4CY3A

Crystal structure of the nsl1-wds complex.
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
303
structure length
303
Chain Sequence
b'KPNYTLKFTLAGHTKAVSAVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVRTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQSKEVVQKLQGHTDTVLCTACHPTENIIASAALENDKTIKLWKSDT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN WILL DIE SLOWLY
molecule tags Transcription
source organism Drosophila melanogaster
publication title Structural Analysis of the Kansl1/Wdr5/Kansl2 Complex Reveals that Wdr5 is Required for Efficient Assembly and Chromatin Targeting of the Nsl Complex.
pubmed doi rcsb
total genus 101
structure length 303
sequence length 303
ec nomenclature
pdb deposition date 2014-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4cy3A00
3IIYA 1VYHC 3GFCA 5CXBB 3SBPA 4JT6C 4FA4D 4JSXC 3MKSB 3MMYA 5C9ZB 1XKSA 2IWFA 3ORVD 3JB9L 4J84A 2B5LA 1L0QA 2CE8A 3ZWLB 4I79A 3EU7A 4ES0A 3PE7A 4J73A 5TEFA 2BCJB 1NR0A 5C2WB 2AQ5A 4CC9A 3W15A 5IJ8E 3C5MA 3JAMg 4D6VA 4A08B 3J81g 2OIZA 4FWWA 1FWXA 4GGCA 4K3ID 4BUJC 3I7KA 3SBRA 4H5IA 3PSCB 2H13A 1GOTB 4FA1D 2H9PA 3CFVA 2CN2A 4KFMB 3HFQA 5GMKn 4AOWA 2G99A 4D0KA 2HYEA 2IUPA 5HYNB 2GC4A 1N6FA 4QT8A 2UZYB 5IJ7E 2AGLA 3EG6A 4ZN4A 3MZLA 2OK6A 2P9UC 3DSMA 3SBQA 3SLED 4PC0A 5IGOA 3C99A 5FA5B 5GXIA 1XIPA 4GZ8A 4CY5A 3SVWD 4J79A 5CXCB 2XYIA 4GM8A 3DXKC 4GGDA 1B9XA 1JJUB 3I7PA 3E0CA 3I2NA 4FB1D 5I5JA 4Y7RA 3OKTA 2J57G 4XYHA 5FLXg 5EMMB 5IC7A 2PM6B 2BBKH 3RN0D 4X3EA 4E54B 4JSNC 2HJBA 3RFGA 4YVDA 2I0RA 2IWKA 4J82A 4OZUA 5H1MA 3RLMD 1QNIA 3UVOA 5THAA 2H6NA 3L4OD 3GREA 3NVQA 2B5NA 3JPXA 1MG2A 4L3GD 3PXSD 4PBZA 1K8KC 3PXWD 2P9IC 3AL8A 1PGUA 3EI4A 3EMHA 3OTTA 4X61B 3K26A 4AEZA 3JZHA 3F3PA 1NEXB 3EWEA 3F3GA 5AFU3 3L4MD 3C75H 5K1CC 1K32A 2CNXA 2HJ4A 2H3XA 2OVPB 3UKRC 1GXRA 4CZXA 4J0XA 4E54A 5HE0B 2H6KA 2IURA 2OVRB 4GQBB 3FGBA 3UVLA 3SCYA 3SN6B 4CI3A 4H5JA 3ODTA 3BG0A 5EMJB 4GM9A 5CYKB 3FM0A 2P9KC 4O45A 5HQGA 5CYKA 4ZOYA 4O1QD 4A09B 2OK4A 4CI1A 4J87A 5GSAA 2J55H 2AGWA 3EI3A 4A0BB 2XL3A 4J86A 2XU7A 4QRJA 2HXCA 3N0DA 4K3JB 1SHYB 1PBYB 3F3FA 3B7FA 3I8EA 4PSWB 3VH0A 4ZOVA 3EI1B 5GXHA 4IMMA 2W18A 4JXMA 3BG1A 4LG8A 2TRCB 3IJCA 5AMSA 2OVQB 2P9SC 1RI6A 1GG2B 2O9KA 3RRMC 4GGAA 2XL2A 2YB8B 4FAVD 3FRXA 4GMBA 1TBGA 1Q47A 2I3TA 2Z2OA 3I8CA 5JWZA 3PXTD 2H9LA 2I3SA 4GQ1A 5TDHB 2H47A 3IJ1A 3RN1D 1JMXB 3EI1A 1OLZA 2G9AA 2H9MA 1U4CA 2YBAA 3DXMC 3BWSA 2B4EA 5HE2B 3JROA 3V7DB 4O3TB 3SFZA 2IAAA 3CIKB 3NVXA 2UZXB 3PVWB 1YFQA 5EAPA 4CI8A 3KRXB 5HE1B 2IUVA 2CO0A 4U1EI 5EMLB 4TZ4A 2H68A 5EM2A 2P9NC 1JOFA 1S4UX 2MTAH 3RMZD 3SXTD 3P4FA 2EBSA 4HDJA 4EWRA 4ERYA 5AJAA 2IUQA 4JSVC 4N14A 4JSPC 3OKYB 4E5ZA 2PM7B 2AGYA 2P9PC 1N6DA 5EAMA 4J0WA 4LG9A 4QL1A 2P9LC 4J8BA 5EARA 5IGQA 3OKWA 4A2MA 3DWLC 3KRWB 3SWSD 3K27A 3V5WB 4GQ2P 4XYIA 2PM9A 5SXMA 3J80g 1P22A 3MKQA 5CXCA 2PM9B 4PXWA 5EALA 1A0RB 2YNOA 5FKRA 5I5MA 3I7NA 3JZGA 4G56B 3SJLD 4E5ZB 4U7AA 4FA9D 4GM3A 2AGZA 5KDOB 2J56H 3OKYA 4CZVA 3DM0A 4A11B 3MZKA 4PNKB 1JMZB 3SHFA 4J81A 4BH6A 5TEEA 2AH0A 2Z2NA 4ZOXA 1OMWB 3IKOA 5FXYA 4X60B 1SQ9A 3PSLA 3JRPA 1SQJA 2H14A 2H9NA 4LGNA 4FHLA 1PI6A 5EMKB 1U2VC 3CFSB 4JD2C 3AL8B 3I7LA 3AFCA 3I7HA 2B5MA 3UVKA 2YNPA 4O9DA 3RSEC 5IT9g 2Q7QA 4A7JA 3IIWA 3PVUB 4CI2A 3UKUC 3MXXA 2HESX 5HE3B 4O3UB 5FKQA 3EI3B 4L9OA 2OJYA 4Y5RD 2I0TA 3EI2A 2GC7A 4A0BA 3VGZA 3I7OA 5A2Qg 4FA5D 4X63B 5CXBA 3VA6A 1ERJA 