4CY3A

Crystal structure of the nsl1-wds complex.
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
303
structure length
303
Chain Sequence
KPNYTLKFTLAGHTKAVSAVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVRTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQSKEVVQKLQGHTDTVLCTACHPTENIIASAALENDKTIKLWKSDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN WILL DIE SLOWLY
publication title Structural Analysis of the Kansl1/Wdr5/Kansl2 Complex Reveals that Wdr5 is Required for Efficient Assembly and Chromatin Targeting of the Nsl Complex.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription
total genus 101
structure length 303
sequence length 303
ec nomenclature
pdb deposition date 2014-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4cy3A00
4JXMA 3FM0A 2AQ5A 3JROA 1L0QA 4LG9A 3IIYA 5FKRA 3OTTA 3FRXA 4NSXA 4FA5D 2HXCA 2P9LC 3K27A 2IURA 4XYHA 1MG2A 4E5ZB 1U2VC 2QXVA 3NVQA 4JT5C 2IWFA 3IIWA 4QT8A 4CC9A 4PC0A 2PBIB 5CXBB 5I5JA 4GQ1A 4FAVD 2GC4A 4CI1A 1RI6A 5GMKn 2P9IC 2J57G 3MZKA 2HJBA 1JMXB 2IUPA 4GGCA 2AGXA 2CN2A 5SXMA 3IKOA 4J77A 3EWEA 5CXCA 4QRJA 1R5MA 4CI2A 3UKUC 2GC7A 5AMSA 4YVDA 2UZXB 3C9CA 1TBGA 3L4MD 4LGNA 5GXIA 4L1QD 2OVRB 3W15A 1SQJA 4CI3A 3IJ0A 5HE3B 3UR4A 5HE0B 3RSEC 5GXHA 4A0AA 2HJ4A 3MMYA 3B7FA 3ORVD 2PM9A 1N6EA 2MTAH 4X63B 3SBQA 4A08B 5C2WB 4ZOVA 1PBYB 2OK4A 5K1CC 2AGZA 3PXWD 3A0FA 4GGDA 1MG3A 2I3TA 5TEEA 4O3TB 3RFHA 4ZOZA 4L3HD 3OKYB 4GZ8A 3E0CA 3NVXA 3UKRC 4GM8A 3RMZD 5CXBA 2PM7B 1GXRA 2AGWA 1GOTB 2GNQA 4MK0B 4BH6A 1PGUA 2CE9A 5A2Qg 3DWLC 3JZGA 4GM9A 4UI9R 1JJUB 2AH0A 2TRCB 2AGLA 2AH1A 4N14A 2OK6A 3I8CA 4CY5A 3V5WB 3PVWB 4FA4D 4J73A 5TEFA 3RLMD 4A2MA 4G56B 5KDOB 5I5IA 4Y5RD 2G99A 2Z2OA 4KFMB 2CNXA 3EI3A 2IUQA 2Q7QA 3NVNA 4IMMA 5FQDA 1SQ9A 2H3XA 3AL8B 3DSMA 1K8KC 4L3GD 1Q47A 5EAMA 2B5NA 5THAA 4D0KA 5GSAA 4X3EA 4A08A 3V9FA 2HYEA 2H68A 3JRPA 4LG8A 3N0DA 3I7NA 5FLXg 1S4UX 2CE8A 5K19A 2H6NA 5FKSA 3ODTA 2BBKH 3EI1A 2CN3A 2P9PC 2P9SC 2YNOA 5CYKB 4JT6C 5HE2B 5AFU3 3I7LA 3UVOA 5TDHB 1PEVA 1YFQA 3BG1A 3P4FA 2H9MA 4J8BA 3EU7A 3I89A 3DM0A 3OKTA 3KRXB 2W18A 2CO0A 4JSVC 4J0XA 3SLED 4FAND 3EI2B 3DXMC 3AFCA 2OVQB 5HYNB 4QL1A 3SFZA 2OIZA 4O45A 2P9KC 3BG0A 4PSWB 3OW8A 1P22A 1U4CA 3ULEC 4CY2A 4J86A 3AL8A 3EI4B 4CZVA 3FGBA 4L9OA 4QQEA 2OJYA 4OWRA 3J81g 3BWSA 3C75H 4HDJA 2P9NC 2UZYB 5EM2B 2I0TA 2J55H 3J80g 1ERJA 3RN0D 3N0EA 4O1QD 4ZOXA 4A0BB 4GMBA 1N6DA 3CIKB 4E5ZA 5C2VB 1SHYB 4BUJC 4PXWA 3I7KA 1XIPA 3SMRA 3MKSB 3UVMA 5EAPA 1TYQC 5EMKB 3PSCB 4H5JA 4H5IA 3SWSD 2XL2A 3JAMg 5H1MA 3VH0A 2HKRA 3V7DB 4FB1D 5IJ7E 3AH8B 5B4WA 4AEZA 4J8GA 1XHMA 3CFSB 4PBYA 3SBRA 2H47A 2YNNA 3SN6B 4AOWA 3JZHA 5HE1B 4J79A 1QNIA 3I2NA 4XYIA 4J81A 5FKQA 1N6FA 5EMLB 5EMJB 3DXKC 5IGOA 3ZWLB 2I0RA 3SXTD 4JD2C 2OVPB 3RFGA 2H9LA 2J56H 3C5MA 3OKWA 3C99A 5JWZA 1GG2B 4K3JB 3F3PA 4E54B 4PBZA 3SCYA 4D6VA 4JSXC 2H6KA 2H9PA 4Z8LA 3SJLD 3OL2B 5H17A 2B5MA 4J78A 4FA1D 1VYHC 3JB9L 4ERYA 1XKSA 3PVUB 3OKYA 4A0AB 2Z2PA 4O3UB 5IT9g 2PM9B 4EWRA 2PM6B 1NEXB 1MDAH 3RN1D 2AGYA 1A0RB 4CI8A 3F3GA 2BCJB 5H14A 4TZ4A 4U1EI 4FHLA 2I0SA 5IGQA 2H13A 4FWWA 4GQ2P 3VGZA 2XYIA 4J82A 1B9YA 2HKMA 3PE7A 1NR0A 2YBAA 5EMMB 3AL9A 1OMWB 3U4YA 3I7HA 3MKQA 2H14A 2Z2NA 4J87A 3MZLA 5FA5B 3I8EA 4E54A 3PSLA 4O9DA 3PXSD 3UVNA 2H9NA 5I5MA 3MXXA 3KRWB 4A7JA 4JSNC 4GGAA 2YNPA 4CY3A 3OL2A 1K32A 3I7PA 3EI3B 4ERZA 2I3SA 4R7AB 1JOFA 4A11B 4A09B 4ZN4A 4X61B 4A2LA 4CZYA 