I7N A;  1JMZ B;  5C2V B;  2P9S C;  2YNN A;  3UVO A;  2P9K C;  4JSV C;  4TZ4 A;  4L3H D;  1R5M A;  4A09 A;  1JMX B;  3K26 A;  2B5M A;  3AFC A;  4A7J A;  2HYE A;  5GSA A;  1U4C A;  3UKR C;  3JZG A;  5FKT A;  4CY1 A;  4I79 A;  1PBY B;  3E0C A;  2P9N C;  4AEZ A;  5EAM A;  5THA A;  3PXS D;  3L4O D;  2B5L A;  3I7O A;  4CY2 A;  5A2Q g;  3MMY A;  3VA6 A;  2Q7Q A;  3PE7 A;  4J87 A;  4N14 A;  3ORV D;  3UVK A;  5FKR A;  5FLX g;  4E54 A;  3EI2 A;  4LG8 A;  5K1C C;  2CE9 A;  3MZL A;  1N6D A;  3N0E A;  3RN1 D;  2H9N A;  4PSX B;  3IIW A;  3IJC A;  4UI9 R;  5EM2 B;  3F3P A;  4X60 B;  3EWE A;  1NEX B;  4CY3 A;  4CZX A;  3SN6 B;  4R7A B;  5EM2 A;  5SXM A;  1K32 A;  3SXT D;  4GQ2 P;  4A2M A;  4BH6 A;  3V9F A;  2B5N A;  3EMH A;  3SLE D;  1RI6 A;  2H3X A;  5GMK n;  3EI1 B;  2YB8 B;  3B7F A;  3MXX A;  2Z2P A;  4NSX A;  1JOF A;  4GZ8 A;  5TF2 A;  5IJ8 E;  3OKY B;  1B9X A;  2OIZ A;  3UKU C;  4HDJ A;  5EAR A;  4LGN A;  5HYN B;  3OKY A;  3DXM C;  3RN0 D;  4K3J B;  2H47 A;  3IKO A;  4AOW A;  3JRP A;  4CI3 A;  1XIP A;  3I7P A;  4QQE A;  1QNI A;  3OTT A;  2PM9 B;  4A08 A;  4A0B B;  3JPX A;  3IJ0 A;  3U4Y A;  3PXT D;  2J55 H;  3BG1 A;  3NVN A;  1P22 A;  3P4F A;  4U7A A;  4CC9 A;  5AFU 3;  2IUV A;  3VH0 A;  3BG0 A;  1TBG A;  2YNP A;  4GM8 A;  1XHM A;  3C75 H;  4KFM B;  2OVR B;  2BCJ B;  4A11 A;  1PGU A;  4CZV A;  2HES X;  4L1Q D;  5FKQ A;  5B4W A;  3RMZ D;  3MKS B;  4GQ1 A;  4PXW A;  4J78 A;  4IA9 A;  4CI2 A;  3L4M D;  4CZY A;  4ESG A;  2PBI B;  3MKQ A;  5I5I A;  4A09 B;  1Q47 A;  3V5W B;  4GMB A;  4X63 B;  4FA9 D;  4EWR A;  1TYQ C;  3IJ1 A;  5KDO B;  2AGY A;  4PSW B;  4O1Q D;  2H9P A;  5EAP A; 
#chains in the Genus database with same CATH topology
 5HE1 B;  3OKW A;  4H5J A;  3PVU B;  4J8G A;  1S4U X;  3SVW D;  4GGC A;  2H14 A;  4J77 A;  4BP8 A;  3HFQ A;  1GOT B;  4MMY A;  3SJL D;  2CNX A;  4NBM A;  4E54 B;  4PC0 A;  3PVW B;  3FM0 A;  3EI2 B;  5FFO A;  4WK2 A;  2QC5 A;  4ZN4 A;  3KRW B;  4ERY A;  1SQ9 A;  5M61 A;  3K71 A;  3FCS A;  5FQD A;  4U1E I;  2CN3 A;  2EBS A;  2H9M A;  4J8B A;  3I8E A;  2HU5 A;  3AH8 B;  4A2L A;  4XYH A;  5H14 