4Z8LA 4A0AA 5K19A 5FKSA 1GP2B 2CO0C 3OL2B 4J8GA 3ULEC 3NVNA 4JT5C 3AH8B 1PEVA 4ERZA 4J78A 2CN3A 3OW8A 2Z2PA 5H14A 4CY1A 2AGXA 4ERQA 2GNQA 3UVMA 3V9FA 2YMUA 2HKRA 4UI9R 1MG3A 3UVNA 4ZOZA 3EI4B 2CE9A 2QC5A 5B4WA 3C9CA 4MK0B 4CY2A 1R5MA 4ESGA 2YNNA 4OWRA 4PSXB 2HKMA 2PBIB 4XEIC 4NSXA 3UR4A 1B9YA 3I89A 3N0EA 4A11A 4PBYA 1MDAH 4CZYA 1N6EA 4A0AB 4FAND 2I0SA 3OL2A 4IA9A 4L3HD 4QQEA 1TYQC 3IJ0A 4CY3A 1XHMA 2AH1A 4A08A 3AL9A 5EM2B 3U4YA 4A09A 5TF2A 5FKTA 4J77A 4A2LA 3A0FA 4R7AB 3SMRA 2QXVA 3RFHA 4L1QD 5I5IA 5C2VB 5FQDA 5H17A 2H6QA 3EI2B 3JZNA 4BL0A
chains in the Genus database with same CATH superfamily
4IRZA 5FFOA 3IIYA 3MVDK 3K6SA 2WQ8A 1VYHC 3GFCA 5CXBB 3SBPA 4JT6C 4FA4D 4JSXC 3MKSB 3MMYA 5C9ZB 1XKSA 2XZGA 2IWFA 3ORVD 1QFMA 3JB9L 4J84A 2B5LA 1L0QA 2CE8A 3ZWLB 4I79A 3EU7A 4ES0A 3PE7A 4J73A 5TEFA 2BCJB 1NR0A 5C2WB 1TYEA 4AMZA 3KCIA 3QHYB 2AQ5A 4UM8A 4CC9A 3W15A 3NIGA 4UM9A 3C5MA 5IJ8E 3JAMg 4D6VA 4A08B 3J81g 2OIZA 3EQ7A 4FWWA 1FWXA 4GGCA 4K3ID 4BUJC 3I7KA 3SBRA 1VZ2A 3NIFA 4H5IA 4RE6A 3PSCB 2VDPA 2H13A 1GOTB 2VDKA 1E8NA 4FA1D 2H9PA 3CFVA 3IUNA 2CN2A 4KFMB 3HFQA 3MUOA 5GMKn 4AOWA 1U8CA 2G99A 3EQ9A 4D0KA 2IUPA 2HYEA 5HYNB 2GC4A 1N6FA 4QT8A 2UZYB 5IJ7E 2AGLA 3EG6A 4ZN4A 3IULA 3MZLA 2OK6A 2P9UC 4BP9A 3DSMA 3SBQA 3SLED 4PC0A 5IGOA 3C99A 4AN0A 5FA5B 5GXIA 1XIPA 4GZ8A 4CY5A 3SVWD 5HDBA 4J79A 5CXCB 2XYIA 3IUJA 4GM8A 3DXKC 4GGDA 1B9XA 1JJUB 3I7PA 3E0CA 3I2NA 4FB1D 5I5JA 4Y7RA 3OKTA 5M5VA 2J57G 4XYHA 5FLXg 5EMMB 4DNUA 5IC7A 2PM6B 2BBKH 5M61A 4BP8A 3RN0D 4X3EA 4E54B 4JSNC 2HJBA 4G1MA 3RFGA 1VE6A 4YVDA 2I0RA 2IWKA 4J82A 4OZUA 5H1MA 3RLMD 1QNIA 3IVMA 3UVOA 5THAA 2H6NA 3L4OD 3GREA 3NVQA 2B5NA 3JPXA 1MG2A 4L3GD 3PXSD 4PBZA 3ZE2A 1K8KC 3PXWD 4MMYA 2P9IC 1JV2A 3AL8A 1PGUA 4DNWA 3EI4A 3EMHA 3OTTA 4X61B 3K26A 1T2XA 4AEZA 3JZHA 3F3PA 1NEXB 3QI0A 3EWEA 3F3GA 5AFU3 3L4MD 3C75H 3K72A 5K1CC 1K32A 2CNXA 2HJ4A 2H3XA 3ZE1A 2EIDA 2OVPB 3UKRC 1GXRA 4CZXA 4J0XA 4E54A 5HE0B 2H6KA 2IURA 5M5RA 2OVRB 4GQBB 1VZ3A 3O4GA 4AMYA 3FGBA 3UVLA 1H2ZA 2VDMA 3SCYA 4WJKA 3SN6B 4AX4A 4H5JA 4CI3A 3ODTA 3BG0A 5EMJB 4GM9A 5CYKB 3FM0A 2P9KC 4O45A 5HQGA 5CYKA 4ZOYA 4O1QD 4A09B 5C92A 2OK4A 3ZDYA 4CI1A 4J87A 5GSAA 2J55H 2AGWA 3EI3A 4A0BB 2XL3A 4J86A 2XU7A 4WK2A 4QRJA 4WK0A 2HXCA 3N0DA 4K3JB 3ZDXA 1SHYB 1PBYB 3F3FA 3B7FA 3I8EA 3IUQA 4PSWB 4ZOVA 3VH0A 3EI1B 5GXHA 5E6SA 4IMMA 1GOFA 2W18A 1UOOA 3V4PA 4JXMA 3BG1A 4LG8A 2TRCB 3IJEA 3IJCA 5AMSA 2OVQB 2VDQA 1UTCA 2P9SC 1RI6A 1GG2B 2O9KA 5E6RA 3ZE0A 3RRMC 3IUMA 4GGAA 2XL2A 2YB8B 4FAVD 3FRXA 4O02A 3VI3A 4GMBA 1TBGA 1Q47A 2I3TA 2Z2OA 2HU5A 3I8CA 5JWZA 3PXTD 2H9LA 2I3SA 2VDOA 4D9SA 4GQ1A 1K3IA 4DNVA 5TDHB 2H47A 2VDRA 2QZPA 2HU8A 3IJ1A 3RN1D 1JMXB 3EI1A 1E8MA 1OLZA 2G9AA 3NIDA 2H9MA 1U4CA 2YBAA 3DXMC 3BWSA 2B4EA 1VE7A 5HE2B 3JROA 3V7DB 4O3TB 3SFZA 4Z7QA 2IAAA 3CIKB 2QR5A 3NVXA 2UZXB 1JTDB 3PVWB 1YFQA 5EAPA 4CI8A 4BCDA 3KRXB 5HE1B 2IUVA 2CO0A 4U1EI 5EMLB 1O6GA 4TZ4A 2H68A 4JHPC 4NBMA 5EM2A 4Z7NA 2P9NC 1JOFA 1S4UX 5E6UA 3MUNA 2MTAH 3FCSA 3RMZD 3SXTD 3P4FA 2BKLA 2VDLA 2EBSA 3O4JA 4HDJA 4NENA 4EWRA 4ERYA 3V4VA 3O4IA 5AJAA 2EICA 2IUQA 4JSVC 4N14A 4JSPC 3OKYB 4E5ZA 2PM7B 2AGYA 2P9PC 1N6DA 4Z7OA 5EAMA 3O4HA 4J0WA 4LG9A 3ZDZA 4RE5A 4QL1A 2P9LC 3EQ8A 4J8BA 5EARA 4NAAA 5IGQA 3OKWA 4A2MA 3DWLC 3KRWB 3SWSD 3K27A 3V5WB 4GQ2P 4XYIA 1UOQA 2PM9A 5SXMA 3T3PA 5M5UA 1P22A 3MKQA 4G55A 3J80g 4O2WA 5CXCA 1YR2A 2PM9B 4PXWA 5EALA 1A0RB 2YNOA 5FKRA 5I5MA 