2H6QA 4FA9D 2CO0C 3GFCA 5CYKA 2EBSA 4ESGA 3JZNA 4ERQA 4CZXA 3IJCA 4GQBB 3PXTD 3L4OD 2HESX 3IJ1A 5EARA 2P9UC 4J84A 2B4EA 5EALA 4I79A 4XEIC 5TF2A 2O9KA 3EI1B 3UVKA 3EI2A 1OLZA 4IA9A 4J0WA 4PNKB 3SHFA 3SVWD 2IWKA 1GP2B 2IUVA 2YB8B 3CFVA 3EI4A 3SBPA 5IC7A 5IJ8E 3HFQA 5HQGA 5C9ZB 3EMHA 5CXCB 4GM3A 1FWXA 5FKTA 3EG6A 4JSPC 4ZOYA 3K26A 4X60B 4Y7RA 3VA6A 4CY1A 5EM2A 4OZUA 3F3FA 2YMUA 2IAAA 1B9XA 2XU7A 4A0BA 4A11A 1JMZB 4PSXB 4A09A 3JPXA 3UVLA 4K3ID 2B5LA 2XL3A 3I7OA 5AJAA 4U7AA 5FXYA 3RRMC 1PI6A 4BL0A 4ES0A 2QC5A 3GREA 2G9AA
chains in the Genus database with same CATH superfamily
4JXMA 3FM0A 2AQ5A 3JROA 1L0QA 4LG9A 3IIYA 3NIGA 3OTTA 5FKRA 3FRXA 4NSXA 4FA5D 2HXCA 2P9LC 3K27A 2IURA 4XYHA 1MG2A 4E5ZB 1U2VC 2QXVA 3NVQA 4JT5C 1GOGA 2IWFA 3IIWA 4QT8A 4CC9A 4UM9A 2QZPA 2VDOA 4PC0A 2PBIB 5CXBB 5I5JA 4GQ1A 4FAVD 2GC4A 4CI1A 1RI6A 1O6GA 5GMKn 2P9IC 2J57G 3MZKA 2HJBA 1JMXB 3NIFA 2IUPA 2HU5A 4GGCA 3QI0A 2AGXA 2CN2A 5SXMA 3IKOA 4J77A 3EWEA 5CXCA 4QRJA 1R5MA 4CI2A 3UKUC 4DNUA 3DDUA 5FFGA 2GC7A 5AMSA 4YVDA 4BCBA 2UZXB 3C9CA 1TBGA 3L4MD 4LGNA 5GXIA 4L1QD 2OVRB 3W15A 1SQJA 4CI3A 3IJ0A 5HE3B 2VDRA 3UR4A 2VZ3A 5HE0B 3RSEC 5GXHA 4A0AA 2HJ4A 3MMYA 3B7FA 3ORVD 2HU8A 2PM9A 1N6EA 1VZ2A 3MVDK 2MTAH 4X63B 3SBQA 4A08B 5C2WB 3ZE2A 4O02A 4ZOVA 3OF7A 1PBYB 2OK4A 3MUNA 3O4GA 5K1CC 2AGZA 3PXWD 3A0FA 3ZDZA 3FCUA 4GGDA 1MG3A 2I3TA 1C9IA 5TEEA 4O3TB 3RFHA 2EICA 4ZOZA 4L3HD 3OKYB 4GZ8A 3E0CA 4AMZA 3NVXA 3K71A 3UKRC 4GM8A 3RMZD 5CXBA 2PM7B 1GXRA 1H2ZA 1BPOA 2AGWA 1GOTB 3ZE0A 4NENA 2GNQA 4D9SA 4MK0B 4BH6A 1PGUA 2CE9A 5A2Qg 3DWLC 3JZGA 4GM9A 4UI9R 1JJUB 2EIEA 2AH0A 4G1EA 2BKLA 3FCSA 2TRCB 2AGLA 2AH1A 4N14A 4BP9A 2OK6A 3I8CA 4CY5A 3V5WB 3PVWB 4FA4D 4J73A 5M5UA 5TEFA 3RLMD 4A2MA 4QAMA 4G56B 5KDOB 5I5IA 4Y5RD 1TYEA 3ZDYA 2G99A 2Z2OA 4KFMB 2CNXA 3EI3A 2IUQA 2Q7QA 3NVNA 4IMMA 5FQDA 1SQ9A 2H3XA 3AL8B 3DSMA 1K8KC 4L3GD 1Q47A 5EAMA 2B5NA 5THAA 4D0KA 5GSAA 4X3EA 4A08A 3V9FA 5C92A 2HYEA 3ZE1A 2H68A 3JRPA 4LG8A 3N0DA 2VZ1A 3I7NA 5FLXg 1S4UX 2CE8A 5K19A 4AMYA 2H6NA 1M1XA 5FKSA 3ODTA 2BBKH 3EI1A 2CN3A 2P9PC 2P9SC 4BP8A 2YNOA 5CYKB 3V4PA 4JT6C 5HE2B 5AFU3 2EIBA 3I7LA 3UVOA 5TDHB 1PEVA 1YFQA 3BG1A 3EQ7A 3P4FA 2H9MA 4J8BA 1C9LA 3EU7A 4Z7NA 4JHPC 3I89A 3DM0A 3OKTA 1VE7A 3KRXB 2W18A 2CO0A 4JSVC 3K72A 4J0XA 3SLED 4FAND 2VDQA 3EI2B 3DXMC 4L1MA 3AFCA 4MMXA 2OVQB 5HYNB 4QL1A 3SFZA 2OIZA 4O45A 2P9KC 3BG0A 5C86A 4PSWB 3OW8A 1JV2A 1P22A 1U4CA 3ULEC 5E6RA 4CY2A 4J86A 1UOPA 3AL8A 3EI4B 3O4HA 4CZVA 3FGBA 3O4JA 4L9OA 4QQEA 2OJYA 4OWRA 4WK2A 3J81g 3BWSA 3C75H 4HDJA 2P9NC 4AN0A 2UZYB 5EM2B 2I0TA 2J55H 3J80g 1ERJA 3RN0D 3N0EA 4O1QD 4ZOXA 3IURA 4A0BB 4GMBA 1N6DA 3CIKB 5M5RA 4E5ZA 5C2VB 1SHYB 4BUJC 4WJKA 4PXWA 1E8NA 3I7KA 1XIPA 3SMRA 3MKSB 3UVMA 3KCIA 1JTDB 1TYQC 5EAPA 5EMKB 3PSCB 3VI3A 3IUJA 4H5JA 4H5IA 3SWSD 2XL2A 4NAAA 3JAMg 5H1MA 3VH0A 2HKRA 3V7DB 4FB1D 3GD1I 5IJ7E 4DNVA 1H2XA 3AH8B 5B4WA 4AEZA 4J8GA 1XHMA 3CFSB 4PBYA 3SBRA 2H47A 2YNNA 3SN6B 4AOWA 2XZGA 3JZHA 5HE1B 4J79A 1QNIA 3I2NA 4XYIA 4J81A 2WQ8A 5FKQA 1N6FA 5EMLB 1YR2A 5EMJB 3DXKC 5IGOA 3ZWLB 2I0RA 1H2YA 3EQ8A 3MUOA 3SXTD 1I2MB 2VDNA 4JD2C 2OVPB 3RFGA 2H9LA 2J56H 3C5MA 3OKWA 4BCDA 5FFOA 3C99A 5JWZA 1GG2B 4K3JB 3F3PA 4E54B 4PBZA 3SCYA 1O6FA 4BCCA 4D6VA 4NC4A 4JSXC 4WK4A 1A12A 2H6KA 2H9PA 2JKXA 4Z8LA 3SJLD 3OL2B 3IJEA 5H17A 2B5MA 3EQ9A 4J78A 4FA1D 1VYHC 5M61A 3JB9L 1L5GA 4ERYA 4DNWA 3QHYB 1XKSA 5M5TA 3PVUB 3ZDXA 3OKYA 4A0AB 