A;  4YVD A;  4FAN D;  1VE7 A;  2YMU A;  2P9U C;  3DSM A;  4Z7N A;  3IUM A;  3IUQ A;  4J0X A;  3C5M A;  4O3T B;  1L0Q A;  4MMX A;  1O6F A;  2HJ4 A;  5H1M A;  4FB1 D;  3I7K A;  1ERJ A;  5HDB A;  4JT5 C;  1GP2 B;  5GXH A;  3V7D B;  4BUJ C;  3J80 g;  3JRO A;  2AGX A;  3ULE C;  3T3P A;  1NR0 A;  2H6Q A;  4ES0 A;  3VGZ A;  2YNO A;  2HKR A;  5HE0 B;  4IMM A;  4O45 A;  3OL2 A;  5M5U A;  1A0R B;  3C9C A;  2IUQ A;  4Z8L A;  3GC3 B;  2EIE A;  5E6U A;  3UVM A;  5EML B;  4A0A B;  1PEV A;  3KRX B;  3SCY A;  2VDM A;  3CFS B;  2P9P C;  3ZDZ A;  4D6V A;  5K19 A;  4FA1 D;  5HE3 B;  4MK0 B;  3SFZ A;  2AH1 A;  2TRC B;  4A0A A;  4GM9 A;  4Y5R D;  4A08 B;  4OZU A;  2IWK A;  2XDW A;  3SMR A;  3GRE A;  2H68 A;  1MG3 A;  1GG2 B;  1N6F A;  4JSX C;  3IIY A;  1B9Y A;  2HJB A;  2OJY A;  3NIF A;  1JJU B;  2GC7 A;  3K6S A;  3J81 g;  3MZK A;  4E5Z A;  1YR2 A;  3NVQ A;  3VI3 A;  4CI1 A;  2H6K A;  3PSC B;  4A11 B;  2IWF A;  2AQ5 A;  3EI4 A;  4JD2 C;  2EID A;  3ODT A;  3GFC A;  4PNK B;  3NIG A;  3JZH A;  1E8N A;  1GOH A;  4X61 B;  5EMJ B;  2VDO A;  3FGB A;  5CXC B;  5FKS A;  2BBK H;  2HKM A;  5AJA A;  3EU7 A;  2I0S A;  4GQB B;  2AGZ A;  3AL8 B;  3FCU A;  4NAA A;  5FA5 B;  1PI6 A;  5CXC A;  3RFG A;  2AGW A;  2CE8 A;  1JTD B;  4ZOZ A;  3EI3 A;  2UZX B;  3RFH A;  2PM7 B;  4RE6 A;  5GXI A;  3AL8 A;  5TDH B;  5TEF A;  2VDL A;  3RRM C;  4K3I D;  4CY5 A;  2B4E A;  2XL3 A;  4XYI A;  4L9O A;  4LG9 A;  4PBZ A;  3UVL A;  3I89 A;  3DDU A;  4AN1 A;  1VZ2 A;  3IUR A;  2I3T A;  5EAL A;  2OVP B;  4D9S A;  4CI8 A;  4OWR A;  4WK0 A;  5C2W B;  3DWL C;  3F3G A;  3I8C A;  3AL9 A;  5CXB A;  2CO0 A;  5TEE A;  4FWW A;  5HQG A;  4GGA A;  3DM0 A;  4Y7R A;  4FA5 D;  4ZOY A;  1MG2 A;  2I0T A;  1VZ3 A;  3ZE0 A;  3RLM D;  1GXR A;  3SBQ A;  4IRZ A;  4NC4 A;  1U2V C;  3IUN A;  1JV2 A;  4GGD A;  3K27 A;  2G99 A;  5E6S A;  4O9D A;  4QRJ A;  3BWS A;  5I5M A;  3A0F A;  4J81 A;  3IVM A;  4JXM A;  2XYI A;  1OLZ A;  3RSE C;  2OVQ B;  4JSP C;  5I5J A;  5EMK B;  4D0K A;  2GC4 A;  2VDR A;  4J86 A;  3JZN A;  3ZE2 A;  3F3F A;  3OW8 A;  4J84 A;  2P9L C;  2W18 A;  2I0R A;  3O4G A;  