3I7NA 3JZGA 4G56B 3SJLD 4E5ZB 4QAMA 4U7AA 4FA9D 4GM3A 2AGZA 3FCUA 5KDOB 2J56H 3OKYA 4G1EA 4CZVA 3DM0A 4A11B 3MZKA 4PNKB 1JMZB 1L5GA 5C86A 3SHFA 4J81A 4BH6A 5TEEA 2EIEA 2AH0A 2Z2NA 4ZOXA 1OMWB 3IKOA 5FXYA 4X60B 1C9IA 1SQ9A 1H2WA 3PSLA 3JRPA 1SQJA 2H14A 2H9NA 4JHNA 4LGNA 4FHLA 1PI6A 5EMKB 1U2VC 1I2MB 3CFSB 4JD2C 2EIBA 3AL8B 2HU7A 3I7LA 3I7HA 1BPOA 2B5MA 3AFCA 3UVKA 2YNPA 5M5SA 3GC3B 4O9DA 3RSEC 5IT9g 2Q7QA 4A7JA 3OF7A 3IIWA 1UOPA 1E5TA 3PVUB 4CI2A 3UKUC 3MXXA 3GD1I 2HESX 5HE3B 4O3UB 5FKQA 3EI3B 4L9OA 2OJYA 4Y5RD 2I0TA 3EI2A 2GC7A 4A0BA 3VGZA 1H2XA 2VZ3A 3I7OA 3DDUA 4WK4A 5A2Qg 4FA5D 4X63B 5CXBA 3VA6A 1ERJA 4Z8LA 4AN1A 1H2YA 4A0AA 5K19A 5FKSA 1GP2B 1A12A 2CO0C 3OL2B 3VI4A 4J8GA 3ULEC 3NVNA 4JT5C 3AH8B 1PEVA 4ERZA 2VZ1A 4J78A 2CN3A 3OW8A 2Z2PA 1M1XA 5H14A 2AGXA 4CY1A 4ERQA 3K71A 2XDWA 4MMZA 4MMXA 2GNQA 2VC2A 3UVMA 3V9FA 1QFSA 2YMUA 5M5TA 2HKRA 4UI9R 1MG3A 3UVNA 1O6FA 4ZOZA 3EI4B 2CE9A 2QC5A 4NC4A 5B4WA 3C9CA 4MK0B 4CY2A 1R5MA 4ESGA 2JKXA 3T3MA 2YNNA 4OWRA 4PSXB 2HKMA 1GOGA 2PBIB 4XEIC 4NSXA 3UR4A 1B9YA 3I89A 3N0EA 4A11A 4PBYA 1MDAH 5FFGA 4CZYA 1N6EA 4A0AB 4FAND 2I0SA 3OL2A 4IA9A 1C9LA 1GOHA 4BCBA 4L3HD 4QQEA 4L1MA 4BCCA 1TYQC 3IJ0A 4CY3A 1XHMA 2AH1A 4A08A 3AL9A 5EM2B 3U4YA 4A09A 5TF2A 5FKTA 4J77A 4A2LA 3A0FA 4R7AB 3SMRA 2QXVA 3IURA 3RFHA 2XE4A 4L1QD 5I5IA 5C2VB 5FQDA 5H17A 2H6QA 2VDNA 3EI2B 3JZNA 4BL0A
chains in the Genus database with same CATH topology
3IIYA 1VYHC 3GFCA 5CXBB 3SBPA 4JT6C 4FA4D 4JSXC 3MKSB 3MMYA 5C9ZB 1XKSA 2IWFA 3ORVD 3JB9L 4J84A 2B5LA 1L0QA 2CE8A 3ZWLB 4I79A 3EU7A 4ES0A 3PE7A 4J73A 5TEFA 2BCJB 1NR0A 5C2WB 2AQ5A 4CC9A 3W15A 5IJ8E 3C5MA 3JAMg 4D6VA 4A08B 3J81g 2OIZA 4FWWA 1FWXA 4GGCA 4K3ID 4BUJC 3I7KA 3SBRA 4H5IA 3PSCB 2H13A 1GOTB 4FA1D 2H9PA 3CFVA 2CN2A 4KFMB 3HFQA 5GMKn 4AOWA 2G99A 4D0KA 2HYEA 2IUPA 5HYNB 2GC4A 1N6FA 4QT8A 2UZYB 5IJ7E 2AGLA 3EG6A 4ZN4A 3MZLA 2OK6A 2P9UC 3DSMA 3SBQA 3SLED 4PC0A 5IGOA 3C99A 5FA5B 5GXIA 1XIPA 4GZ8A 4CY5A 3SVWD 4J79A 5CXCB 2XYIA 4GM8A 3DXKC 4GGDA 1B9XA 1JJUB 3I7PA 3E0CA 3I2NA 4FB1D 5I5JA 4Y7RA 3OKTA 2J57G 4XYHA 5FLXg 5EMMB 5IC7A 2PM6B 2BBKH 3RN0D 4X3EA 4E54B 4JSNC 2HJBA 3RFGA 4YVDA 2I0RA 2IWKA 4J82A 4OZUA 5H1MA 3RLMD 1QNIA 3UVOA 5THAA 2H6NA 3L4OD 3GREA 3NVQA 2B5NA 3JPXA 1MG2A 4L3GD 3PXSD 4PBZA 1K8KC 3PXWD 2P9IC 3AL8A 1PGUA 3EI4A 3EMHA 3OTTA 4X61B 3K26A 4AEZA 3JZHA 3F3PA 1NEXB 3EWEA 3F3GA 5AFU3 3L4MD 3C75H 5K1CC 1K32A 2CNXA 2HJ4A 2H3XA 2OVPB 3UKRC 1GXRA 4CZXA 4J0XA 4E54A 5HE0B 2H6KA 2IURA 2OVRB 4GQBB 3FGBA 3UVLA 3SCYA 3SN6B 4CI3A 4H5JA 3ODTA 3BG0A 5EMJB 4GM9A 5CYKB 3FM0A 2P9KC 4O45A 5HQGA 5CYKA 4ZOYA 4O1QD 4A09B 2OK4A 4CI1A 4J87A 5GSAA 2J55H 2AGWA 3EI3A 4A0BB 2XL3A 4J86A 2XU7A 4QRJA 2HXCA 3N0DA 4K3JB 1SHYB 1PBYB 3F3FA 3B7FA 3I8EA 4PSWB 3VH0A 4ZOVA 3EI1B 5GXHA 4IMMA 2W18A 4JXMA 3BG1A 4LG8A 2TRCB 3IJCA 5AMSA 2OVQB 2P9SC 1RI6A 1GG2B 2O9KA 3RRMC 4GGAA 2XL2A 2YB8B 4FAVD 3FRXA 4GMBA 1TBGA 1Q47A 2I3TA 2Z2OA 3I8CA 5JWZA 3PXTD 2H9LA 2I3SA 4GQ1A 5TDHB 2H47A 3IJ1A 3RN1D 1JMXB 3EI1A 1OLZA 2G9AA 2H9MA 1U4CA 2YBAA 3DXMC 3BWSA 2B4EA 5HE2B 3JROA 3V7DB 4O3TB 3SFZA 2IAAA 3CIKB 3NVXA 2UZXB 3PVWB 1YFQA 5EAPA 4CI8A 3KRXB 5HE1B 2IUVA 2CO0A 4U1EI 5EMLB 4TZ4A 2H68A 5EM2A 2P9NC 1JOFA 1S4UX 2MTAH 3RMZD 3SXTD 3P4FA 2EBSA 4HDJA 4EWRA 4ERYA 5AJAA 2IUQA 4JSVC 4N14A 4JSPC 3OKYB 4E5ZA 2PM7B 2AGYA 2P9PC 1N6DA 5EAMA 4J0WA 4LG9A 4QL1A 2P9LC 4J8BA 5EARA 5IGQA 3OKWA 4A2MA 3DWLC 3KRWB 3SWSD 3K27A 