2Z2PA 4O3UB 5IT9g 4O2WA 2PM9B 5M5VA 4EWRA 4MMYA 2PM6B 1NEXB 1VE6A 1MDAH 1H2WA 3RN1D 2AGYA 1A0RB 3IUMA 2XE4A 5HDBA 4CI8A 3F3GA 2BCJB 4AN1A 5H14A 4TZ4A 1VZ3A 4U1EI 4IRZA 4FHLA 2I0SA 5IGQA 2H13A 4FWWA 1K3IA 4GQ2P 4G55A 3VGZA 2XYIA 4J82A 1B9YA 2HKMA 3PE7A 2XDWA 1NR0A 2YBAA 3GC3B 5EMMB 4WK0A 3AL9A 1OMWB 3U4YA 5M5SA 3I7HA 3MKQA 2H14A 2Z2NA 4J87A 2QR5A 3MZLA 5FA5B 3I8EA 4E54A 3PSLA 4O9DA 3PXSD 3IUNA 2H9NA 3UVNA 5I5MA 3MXXA 3T3PA 3KRWB 4A7JA 4JSNC 4GGAA 2YNPA 4CY3A 5E6UA 3OL2A 1E5TA 1K32A 3I7PA 3EI3B 4AX4A 2I3SA 4ERZA 4R7AB 1JOFA 4A11B 4Z7OA 4A09B 4ZN4A 4JHNA 4NBMA 4X61B 3V4VA 4A2LA 4CZYA 2H6QA 3T3MA 4FA9D 2CO0C 3GFCA 1UOQA 5CYKA 2EBSA 4ESGA 4UM8A 3JZNA 4ERQA 4CZXA 3IUQA 1GOHA 4Z7QA 2VDKA 3IJCA 1UOOA 2EIDA 2VDLA 4GQBB 3PXTD 3L4OD 4RE5A 3NIDA 1UTCA 2HESX 3IJ1A 5EARA 2P9UC 4J84A 2B4EA 5EALA 4I79A 4XEIC 5TF2A 2O9KA 3EI1B 3UVKA 3EI2A 2HU7A 1OLZA 4IA9A 4J0WA 3O4IA 4PNKB 1QFMA 3SHFA 2IWKA 1GP2B 3SVWD 4MMZA 3IVMA 2IUVA 1E8MA 2YB8B 3CFVA 3EI4A 4RE6A 3SBPA 5IC7A 5IJ8E 3HFQA 5HQGA 5C9ZB 4G1MA 3EMHA 5E6SA 3IULA 5CXCB 4GM3A 1FWXA 1QFSA 5FKTA 3K6SA 3EG6A 4JSPC 4ZOYA 3K26A 4X60B 4Y7RA 3VA6A 4CY1A 5EM2A 4OZUA 3F3FA 2YMUA 2IAAA 2VDMA 1B9XA 2XU7A 4A0BA 4A11A 2VC2A 1JMZB 4PSXB 4A09A 3JPXA 3VI4A 3UVLA 4K3ID 2B5LA 2XL3A 3I7OA 5AJAA 4U7AA 5FXYA 1GOFA 1U8CA 2VDPA 3RRMC 1PI6A 4BL0A 4ES0A 2QC5A 3GREA 1T2XA 2G9AA
chains in the Genus database with same CATH topology
4JXMA 3FM0A 2AQ5A 3JROA 1L0QA 4LG9A 3IIYA 5FKRA 3OTTA 3FRXA 4NSXA 4FA5D 2HXCA 2P9LC 3K27A 2IURA 4XYHA 1MG2A 4E5ZB 1U2VC 2QXVA 3NVQA 4JT5C 2IWFA 3IIWA 4QT8A 4CC9A 4PC0A 2PBIB 5CXBB 5I5JA 4GQ1A 4FAVD 2GC4A 4CI1A 1RI6A 5GMKn 2P9IC 2J57G 3MZKA 2HJBA 1JMXB 2IUPA 4GGCA 2AGXA 2CN2A 5SXMA 3IKOA 4J77A 3EWEA 5CXCA 4QRJA 1R5MA 4CI2A 3UKUC 2GC7A 5AMSA 4YVDA 2UZXB 3C9CA 1TBGA 3L4MD 4LGNA 5GXIA 4L1QD 2OVRB 3W15A 1SQJA 4CI3A 3IJ0A 5HE3B 3UR4A 5HE0B 3RSEC 5GXHA 4A0AA 2HJ4A 3MMYA 3B7FA 3ORVD 2PM9A 1N6EA 2MTAH 4X63B 3SBQA 4A08B 5C2WB 4ZOVA 1PBYB 2OK4A 5K1CC 2AGZA 3PXWD 3A0FA 4GGDA 1MG3A 2I3TA 5TEEA 4O3TB 3RFHA 4ZOZA 4L3HD 3OKYB 4GZ8A 3E0CA 3NVXA 3UKRC 4GM8A 3RMZD 5CXBA 2PM7B 1GXRA 2AGWA 1GOTB 2GNQA 4MK0B 4BH6A 1PGUA 2CE9A 5A2Qg 3DWLC 3JZGA 4GM9A 4UI9R 1JJUB 2AH0A 2TRCB 2AGLA 2AH1A 4N14A 2OK6A 3I8CA 4CY5A 3V5WB 3PVWB 4FA4D 4J73A 5TEFA 3RLMD 4A2MA 4G56B 5KDOB 5I5IA 4Y5RD 2G99A 2Z2OA 4KFMB 2CNXA 3EI3A 2IUQA 2Q7QA 3NVNA 4IMMA 5FQDA 1SQ9A 2H3XA 3AL8B 3DSMA 1K8KC 4L3GD 1Q47A 5EAMA 2B5NA 5THAA 4D0KA 5GSAA 4X3EA 4A08A 3V9FA 2HYEA 2H68A 3JRPA 4LG8A 3N0DA 3I7NA 5FLXg 1S4UX 2CE8A 5K19A 2H6NA 5FKSA 3ODTA 2BBKH 3EI1A 2CN3A 2P9PC 2P9SC 2YNOA 5CYKB 4JT6C 5HE2B 5AFU3 3I7LA 3UVOA 5TDHB 1PEVA 1YFQA 3BG1A 3P4FA 2H9MA 4J8BA 3EU7A 3I89A 3DM0A 3OKTA 3KRXB 2W18A 2CO0A 4JSVC 4J0XA 3SLED 4FAND 3EI2B 3DXMC 3AFCA 2OVQB 5HYNB 4QL1A 3SFZA 2OIZA 4O45A 2P9KC 3BG0A 4PSWB 3OW8A 1P22A 1U4CA 3ULEC 4CY2A 4J86A 3AL8A 3EI4B 4CZVA 3FGBA 4L9OA 4QQEA 2OJYA 4OWRA 3J81g 3BWSA 3C75H 4HDJA 2P9NC 2UZYB 5EM2B 2I0TA 2J55H 3J80g 1ERJA 3RN0D 3N0EA 4O1QD 4ZOXA 4A0BB 4GMBA 1N6DA 3CIKB 4E5ZA 5C2VB 1SHYB 4BUJC 4PXWA 3I7KA 1XIPA 3SMRA 3MKSB 3UVMA 5EAPA 1TYQC 5EMKB 3PSCB 4H5JA 4H5IA 3SWSD 2XL2A 3JAMg 5H1MA 3VH0A 2HKRA 3V7DB 4FB1D 5IJ7E 3AH8B 5B4WA 4AEZA 4J8GA 1XHMA 3CFSB 4PBYA 3SBRA 2H47A 2YNNA 3SN6B 4AOWA 3JZHA 5HE1B 4J79A 1QNIA 3I2NA 4XYIA 4J81A 5FKQA 1N6FA 5EMLB 5EMJB 3DXKC 5IGOA 3ZWLB 2I0RA 3SXTD 4JD2C 2OVPB 3RFGA 2H9LA 2J56H 3C5MA 3OKWA 3C99A 