3ZWL B;  4JHN A;  4FAV D;  4J0W A;  3EQ9 A;  4FHL A;  2G9A A;  2CN2 A;  2O9K A;  1H2Y A;  2PM6 B;  4J73 A;  1N6E A;  1OMW B;  1SQJ A;  2HXC A;  2VDP A;  2YBA A;  3OL2 B;  1K8K C;  2VC2 A;  3EG6 A;  3DXK C;  2EIC A;  2H9L A;  3OKT A;  3IUL A;  4AMZ A;  2H6N A;  4QL1 A;  1VE6 A;  5FXY A;  1K3I A;  2AH0 A;  3O4J A;  4J79 A;  3NVX A;  2HU7 A;  1GOG A;  4BCB A;  2JKX A;  5IJ7 E;  3JB9 L;  2CO0 C;  4UM8 A;  4MMZ A;  3I7H A;  2P9I C;  2AGL A;  2IAA A;  3C99 A;  1FWX A;  3FRX A;  3CFV A;  3MUO A;  4QAM A;  3PSL A;  3SHF A;  2Z2O A;  2MTA H;  4DNW A;  5JWZ A;  4QT8 A;  3SBR A;  4G56 B;  2OK4 A;  4E5Z B;  1H2X A;  1VYH C;  5EMM B;  4RE5 A;  3V4P A;  4X3E A;  3EI4 B;  3EQ8 A;  3PXW D;  4JSN C;  5IGQ A;  3EI1 A;  3JAM g;  1L5G A;  2XE4 A;  5AMS A;  4JT6 C;  1YFQ A;  2Z2N A;  5CYK B;  2QZP A;  1XKS A;  4BL0 A;  5CYK A;  4ERQ A;  1SHY B;  5IC7 A;  2VDK A;  3EI3 B;  4GM3 A;  4J82 A;  4H5I A;  2J56 H;  4ZOV A;  2IUP A;  5IGO A;  3GD1 I;  3I7L A;  3SWS D;  5HE2 B;  2GNQ A;  2PM9 A;  4ERZ A;  3CIK B;  4ZOX A;  4A0B A;  4AN0 A;  4DNV A;  1UOP A;  1MDA H;  4O3U B;  5C9Z B;  4PBY A;  3W15 A;  5IT9 g;  2OK6 A;  3IJE A;  3I2N A;  2J57 G;  2H13 A;  4L3G D;  3UR4 A;  4FA4 D;  3QHY B;  2UZY B;  2VDN A;  2XU7 A;  5CXB B;  2QXV A;  5H17 A;  2IUR A;  5M5T A;  3N0D A;  3UVN A;  4XEI C;  2XL2 A;  2I3S A;  3SBP A;  3I7N A;  1JMZ B;  5C2V B;  2P9S C;  2YNN A;  3UVO A;  2P9K C;  4G1M A;  4JSV C;  4TZ4 A;  4L3H D;  1QFS A;  1R5M A;  2BKL A;  4A09 A;  4G1E A;  1JMX B;  3K26 A;  2B5M A;  3AFC A;  4A7J A;  2HYE A;  1U8C A;  5GSA A;  1U4C A;  3O4H A;  3UKR C;  3JZG A;  5C92 A;  5FKT A;  4CY1 A;  4I79 A;  1PBY B;  3E0C A;  2HU8 A;  1E5T A;  4Z7Q A;  2P9N C;  4AEZ A;  5EAM A;  5THA A;  3PXS D;  2EIB A;  3L4O D;  2B5L A;  3I7O A;  4CY2 A;  5M5R A;  5A2Q g;  3MMY A;  3VA6 A;  2Q7Q A;  1H2Z A;  4L1M A;  1E8M A;  4NEN A;  3PE7 A;  5FFG A;  1A12 A;  4J87 A;  4N14 A;  1C9L A;  3ORV D;  3UVK A;  5M5V A;  5FKR A;  5FLX g;  3EQ7 A;  4E54 A;  3EI2 A;  1TYE A;  4LG8 A;  4WJK A;  5K1C C;  1H2W A;  2CE9 A;  3MZL A;  1N6D A;  4AX4 A;  3N0E A;  3RN1 D;  2H9N A;  