4CY3A

Crystal structure of the nsl1-wds complex.
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
303
structure length
303
Chain Sequence
KPNYTLKFTLAGHTKAVSAVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVRTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQSKEVVQKLQGHTDTVLCTACHPTENIIASAALENDKTIKLWKSDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords PROTEIN WILL DIE SLOWLY
publication title Structural Analysis of the Kansl1/Wdr5/Kansl2 Complex Reveals that Wdr5 is Required for Efficient Assembly and Chromatin Targeting of the Nsl Complex.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 101
structure length 303
sequence length 303
ec nomenclature
pdb deposition date 2014-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4cy3A00
4CY5A 2YNOA 4OZUA 4J8GA 4H5IA 2PM9A 2YNPA 5GMKn 2J57G 4OWRA 3AL8B 4QQEA 5FKQA 2P9PC 5CYKB 3L4MD 4QT8A 2CNXA 4GQ1A 1GP2B 2AH1A 2P9LC 3I7KA 4A0AB 2H13A 4J0XA 4A2MA 3RSEC 1PGUA 2BBKH 3DWLC 4ERQA 3RN1D 3K26A 2HJBA 2P9NC 2Z2PA 2OVQB 4LG9A 4D0KA 3I7PA 3DSMA 3PVUB 3CFVA 3PSLA 4A08B 3MKSB 5CXBB 5FKRA 3AL8A 5AFU3 1JJUB 4JSXC 5FKTA 1TBGA 3OL2B 4X63B 1RI6A 2H9MA 4GGCA 4U1EI 3UR4A 1P22A 1XKSA 5CYKA 3DM0A 2I0SA 5IJ8E 4A0AA 4J77A 4JT6C 2CE8A 2Q7QA 2H9PA 4Z8LA 5HQGA 4IA9A 3I8CA 2HYEA 1GG2B 4J84A 4O9DA 3MZLA 3I7NA 5FKSA 2H47A 1B9XA 4CY2A 4A08A 5CXBA 4O1QD 4N14A 3OL2A 4FHLA 5IT9g 5EAMA 3EU7A 5AMSA 4J87A 3BG0A 4CY1A 5H1MA 2B5MA 5IJ7E 2AGWA 3EI2B 2IUPA 3GREA 3NVNA 5IGQA 4BUJC 5H14A 3V7DB 4J78A 3DXMC 3NVXA 1GXRA 3V9FA 4CI3A 3U4YA 3SN6B 4I79A 4JSNC 4Y7RA 3RRMC 3V5WB 3JZGA 5EMJB 5TF2A 3N0DA 1PBYB 2EBSA 4XEIC 2H14A 3VGZA 3EI3B 4H5JA 2H9LA 4U7AA 4J0WA 3IIWA 3RFHA 5I5IA 2YMUA 4QRJA 5FQDA 4ERYA 3AFCA 2IWKA 4GQ2P 4LGNA 1MDAH 4PC0A 4ZN4A 3ODTA 3I89A 1NEXB 2OVPB 5HE0B 2GC7A 3VA6A 3C75H 2I0RA 3F3FA 2XU7A 4J79A 3EI2A 4PSXB 4ZOYA 3PE7A 1U2VC 4A11A 4CI2A 1TYQC 4GGAA 4GMBA 4PNKB 5HYNB 1ERJA 4L1QD 4BH6A 3PXTD 5IC7A 4L3HD 5K19A 3IIYA 1A0RB 5HE3B 3EI3A 4O45A 5THAA 3EI4B 3EI1B 4GM8A 5EALA 4J73A 2OK4A 2OK6A 5EMMB 2XL2A 1K8KC 3ULEC 3ORVD 1YFQA 2UZYB 5C2VB 4XYIA 4AEZA 5TEEA 5TEFA 3IKOA 3JROA 2Z2NA 3GFCA 4CI8A 4L3GD 4J8BA 2AGXA 3OKTA 3RMZD 4A2LA 4PBZA 3SBQA 2H68A 3I7LA 2GC4A 3EI4A 2H3XA 3UVKA 2PM6B 3JZHA 5A2Qg 3EI1A 3EMHA 2HJ4A 4UI9R 1PEVA 2CO0C 5H17A 3I8EA 1SQJA 3KRXB 5FA5B 3OTTA 3BWSA 2OIZA 2QXVA 4X61B 4X3EA 4ESGA 2I3TA 4ZOZA 2Z2OA 3SLED 2AGZA 2TRCB 1S4UX 3EWEA 2G9AA 3IJCA 3UKUC 4CZVA 2HKMA 3A0FA 4R7AB 4L9OA 3OKYB 3PVWB 3VH0A 4FAND 4ES0A 2J55H 3C9CA 4LG8A 2H6KA 3F3PA 3I7OA 2CN3A 2H6QA 2CE9A 2B5NA 3W15A 4D6VA 2P9IC 4E5ZB 2HXCA 2YB8B 4J81A 2P9UC 5JWZA 3PSCB 4ERZA 1N6EA 3FRXA 3ZWLB 2YNNA 2H6NA 3SBRA 4PSWB 2O9KA 3SWSD 3EG6A 5HE2B 1GOTB 4JT5C 3MZKA 2G99A 3FM0A 3JB9L 4O3UB 2MTAH 3OKYA 2YBAA 3DXKC 4A09B 4X60B 2XYIA 1SHYB 5EMKB 3SFZA 4EWRA 5GSAA 5B4WA 4ZOXA 2B5LA 4GQBB 3E0CA 5CXCB 4KFMB 5EAPA 3PXSD 2QC5A 2AGYA 3SVWD 4TZ4A 5FLXg 1OLZA 4NSXA 5C2WB 2W18A 3RLMD 1VYHC 1JMXB 4E5ZA 3KRWB 2XL3A 1JMZB 4CZYA 1XIPA 4JXMA 3IJ1A 2CO0A 2UZXB 3UKRC 2IUQA 1U4CA 2IAAA 4J86A 3SCYA 3UVLA 1QNIA 1FWXA 3J80g 5HE1B 4YVDA 5KDOB 4FA9D 4A09A 4JSPC 3I2NA 4PBYA 4MK0B 2B4EA 5CXCA 5GXHA 2PM7B 5C9ZB 4CY3A 4O3TB 3MXXA 2I0TA 4E54B 1NR0A 4G56B 3OKWA 1L0QA 1Q47A 4FWWA 3UVNA 1N6DA 1XHMA 5FXYA 4CI1A 4A0BB 1K32A 3IJ0A 5EMLB 2AQ5A 5IGOA 4GM3A 5EM2B 2IUVA 2CN2A 1SQ9A 3OW8A 4JD2C 3JZNA 3P4FA 4GZ8A 3BG1A 3FGBA 4FA1D 1MG3A 4HDJA 3RN0D 