5JWZA 1GG2B 4K3JB 3F3PA 4E54B 4PBZA 3SCYA 4D6VA 4JSXC 2H6KA 2H9PA 4Z8LA 3SJLD 3OL2B 5H17A 2B5MA 4J78A 4FA1D 1VYHC 3JB9L 4ERYA 1XKSA 3PVUB 3OKYA 4A0AB 2Z2PA 4O3UB 5IT9g 2PM9B 4EWRA 2PM6B 1NEXB 1MDAH 3RN1D 2AGYA 1A0RB 4CI8A 3F3GA 2BCJB 5H14A 4TZ4A 4U1EI 4FHLA 2I0SA 5IGQA 2H13A 4FWWA 4GQ2P 3VGZA 2XYIA 4J82A 1B9YA 2HKMA 3PE7A 1NR0A 2YBAA 5EMMB 3AL9A 1OMWB 3U4YA 3I7HA 3MKQA 2H14A 2Z2NA 4J87A 3MZLA 5FA5B 3I8EA 4E54A 3PSLA 4O9DA 3PXSD 3UVNA 2H9NA 5I5MA 3MXXA 3KRWB 4A7JA 4JSNC 4GGAA 2YNPA 4CY3A 3OL2A 1K32A 3I7PA 3EI3B 4ERZA 2I3SA 4R7AB 1JOFA 4A11B 4A09B 4ZN4A 4X61B 4A2LA 4CZYA 2H6QA 4FA9D 2CO0C 3GFCA 5CYKA 2EBSA 4ESGA 3JZNA 4ERQA 4CZXA 3IJCA 4GQBB 3PXTD 3L4OD 2HESX 3IJ1A 5EARA 2P9UC 4J84A 2B4EA 5EALA 4I79A 4XEIC 5TF2A 2O9KA 3EI1B 3UVKA 3EI2A 1OLZA 4IA9A 4J0WA 4PNKB 3SHFA 3SVWD 2IWKA 1GP2B 2IUVA 2YB8B 3CFVA 3EI4A 3SBPA 5IC7A 5IJ8E 3HFQA 5HQGA 5C9ZB 3EMHA 5CXCB 4GM3A 1FWXA 5FKTA 3EG6A 4JSPC 4ZOYA 3K26A 4X60B 4Y7RA 3VA6A 4CY1A 5EM2A 4OZUA 3F3FA 2YMUA 2IAAA 1B9XA 2XU7A 4A0BA 4A11A 1JMZB 4PSXB 4A09A 3JPXA 3UVLA 4K3ID 2B5LA 2XL3A 3I7OA 5AJAA 4U7AA 5FXYA 3RRMC 1PI6A 4BL0A 4ES0A 2QC5A 3GREA 2G9AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JXM A;  3FM0 A;  2AQ5 A;  3JRO A;  1L0Q A;  4LG9 A;  3IIY A;  5FKR A;  3OTT A;  3FRX A;  4NSX A;  4FA5 D;  2HXC A;  2P9L C;  3K27 A;  2IUR A;  4XYH A;  1MG2 A;  4E5Z B;  1U2V C;  2QXV A;  3NVQ A;  4JT5 C;  2IWF A;  3IIW A;  4QT8 A;  4CC9 A;  4PC0 A;  2PBI B;  5CXB B;  5I5J A;  4GQ1 A;  4FAV D;  2GC4 A;  4CI1 A;  1RI6 A;  5GMK n;  2P9I C;  2J57 G;  3MZK A;  2HJB A;  1JMX B;  2IUP A;  4GGC A;  2AGX A;  2CN2 A;  5SXM A;  3IKO A;  4J77 A;  3EWE A;  5CXC A;  4QRJ A;  1R5M A;  4CI2 A;  3UKU C;  2GC7 A;  5AMS A;  4YVD A;  2UZX B;  3C9C A;  1TBG A;  3L4M D;  4LGN A;  5GXI A;  4L1Q D;  2OVR B;  3W15 A;  1SQJ A;  4CI3 A;  3IJ0 A;  5HE3 B;  3UR4 A;  5HE0 B;  3RSE C;  5GXH A;  4A0A A;  2HJ4 A;  3MMY A;  3B7F A;  3ORV D;  2PM9 A;  1N6E A;  2MTA H;  4X63 B;  3SBQ A;  4A08 B;  5C2W B;  4ZOV A;  1PBY B;  2OK4 A;  5K1C C;  2AGZ A;  3PXW D;  3A0F A;  4GGD A;  1MG3 A;  2I3T A;  5TEE A;  4O3T B;  3RFH A;  4ZOZ A;  4L3H D;  3OKY B;  4GZ8 A;  3E0C A;  3NVX A;  3UKR C;  4GM8 A;  3RMZ D;  5CXB A;  2PM7 B;  1GXR A;  2AGW A;  1GOT B;  2GNQ A;  4MK0 B;  4BH6 A;  1PGU A;  2CE9 A;  5A2Q g;  3DWL C;  3JZG A;  4GM9 A;  4UI9 R;  1JJU B;  2AH0 A;  2TRC B;  2AGL A;  2AH1 A;  4N14 A;  2OK6 A;  3I8C A;  4CY5 A;  3V5W B;  3PVW B;  4FA4 D;  4J73 A;  5TEF A;  3RLM D;  4A2M A;  4G56 B;  5KDO B;  5I5I A;  4Y5R D;  2G99 A;  2Z2O A;  4KFM B;  2CNX A;  3EI3 A;  2IUQ A;  2Q7Q A;  3NVN A;  4IMM A;  5FQD A;  1SQ9 A;  2H3X A;  3AL8 B;  3DSM A;  1K8K C;  4L3G D;  1Q47 A;  5EAM A;  2B5N A;  5THA A;  4D0K A;  5GSA A;  4X3E A;  4A08 A;  3V9F A;  2HYE A;  2H68 A;  3JRP A;  4LG8 A;  3N0D A;  3I7N A;  5FLX g;  1S4U X;  2CE8 A;  5K19 A;  2H6N A;  5FKS A;  3ODT A;  2BBK H;  3EI1 A;  2CN3 A;  2P9P C;  2P9S C;  2YNO A;  5CYK B;  4JT6 C;  5HE2 B;  5AFU 3;  3I7L A;  3UVO A;  5TDH B;  1PEV A;  1YFQ A;  3BG1 A;  3P4F A;  2H9M A;  4J8B A;  3EU7 A;  3I89 A;  3DM0 A;  3OKT A;  3KRX B;  2W18 A;  2CO0 A;  4JSV C;  4J0X A;  3SLE D;  4FAN D;  3EI2 B;  3DXM C;  3AFC A;  2OVQ B;  5HYN B;  4QL1 A;  3SFZ A;  2OIZ A;  4O45 A;  2P9K C;  3BG0 A;  4PSW B;  3OW8 A;  1P22 A;  1U4C A;  3ULE C;  4CY2 A;  4J86 A;  3AL8 A;  3EI4 B;  4CZV A;  3FGB A;  4L9O