3V5WB 4GQ2P 4XYIA 2PM9A 5SXMA 3J80g 1P22A 3MKQA 5CXCA 2PM9B 4PXWA 5EALA 1A0RB 2YNOA 5FKRA 5I5MA 3I7NA 3JZGA 4G56B 3SJLD 4E5ZB 4U7AA 4FA9D 4GM3A 2AGZA 5KDOB 2J56H 3OKYA 4CZVA 3DM0A 4A11B 3MZKA 4PNKB 1JMZB 3SHFA 4J81A 4BH6A 5TEEA 2AH0A 2Z2NA 4ZOXA 1OMWB 3IKOA 5FXYA 4X60B 1SQ9A 3PSLA 3JRPA 1SQJA 2H14A 2H9NA 4LGNA 4FHLA 1PI6A 5EMKB 1U2VC 3CFSB 4JD2C 3AL8B 3I7LA 3AFCA 3I7HA 2B5MA 3UVKA 2YNPA 4O9DA 3RSEC 5IT9g 2Q7QA 4A7JA 3IIWA 3PVUB 4CI2A 3UKUC 3MXXA 2HESX 5HE3B 4O3UB 5FKQA 3EI3B 4L9OA 2OJYA 4Y5RD 2I0TA 3EI2A 2GC7A 4A0BA 3VGZA 3I7OA 5A2Qg 4FA5D 4X63B 5CXBA 3VA6A 1ERJA 4Z8LA 4A0AA 5K19A 5FKSA 1GP2B 2CO0C 3OL2B 4J8GA 3ULEC 3NVNA 4JT5C 3AH8B 1PEVA 4ERZA 4J78A 2CN3A 3OW8A 2Z2PA 5H14A 4CY1A 2AGXA 4ERQA 2GNQA 3UVMA 3V9FA 2YMUA 2HKRA 4UI9R 1MG3A 3UVNA 4ZOZA 3EI4B 2CE9A 2QC5A 5B4WA 3C9CA 4MK0B 4CY2A 1R5MA 4ESGA 2YNNA 4OWRA 4PSXB 2HKMA 2PBIB 4XEIC 4NSXA 3UR4A 1B9YA 3I89A 3N0EA 4A11A 4PBYA 1MDAH 4CZYA 1N6EA 4A0AB 4FAND 2I0SA 3OL2A 4IA9A 4L3HD 4QQEA 1TYQC 3IJ0A 4CY3A 1XHMA 2AH1A 4A08A 3AL9A 5EM2B 3U4YA 4A09A 5TF2A 5FKTA 4J77A 4A2LA 3A0FA 4R7AB 3SMRA 2QXVA 3RFHA 4L1QD 5I5IA 5C2VB 5FQDA 5H17A 2H6QA 3EI2B 3JZNA 4BL0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IIY A;  1VYH C;  3GFC A;  5CXB B;  3SBP A;  4JT6 C;  4FA4 D;  4JSX C;  3MKS B;  3MMY A;  5C9Z B;  1XKS A;  2IWF A;  3ORV D;  3JB9 L;  4J84 A;  2B5L A;  1L0Q A;  2CE8 A;  3ZWL B;  4I79 A;  3EU7 A;  4ES0 A;  3PE7 A;  4J73 A;  5TEF A;  2BCJ B;  1NR0 A;  5C2W B;  2AQ5 A;  4CC9 A;  3W15 A;  5IJ8 E;  3C5M A;  3JAM g;  4D6V A;  4A08 B;  3J81 g;  2OIZ A;  4FWW A;  1FWX A;  4GGC A;  4K3I D;  4BUJ C;  3I7K A;  3SBR A;  4H5I A;  3PSC B;  2H13 A;  1GOT B;  4FA1 D;  2H9P A;  3CFV A;  2CN2 A;  4KFM B;  3HFQ A;  5GMK n;  4AOW A;  2G99 A;  4D0K A;  2HYE A;  2IUP A;  5HYN B;  2GC4 A;  1N6F A;  4QT8 A;  2UZY B;  5IJ7 E;  2AGL A;  3EG6 A;  4ZN4 A;  3MZL A;  2OK6 A;  2P9U C;  3DSM A;  3SBQ A;  3SLE D;  4PC0 A;  5IGO A;  3C99 A;  5FA5 B;  5GXI A;  1XIP A;  4GZ8 A;  4CY5 A;  3SVW D;  4J79 A;  5CXC B;  2XYI A;  4GM8 A;  3DXK C;  4GGD A;  1B9X A;  1JJU B;  3I7P A;  3E0C A;  3I2N A;  4FB1 D;  5I5J A;  4Y7R A;  3OKT A;  2J57 G;  4XYH A;  5FLX g;  5EMM B;  5IC7 A;  2PM6 B;  2BBK H;  3RN0 D;  4X3E A;  4E54 B;  4JSN C;  2HJB A;  3RFG A;  4YVD A;  2I0R A;  2IWK A;  4J82 A;  4OZU A;  5H1M A;  3RLM D;  1QNI A;  3UVO A;  5THA A;  2H6N A;  3L4O D;  3GRE A;  3NVQ A;  2B5N A;  3JPX A;  1MG2 A;  4L3G D;  3PXS D;  4PBZ A;  1K8K C;  3PXW D;  2P9I C;  3AL8 A;  1PGU A;  3EI4 A;  3EMH A;  3OTT A;  4X61 B;  3K26 A;  4AEZ A;  3JZH A;  3F3P A;  1NEX B;  3EWE A;  3F3G A;  5AFU 3;  3L4M D;  3C75 H;  5K1C C;  1K32 A;  2CNX A;  2HJ4 A;  2H3X A;  2OVP B;  3UKR C;  1GXR A;  4CZX A;  4J0X A;  4E54 A;  5HE0 B;  2H6K A;  2IUR A;  2OVR B;  4GQB B;  3FGB A;  3UVL A;  3SCY A;  3SN6 B;  4CI3 A;  4H5J A;  3ODT A;  3BG0 A;  5EMJ B;  4GM9 A;  5CYK B;  3FM0 A;  2P9K C;  4O45 A;  5HQG A;  5CYK A;  4ZOY A;  4O1Q D;  4A09 B;  2OK4 A;  4CI1 A;  4J87 A;  5GSA A;  2J55 H;  2AGW A;  3EI3 A;  4A0B B;  2XL3 A;  4J86 A;  2XU7 A;  4QRJ A;  2HXC A;  3N0D A;  4K3J B;  1SHY B;  1PBY B;  3F3F A;  3B7F A;  3I8E A;  4PSW B;  3VH0 A;  4ZOV A;  3EI1 B;  5GXH A;  4IMM A;  2W18 A;  4JXM A;  3BG1 A;  4LG8 A;  2TRC B;  3IJC A;  5AMS A;  2OVQ B;  2P9S C;  1RI6 A;  1GG2 B;  2O9K A;  3RRM C;  4GGA A;  2XL2 A;  2YB8 B;  4FAV D;  3FRX A;  4GMB A;  