3AL9A 3N0EA 5EARA 3NVQA 5K1CC 5GXIA 4E54A 2IURA 2P9SC 3JAMg 4A0BA 4GM9A 5I5JA 4K3ID 3CFSB 3HFQA 3J81g 4K3JB 5EM2A 2OVRB 5AJAA 4BL0A 2HESX 3PXWD 3SHFA 2AGLA 3F3GA 1PI6A 1B9YA 3SXTD 3SMRA 4Y5RD 2IWFA 2AH0A 3AH8B 1N6FA 3C5MA 4JSVC 3SJLD 4AOWA 2GNQA 2P9KC 1JOFA 4A7JA 3I7HA 3UVOA 3MKQA 4CC9A 4A11B 2I3SA 3C99A 2PM9B 4FA5D 2H9NA 4XYHA 1R5MA 4FAVD 4FB1D 3JPXA 2OJYA 1OMWB 2BCJB 3JRPA 4FA4D 2J56H 5I5MA 2PBIB 3B7FA 3CIKB 3K27A 3MMYA 4QL1A 4GGDA 1MG2A 4ZOVA 3L4OD 4J82A 3RFGA 4PXWA 3SBPA 2HKRA 5TDHB 3UVMA 4CZXA 5SXMA 4IMMA
chains in the Genus database with same CATH superfamily
4CY5A 2YNOA 4OZUA 1YR2A 4J8GA 5M5RA 4H5IA 2PM9A 2YNPA 5GMKn 2J57G 4OWRA 3AL8B 5E6SA 4QQEA 5FKQA 2VDKA 3IVMA 2P9PC 5CYKB 3L4MD 4QT8A 2CNXA 3QI0A 4GQ1A 1GP2B 4MMZA 5M5SA 2AH1A 2P9LC 3I7KA 4A0AB 2H13A 2VDQA 4J0XA 4A2MA 3RSEC 1PGUA 2BBKH 3DWLC 4ERQA 3RN1D 3K26A 2HJBA 2P9NC 2Z2PA 2OVQB 4NBMA 4WJKA 4LG9A 4D0KA 3I7PA 2VZ1A 3DSMA 3PVUB 2VDRA 3CFVA 3PSLA 4A08B 3MKSB 5CXBB 1C9LA 5FKRA 3AL8A 5AFU3 1JJUB 4JSXC 5FKTA 1TBGA 3OL2B 4X63B 3KCIA 3EQ7A 1RI6A 2H9MA 4G1EA 4GGCA 1H2XA 1P22A 4U1EI 3UR4A 1XKSA 5CYKA 3EQ9A 3DM0A 5E6RA 2I0SA 1UTCA 1O6GA 4AX4A 5IJ8E 3O4HA 4A0AA 4J77A 4JT6C 5M5VA 2CE8A 2Q7QA 2EIEA 2H9PA 4Z8LA 5HQGA 4IA9A 4BCDA 3I8CA 4BP9A 1GG2B 1L5GA 4J84A 4O9DA 2HYEA 3MZLA 1H2ZA 1VZ3A 3I7NA 5FKSA 2H47A 1B9XA 4CY2A 4A08A 5CXBA 4O1QD 3IULA 4N14A 3OL2A 4FHLA 5IT9g 5EAMA 3EU7A 4D9SA 5AMSA 4UM8A 4J87A 3NIGA 3BG0A 4CY1A 2HU7A 5H1MA 2B5MA 5IJ7E 2AGWA 2VZ3A 3EI2B 2IUPA 3GREA 3NVNA 5IGQA 4BUJC 3O4JA 4MMYA 4NENA 5H14A 3V7DB 4J78A 3DXMC 3NVXA 1GXRA 3V9FA 4CI3A 3IUQA 3SN6B 4I79A 3U4YA 4JSNC 4Y7RA 3RRMC 3V5WB 3JZGA 5EMJB 5TF2A 3N0DA 1PBYB 2EBSA 4XEIC 2H14A 3VGZA 3EI3B 4H5JA 4MMXA 2H9LA 1H2YA 1JTDB 3IIWA 4J0WA 4U7AA 3RFHA 3NIFA 4DNWA 5I5IA 2YMUA 4QRJA 5FQDA 4ERYA 3AFCA 2IWKA 4GQ2P 4LGNA 1MDAH 4PC0A 4ZN4A 3ODTA 3I89A 1NEXB 2OVPB 2XZGA 4RE5A 2GC7A 5HE0B 3VA6A 3C75H 2I0RA 3F3FA 2XU7A 4J79A 1O6FA 3EI2A 4PSXB 4ZOYA 3PE7A 5HDBA 3ZE1A 1U2VC 4A11A 5C92A 4CI2A 1TYQC 2HU5A 2WQ8A 4GGAA 4GMBA 4PNKB 5HYNB 4JHPC 1ERJA 4L1QD 4BH6A 3PXTD 5IC7A 4L3HD 5K19A 2HU8A 3IIYA 1A0RB 5HE3B 3EI3A 4O45A 5THAA 3EI4B 3EI1B 4AMZA 4GM8A 5EALA 4O02A 4J73A 3T3PA 1C9IA 2OK4A 2OK6A 5EMMB 2XL2A 2VDPA 1K8KC 3ULEC 4G1MA 3ORVD 1YFQA 2UZYB 3IJEA 1UOOA 5C2VB 4XYIA 4AEZA 5TEEA 5TEFA 3IKOA 3JROA 2Z2NA 3GFCA 4CI8A 1TYEA 4L3GD 4J8BA 2AGXA 3OKTA 1A12A 3RMZD 4A2LA 4PBZA 3SBQA 2H68A 3I7LA 4AN1A 2GC4A 3EI4A 2H3XA 3UVKA 2PM6B 3JZHA 5A2Qg 3EI1A 3EMHA 2HJ4A 4UI9R 1PEVA 2CO0C 5H17A 3I8EA 1SQJA 3KRXB 5FA5B 3OTTA 3BWSA 2OIZA 3IUJA 2QXVA 4X61B 1JV2A 4X3EA 4ESGA 2I3TA 4ZOZA 2Z2OA 3SLED 2AGZA 3ZDYA 2TRCB 1S4UX 3EWEA 2G9AA 3IJCA 3UKUC 3EQ8A 3QHYB 3DDUA 4CZVA 1GOGA 2HKMA 4IRZA 3A0FA 4R7AB 4L9OA 3OKYB 3PVWB 3VH0A 4FAND 4ES0A 2VDNA 2J55H 3C9CA 4LG8A 2H6KA 3OF7A 3F3PA 3I7OA 2CN3A 2H6QA 2CE9A 2B5NA 3W15A 4D6VA 2P9IC 4E5ZB 2HXCA 2YB8B 3ZE0A 4J81A 2P9UC 5JWZA 5M5TA 3PSCB 4ERZA 1N6EA 3FRXA 3ZWLB 2YNNA 2H6NA 3SBRA 4PSWB 2O9KA 3SWSD 2EICA 1T2XA 2JKXA 2XDWA 3EG6A 5HE2B 1GOTB 1VE6A 4JT5C 1QFSA 3MZKA 2G99A 3FM0A 3JB9L 1GOHA 4O3UB 1E8MA 2MTAH 3V4VA 3OKYA 2YBAA 3DXKC 3ZDXA 4A09B 4X60B 2XYIA 1SHYB 5EMKB 3SFZA 4EWRA 5GSAA 5B4WA 4ZOXA 2B5LA 4GQBB 3E0CA 5CXCB 4KFMB 5EAPA 3VI3A 3PXSD 2QC5A 2AGYA 4QAMA 3SVWD 4TZ4A 3ZDZA 5FLXg 1OLZA 4NSXA 5C2WB 2W18A 3RLMD 1VYHC 1JMXB 4WK2A 4E5ZA 3VI4A 3KRWB 2VDLA 2XL3A 1JMZB 1QFMA 4CZYA 1XIPA 4JXMA 3IJ1A 2CO0A 2UZXB 3UKRC 4AN0A 2IUQA 1U4CA 2IAAA 4J86A 3SCYA 3UVLA 4WK0A 1QNIA 1FWXA 3J80g 2VC2A 4JHNA 5HE1B 4YVDA 5KDOB 4FA9D 4A09A 4JSPC 3I2NA 4PBYA 4MK0B 2B4EA 5CXCA 5GXHA 2QZPA 4NC4A 5M61A 2PM7B 3IUMA 5C9ZB 4CY3A 3K71A 4L1MA 4O3TB 1K3IA 3MXXA 3O4IA 2QR5A 2I0TA 4E54B 1NR0A 4G56B 1H2WA 3OKWA 1L0QA 1Q47A 4FWWA 3UVNA 1N6DA 1XHMA 1VZ2A 5FXYA 4CI1A 4A0BB 5M5UA 1K32A 3IJ0A 5EMLB 2AQ5A 5IGOA 4BP8A 1UOQA 4GM3A 4BCBA 3MVDK 1VE7A 4Z7QA 5EM2B 2IUVA 3O4GA 1U8CA 3V4PA 2CN2A 1M1XA 1SQ9A 3OW8A 4JD2C 3JZNA 3P4FA 4GZ8A 2VDMA 3BG1A 3FGBA 4AMYA 4FA1D 1MG3A 4HDJA 3RN0D 3AL9A 5E6UA 3N0EA 3MUNA 5EARA 3NVQA 3IUNA 5K1CC 5GXIA 4G55A 4E54A 2IURA 4NAAA 2P9SC 3JAMg 4A0BA 2BKLA 3GD1I 4GM9A 5I5JA 4K3ID 3CFSB 3HFQA 4DNVA 3J81g 4RE6A 3NIDA 4K3JB 3FCSA 5EM2A 2OVRB 5AJAA 4UM9A 4BL0A 2HESX 3PXWD 5FFOA 4Z7OA 4DNUA 3SHFA 2AGLA 3F3GA 1PI6A 1B9YA 5C86A 3SXTD 3SMRA 3MUOA 4BCCA 4Y5RD 2IWFA 2AH0A 3AH8B 2EIBA 3FCUA 2EIDA 1N6FA 3C5MA 4JSVC 3SJLD 4AOWA 2GNQA 2P9KC 1JOFA 4A7JA 3I7HA 3UVOA 3MKQA 4CC9A 3K6SA 4Z7NA 4A11B 2I3SA 3C99A 4O2WA 2PM9B 4FA5D 2H9NA 4XYHA 1R5MA 4FAVD 4FB1D 3JPXA 2OJYA 2BCJB 1E5TA 3JRPA 3ZE2A 4FA4D 2VDOA 1BPOA 1I2MB 2J56H 5I5MA 2PBIB 3B7FA 3CIKB 3K27A 3MMYA 4QL1A 4GGDA 4WK4A 3GC3B 1MG2A 4ZOVA 3L4OD 2XE4A 3K72A 3IURA 4J82A 3RFGA 4PXWA 3SBPA 2HKRA 5TDHB 3UVMA 3T3MA 1UOPA 4CZXA 5SXMA 1E8NA 5FFGA 1GOFA 4IMMA 1OMWB
chains in the Genus database with same CATH topology
4CY5A 2YNOA 4OZUA 4J8GA 4H5IA 2PM9A 2YNPA 5GMKn 2J57G 4OWRA 3AL8B 4QQEA 5FKQA 2P9PC 5CYKB 3L4MD 4QT8A 2CNXA 4GQ1A 1GP2B 2AH1A 2P9LC 3I7KA 4A0AB 2H13A 4J0XA 4A2MA 3RSEC 1PGUA 2BBKH 3DWLC 4ERQA 3RN1D 3K26A 2HJBA 2P9NC 2Z2PA 2OVQB 4LG9A 4D0KA 3I7PA 3DSMA 3PVUB 3CFVA 3PSLA 4A08B 3MKSB 5CXBB 5FKRA 3AL8A 5AFU3 1JJUB 4JSXC 5FKTA 1TBGA 3OL2B 4X63B 1RI6A 2H9MA 4GGCA 4U1EI 3UR4A 1P22A 1XKSA 5CYKA 3DM0A 2I0SA 5IJ8E 4A0AA 4J77A 4JT6C 2CE8A 2Q7QA 2H9PA 4Z8LA 5HQGA 4IA9A 3I8CA 2HYEA 1GG2B 4J84A 4O9DA 3MZLA 3I7NA 5FKSA 2H47A 1B9XA 4CY2A 4A08A 5CXBA 4O1QD 4N14A 3OL2A 4FHLA 5IT9g 5EAMA 3EU7A 5AMSA 4J87A 3BG0A 4CY1A 5H1MA 2B5MA 5IJ7E 2AGWA 3EI2B 2IUPA 3GREA 3NVNA 5IGQA 4BUJC 5H14A 3V7DB 4J78A 3DXMC 3NVXA 1GXRA 3V9FA 4CI3A 3U4YA 3SN6B 4I79A 4JSNC 4Y7RA 3RRMC 3V5WB 3JZGA 5EMJB 5TF2A 3N0DA 1PBYB 2EBSA 4XEIC 2H14A 3VGZA 3EI3B 4H5JA 2H9LA 4U7AA 4J0WA 3IIWA 3RFHA 5I5IA 2YMUA 4QRJA 5FQDA 4ERYA 3AFCA 2IWKA 4GQ2P 4LGNA 1MDAH 4PC0A 4ZN4A 3ODTA 3I89A 1NEXB 2OVPB 5HE0B 2GC7A 3VA6A 3C75H 2I0RA 3F3FA 2XU7A 4J79A 3EI2A 4PSXB 4ZOYA 3PE7A 1U2VC 4A11A 4CI2A 1TYQC 4GGAA 4GMBA 4PNKB 5HYNB 1ERJA 4L1QD 4BH6A 3PXTD 5IC7A 4L3HD 5K19A 3IIYA 1A0RB 5HE3B 3EI3A 4O45A 5THAA 3EI4B 3EI1B 4GM8A 5EALA 4J73A 2OK4A 2OK6A 5EMMB 2XL2A 1K8KC 3ULEC 3ORVD 1YFQA 2UZYB 5C2VB 4XYIA 4AEZA 5TEEA 5TEFA 3IKOA 3JROA 2Z2NA 3GFCA 4CI8A 4L3GD 4J8BA 2AGXA 3OKTA 3RMZD 4A2LA 4PBZA 3SBQA 2H68A 3I7LA 2GC4A 3EI4A 2H3XA 3UVKA 2PM6B 3JZHA 5A2Qg 3EI1A 3EMHA 2HJ4A 4UI9R 1PEVA 2CO0C 5H17A 3I8EA 1SQJA 3KRXB 5FA5B 3OTTA 3BWSA 2OIZA 2QXVA 4X61B 4X3EA 4ESGA 2I3TA 4ZOZA 2Z2OA 3SLED 2AGZA 2TRCB 1S4UX 3EWEA 2G9AA 3IJCA 3UKUC 4CZVA 2HKMA 3A0FA 4R7AB 4L9OA 3OKYB 3PVWB 3VH0A 4FAND 4ES0A 2J55H 3C9CA 4LG8A 2H6KA 3F3PA 3I7OA 2CN3A 2H6QA 2CE9A 2B5NA 3W15A 4D6VA 2P9IC 4E5ZB 2HXCA 2YB8B 4J81A 2P9UC 5JWZA 3PSCB 4ERZA 1N6EA 3FRXA 3ZWLB 2YNNA 2H6NA 3SBRA 4PSWB 2O9KA 3SWSD 3EG6A 5HE2B 1GOTB 4JT5C 3MZKA 2G99A 3FM0A 3JB9L 4O3UB 2MTAH 3OKYA 2YBAA 3DXKC 4A09B 4X60B 2XYIA 1SHYB 5EMKB 