A;  4QQE A;  2OJY A;  4OWR A;  3J81 g;  3BWS A;  3C75 H;  4HDJ A;  2P9N C;  2UZY B;  5EM2 B;  2I0T A;  2J55 H;  3J80 g;  1ERJ A;  3RN0 D;  3N0E A;  4O1Q D;  4ZOX A;  4A0B B;  4GMB A;  1N6D A;  3CIK B;  4E5Z A;  5C2V B;  1SHY B;  4BUJ C;  4PXW A;  3I7K A;  1XIP A;  3SMR A;  3MKS B;  3UVM A;  5EAP A;  1TYQ C;  5EMK B;  3PSC B;  4H5J A;  4H5I A;  3SWS D;  2XL2 A;  3JAM g;  5H1M A;  3VH0 A;  2HKR A;  3V7D B;  4FB1 D;  5IJ7 E;  3AH8 B;  5B4W A;  4AEZ A;  4J8G A;  1XHM A;  3CFS B;  4PBY A;  3SBR A;  2H47 A;  2YNN A;  3SN6 B;  4AOW A;  3JZH A;  5HE1 B;  4J79 A;  1QNI A;  3I2N A;  4XYI A;  4J81 A;  5FKQ A;  1N6F A;  5EML B;  5EMJ B;  3DXK C;  5IGO A;  3ZWL B;  2I0R A;  3SXT D;  4JD2 C;  2OVP B;  3RFG A;  2H9L A;  2J56 H;  3C5M A;  3OKW A;  3C99 A;  5JWZ A;  1GG2 B;  4K3J B;  3F3P A;  4E54 B;  4PBZ A;  3SCY A;  4D6V A;  4JSX C;  2H6K A;  2H9P A;  4Z8L A;  3SJL D;  3OL2 B;  5H17 A;  2B5M A;  4J78 A;  4FA1 D;  1VYH C;  3JB9 L;  4ERY A;  1XKS A;  3PVU B;  3OKY A;  4A0A B;  2Z2P A;  4O3U B;  5IT9 g;  2PM9 B;  4EWR A;  2PM6 B;  1NEX B;  1MDA H;  3RN1 D;  2AGY A;  1A0R B;  4CI8 A;  3F3G A;  2BCJ B;  5H14 A;  4TZ4 A;  4U1E I;  4FHL A;  2I0S A;  5IGQ A;  2H13 A;  4FWW A;  4GQ2 P;  3VGZ A;  2XYI A;  4J82 A;  1B9Y A;  2HKM A;  3PE7 A;  1NR0 A;  2YBA A;  5EMM B;  3AL9 A;  1OMW B;  3U4Y A;  3I7H A;  3MKQ A;  2H14 A;  2Z2N A;  4J87 A;  3MZL A;  5FA5 B;  3I8E A;  4E54 A;  3PSL A;  4O9D A;  3PXS D;  3UVN A;  2H9N A;  5I5M A;  3MXX A;  3KRW B;  4A7J A;  4JSN C;  4GGA A;  2YNP A;  4CY3 A;  3OL2 A;  1K32 A;  3I7P A;  3EI3 B;  4ERZ A;  2I3S A;  4R7A B;  1JOF A;  4A11 B;  4A09 B;  4ZN4 A;  4X61 B;  4A2L A;  4CZY A;  2H6Q A;  4FA9 D;  2CO0 C;  3GFC A;  5CYK A;  2EBS A;  4ESG A;  3JZN A;  4ERQ A;  4CZX A;  3IJC A;  4GQB B;  3PXT D;  3L4O D;  2HES X;  3IJ1 A;  5EAR A;  2P9U C;  4J84 A;  2B4E A;  5EAL A;  4I79 A;  4XEI C;  5TF2 A;  2O9K A;  3EI1 B;  3UVK A;  3EI2 A;  1OLZ A;  4IA9 A;  4J0W A;  4PNK B;  3SHF A;  3SVW D;  2IWK A;  1GP2 B;  2IUV A;  2YB8 B;  3CFV A;  3EI4 A;  3SBP A;  5IC7 A;  5IJ8 E;  3HFQ A;  5HQG A;  5C9Z B;  3EMH A;  5CXC B;  4GM3 A;  1FWX A;  5FKT A;  3EG6 A;  4JSP C;  4ZOY A;  3K26 A;  4X60 B;  4Y7R A;  3VA6 A;  4CY1 A;  5EM2 A;  4OZU A;  3F3F A;  2YMU A;  2IAA A;  1B9X A;  2XU7 A;  4A0B A;  4A11 A;  1JMZ B;  4PSX B;  4A09 A;  3JPX A;  3UVL A;  4K3I D;  2B5L A;  2XL3 A;  3I7O A;  5AJA A;  4U7A A;  5FXY A;  3RRM C;  1PI6 A;  4BL0 A;  4ES0 A;  2QC5 A;  3GRE A;  2G9A A; 
#chains in the Genus database with same CATH topology
 4JXM A;  3FM0 A;  2AQ5 A;  3JRO A;  1L0Q A;  4LG9 A;  3IIY A;  3NIG A;  3OTT A;  5FKR A;  3FRX A;  4NSX A;  4FA5 D;  2HXC A;  2P9L C;  3K27 A;  2IUR A;  4XYH A;  1MG2 A;  4E5Z B;  1U2V C;  2QXV A;  3NVQ A;  4JT5 C;  1GOG A;  2IWF A;  3IIW A;  4QT8 A;  4CC9 A;  4UM9 A;  2QZP A;  2VDO A;  4PC0 A;  2PBI B;  5CXB B;  5I5J A;  4GQ1 A;  4FAV D;  2GC4 A;  4CI1 A;  1RI6 A;  1O6G A;  5GMK n;  2P9I C;  2J57 G;  3MZK A;  2HJB A;  1JMX B;  3NIF A;  2IUP A;  2HU5 A;  4GGC A;  3QI0 A;  2AGX A;  2CN2 A;  5SXM A;  3IKO A;  4J77 A;  3EWE A;  5CXC A;  4QRJ A;  1R5M A;  4CI2 A;  3UKU C;  4DNU A;  3DDU A;  5FFG A;  2GC7 A;  5AMS A;  4YVD A;  4BCB A;  2UZX B;  3C9C A;  1TBG A;  3L4M D;  4LGN A;  5GXI A;  4L1Q D;  2OVR B;  3W15 A;  1SQJ A;  4CI3 A;  3IJ0 A;  5HE3 B;  2VDR A;  3UR4 A;  2VZ3 A;  5HE0 B;  3RSE C;  5GXH A;  