1TBG A;  1Q47 A;  2I3T A;  2Z2O A;  3I8C A;  5JWZ A;  3PXT D;  2H9L A;  2I3S A;  4GQ1 A;  5TDH B;  2H47 A;  3IJ1 A;  3RN1 D;  1JMX B;  3EI1 A;  1OLZ A;  2G9A A;  2H9M A;  1U4C A;  2YBA A;  3DXM C;  3BWS A;  2B4E A;  5HE2 B;  3JRO A;  3V7D B;  4O3T B;  3SFZ A;  2IAA A;  3CIK B;  3NVX A;  2UZX B;  3PVW B;  1YFQ A;  5EAP A;  4CI8 A;  3KRX B;  5HE1 B;  2IUV A;  2CO0 A;  4U1E I;  5EML B;  4TZ4 A;  2H68 A;  5EM2 A;  2P9N C;  1JOF A;  1S4U X;  2MTA H;  3RMZ D;  3SXT D;  3P4F A;  2EBS A;  4HDJ A;  4EWR A;  4ERY A;  5AJA A;  2IUQ A;  4JSV C;  4N14 A;  4JSP C;  3OKY B;  4E5Z A;  2PM7 B;  2AGY A;  2P9P C;  1N6D A;  5EAM A;  4J0W A;  4LG9 A;  4QL1 A;  2P9L C;  4J8B A;  5EAR A;  5IGQ A;  3OKW A;  4A2M A;  3DWL C;  3KRW B;  3SWS D;  3K27 A;  3V5W B;  4GQ2 P;  4XYI A;  2PM9 A;  5SXM A;  3J80 g;  1P22 A;  3MKQ A;  5CXC A;  2PM9 B;  4PXW A;  5EAL A;  1A0R B;  2YNO A;  5FKR A;  5I5M A;  3I7N A;  3JZG A;  4G56 B;  3SJL D;  4E5Z B;  4U7A A;  4FA9 D;  4GM3 A;  2AGZ A;  5KDO B;  2J56 H;  3OKY A;  4CZV A;  3DM0 A;  4A11 B;  3MZK A;  4PNK B;  1JMZ B;  3SHF A;  4J81 A;  4BH6 A;  5TEE A;  2AH0 A;  2Z2N A;  4ZOX A;  1OMW B;  3IKO A;  5FXY A;  4X60 B;  1SQ9 A;  3PSL A;  3JRP A;  1SQJ A;  2H14 A;  2H9N A;  4LGN A;  4FHL A;  1PI6 A;  5EMK B;  1U2V C;  3CFS B;  4JD2 C;  3AL8 B;  3I7L A;  3AFC A;  3I7H A;  2B5M A;  3UVK A;  2YNP A;  4O9D A;  3RSE C;  5IT9 g;  2Q7Q A;  4A7J A;  3IIW A;  3PVU B;  4CI2 A;  3UKU C;  3MXX A;  2HES X;  5HE3 B;  4O3U B;  5FKQ A;  3EI3 B;  4L9O A;  2OJY A;  4Y5R D;  2I0T A;  3EI2 A;  2GC7 A;  4A0B A;  3VGZ A;  3I7O A;  5A2Q g;  4FA5 D;  4X63 B;  5CXB A;  3VA6 A;  1ERJ A;  4Z8L A;  4A0A A;  5K19 A;  5FKS A;  1GP2 B;  2CO0 C;  3OL2 B;  4J8G A;  3ULE C;  3NVN A;  4JT5 C;  3AH8 B;  1PEV A;  4ERZ A;  4J78 A;  2CN3 A;  3OW8 A;  2Z2P A;  5H14 A;  4CY1 A;  2AGX A;  4ERQ A;  2GNQ A;  3UVM A;  3V9F A;  2YMU A;  2HKR A;  4UI9 R;  1MG3 A;  3UVN A;  4ZOZ A;  3EI4 B;  2CE9 A;  2QC5 A;  5B4W A;  3C9C A;  4MK0 B;  4CY2 A;  1R5M A;  4ESG A;  2YNN A;  4OWR A;  4PSX B;  2HKM A;  2PBI B;  4XEI C;  4NSX A;  3UR4 A;  1B9Y A;  3I89 A;  3N0E A;  4A11 A;  4PBY A;  1MDA H;  4CZY A;  1N6E A;  4A0A B;  4FAN D;  2I0S A;  3OL2 A;  4IA9 A;  4L3H D;  4QQE A;  1TYQ C;  3IJ0 A;  4CY3 A;  1XHM A;  2AH1 A;  4A08 A;  3AL9 A;  5EM2 B;  3U4Y A;  4A09 A;  5TF2 A;  5FKT A;  4J77 A;  4A2L A;  3A0F A;  4R7A B;  3SMR A;  2QXV A;  3RFH A;  4L1Q D;  5I5I A;  5C2V B;  5FQD A;  5H17 A;  2H6Q A;  3EI2 B;  3JZN A;  4BL0 A; 
#chains in the Genus database with same CATH topology
 4IRZ A;  5FFO A;  3IIY A;  3MVD K;  3K6S A;  2WQ8 A;  1VYH C;  3GFC A;  5CXB B;  3SBP A;  4JT6 C;  4FA4 D;  4JSX C;  3MKS B;  3MMY A;  5C9Z B;  1XKS A;  2XZG A;  2IWF A;  3ORV D;  1QFM A;  3JB9 L;  4J84 A;  2B5L A;  1L0Q A;  2CE8 A;  3ZWL B;  4I79 A;  3EU7 A;  4ES0 A;  3PE7 A;  4J73 A;  5TEF A;  2BCJ B;  1NR0 A;  5C2W B;  1TYE A;  4AMZ A;  3KCI A;  3QHY B;  2AQ5 A;  4UM8 A;  4CC9 A;  3W15 A;  3NIG A;  4UM9 A;  3C5M A;  5IJ8 E;  3JAM g;  4D6V A;  4A08 B;  3J81 g;  2OIZ A;  3EQ7 A;  4FWW A;  1FWX A;  4GGC A;  4K3I D;  4BUJ C;  3I7K A;  3SBR A;  1VZ2 A;  3NIF A;  4H5I A;  4RE6 A;  3PSC B;  2VDP A;  2H13 A;  1GOT B;  2VDK A;  1E8N A;  4FA1 D;  2H9P A;  3CFV A;  3IUN A;  2CN2 A;  4KFM B;  3HFQ A;  3MUO A;  5GMK n;  4AOW A;  1U8C A;  2G99 A;  3EQ9 A;  4D0K A;  2IUP A;  2HYE A;  5HYN B;  2GC4 