3SFZA 4EWRA 5GSAA 5B4WA 4ZOXA 2B5LA 4GQBB 3E0CA 5CXCB 4KFMB 5EAPA 3PXSD 2QC5A 2AGYA 3SVWD 4TZ4A 5FLXg 1OLZA 4NSXA 5C2WB 2W18A 3RLMD 1VYHC 1JMXB 4E5ZA 3KRWB 2XL3A 1JMZB 4CZYA 1XIPA 4JXMA 3IJ1A 2CO0A 2UZXB 3UKRC 2IUQA 1U4CA 2IAAA 4J86A 3SCYA 3UVLA 1QNIA 1FWXA 3J80g 5HE1B 4YVDA 5KDOB 4FA9D 4A09A 4JSPC 3I2NA 4PBYA 4MK0B 2B4EA 5CXCA 5GXHA 2PM7B 5C9ZB 4CY3A 4O3TB 3MXXA 2I0TA 4E54B 1NR0A 4G56B 3OKWA 1L0QA 1Q47A 4FWWA 3UVNA 1N6DA 1XHMA 5FXYA 4CI1A 4A0BB 1K32A 3IJ0A 5EMLB 2AQ5A 5IGOA 4GM3A 5EM2B 2IUVA 2CN2A 1SQ9A 3OW8A 4JD2C 3JZNA 3P4FA 4GZ8A 3BG1A 3FGBA 4FA1D 1MG3A 4HDJA 3RN0D 3AL9A 3N0EA 5EARA 3NVQA 5K1CC 5GXIA 4E54A 2IURA 2P9SC 3JAMg 4A0BA 4GM9A 5I5JA 4K3ID 3CFSB 3HFQA 3J81g 4K3JB 5EM2A 2OVRB 5AJAA 4BL0A 2HESX 3PXWD 3SHFA 2AGLA 3F3GA 1PI6A 1B9YA 3SXTD 3SMRA 4Y5RD 2IWFA 2AH0A 3AH8B 1N6FA 3C5MA 4JSVC 3SJLD 4AOWA 2GNQA 2P9KC 1JOFA 4A7JA 3I7HA 3UVOA 3MKQA 4CC9A 4A11B 2I3SA 3C99A 2PM9B 4FA5D 2H9NA 4XYHA 1R5MA 4FAVD 4FB1D 3JPXA 2OJYA 1OMWB 2BCJB 3JRPA 4FA4D 2J56H 5I5MA 2PBIB 3B7FA 3CIKB 3K27A 3MMYA 4QL1A 4GGDA 1MG2A 4ZOVA 3L4OD 4J82A 3RFGA 4PXWA 3SBPA 2HKRA 5TDHB 3UVMA 4CZXA 5SXMA 4IMMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CY5 A;  2YNO A;  4OZU A;  4J8G A;  4H5I A;  2PM9 A;  2YNP A;  5GMK n;  2J57 G;  4OWR A;  3AL8 B;  4QQE A;  5FKQ A;  2P9P C;  5CYK B;  3L4M D;  4QT8 A;  2CNX A;  4GQ1 A;  1GP2 B;  2AH1 A;  2P9L C;  3I7K A;  4A0A B;  2H13 A;  4J0X A;  4A2M A;  3RSE C;  1PGU A;  2BBK H;  3DWL C;  4ERQ A;  3RN1 D;  3K26 A;  2HJB A;  2P9N C;  2Z2P A;  2OVQ B;  4LG9 A;  4D0K A;  3I7P A;  3DSM A;  3PVU B;  3CFV A;  3PSL A;  4A08 B;  3MKS B;  5CXB B;  5FKR A;  3AL8 A;  5AFU 3;  1JJU B;  4JSX C;  5FKT A;  1TBG A;  3OL2 B;  4X63 B;  1RI6 A;  2H9M A;  4GGC A;  4U1E I;  3UR4 A;  1P22 A;  1XKS A;  5CYK A;  3DM0 A;  2I0S A;  5IJ8 E;  4A0A A;  4J77 A;  4JT6 C;  2CE8 A;  2Q7Q A;  2H9P A;  4Z8L A;  5HQG A;  4IA9 A;  3I8C A;  2HYE A;  1GG2 B;  4J84 A;  4O9D A;  3MZL A;  3I7N A;  5FKS A;  2H47 A;  1B9X A;  4CY2 A;  4A08 A;  5CXB A;  4O1Q D;  4N14 A;  3OL2 A;  4FHL A;  5IT9 g;  5EAM A;  3EU7 A;  5AMS A;  4J87 A;  3BG0 A;  4CY1 A;  5H1M A;  2B5M A;  5IJ7 E;  2AGW A;  3EI2 B;  2IUP A;  3GRE A;  3NVN A;  5IGQ A;  4BUJ C;  5H14 A;  3V7D B;  4J78 A;  3DXM C;  3NVX A;  1GXR A;  3V9F A;  4CI3 A;  3U4Y A;  3SN6 B;  4I79 A;  4JSN C;  4Y7R A;  3RRM C;  3V5W B;  3JZG A;  5EMJ B;  5TF2 A;  3N0D A;  1PBY B;  2EBS A;  4XEI C;  2H14 A;  3VGZ A;  3EI3 B;  4H5J A;  2H9L A;  4U7A A;  4J0W A;  3IIW A;  3RFH A;  5I5I A;  2YMU A;  4QRJ A;  5FQD A;  4ERY A;  3AFC A;  2IWK A;  4GQ2 P;  4LGN A;  1MDA H;  4PC0 A;  4ZN4 A;  3ODT A;  3I89 A;  1NEX B;  2OVP B;  5HE0 B;  2GC7 A;  3VA6 A;  3C75 H;  2I0R A;  3F3F A;  2XU7 A;  4J79 A;  3EI2 A;  4PSX B;  4ZOY A;  3PE7 A;  1U2V C;  4A11 A;  4CI2 A;  1TYQ C;  4GGA A;  4GMB A;  4PNK B;  5HYN B;  1ERJ A;  4L1Q D;  4BH6 A;  3PXT D;  5IC7 A;  4L3H D;  5K19 A;  3IIY A;  1A0R B;  5HE3 B;  3EI3 A;  4O45 A;  5THA A;  3EI4 B;  3EI1 B;  4GM8 A;  5EAL A;  4J73 A;  2OK4 A;  2OK6 A;  5EMM B;  2XL2 A;  1K8K C;  3ULE C;  3ORV D;  1YFQ A;  2UZY B;  5C2V B;  4XYI A;  4AEZ A;  5TEE A;  5TEF A;  3IKO A;  3JRO A;  2Z2N A;  3GFC A;  4CI8 A;  4L3G D;  4J8B A;  2AGX A;  3OKT A;  3RMZ D;  4A2L A;  4PBZ A;  3SBQ A;  2H68 A;  3I7L A;  2GC4 A;  3EI4 A;  2H3X A;  3UVK A;  2PM6 B;  3JZH A;  5A2Q g;  3EI1 A;  3EMH A;  2HJ4 A;  