4A0A A;  2HJ4 A;  3MMY A;  3B7F A;  3ORV D;  2HU8 A;  2PM9 A;  1N6E A;  1VZ2 A;  3MVD K;  2MTA H;  4X63 B;  3SBQ A;  4A08 B;  5C2W B;  3ZE2 A;  4O02 A;  4ZOV A;  3OF7 A;  1PBY B;  2OK4 A;  3MUN A;  3O4G A;  5K1C C;  2AGZ A;  3PXW D;  3A0F A;  3ZDZ A;  3FCU A;  4GGD A;  1MG3 A;  2I3T A;  1C9I A;  5TEE A;  4O3T B;  3RFH A;  2EIC A;  4ZOZ A;  4L3H D;  3OKY B;  4GZ8 A;  3E0C A;  4AMZ A;  3NVX A;  3K71 A;  3UKR C;  4GM8 A;  3RMZ D;  5CXB A;  2PM7 B;  1GXR A;  1H2Z A;  1BPO A;  2AGW A;  1GOT B;  3ZE0 A;  4NEN A;  2GNQ A;  4D9S A;  4MK0 B;  4BH6 A;  1PGU A;  2CE9 A;  5A2Q g;  3DWL C;  3JZG A;  4GM9 A;  4UI9 R;  1JJU B;  2EIE A;  2AH0 A;  4G1E A;  2BKL A;  3FCS A;  2TRC B;  2AGL A;  2AH1 A;  4N14 A;  4BP9 A;  2OK6 A;  3I8C A;  4CY5 A;  3V5W B;  3PVW B;  4FA4 D;  4J73 A;  5M5U A;  5TEF A;  3RLM D;  4A2M A;  4QAM A;  4G56 B;  5KDO B;  5I5I A;  4Y5R D;  1TYE A;  3ZDY A;  2G99 A;  2Z2O A;  4KFM B;  2CNX A;  3EI3 A;  2IUQ A;  2Q7Q A;  3NVN A;  4IMM A;  5FQD A;  1SQ9 A;  2H3X A;  3AL8 B;  3DSM A;  1K8K C;  4L3G D;  1Q47 A;  5EAM A;  2B5N A;  5THA A;  4D0K A;  5GSA A;  4X3E A;  4A08 A;  3V9F A;  5C92 A;  2HYE A;  3ZE1 A;  2H68 A;  3JRP A;  4LG8 A;  3N0D A;  2VZ1 A;  3I7N A;  5FLX g;  1S4U X;  2CE8 A;  5K19 A;  4AMY A;  2H6N A;  1M1X A;  5FKS A;  3ODT A;  2BBK H;  3EI1 A;  2CN3 A;  2P9P C;  2P9S C;  4BP8 A;  2YNO A;  5CYK B;  3V4P A;  4JT6 C;  5HE2 B;  5AFU 3;  2EIB A;  3I7L A;  3UVO A;  5TDH B;  1PEV A;  1YFQ A;  3BG1 A;  3EQ7 A;  3P4F A;  2H9M A;  4J8B A;  1C9L A;  3EU7 A;  4Z7N A;  4JHP C;  3I89 A;  3DM0 A;  3OKT A;  1VE7 A;  3KRX B;  2W18 A;  2CO0 A;  4JSV C;  3K72 A;  4J0X A;  3SLE D;  4FAN D;  2VDQ A;  3EI2 B;  3DXM C;  4L1M A;  3AFC A;  4MMX A;  2OVQ B;  5HYN B;  4QL1 A;  3SFZ A;  2OIZ A;  4O45 A;  2P9K C;  3BG0 A;  5C86 A;  4PSW B;  3OW8 A;  1JV2 A;  1P22 A;  1U4C A;  3ULE C;  5E6R A;  4CY2 A;  4J86 A;  1UOP A;  3AL8 A;  3EI4 B;  3O4H A;  4CZV A;  3FGB A;  3O4J A;  4L9O A;  4QQE A;  2OJY A;  4OWR A;  4WK2 A;  3J81 g;  3BWS A;  3C75 H;  4HDJ A;  2P9N C;  4AN0 A;  2UZY B;  5EM2 B;  2I0T A;  2J55 H;  3J80 g;  1ERJ A;  3RN0 D;  3N0E A;  4O1Q D;  4ZOX A;  3IUR A;  4A0B B;  4GMB A;  1N6D A;  3CIK B;  5M5R A;  4E5Z A;  5C2V B;  1SHY B;  4BUJ C;  4WJK A;  4PXW A;  1E8N A;  3I7K A;  1XIP A;  3SMR A;  3MKS B;  3UVM A;  3KCI A;  1JTD B;  1TYQ C;  5EAP A;  5EMK B;  3PSC B;  3VI3 A;  3IUJ A;  4H5J A;  4H5I A;  3SWS D;  2XL2 A;  4NAA A;  3JAM g;  5H1M A;  3VH0 A;  2HKR A;  3V7D B;  4FB1 D;  3GD1 I;  5IJ7 E;  4DNV A;  1H2X A;  3AH8 B;  5B4W A;  4AEZ A;  4J8G A;  1XHM A;  3CFS B;  4PBY A;  3SBR A;  2H47 A;  2YNN A;  3SN6 B;  4AOW A;  2XZG A;  3JZH A;  5HE1 B;  4J79 A;  1QNI A;  3I2N A;  4XYI A;  4J81 A;  2WQ8 A;  5FKQ A;  1N6F A;  5EML B;  1YR2 A;  5EMJ B;  3DXK C;  5IGO A;  3ZWL B;  2I0R A;  1H2Y A;  3EQ8 A;  3MUO A;  3SXT D;  1I2M B;  2VDN A;  4JD2 C;  2OVP B;  3RFG A;  2H9L A;  2J56 H;  3C5M A;  3OKW A;  4BCD A;  5FFO A;  3C99 A;  5JWZ A;  1GG2 B;  4K3J B;  3F3P A;  4E54 B;  4PBZ A;  3SCY A;  1O6F A;  4BCC A;  4D6V A;  4NC4 A;  4JSX C;  4WK4 A;  1A12 A;  2H6K A;  2H9P A;  2JKX A;  4Z8L A;  3SJL D;  3OL2 B;  3IJE A;  5H17 A;  2B5M A;  3EQ9 A;  4J78 A;  4FA1 D;  1VYH C;  5M61 A;  3JB9 L;  1L5G A;  4ERY A;  4DNW A;  3QHY B;  1XKS A;  5M5T A;  3PVU B;  3ZDX A;  3OKY A;  4A0A B;  2Z2P A;  4O3U B;  5IT9 g;  4O2W A;  2PM9 B;  