A;  1N6F A;  4QT8 A;  2UZY B;  5IJ7 E;  2AGL A;  3EG6 A;  4ZN4 A;  3IUL A;  3MZL A;  2OK6 A;  2P9U C;  4BP9 A;  3DSM A;  3SBQ A;  3SLE D;  4PC0 A;  5IGO A;  3C99 A;  4AN0 A;  5FA5 B;  5GXI A;  1XIP A;  4GZ8 A;  4CY5 A;  3SVW D;  5HDB A;  4J79 A;  5CXC B;  2XYI A;  3IUJ A;  4GM8 A;  3DXK C;  4GGD A;  1B9X A;  1JJU B;  3I7P A;  3E0C A;  3I2N A;  4FB1 D;  5I5J A;  4Y7R A;  3OKT A;  5M5V A;  2J57 G;  4XYH A;  5FLX g;  5EMM B;  4DNU A;  5IC7 A;  2PM6 B;  2BBK H;  5M61 A;  4BP8 A;  3RN0 D;  4X3E A;  4E54 B;  4JSN C;  2HJB A;  4G1M A;  3RFG A;  1VE6 A;  4YVD A;  2I0R A;  2IWK A;  4J82 A;  4OZU A;  5H1M A;  3RLM D;  1QNI A;  3IVM A;  3UVO A;  5THA A;  2H6N A;  3L4O D;  3GRE A;  3NVQ A;  2B5N A;  3JPX A;  1MG2 A;  4L3G D;  3PXS D;  4PBZ A;  3ZE2 A;  1K8K C;  3PXW D;  4MMY A;  2P9I C;  1JV2 A;  3AL8 A;  1PGU A;  4DNW A;  3EI4 A;  3EMH A;  3OTT A;  4X61 B;  3K26 A;  1T2X A;  4AEZ A;  3JZH A;  3F3P A;  1NEX B;  3QI0 A;  3EWE A;  3F3G A;  5AFU 3;  3L4M D;  3C75 H;  3K72 A;  5K1C C;  1K32 A;  2CNX A;  2HJ4 A;  2H3X A;  3ZE1 A;  2EID A;  2OVP B;  3UKR C;  1GXR A;  4CZX A;  4J0X A;  4E54 A;  5HE0 B;  2H6K A;  2IUR A;  5M5R A;  2OVR B;  4GQB B;  1VZ3 A;  3O4G A;  4AMY A;  3FGB A;  3UVL A;  1H2Z A;  2VDM A;  3SCY A;  4WJK A;  3SN6 B;  4AX4 A;  4H5J A;  4CI3 A;  3ODT A;  3BG0 A;  5EMJ B;  4GM9 A;  5CYK B;  3FM0 A;  2P9K C;  4O45 A;  5HQG A;  5CYK A;  4ZOY A;  4O1Q D;  4A09 B;  5C92 A;  2OK4 A;  3ZDY A;  4CI1 A;  4J87 A;  5GSA A;  2J55 H;  2AGW A;  3EI3 A;  4A0B B;  2XL3 A;  4J86 A;  2XU7 A;  4WK2 A;  4QRJ A;  4WK0 A;  2HXC A;  3N0D A;  4K3J B;  3ZDX A;  1SHY B;  1PBY B;  3F3F A;  3B7F A;  3I8E A;  3IUQ A;  4PSW B;  4ZOV A;  3VH0 A;  3EI1 B;  5GXH A;  5E6S A;  4IMM A;  1GOF A;  2W18 A;  1UOO A;  3V4P A;  4JXM A;  3BG1 A;  4LG8 A;  2TRC B;  3IJE A;  3IJC A;  5AMS A;  2OVQ B;  2VDQ A;  1UTC A;  2P9S C;  1RI6 A;  1GG2 B;  2O9K A;  5E6R A;  3ZE0 A;  3RRM C;  3IUM A;  4GGA A;  2XL2 A;  2YB8 B;  4FAV D;  3FRX A;  4O02 A;  3VI3 A;  4GMB A;  1TBG A;  1Q47 A;  2I3T A;  2Z2O A;  2HU5 A;  3I8C A;  5JWZ A;  3PXT D;  2H9L A;  2I3S A;  2VDO A;  4D9S A;  4GQ1 A;  1K3I A;  4DNV A;  5TDH B;  2H47 A;  2VDR A;  2QZP A;  2HU8 A;  3IJ1 A;  3RN1 D;  1JMX B;  3EI1 A;  1E8M A;  1OLZ A;  2G9A A;  3NID A;  2H9M A;  1U4C A;  2YBA A;  3DXM C;  3BWS A;  2B4E A;  1VE7 A;  5HE2 B;  3JRO A;  3V7D B;  4O3T B;  3SFZ A;  4Z7Q A;  2IAA A;  3CIK B;  2QR5 A;  3NVX A;  2UZX B;  1JTD B;  3PVW B;  1YFQ A;  5EAP A;  4CI8 A;  4BCD A;  3KRX B;  5HE1 B;  2IUV A;  2CO0 A;  4U1E I;  5EML B;  1O6G A;  4TZ4 A;  2H68 A;  4JHP C;  4NBM A;  5EM2 A;  4Z7N A;  2P9N C;  1JOF A;  1S4U X;  5E6U A;  3MUN A;  2MTA H;  3FCS A;  3RMZ D;  3SXT D;  3P4F A;  2BKL A;  2VDL A;  2EBS A;  3O4J A;  4HDJ A;  4NEN A;  4EWR A;  4ERY A;  3V4V A;  3O4I A;  5AJA A;  2EIC A;  2IUQ A;  4JSV C;  4N14 A;  4JSP C;  3OKY B;  4E5Z A;  2PM7 B;  2AGY A;  2P9P C;  1N6D A;  4Z7O A;  5EAM A;  3O4H A;  4J0W A;  4LG9 A;  3ZDZ A;  4RE5 A;  4QL1 A;  2P9L C;  3EQ8 A;  4J8B A;  5EAR A;  4NAA A;  5IGQ A;  3OKW A;  4A2M A;  3DWL C;  3KRW B;  3SWS D;  3K27 A;  3V5W B;  4GQ2 P;  4XYI A;  1UOQ A;  2PM9 A;  5SXM A;  3T3P A;  5M5U A;  1P22 A;  3MKQ A;  4G55 A;  3J80 g;  4O2W A;  5CXC A;  1YR2 A;  2PM9 B;  4PXW A;  5EAL A;  1A0R B;  2YNO A;  5FKR A;  5I5M A;  3I7N A;  3JZG A;  4G56 B;  3SJL D;  4E5Z B;  4QAM A;  4U7A A;  4FA9 