4UI9 R;  1PEV A;  2CO0 C;  5H17 A;  3I8E A;  1SQJ A;  3KRX B;  5FA5 B;  3OTT A;  3BWS A;  2OIZ A;  2QXV A;  4X61 B;  4X3E A;  4ESG A;  2I3T A;  4ZOZ A;  2Z2O A;  3SLE D;  2AGZ A;  2TRC B;  1S4U X;  3EWE A;  2G9A A;  3IJC A;  3UKU C;  4CZV A;  2HKM A;  3A0F A;  4R7A B;  4L9O A;  3OKY B;  3PVW B;  3VH0 A;  4FAN D;  4ES0 A;  2J55 H;  3C9C A;  4LG8 A;  2H6K A;  3F3P A;  3I7O A;  2CN3 A;  2H6Q A;  2CE9 A;  2B5N A;  3W15 A;  4D6V A;  2P9I C;  4E5Z B;  2HXC A;  2YB8 B;  4J81 A;  2P9U C;  5JWZ A;  3PSC B;  4ERZ A;  1N6E A;  3FRX A;  3ZWL B;  2YNN A;  2H6N A;  3SBR A;  4PSW B;  2O9K A;  3SWS D;  3EG6 A;  5HE2 B;  1GOT B;  4JT5 C;  3MZK A;  2G99 A;  3FM0 A;  3JB9 L;  4O3U B;  2MTA H;  3OKY A;  2YBA A;  3DXK C;  4A09 B;  4X60 B;  2XYI A;  1SHY B;  5EMK B;  3SFZ A;  4EWR A;  5GSA A;  5B4W A;  4ZOX A;  2B5L A;  4GQB B;  3E0C A;  5CXC B;  4KFM B;  5EAP A;  3PXS D;  2QC5 A;  2AGY A;  3SVW D;  4TZ4 A;  5FLX g;  1OLZ A;  4NSX A;  5C2W B;  2W18 A;  3RLM D;  1VYH C;  1JMX B;  4E5Z A;  3KRW B;  2XL3 A;  1JMZ B;  4CZY A;  1XIP A;  4JXM A;  3IJ1 A;  2CO0 A;  2UZX B;  3UKR C;  2IUQ A;  1U4C A;  2IAA A;  4J86 A;  3SCY A;  3UVL A;  1QNI A;  1FWX A;  3J80 g;  5HE1 B;  4YVD A;  5KDO B;  4FA9 D;  4A09 A;  4JSP C;  3I2N A;  4PBY A;  4MK0 B;  2B4E A;  5CXC A;  5GXH A;  2PM7 B;  5C9Z B;  4CY3 A;  4O3T B;  3MXX A;  2I0T A;  4E54 B;  1NR0 A;  4G56 B;  3OKW A;  1L0Q A;  1Q47 A;  4FWW A;  3UVN A;  1N6D A;  1XHM A;  5FXY A;  4CI1 A;  4A0B B;  1K32 A;  3IJ0 A;  5EML B;  2AQ5 A;  5IGO A;  4GM3 A;  5EM2 B;  2IUV A;  2CN2 A;  1SQ9 A;  3OW8 A;  4JD2 C;  3JZN A;  3P4F A;  4GZ8 A;  3BG1 A;  3FGB A;  4FA1 D;  1MG3 A;  4HDJ A;  3RN0 D;  3AL9 A;  3N0E A;  5EAR A;  3NVQ A;  5K1C C;  5GXI A;  4E54 A;  2IUR A;  2P9S C;  3JAM g;  4A0B A;  4GM9 A;  5I5J A;  4K3I D;  3CFS B;  3HFQ A;  3J81 g;  4K3J B;  5EM2 A;  2OVR B;  5AJA A;  4BL0 A;  2HES X;  3PXW D;  3SHF A;  2AGL A;  3F3G A;  1PI6 A;  1B9Y A;  3SXT D;  3SMR A;  4Y5R D;  2IWF A;  2AH0 A;  3AH8 B;  1N6F A;  3C5M A;  4JSV C;  3SJL D;  4AOW A;  2GNQ A;  2P9K C;  1JOF A;  4A7J A;  3I7H A;  3UVO A;  3MKQ A;  4CC9 A;  4A11 B;  2I3S A;  3C99 A;  2PM9 B;  4FA5 D;  2H9N A;  4XYH A;  1R5M A;  4FAV D;  4FB1 D;  3JPX A;  2OJY A;  1OMW B;  2BCJ B;  3JRP A;  4FA4 D;  2J56 H;  5I5M A;  2PBI B;  3B7F A;  3CIK B;  3K27 A;  3MMY A;  4QL1 A;  4GGD A;  1MG2 A;  4ZOV A;  3L4O D;  4J82 A;  3RFG A;  4PXW A;  3SBP A;  2HKR A;  5TDH B;  3UVM A;  4CZX A;  5SXM A;  4IMM A; 
#chains in the Genus database with same CATH topology
 4CY5 A;  2YNO A;  4OZU A;  1YR2 A;  4J8G A;  5M5R A;  4H5I A;  2PM9 A;  2YNP A;  5GMK n;  2J57 G;  4OWR A;  3AL8 B;  5E6S A;  4QQE A;  5FKQ A;  2VDK A;  3IVM A;  2P9P C;  5CYK B;  3L4M D;  4QT8 A;  2CNX A;  3QI0 A;  4GQ1 A;  1GP2 B;  4MMZ A;  5M5S A;  2AH1 A;  2P9L C;  3I7K A;  4A0A B;  2H13 A;  2VDQ A;  4J0X A;  4A2M A;  3RSE C;  1PGU A;  2BBK H;  3DWL C;  4ERQ A;  3RN1 D;  3K26 A;  2HJB A;  2P9N C;  2Z2P A;  2OVQ B;  4NBM A;  4WJK A;  4LG9 A;  4D0K A;  3I7P A;  2VZ1 A;  3DSM A;  3PVU B;  2VDR A;  3CFV A;  3PSL A;  4A08 B;  3MKS B;  5CXB B;  1C9L A;  5FKR A;  3AL8 A;  5AFU 3;  1JJU B;  4JSX C;  5FKT A;  1TBG A;  3OL2 B;  4X63 B;  3KCI A;  3EQ7 A;  1RI6 A;  2H9M A;  4G1E A;  4GGC A;  1H2X A;  1P22 A;  4U1E I;  3UR4 A;  1XKS A;  5CYK A;  3EQ9 A;  3DM0 A;  5E6R A;  2I0S A;  1UTC A;  1O6G A;  4AX4 A;  