4PSX B;  3IIW A;  1UOQ A;  3IJC A;  3MVD K;  1BPO A;  4UI9 R;  5EM2 B;  3V4V A;  3F3P A;  4X60 B;  3EWE A;  1NEX B;  2WQ8 A;  2QR5 A;  4CY3 A;  4CZX A;  3SN6 B;  4R7A B;  5EM2 A;  5SXM A;  4JHP C;  1K32 A;  4UM9 A;  3SXT D;  4GQ2 P;  4A2M A;  4BH6 A;  3ZDY A;  3V9F A;  1C9I A;  2B5N A;  3EMH A;  5C86 A;  1T2X A;  4BCC A;  4G55 A;  3SLE D;  1O6G A;  1RI6 A;  4Z7O A;  2H3X A;  5GMK n;  3EI1 B;  2YB8 B;  3B7F A;  3MXX A;  2Z2P A;  4NSX A;  1JOF A;  2VZ1 A;  4GZ8 A;  3K72 A;  5TF2 A;  5IJ8 E;  3OKY B;  4O02 A;  1B9X A;  5E6R A;  2OIZ A;  1QFM A;  3T3M A;  3UKU C;  4HDJ A;  5EAR A;  4LGN A;  5HYN B;  3OKY A;  1GOF A;  3QI0 A;  3DXM C;  3RN0 D;  4K3J B;  2H47 A;  3IKO A;  3O4I A;  4AOW A;  3JRP A;  4CI3 A;  1XIP A;  3I7P A;  4QQE A;  1QNI A;  3OTT A;  4WK4 A;  2PM9 B;  4A08 A;  4A0B B;  3JPX A;  2XZG A;  3IJ0 A;  3U4Y A;  3PXT D;  2J55 H;  3BG1 A;  3NVN A;  4AMY A;  3NID A;  1P22 A;  2VDQ A;  3VI4 A;  3MUN A;  3KCI A;  3P4F A;  4U7A A;  2VZ3 A;  4CC9 A;  1I2M B;  5AFU 3;  2IUV A;  3VH0 A;  3BG0 A;  1TBG A;  2YNP A;  4GM8 A;  1XHM A;  3C75 H;  4KFM B;  2OVR B;  2BCJ B;  4A11 A;  1PGU A;  4CZV A;  4DNU A;  2HES X;  4L1Q D;  5FKQ A;  5B4W A;  4BCD A;  3RMZ D;  3MKS B;  1UOO A;  4GQ1 A;  3ZE1 A;  4PXW A;  4J78 A;  3OF7 A;  3ZDX A;  4IA9 A;  4CI2 A;  3L4M D;  4CZY A;  1M1X A;  5M5S A;  4O2W A;  4ESG A;  2PBI B;  3MKQ A;  5I5I A;  4A09 B;  1Q47 A;  3V5W B;  4GMB A;  4X63 B;  4FA9 D;  4EWR A;  1TYQ C;  3IUJ A;  3IJ1 A;  5KDO B;  2AGY A;  4PSW B;  1UTC A;  4O1Q D;  4BP9 A;  2H9P A;  5EAP A; 
#chains in the Genus database with same CATH homology
 5HE1 B;  3OKW A;  4H5J A;  3PVU B;  4J8G A;  1S4U X;  3SVW D;  4GGC A;  2H14 A;  4J77 A;  3HFQ A;  1GOT B;  3SJL D;  2CNX A;  4E54 B;  4PC0 A;  3PVW B;  3FM0 A;  3EI2 B;  2QC5 A;  4ZN4 A;  3KRW B;  4ERY A;  1SQ9 A;  5FQD A;  4U1E I;  2CN3 A;  2EBS A;  2H9M A;  4J8B A;  3I8E A;  3AH8 B;  4A2L A;  4XYH A;  5H14 A;  4YVD A;  4FAN D;  2YMU A;  2P9U C;  3DSM A;  4J0X A;  3C5M A;  4O3T B;  1L0Q A;  2HJ4 A;  5H1M A;  4FB1 D;  3I7K A;  1ERJ A;  4JT5 C;  1GP2 B;  5GXH A;  3V7D B;  4BUJ C;  3J80 g;  3JRO A;  2AGX A;  3ULE C;  1NR0 A;  2H6Q A;  4ES0 A;  3VGZ A;  2YNO A;  2HKR A;  5HE0 B;  4IMM A;  4O45 A;  3OL2 A;  1A0R B;  3C9C A;  2IUQ A;  4Z8L A;  3UVM A;  5EML B;  4A0A B;  1PEV A;  3KRX B;  3SCY A;  3CFS B;  2P9P C;  5K19 A;  4D6V A;  4FA1 D;  5HE3 B;  4MK0 B;  3SFZ A;  2AH1 A;  2TRC B;  4A0A A;  4GM9 A;  4Y5R D;  4A08 B;  4OZU A;  2IWK A;  3SMR A;  2H68 A;  1MG3 A;  3GRE A;  1GG2 B;  1N6F A;  4JSX C;  3IIY A;  1B9Y A;  2HJB A;  2OJY A;  1JJU B;  2GC7 A;  3J81 g;  3MZK A;  4E5Z A;  3NVQ A;  4CI1 A;  2H6K A;  3PSC B;  4A11 B;  2IWF A;  2AQ5 A;  3EI4 A;  4JD2 C;  3ODT A;  3GFC A;  4PNK B;  5EMJ B;  3JZH A;  4X61 B;  3FGB A;  5CXC B;  5FKS A;  2BBK H;  2HKM A;  5AJA A;  3EU7 A;  2I0S A;  4GQB B;  2AGZ A;  3AL8 B;  5FA5 B;  1PI6 A;  5CXC A;  3RFG A;  2AGW A;  2CE8 A;  4ZOZ A;  3EI3 A;  2UZX B;  3RFH A;  2PM7 B;  5GXI A;  3AL8 A;  5TDH B;  5TEF A;  3RRM C;  4K3I D;  4CY5 A;  2B4E A;  2XL3 A;  4XYI A;  4L9O A;  4LG9 A;  4PBZ A;  3UVL A;  3I89 A;  2I3T A;  5EAL A;  2OVP B;  4CI8 A;  4OWR A;  5C2W B;  3DWL C;  3F3G A;  3I8C A;  3AL9 A;  5CXB A;  2CO0 A;  5TEE A;  4FWW A;  5HQG A;  4GGA A;  3DM0 A;  4Y7R A;  4FA5 D;  4ZOY A;  1MG2 A;  2I0T A;  3RLM D;  1GXR A;  3SBQ A;  1U2V C;  4GGD A;  3K27 A;  2G99 A;  4O9D A;  4QRJ A;  3BWS A;  5I5M A;  3A0F A;  4J81 A;  4JXM A;  2XYI A;  1OLZ A;  3RSE C;  2OVQ B;  4JSP C;  5I5J A;  5EMK B;  4D0K A;  2GC4 A;  4J86 A;  3JZN A;  3F3F A;  3OW8 A;  4J84 A;  2P9L C;  2W18 A;  2I0R A;  3ZWL B;  4FAV D;  4J0W A;  4FHL A;  2G9A A;  2CN2 A;  2O9K A;  2PM6 B;  4J73 A;  1N6E A;  1OMW B;  1SQJ A;  2HXC A;  2YBA A;  3OL2 B;  1K8K C;  3EG6 A;  3DXK C;  2H9L A;  3OKT A;  2H6N A;  4QL1 A;  5FXY A;  2AH0 A;  4J79 A;  3NVX A;  5IJ7 E;  3JB9 L;  2CO0 C;  3I7H A;  2P9I C;  2AGL A;  2IAA A;  3C99 A;  1FWX A;  3FRX A;  3CFV A;  3SHF A;  3PSL A;  2Z2O A;  2MTA H;  5JWZ A;  4QT8 A;  3SBR A;  4G56 B;  2OK4 A;  4E5Z B;  1VYH C;  5EMM B;  4X3E A;  3EI4 B;  3PXW D;  4JSN C;  5IGQ A;  3EI1 A;  3JAM g;  5AMS A;  4JT6 C;  1YFQ A;  2Z2N A;  5CYK B;  1XKS A;  4BL0 A;  5CYK A;  4ERQ A;  