D;  4GM3 A;  2AGZ A;  3FCU A;  5KDO B;  2J56 H;  3OKY A;  4G1E A;  4CZV A;  3DM0 A;  4A11 B;  3MZK A;  4PNK B;  1JMZ B;  1L5G A;  5C86 A;  3SHF A;  4J81 A;  4BH6 A;  5TEE A;  2EIE A;  2AH0 A;  2Z2N A;  4ZOX A;  1OMW B;  3IKO A;  5FXY A;  4X60 B;  1C9I A;  1SQ9 A;  1H2W A;  3PSL A;  3JRP A;  1SQJ A;  2H14 A;  2H9N A;  4JHN A;  4LGN A;  4FHL A;  1PI6 A;  5EMK B;  1U2V C;  1I2M B;  3CFS B;  4JD2 C;  2EIB A;  3AL8 B;  2HU7 A;  3I7L A;  3I7H A;  1BPO A;  2B5M A;  3AFC A;  3UVK A;  2YNP A;  5M5S A;  3GC3 B;  4O9D A;  3RSE C;  5IT9 g;  2Q7Q A;  4A7J A;  3OF7 A;  3IIW A;  1UOP A;  1E5T A;  3PVU B;  4CI2 A;  3UKU C;  3MXX A;  3GD1 I;  2HES X;  5HE3 B;  4O3U B;  5FKQ A;  3EI3 B;  4L9O A;  2OJY A;  4Y5R D;  2I0T A;  3EI2 A;  2GC7 A;  4A0B A;  3VGZ A;  1H2X A;  2VZ3 A;  3I7O A;  3DDU A;  4WK4 A;  5A2Q g;  4FA5 D;  4X63 B;  5CXB A;  3VA6 A;  1ERJ A;  4Z8L A;  4AN1 A;  1H2Y A;  4A0A A;  5K19 A;  5FKS A;  1GP2 B;  1A12 A;  2CO0 C;  3OL2 B;  3VI4 A;  4J8G A;  3ULE C;  3NVN A;  4JT5 C;  3AH8 B;  1PEV A;  4ERZ A;  2VZ1 A;  4J78 A;  2CN3 A;  3OW8 A;  2Z2P A;  1M1X A;  5H14 A;  2AGX A;  4CY1 A;  4ERQ A;  3K71 A;  2XDW A;  4MMZ A;  4MMX A;  2GNQ A;  2VC2 A;  3UVM A;  3V9F A;  1QFS A;  2YMU A;  5M5T A;  2HKR A;  4UI9 R;  1MG3 A;  3UVN A;  1O6F A;  4ZOZ A;  3EI4 B;  2CE9 A;  2QC5 A;  4NC4 A;  5B4W A;  3C9C A;  4MK0 B;  4CY2 A;  1R5M A;  4ESG A;  2JKX A;  3T3M A;  2YNN A;  4OWR A;  4PSX B;  2HKM A;  1GOG A;  2PBI B;  4XEI C;  4NSX A;  3UR4 A;  1B9Y A;  3I89 A;  3N0E A;  4A11 A;  4PBY A;  1MDA H;  5FFG A;  4CZY A;  1N6E A;  4A0A B;  4FAN D;  2I0S A;  3OL2 A;  4IA9 A;  1C9L A;  1GOH A;  4BCB A;  4L3H D;  4QQE A;  4L1M A;  4BCC A;  1TYQ C;  3IJ0 A;  4CY3 A;  1XHM A;  2AH1 A;  4A08 A;  3AL9 A;  5EM2 B;  3U4Y A;  4A09 A;  5TF2 A;  5FKT A;  4J77 A;  4A2L A;  3A0F A;  4R7A B;  3SMR A;  2QXV A;  3IUR A;  3RFH A;  2XE4 A;  4L1Q D;  5I5I A;  5C2V B;  5FQD A;  5H17 A;  2H6Q A;  2VDN A;  3EI2 B;  3JZN A;  4BL0 A; 
#chains in the Genus database with same CATH homology
 3IIY A;  1VYH C;  3GFC A;  5CXB B;  3SBP A;  4JT6 C;  4FA4 D;  4JSX C;  3MKS B;  3MMY A;  5C9Z B;  1XKS A;  2IWF A;  3ORV D;  3JB9 L;  4J84 A;  2B5L A;  1L0Q A;  2CE8 A;  3ZWL B;  4I79 A;  3EU7 A;  4ES0 A;  3PE7 A;  4J73 A;  5TEF A;  2BCJ B;  1NR0 A;  5C2W B;  2AQ5 A;  4CC9 A;  3W15 A;  5IJ8 E;  3C5M A;  3JAM g;  4D6V A;  4A08 B;  3J81 g;  2OIZ A;  4FWW A;  1FWX A;  4GGC A;  4K3I D;  4BUJ C;  3I7K A;  3SBR A;  4H5I A;  3PSC B;  2H13 A;  1GOT B;  4FA1 D;  2H9P A;  3CFV A;  2CN2 A;  4KFM B;  3HFQ A;  5GMK n;  4AOW A;  2G99 A;  4D0K A;  2HYE A;  2IUP A;  5HYN B;  2GC4 A;  1N6F A;  4QT8 A;  2UZY B;  5IJ7 E;  2AGL A;  3EG6 A;  4ZN4 A;  3MZL A;  2OK6 A;  2P9U C;  3DSM A;  3SBQ A;  3SLE D;  4PC0 A;  5IGO A;  3C99 A;  5FA5 B;  5GXI A;  1XIP A;  4GZ8 A;  4CY5 A;  3SVW D;  4J79 A;  5CXC B;  2XYI A;  4GM8 A;  3DXK C;  4GGD A;  1B9X A;  1JJU B;  3I7P A;  3E0C A;  3I2N A;  4FB1 D;  5I5J A;  4Y7R A;  3OKT A;  2J57 G;  4XYH A;  5FLX g;  5EMM B;  5IC7 A;  2PM6 B;  2BBK H;  3RN0 D;  4X3E A;  4E54 B;  4JSN C;  2HJB A;  3RFG A;  4YVD A;  2I0R A;  2IWK A;  4J82 A;  4OZU A;  5H1M A;  3RLM D;  1QNI A;  3UVO A;  5THA A;  2H6N A;  3L4O D;  3GRE A;  3NVQ A;  2B5N A;  3JPX A;  1MG2 A;  4L3G D;  3PXS D;  4PBZ A;  1K8K C;  3PXW D;  2P9I C;  3AL8 A;  1PGU A;  3EI4 A;  3EMH A;  3OTT A;  4X61 B;  3K26 A;  