5IJ8 E;  3O4H A;  4A0A A;  4J77 A;  4JT6 C;  5M5V A;  2CE8 A;  2Q7Q A;  2EIE A;  2H9P A;  4Z8L A;  5HQG A;  4IA9 A;  4BCD A;  3I8C A;  4BP9 A;  1GG2 B;  1L5G A;  4J84 A;  4O9D A;  2HYE A;  3MZL A;  1H2Z A;  1VZ3 A;  3I7N A;  5FKS A;  2H47 A;  1B9X A;  4CY2 A;  4A08 A;  5CXB A;  4O1Q D;  3IUL A;  4N14 A;  3OL2 A;  4FHL A;  5IT9 g;  5EAM A;  3EU7 A;  4D9S A;  5AMS A;  4UM8 A;  4J87 A;  3NIG A;  3BG0 A;  4CY1 A;  2HU7 A;  5H1M A;  2B5M A;  5IJ7 E;  2AGW A;  2VZ3 A;  3EI2 B;  2IUP A;  3GRE A;  3NVN A;  5IGQ A;  4BUJ C;  3O4J A;  4MMY A;  4NEN A;  5H14 A;  3V7D B;  4J78 A;  3DXM C;  3NVX A;  1GXR A;  3V9F A;  4CI3 A;  3IUQ A;  3SN6 B;  4I79 A;  3U4Y A;  4JSN C;  4Y7R A;  3RRM C;  3V5W B;  3JZG A;  5EMJ B;  5TF2 A;  3N0D A;  1PBY B;  2EBS A;  4XEI C;  2H14 A;  3VGZ A;  3EI3 B;  4H5J A;  4MMX A;  2H9L A;  1H2Y A;  1JTD B;  3IIW A;  4J0W A;  4U7A A;  3RFH A;  3NIF A;  4DNW A;  5I5I A;  2YMU A;  4QRJ A;  5FQD A;  4ERY A;  3AFC A;  2IWK A;  4GQ2 P;  4LGN A;  1MDA H;  4PC0 A;  4ZN4 A;  3ODT A;  3I89 A;  1NEX B;  2OVP B;  2XZG A;  4RE5 A;  2GC7 A;  5HE0 B;  3VA6 A;  3C75 H;  2I0R A;  3F3F A;  2XU7 A;  4J79 A;  1O6F A;  3EI2 A;  4PSX B;  4ZOY A;  3PE7 A;  5HDB A;  3ZE1 A;  1U2V C;  4A11 A;  5C92 A;  4CI2 A;  1TYQ C;  2HU5 A;  2WQ8 A;  4GGA A;  4GMB A;  4PNK B;  5HYN B;  4JHP C;  1ERJ A;  4L1Q D;  4BH6 A;  3PXT D;  5IC7 A;  4L3H D;  5K19 A;  2HU8 A;  3IIY A;  1A0R B;  5HE3 B;  3EI3 A;  4O45 A;  5THA A;  3EI4 B;  3EI1 B;  4AMZ A;  4GM8 A;  5EAL A;  4O02 A;  4J73 A;  3T3P A;  1C9I A;  2OK4 A;  2OK6 A;  5EMM B;  2XL2 A;  2VDP A;  1K8K C;  3ULE C;  4G1M A;  3ORV D;  1YFQ A;  2UZY B;  3IJE A;  1UOO A;  5C2V B;  4XYI A;  4AEZ A;  5TEE A;  5TEF A;  3IKO A;  3JRO A;  2Z2N A;  3GFC A;  4CI8 A;  1TYE A;  4L3G D;  4J8B A;  2AGX A;  3OKT A;  1A12 A;  3RMZ D;  4A2L A;  4PBZ A;  3SBQ A;  2H68 A;  3I7L A;  4AN1 A;  2GC4 A;  3EI4 A;  2H3X A;  3UVK A;  2PM6 B;  3JZH A;  5A2Q g;  3EI1 A;  3EMH A;  2HJ4 A;  4UI9 R;  1PEV A;  2CO0 C;  5H17 A;  3I8E A;  1SQJ A;  3KRX B;  5FA5 B;  3OTT A;  3BWS A;  2OIZ A;  3IUJ A;  2QXV A;  4X61 B;  1JV2 A;  4X3E A;  4ESG A;  2I3T A;  4ZOZ A;  2Z2O A;  3SLE D;  2AGZ A;  3ZDY A;  2TRC B;  1S4U X;  3EWE A;  2G9A A;  3IJC A;  3UKU C;  3EQ8 A;  3QHY B;  3DDU A;  4CZV A;  1GOG A;  2HKM A;  4IRZ A;  3A0F A;  4R7A B;  4L9O A;  3OKY B;  3PVW B;  3VH0 A;  4FAN D;  4ES0 A;  2VDN A;  2J55 H;  3C9C A;  4LG8 A;  2H6K A;  3OF7 A;  3F3P A;  3I7O A;  2CN3 A;  2H6Q A;  2CE9 A;  2B5N A;  3W15 A;  4D6V A;  2P9I C;  4E5Z B;  2HXC A;  2YB8 B;  3ZE0 A;  4J81 A;  2P9U C;  5JWZ A;  5M5T A;  3PSC B;  4ERZ A;  1N6E A;  3FRX A;  3ZWL B;  2YNN A;  2H6N A;  3SBR A;  4PSW B;  2O9K A;  3SWS D;  2EIC A;  1T2X A;  2JKX A;  2XDW A;  3EG6 A;  5HE2 B;  1GOT B;  1VE6 A;  4JT5 C;  1QFS A;  3MZK A;  2G99 A;  3FM0 A;  3JB9 L;  1GOH A;  4O3U B;  1E8M A;  2MTA H;  3V4V A;  3OKY A;  2YBA A;  3DXK C;  3ZDX A;  4A09 B;  4X60 B;  2XYI A;  1SHY B;  5EMK B;  3SFZ A;  4EWR A;  5GSA A;  5B4W A;  4ZOX A;  2B5L A;  4GQB B;  3E0C A;  5CXC B;  4KFM B;  5EAP A;  3VI3 A;  3PXS D;  2QC5 A;  2AGY A;  4QAM A;  3SVW D;  4TZ4 A;  3ZDZ A;  5FLX g;  1OLZ A;  4NSX A;  5C2W B;  2W18 A;  3RLM D;  1VYH C;  1JMX B;  4WK2 A;  4E5Z A;  3VI4 A;  3KRW B;  2VDL A;  2XL3 A;  1JMZ B;  1QFM A;  4CZY A;  1XIP A;  4JXM A;  3IJ1 A;  2CO0 A;  2UZX B;  3UKR C;  4AN0 A;  2IUQ A;  1U4C