1SHY B;  5IC7 A;  3EI3 B;  4GM3 A;  4J82 A;  4H5I A;  2J56 H;  4ZOV A;  2IUP A;  5IGO A;  3I7L A;  3SWS D;  5HE2 B;  2GNQ A;  2PM9 A;  4ERZ A;  3CIK B;  4ZOX A;  4A0B A;  4O3U B;  1MDA H;  5C9Z B;  4PBY A;  3W15 A;  5IT9 g;  2OK6 A;  3I2N A;  2J57 G;  2H13 A;  4L3G D;  3UR4 A;  4FA4 D;  2UZY B;  2XU7 A;  5CXB B;  2QXV A;  5H17 A;  2IUR A;  3N0D A;  3UVN A;  4XEI C;  2XL2 A;  2I3S A;  3SBP A;  3I7N A;  1JMZ B;  5C2V B;  2P9S C;  2YNN A;  3UVO A;  2P9K C;  4JSV C;  4TZ4 A;  4L3H D;  1R5M A;  4A09 A;  1JMX B;  3K26 A;  2B5M A;  3AFC A;  4A7J A;  2HYE A;  5GSA A;  1U4C A;  3UKR C;  3JZG A;  5FKT A;  4CY1 A;  4I79 A;  1PBY B;  3E0C A;  2P9N C;  4AEZ A;  5EAM A;  5THA A;  3PXS D;  3L4O D;  2B5L A;  3I7O A;  4CY2 A;  5A2Q g;  3MMY A;  3VA6 A;  2Q7Q A;  3PE7 A;  4J87 A;  4N14 A;  3ORV D;  3UVK A;  5FKR A;  5FLX g;  4E54 A;  3EI2 A;  4LG8 A;  5K1C C;  2CE9 A;  3MZL A;  1N6D A;  3N0E A;  3RN1 D;  2H9N A;  4PSX B;  3IIW A;  3IJC A;  4UI9 R;  5EM2 B;  3F3P A;  4X60 B;  3EWE A;  1NEX B;  4CY3 A;  4CZX A;  3SN6 B;  4R7A B;  5EM2 A;  5SXM A;  1K32 A;  3SXT D;  4GQ2 P;  4A2M A;  4BH6 A;  3V9F A;  2B5N A;  3EMH A;  3SLE D;  1RI6 A;  2H3X A;  5GMK n;  3EI1 B;  2YB8 B;  3B7F A;  3MXX A;  2Z2P A;  4NSX A;  1JOF A;  4GZ8 A;  5TF2 A;  5IJ8 E;  3OKY B;  1B9X A;  2OIZ A;  3UKU C;  4HDJ A;  5EAR A;  4LGN A;  5HYN B;  3OKY A;  3DXM C;  3RN0 D;  4K3J B;  2H47 A;  3IKO A;  4AOW A;  3JRP A;  4CI3 A;  1XIP A;  3I7P A;  4QQE A;  1QNI A;  3OTT A;  2PM9 B;  4A08 A;  4A0B B;  3JPX A;  3IJ0 A;  3U4Y A;  3PXT D;  2J55 H;  3BG1 A;  3NVN A;  1P22 A;  3P4F A;  4U7A A;  4CC9 A;  5AFU 3;  2IUV A;  3VH0 A;  3BG0 A;  1TBG A;  2YNP A;  4GM8 A;  1XHM A;  3C75 H;  4KFM B;  2OVR B;  2BCJ B;  4A11 A;  1PGU A;  4CZV A;  2HES X;  4L1Q D;  5FKQ A;  5B4W A;  3RMZ D;  3MKS B;  4GQ1 A;  4PXW A;  4J78 A;  4IA9 A;  4CI2 A;  3L4M D;  4CZY A;  4ESG A;  2PBI B;  3MKQ A;  5I5I A;  4A09 B;  1Q47 A;  3V5W B;  4GMB A;  4X63 B;  4FA9 D;  4EWR A;  1TYQ C;  3IJ1 A;  5KDO B;  2AGY A;  4PSW B;  4O1Q D;  2H9P A;  5EAP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...