4AEZ A;  3JZH A;  3F3P A;  1NEX B;  3EWE A;  3F3G A;  5AFU 3;  3L4M D;  3C75 H;  5K1C C;  1K32 A;  2CNX A;  2HJ4 A;  2H3X A;  2OVP B;  3UKR C;  1GXR A;  4CZX A;  4J0X A;  4E54 A;  5HE0 B;  2H6K A;  2IUR A;  2OVR B;  4GQB B;  3FGB A;  3UVL A;  3SCY A;  3SN6 B;  4CI3 A;  4H5J A;  3ODT A;  3BG0 A;  5EMJ B;  4GM9 A;  5CYK B;  3FM0 A;  2P9K C;  4O45 A;  5HQG A;  5CYK A;  4ZOY A;  4O1Q D;  4A09 B;  2OK4 A;  4CI1 A;  4J87 A;  5GSA A;  2J55 H;  2AGW A;  3EI3 A;  4A0B B;  2XL3 A;  4J86 A;  2XU7 A;  4QRJ A;  2HXC A;  3N0D A;  4K3J B;  1SHY B;  1PBY B;  3F3F A;  3B7F A;  3I8E A;  4PSW B;  3VH0 A;  4ZOV A;  3EI1 B;  5GXH A;  4IMM A;  2W18 A;  4JXM A;  3BG1 A;  4LG8 A;  2TRC B;  3IJC A;  5AMS A;  2OVQ B;  2P9S C;  1RI6 A;  1GG2 B;  2O9K A;  3RRM C;  4GGA A;  2XL2 A;  2YB8 B;  4FAV D;  3FRX A;  4GMB A;  1TBG A;  1Q47 A;  2I3T A;  2Z2O A;  3I8C A;  5JWZ A;  3PXT D;  2H9L A;  2I3S A;  4GQ1 A;  5TDH B;  2H47 A;  3IJ1 A;  3RN1 D;  1JMX B;  3EI1 A;  1OLZ A;  2G9A A;  2H9M A;  1U4C A;  2YBA A;  3DXM C;  3BWS A;  2B4E A;  5HE2 B;  3JRO A;  3V7D B;  4O3T B;  3SFZ A;  2IAA A;  3CIK B;  3NVX A;  2UZX B;  3PVW B;  1YFQ A;  5EAP A;  4CI8 A;  3KRX B;  5HE1 B;  2IUV A;  2CO0 A;  4U1E I;  5EML B;  4TZ4 A;  2H68 A;  5EM2 A;  2P9N C;  1JOF A;  1S4U X;  2MTA H;  3RMZ D;  3SXT D;  3P4F A;  2EBS A;  4HDJ A;  4EWR A;  4ERY A;  5AJA A;  2IUQ A;  4JSV C;  4N14 A;  4JSP C;  3OKY B;  4E5Z A;  2PM7 B;  2AGY A;  2P9P C;  1N6D A;  5EAM A;  4J0W A;  4LG9 A;  4QL1 A;  2P9L C;  4J8B A;  5EAR A;  5IGQ A;  3OKW A;  4A2M A;  3DWL C;  3KRW B;  3SWS D;  3K27 A;  3V5W B;  4GQ2 P;  4XYI A;  2PM9 A;  5SXM A;  3J80 g;  1P22 A;  3MKQ A;  5CXC A;  2PM9 B;  4PXW A;  5EAL A;  1A0R B;  2YNO A;  5FKR A;  5I5M A;  3I7N A;  3JZG A;  4G56 B;  3SJL D;  4E5Z B;  4U7A A;  4FA9 D;  4GM3 A;  2AGZ A;  5KDO B;  2J56 H;  3OKY A;  4CZV A;  3DM0 A;  4A11 B;  3MZK A;  4PNK B;  1JMZ B;  3SHF A;  4J81 A;  4BH6 A;  5TEE A;  2AH0 A;  2Z2N A;  4ZOX A;  1OMW B;  3IKO A;  5FXY A;  4X60 B;  1SQ9 A;  3PSL A;  3JRP A;  1SQJ A;  2H14 A;  2H9N A;  4LGN A;  4FHL A;  1PI6 A;  5EMK B;  1U2V C;  3CFS B;  4JD2 C;  3AL8 B;  3I7L A;  3AFC A;  3I7H A;  2B5M A;  3UVK A;  2YNP A;  4O9D A;  3RSE C;  5IT9 g;  2Q7Q A;  4A7J A;  3IIW A;  3PVU B;  4CI2 A;  3UKU C;  3MXX A;  2HES X;  5HE3 B;  4O3U B;  5FKQ A;  3EI3 B;  4L9O A;  2OJY A;  4Y5R D;  2I0T A;  3EI2 A;  2GC7 A;  4A0B A;  3VGZ A;  3I7O A;  5A2Q g;  4FA5 D;  4X63 B;  5CXB A;  3VA6 A;  1ERJ A;  4Z8L A;  4A0A A;  5K19 A;  5FKS A;  1GP2 B;  2CO0 C;  3OL2 B;  4J8G A;  3ULE C;  3NVN A;  4JT5 C;  3AH8 B;  1PEV A;  4ERZ A;  4J78 A;  2CN3 A;  3OW8 A;  2Z2P A;  5H14 A;  4CY1 A;  2AGX A;  4ERQ A;  2GNQ A;  3UVM A;  3V9F A;  2YMU A;  2HKR A;  4UI9 R;  1MG3 A;  3UVN A;  4ZOZ A;  3EI4 B;  2CE9 A;  2QC5 A;  5B4W A;  3C9C A;  4MK0 B;  4CY2 A;  1R5M A;  4ESG A;  2YNN A;  4OWR A;  4PSX B;  2HKM A;  2PBI B;  4XEI C;  4NSX A;  3UR4 A;  1B9Y A;  3I89 A;  3N0E A;  4A11 A;  4PBY A;  1MDA H;  4CZY A;  1N6E A;  4A0A B;  4FAN D;  2I0S A;  3OL2 A;  4IA9 A;  4L3H D;  4QQE A;  1TYQ C;  3IJ0 A;  4CY3 A;  1XHM A;  2AH1 A;  4A08 A;  3AL9 A;  5EM2 B;  3U4Y A;  4A09 A;  5TF2 A;  5FKT A;  4J77 A;  4A2L A;  3A0F A;  4R7A B;  3SMR A;  2QXV A;  3RFH A;  4L1Q D;  5I5I A;  5C2V B;  5FQD A;  5H17 A;  2H6Q A;  3EI2 B;  3JZN A;  4BL0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...