A;  2IAA A;  4J86 A;  3SCY A;  3UVL A;  4WK0 A;  1QNI A;  1FWX A;  3J80 g;  2VC2 A;  4JHN A;  5HE1 B;  4YVD A;  5KDO B;  4FA9 D;  4A09 A;  4JSP C;  3I2N A;  4PBY A;  4MK0 B;  2B4E A;  5CXC A;  5GXH A;  2QZP A;  4NC4 A;  5M61 A;  2PM7 B;  3IUM A;  5C9Z B;  4CY3 A;  3K71 A;  4L1M A;  4O3T B;  1K3I A;  3MXX A;  3O4I A;  2QR5 A;  2I0T A;  4E54 B;  1NR0 A;  4G56 B;  1H2W A;  3OKW A;  1L0Q A;  1Q47 A;  4FWW A;  3UVN A;  1N6D A;  1XHM A;  1VZ2 A;  5FXY A;  4CI1 A;  4A0B B;  5M5U A;  1K32 A;  3IJ0 A;  5EML B;  2AQ5 A;  5IGO A;  4BP8 A;  1UOQ A;  4GM3 A;  4BCB A;  3MVD K;  1VE7 A;  4Z7Q A;  5EM2 B;  2IUV A;  3O4G A;  1U8C A;  3V4P A;  2CN2 A;  1M1X A;  1SQ9 A;  3OW8 A;  4JD2 C;  3JZN A;  3P4F A;  4GZ8 A;  2VDM A;  3BG1 A;  3FGB A;  4AMY A;  4FA1 D;  1MG3 A;  4HDJ A;  3RN0 D;  3AL9 A;  5E6U A;  3N0E A;  3MUN A;  5EAR A;  3NVQ A;  3IUN A;  5K1C C;  5GXI A;  4G55 A;  4E54 A;  2IUR A;  4NAA A;  2P9S C;  3JAM g;  4A0B A;  2BKL A;  3GD1 I;  4GM9 A;  5I5J A;  4K3I D;  3CFS B;  3HFQ A;  4DNV A;  3J81 g;  4RE6 A;  3NID A;  4K3J B;  3FCS A;  5EM2 A;  2OVR B;  5AJA A;  4UM9 A;  4BL0 A;  2HES X;  3PXW D;  5FFO A;  4Z7O A;  4DNU A;  3SHF A;  2AGL A;  3F3G A;  1PI6 A;  1B9Y A;  5C86 A;  3SXT D;  3SMR A;  3MUO A;  4BCC A;  4Y5R D;  2IWF A;  2AH0 A;  3AH8 B;  2EIB A;  3FCU A;  2EID A;  1N6F A;  3C5M A;  4JSV C;  3SJL D;  4AOW A;  2GNQ A;  2P9K C;  1JOF A;  4A7J A;  3I7H A;  3UVO A;  3MKQ A;  4CC9 A;  3K6S A;  4Z7N A;  4A11 B;  2I3S A;  3C99 A;  4O2W A;  2PM9 B;  4FA5 D;  2H9N A;  4XYH A;  1R5M A;  4FAV D;  4FB1 D;  3JPX A;  2OJY A;  2BCJ B;  1E5T A;  3JRP A;  3ZE2 A;  4FA4 D;  2VDO A;  1BPO A;  1I2M B;  2J56 H;  5I5M A;  2PBI B;  3B7F A;  3CIK B;  3K27 A;  3MMY A;  4QL1 A;  4GGD A;  4WK4 A;  3GC3 B;  1MG2 A;  4ZOV A;  3L4O D;  2XE4 A;  3K72 A;  3IUR A;  4J82 A;  3RFG A;  4PXW A;  3SBP A;  2HKR A;  5TDH B;  3UVM A;  3T3M A;  1UOP A;  4CZX A;  5SXM A;  1E8N A;  5FFG A;  1GOF A;  4IMM A;  1OMW B; 
#chains in the Genus database with same CATH homology
 4CY5 A;  2YNO A;  4OZU A;  4J8G A;  4H5I A;  2PM9 A;  2YNP A;  5GMK n;  2J57 G;  4OWR A;  3AL8 B;  4QQE A;  5FKQ A;  2P9P C;  5CYK B;  3L4M D;  4QT8 A;  2CNX A;  4GQ1 A;  1GP2 B;  2AH1 A;  2P9L C;  3I7K A;  4A0A B;  2H13 A;  4J0X A;  4A2M A;  3RSE C;  1PGU A;  2BBK H;  3DWL C;  4ERQ A;  3RN1 D;  3K26 A;  2HJB A;  2P9N C;  2Z2P A;  2OVQ B;  4LG9 A;  4D0K A;  3I7P A;  3DSM A;  3PVU B;  3CFV A;  3PSL A;  4A08 B;  3MKS B;  5CXB B;  5FKR A;  3AL8 A;  5AFU 3;  1JJU B;  4JSX C;  5FKT A;  1TBG A;  3OL2 B;  4X63 B;  1RI6 A;  2H9M A;  4GGC A;  4U1E I;  3UR4 A;  1P22 A;  1XKS A;  5CYK A;  3DM0 A;  2I0S A;  5IJ8 E;  4A0A A;  4J77 A;  4JT6 C;  2CE8 A;  2Q7Q A;  2H9P A;  4Z8L A;  5HQG A;  4IA9 A;  3I8C A;  2HYE A;  1GG2 B;  4J84 A;  4O9D A;  3MZL A;  3I7N A;  5FKS A;  2H47 A;  1B9X A;  4CY2 A;  4A08 A;  5CXB A;  4O1Q D;  4N14 A;  3OL2 A;  4FHL A;  5IT9 g;  5EAM A;  3EU7 A;  5AMS A;  4J87 A;  3BG0 A;  4CY1 A;  5H1M A;  2B5M A;  5IJ7 E;  2AGW A;  3EI2 B;  2IUP A;  3GRE A;  3NVN A;  5IGQ A;  4BUJ C;  5H14 A;  3V7D B;  4J78 A;  3DXM C;  3NVX A;  1GXR A;  3V9F A;  4CI3 A;  3U4Y A;  3SN6 B;  4I79 A;  4JSN C;  4Y7R A;  3RRM C;  3V5W B;  3JZG A;  5EMJ B;  5TF2 A;  3N0D A;  1PBY B;  2EBS A;  4XEI C;  2H14 A;  3VGZ A;  3EI3 B;  4H5J A;  2H9L A;  4U7A A;  4J0W A;  3IIW A;  3RFH A;  5I5I A;  2YMU A;  4QRJ A;  5FQD A;  4ERY A;  3AFC A;  2IWK A;  4GQ2 P;  4LGN A;  1MDA H;  4PC0 A;  4ZN4 A;  3ODT A;  3I89 A;  1NEX B;  2OVP B;  5HE0 B;  2GC7 A;  3VA6 A;  3C75 H;  2I0R A;  3F3F A;  2XU7 A;  4J79 A;  3EI2 A;  4PSX B;  4ZOY A;  3PE7 A;  1U2V C;  4A11 A;  4CI2 A;  1TYQ C;  4GGA A;  4GMB A;  4PNK B;  5HYN B;  1ERJ A;  4L1Q D;  4BH6 A;  3PXT D;  5IC7 A;  4L3H D;  5K19 A;  3IIY A;  1A0R B;  5HE3 B;  3EI3 A;  4O45 A;  5THA A;  3EI4 B;  3EI1 B;  4GM8 A;  5EAL A;  4J73 A;  2OK4 A;  2OK6 A;  5EMM B;  2XL2 A;  1K8K C;  3ULE C;  3ORV D;  1YFQ A;  2UZY B;  5C2V B;  4XYI A;  4AEZ A;  5TEE A;  5TEF A;  3IKO A;  3JRO A;  2Z2N A;  3GFC A;  4CI8 A;  4L3G D;  4J8B A;  2AGX A;  3OKT A;  3RMZ D;  4A2L A;  4PBZ A;  3SBQ A;  2H68 A;  3I7L A;  2GC4 A;  3EI4 A;  2H3X A;  3UVK A;  2PM6 B;  3JZH A;  5A2Q g;  3EI1 A;  3EMH A;  2HJ4 A;  4UI9 R;  1PEV A;  2CO0 C;  5H17 A;  3I8E A;  1SQJ A;  3KRX B;  5FA5 B;  3OTT A;  3BWS A;  2OIZ A;  2QXV A;  4X61 B;  4X3E A;  4ESG A;  2I3T A;  4ZOZ A;  2Z2O A;  3SLE D;  2AGZ A;  2TRC B;  1S4U X;  3EWE A;  2G9A A;  3IJC A;  3UKU C;  4CZV A;  2HKM A;  3A0F A;  4R7A B;  4L9O A;  3OKY B;  3PVW B;  3VH0 A;  4FAN D;  4ES0 A;  2J55 H;  3C9C A;  4LG8 A;  2H6K A;  3F3P A;  3I7O A;  2CN3 A;  2H6Q A;  2CE9 A;  2B5N A;  3W15 A;  4D6V A;  2P9I C;  4E5Z B;  2HXC A;  2YB8 B;  4J81 A;  2P9U C;  5JWZ A;  3PSC B;  4ERZ A;  1N6E A;  3FRX A;  3ZWL B;  2YNN A;  2H6N A;  3SBR A;  4PSW B;  2O9K A;  3SWS D;  3EG6 A;  5HE2 B;  1GOT B;  4JT5 C;  3MZK A;  2G99 A;  3FM0 A;  3JB9 L;  4O3U B;  2MTA H;  3OKY A;  2YBA A;  3DXK C;  4A09 B;  4X60 B;  2XYI A;  1SHY B;  5EMK B;  3SFZ A;  4EWR A;  5GSA A;  5B4W A;  4ZOX A;  2B5L A;  4GQB B;  3E0C A;  5CXC B;  4KFM B;  5EAP A;  3PXS D;  2QC5 A;  2AGY A;  3SVW D;  4TZ4 A;  5FLX g;  1OLZ A;  4NSX A;  5C2W B;  2W18 A;  3RLM D;  1VYH C;  1JMX B;  4E5Z A;  3KRW B;  2XL3 A;  1JMZ B;  4CZY A;  1XIP A;  4JXM A;  3IJ1 A;  2CO0 A;  2UZX B;  3UKR C;  2IUQ A;  1U4C A;  2IAA A;  4J86 A;  3SCY A;  3UVL A;  1QNI A;  1FWX A;  3J80 g;  5HE1 B;  4YVD A;  5KDO B;  4FA9 D;  4A09 A;  4JSP C;  3I2N A;  4PBY A;  4MK0 B;  2B4E A;  5CXC A;  5GXH A;  2PM7 B;  5C9Z B;  4CY3 A;  4O3T B;  3MXX A;  2I0T A;  4E54 B;  1NR0 A;  4G56 B;  3OKW A;  1L0Q A;  1Q47 A;  4FWW A;  3UVN A;  1N6D A;  1XHM A;  5FXY A;  4CI1 A;  4A0B B;  1K32 A;  3IJ0 A;  5EML B;  2AQ5 A;  5IGO A;  4GM3 A;  5EM2 B;  2IUV A;  2CN2 A;  1SQ9 A;  3OW8 A;  4JD2 C;  3JZN A;  3P4F A;  4GZ8 A;  3BG1 A;  3FGB A;  4FA1 D;  1MG3 A;  4HDJ A;  3RN0 D;  3AL9 A;  3N0E A;  5EAR A;  3NVQ A;  5K1C C;  5GXI A;  4E54 A;  2IUR A;  2P9S C;  3JAM g;  4A0B A;  4GM9 A;  5I5J A;  4K3I D;  3CFS B;  3HFQ A;  3J81 g;  4K3J B;  5EM2 A;  2OVR B;  5AJA A;  4BL0 A;  2HES X;  3PXW D;  3SHF A;  2AGL A;  3F3G A;  1PI6 A;  1B9Y A;  3SXT D;  3SMR A;  4Y5R D;  2IWF A;  2AH0 A;  3AH8 B;  1N6F A;  3C5M A;  4JSV C;  3SJL D;  4AOW A;  2GNQ A;  2P9K C;  1JOF A;  4A7J A;  3I7H A;  3UVO A;  3MKQ A;  4CC9 A;  4A11 B;  2I3S A;  3C99 A;  2PM9 B;  4FA5 D;  2H9N A;  4XYH A;  1R5M A;  4FAV D;  4FB1 D;  3JPX A;  2OJY A;  1OMW B;  2BCJ B;  3JRP A;  4FA4 D;  2J56 H;  5I5M A;  2PBI B;  3B7F A;  3CIK B;  3K27 A;  3MMY A;  4QL1 A;  4GGD A;  1MG2 A;  4ZOV A;  3L4O D;  4J82 A;  3RFG A;  4PXW A;  3SBP A;  2HKR A;  5TDH B;  3UVM A;  4CZX A;  5SXM A;  4IMM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...