5M5V A;  4EWR A;  4MMY A;  2PM6 B;  1NEX B;  1VE6 A;  1MDA H;  1H2W A;  3RN1 D;  2AGY A;  1A0R B;  3IUM A;  2XE4 A;  5HDB A;  4CI8 A;  3F3G A;  2BCJ B;  4AN1 A;  5H14 A;  4TZ4 A;  1VZ3 A;  4U1E I;  4IRZ A;  4FHL A;  2I0S A;  5IGQ A;  2H13 A;  4FWW A;  1K3I A;  4GQ2 P;  4G55 A;  3VGZ A;  2XYI A;  4J82 A;  1B9Y A;  2HKM A;  3PE7 A;  2XDW A;  1NR0 A;  2YBA A;  3GC3 B;  5EMM B;  4WK0 A;  3AL9 A;  1OMW B;  3U4Y A;  5M5S A;  3I7H A;  3MKQ A;  2H14 A;  2Z2N A;  4J87 A;  2QR5 A;  3MZL A;  5FA5 B;  3I8E A;  4E54 A;  3PSL A;  4O9D A;  3PXS D;  3IUN A;  2H9N A;  3UVN A;  5I5M A;  3MXX A;  3T3P A;  3KRW B;  4A7J A;  4JSN C;  4GGA A;  2YNP A;  4CY3 A;  5E6U A;  3OL2 A;  1E5T A;  1K32 A;  3I7P A;  3EI3 B;  4AX4 A;  2I3S A;  4ERZ A;  4R7A B;  1JOF A;  4A11 B;  4Z7O A;  4A09 B;  4ZN4 A;  4JHN A;  4NBM A;  4X61 B;  3V4V A;  4A2L A;  4CZY A;  2H6Q A;  3T3M A;  4FA9 D;  2CO0 C;  3GFC A;  1UOQ A;  5CYK A;  2EBS A;  4ESG A;  4UM8 A;  3JZN A;  4ERQ A;  4CZX A;  3IUQ A;  1GOH A;  4Z7Q A;  2VDK A;  3IJC A;  1UOO A;  2EID A;  2VDL A;  4GQB B;  3PXT D;  3L4O D;  4RE5 A;  3NID A;  1UTC A;  2HES X;  3IJ1 A;  5EAR A;  2P9U C;  4J84 A;  2B4E A;  5EAL A;  4I79 A;  4XEI C;  5TF2 A;  2O9K A;  3EI1 B;  3UVK A;  3EI2 A;  2HU7 A;  1OLZ A;  4IA9 A;  4J0W A;  3O4I A;  4PNK B;  1QFM A;  3SHF A;  2IWK A;  1GP2 B;  3SVW D;  4MMZ A;  3IVM A;  2IUV A;  1E8M A;  2YB8 B;  3CFV A;  3EI4 A;  4RE6 A;  3SBP A;  5IC7 A;  5IJ8 E;  3HFQ A;  5HQG A;  5C9Z B;  4G1M A;  3EMH A;  5E6S A;  3IUL A;  5CXC B;  4GM3 A;  1FWX A;  1QFS A;  5FKT A;  3K6S A;  3EG6 A;  4JSP C;  4ZOY A;  3K26 A;  4X60 B;  4Y7R A;  3VA6 A;  4CY1 A;  5EM2 A;  4OZU A;  3F3F A;  2YMU A;  2IAA A;  2VDM A;  1B9X A;  2XU7 A;  4A0B A;  4A11 A;  2VC2 A;  1JMZ B;  4PSX B;  4A09 A;  3JPX A;  3VI4 A;  3UVL A;  4K3I D;  2B5L A;  2XL3 A;  3I7O A;  5AJA A;  4U7A A;  5FXY A;  1GOF A;  1U8C A;  2VDP A;  3RRM C;  1PI6 A;  4BL0 A;  4ES0 A;  2QC5 A;  3GRE A;  1T2X A;  2G9A A; 
#chains in the Genus database with same CATH homology
 4JXM A;  3FM0 A;  2AQ5 A;  3JRO A;  1L0Q A;  4LG9 A;  3IIY A;  5FKR A;  3OTT A;  3FRX A;  4NSX A;  4FA5 D;  2HXC A;  2P9L C;  3K27 A;  2IUR A;  4XYH A;  1MG2 A;  4E5Z B;  1U2V C;  2QXV A;  3NVQ A;  4JT5 C;  2IWF A;  3IIW A;  4QT8 A;  4CC9 A;  4PC0 A;  2PBI B;  5CXB B;  5I5J A;  4GQ1 A;  4FAV D;  2GC4 A;  4CI1 A;  1RI6 A;  5GMK n;  2P9I C;  2J57 G;  3MZK A;  2HJB A;  1JMX B;  2IUP A;  4GGC A;  2AGX A;  2CN2 A;  5SXM A;  3IKO A;  4J77 A;  3EWE A;  5CXC A;  4QRJ A;  1R5M A;  4CI2 A;  3UKU C;  2GC7 A;  5AMS A;  4YVD A;  2UZX B;  3C9C A;  1TBG A;  3L4M D;  4LGN A;  5GXI A;  4L1Q D;  2OVR B;  3W15 A;  1SQJ A;  4CI3 A;  3IJ0 A;  5HE3 B;  3UR4 A;  5HE0 B;  3RSE C;  5GXH A;  4A0A A;  2HJ4 A;  3MMY A;  3B7F A;  3ORV D;  2PM9 A;  1N6E A;  2MTA H;  4X63 B;  3SBQ A;  4A08 B;  5C2W B;  4ZOV A;  1PBY B;  2OK4 A;  5K1C C;  2AGZ A;  3PXW D;  3A0F A;  4GGD A;  1MG3 A;  2I3T A;  5TEE A;  4O3T B;  3RFH A;  4ZOZ A;  4L3H D;  3OKY B;  4GZ8 A;  3E0C A;  3NVX A;  3UKR C;  4GM8 A;  3RMZ D;  5CXB A;  2PM7 B;  1GXR A;  2AGW A;  1GOT B;  2GNQ A;  4MK0 B;  4BH6 A;  1PGU A;  2CE9 A;  5A2Q g;  3DWL C;  3JZG A;  4GM9 A;  4UI9 R;  1JJU B;  2AH0 A;  2TRC B;  2AGL A;  2AH1 A;  4N14 A;  2OK6 A;  3I8C A;  4CY5 A;  3V5W B;  3PVW B;  4FA4 D;  4J73 A;  5TEF A;  3RLM D;  4A2M A;  4G56 B;  5KDO B;  5I5I A;  4Y5R D;  2G99 A;  2Z2O A;  4KFM B;  2CNX A;  3EI3 A;  2IUQ A;  2Q7Q A;  3NVN A;  4IMM A;  5FQD A;  1SQ9 A;  2H3X A;  3AL8 B;  3DSM A;  1K8K C;  4L3G D;  1Q47 A;  5EAM A;  2B5N A;  5THA A;  4D0K A;  5GSA A;  4X3E A;  4A08 A;  3V9F A;  2HYE A;  2H68 A;  3JRP A;  4LG8 A;  3N0D A;  3I7N A;  5FLX g;  1S4U X;  2CE8 A;  5K19 A;  2H6N A;  5FKS A;  3ODT A;  2BBK H;  3EI1 A;  2CN3 A;  2P9P C;  2P9S C;  2YNO A;  5CYK B;  4JT6 C;  5HE2 B;  5AFU 3;  3I7L A;  3UVO A;  5TDH B;  1PEV A;  1YFQ A;  3BG1 A;  3P4F A;  2H9M A;  4J8B A;  3EU7 A;  3I89 A;  3DM0 A;  3OKT A;  3KRX B;  2W18 A;  2CO0 A;  4JSV C;  4J0X A;  3SLE D;  4FAN D;  3EI2 B;  3DXM C;  3AFC A;  2OVQ B;  5HYN B;  4QL1 A;  3SFZ A;  2OIZ A;  4O45 A;  2P9K C;  3BG0 A;  4PSW B;  3OW8 A;  1P22 A;  1U4C A;  3ULE C;  4CY2 A;  4J86 A;  3AL8 A;  3EI4 B;  4CZV A;  3FGB A;  4L9O A;  4QQE A;  2OJY A;  4OWR A;  3J81 g;  3BWS A;  3C75 H;  4HDJ A;  2P9N C;  2UZY B;  5EM2 B;  2I0T A;  2J55 H;  3J80 g;  1ERJ A;  3RN0 D;  3N0E A;  4O1Q D;  4ZOX A;  4A0B B;  4GMB A;  1N6D A;  3CIK B;  4E5Z A;  5C2V B;  1SHY B;  4BUJ C;  4PXW A;  3I7K A;  1XIP A;  3SMR A;  3MKS B;  3UVM A;  5EAP A;  1TYQ C;  5EMK B;  3PSC B;  4H5J A;  4H5I A;  3SWS D;  2XL2 A;  3JAM g;  5H1M A;  3VH0 A;  2HKR A;  3V7D B;  4FB1 D;  5IJ7 E;  3AH8 B;  5B4W A;  4AEZ A;  4J8G A;  1XHM A;  3CFS B;  4PBY A;  3SBR A;  2H47 A;  2YNN A;  3SN6 B;  4AOW A;  3JZH A;  5HE1 B;  4J79 A;  1QNI A;  3I2N A;  4XYI A;  4J81 A;  5FKQ A;  1N6F A;  5EML B;  5EMJ B;  3DXK C;  5IGO A;  3ZWL B;  2I0R A;  3SXT D;  4JD2 C;  2OVP B;  3RFG A;  2H9L A;  2J56 H;  3C5M A;  3OKW A;  3C99 A;  5JWZ A;  1GG2 B;  4K3J B;  3F3P A;  4E54 B;  4PBZ A;  3SCY A;  4D6V A;  4JSX C;  2H6K A;  2H9P A;  4Z8L A;  3SJL D;  3OL2 B;  5H17 A;  2B5M A;  4J78 A;  4FA1 D;  1VYH C;  3JB9 L;  4ERY A;  1XKS A;  3PVU B;  3OKY A;  4A0A B;  2Z2P A;  4O3U B;  5IT9 g;  2PM9 B;  4EWR A;  2PM6 B;  1NEX B;  1MDA H;  3RN1 D;  2AGY A;  1A0R B;  4CI8 A;  3F3G A;  2BCJ B;  5H14 A;  4TZ4 A;  4U1E I;  4FHL A;  2I0S A;  5IGQ A;  2H13 A;  4FWW A;  4GQ2 P;  3VGZ A;  2XYI A;  4J82 A;  1B9Y A;  2HKM A;  3PE7 A;  1NR0 A;  2YBA A;  5EMM B;  3AL9 A;  1OMW B;  3U4Y A;  3I7H A;  3MKQ A;  2H14 A;  2Z2N A;  4J87 A;  3MZL A;  5FA5 B;  3I8E A;  4E54 A;  3PSL A;  4O9D A;  3PXS D;  3UVN A;  2H9N A;  5I5M A;  3MXX A;  3KRW B;  4A7J A;  4JSN C;  4GGA A;  2YNP A;  4CY3 A;  3OL2 A;  1K32 A;  3I7P A;  3EI3 B;  4ERZ A;  2I3S A;  4R7A B;  1JOF A;  4A11 B;  4A09 B;  4ZN4 A;  4X61 B;  4A2L A;  4CZY A;  2H6Q A;  4FA9 D;  2CO0 C;  3GFC A;  5CYK A;  2EBS A;  4ESG A;  3JZN A;  4ERQ A;  4CZX A;  3IJC A;  4GQB B;  3PXT D;  3L4O D;  2HES X;  3IJ1 A;  5EAR A;  2P9U C;  4J84 A;  2B4E A;  5EAL A;  4I79 A;  4XEI C;  5TF2 A;  2O9K A;  3EI1 B;  3UVK A;  3EI2 A;  1OLZ A;  4IA9 A;  4J0W A;  4PNK B;  3SHF A;  3SVW D;  2IWK A;  1GP2 B;  2IUV A;  2YB8 B;  3CFV A;  3EI4 A;  3SBP A;  5IC7 A;  5IJ8 E;  3HFQ A;  5HQG A;  5C9Z B;  3EMH A;  5CXC B;  4GM3 A;  1FWX A;  5FKT A;  3EG6 A;  4JSP C;  4ZOY A;  3K26 A;  4X60 B;  4Y7R A;  3VA6 A;  4CY1 A;  5EM2 A;  4OZU A;  3F3F A;  2YMU A;  2IAA A;  1B9X A;  2XU7 A;  4A0B A;  4A11 A;  1JMZ B;  4PSX B;  4A09 A;  3JPX A;  3UVL A;  4K3I D;  2B5L A;  2XL3 A;  3I7O A;  5AJA A;  4U7A A;  5FXY A;  3RRM C;  1PI6 A;  4BL0 A;  4ES0 A;  2QC5 A;  3GRE A;  2G9A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...