4CY3A

Crystal structure of the nsl1-wds complex.
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
303
structure length
303
Chain Sequence
KPNYTLKFTLAGHTKAVSAVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSRLLVSGSDDKTLKVWELSTGKSLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVRTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNMVYIWNLQSKEVVQKLQGHTDTVLCTACHPTENIIASAALENDKTIKLWKSDT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis of the Kansl1/Wdr5/Kansl2 Complex Reveals that Wdr5 is Required for Efficient Assembly and Chromatin Targeting of the Nsl Complex.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription
molecule keywords PROTEIN WILL DIE SLOWLY
total genus 101
structure length 303
sequence length 303
ec nomenclature
pdb deposition date 2014-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 4cy3A00
2HJ4A 4ES0A 5IJ8E 3RMZD 4CZXA 2AGLA 5I5IA 4E5ZA 1U2VC 2H47A 4L1QD 3I89A 4MK0B 4JSXC 2QXVA 2CN3A 4U1EI 5AJAA 3JZHA 3DXKC 1MG2A 4KFMB 5HQGA 3AL8B 2I3SA 3CFVA 3SCYA 3MKSB 4L3GD 5H14A 5HE2B 2H14A 1SQJA 3F3GA 2HESX 4A0AB 3IJCA 4J77A 2H9LA 2YNNA 2B5LA 5FLXg 5IGOA 4FWWA 4XYIA 1XIPA 4XYHA 4ERQA 4PC0A 1K8KC 1RI6A 1TYQC 4J79A 2Z2PA 3NVXA 4J84A 4FHLA 4A2LA 4X63B 4PXWA 4GGAA 3VA6A 4XEIC 4GQBB 4IMMA 2H9MA 5CXCA 5CXBA 4CY1A 4L3HD 5B4WA 3C99A 4A0BB 3PXTD 3C75H 2HYEA 3FGBA 5C2WB 3MMYA 4JXMA 1A0RB 4CC9A 4ZN4A 4O45A 4D0KA 4D6VA 2CO0A 2IUQA 3SBPA 2GC7A 4ZOYA 2HJBA 2J55H 3EI3A 5H17A 4GM3A 4NSXA 3AL8A 3SMRA 3UVLA 4O3UB 2XU7A 4FA4D 3OKYA 1B9YA 1Q47A 3VGZA 3AFCA 4J73A 3IJ1A 5FQDA 5IT9g 4ERYA 1FWXA 2Z2OA 2XYIA 2J57G 2IWKA 1R5MA 3PSCB 2O9KA 3IKOA 4J8BA 4AEZA 5EAPA 3IIWA 2P9IC 3BG1A 4JT6C 5H1MA 3ORVD 3MXXA 4IA9A 3PXWD 5EMKB 3W15A 2H9PA 3UKRC 3AH8B 4BUJC 4Z8LA 4BH6A 4J78A 2PM7B 2YNPA 3RN1D 4J82A 4JSPC 2H3XA 4LGNA 3C9CA 2OIZA 4LG8A 3RFGA 3RN0D 4ZOXA 1PEVA 1ERJA 2YB8B 4PNKB 2B5NA 5CYKB 1JJUB 5CYKA 5FKTA 1B9XA 2CO0C 3DWLC 1YFQA 3SJLD 4A11B 4FA1D 5C9ZB 3IJ0A 1NEXB 2HXCA 2GNQA 3BG0A 4U7AA 4A09A 4L9OA 2P9SC 4CZYA 1OLZA 3I7HA 2IWFA 2CE8A 3EMHA 4J0WA 3MZLA 3V7DB 5GSAA 4PSWB 3UVMA 3IIYA 3I8CA 4JD2C 2MTAH 1TBGA 2Z2NA 2CE9A 2PBIB 2H13A 3V5WB 5EMLB 4CY5A 4ESGA 3ZWLB 3EI4B 4A08A 1OMWB 1U4CA 2IUVA 1GXRA 3N0EA 4GM9A 4CI3A 2BBKH 4CY2A 2AGZA 1MDAH 5GMKn 5IJ7E 4G56B 5THAA 3SFZA 3JB9L 3SHFA 4HDJA 4OZUA 1GOTB 1NR0A 1SQ9A 4FAVD 5K19A 4FB1D 2B5MA 3L4OD 4QQEA 2I0TA 4H5IA 3DSMA 3I7LA 4ZOZA 1P22A 3C5MA 2EBSA 3EI1B 3EI1A 2TRCB 5AFU3 4R7AB 2YMUA 3SN6B 5GXHA 4O1QD 1PI6A 4A2MA 5SXMA 5K1CC 3I2NA 5HE3B 3B7FA 5TEEA 3F3PA 4J0XA 3J80g 4JSNC 1GG2B 5A2Qg 2IURA 3FRXA 3OL2B 3OL2A 2GC4A 3KRWB 5FKSA 3RLMD 2IAAA 1K32A 3JPXA 2Q7QA 5GXIA 3P4FA 2I0SA 3KRXB 2OVRB 4O9DA 3K26A 3I8EA 2IUPA 3PE7A 3UVNA 5IGQA 3EI4A 3JAMg 4A08B 4J87A 2CN2A 2HKRA 2QC5A 1JMXB 1PGUA 4TZ4A 5JWZA 4PBYA 4N14A 2OK6A 2HKMA 3CIKB 5EMJB 3GFCA 1PBYB 2OVQB 3SWSD 4E5ZB 5EMMB 3ODTA 5I5JA 2P9PC 3RSEC 2AGWA 3UVOA 4I79A 4GGCA 3CFSB 1XHMA 3I7KA 4A11A 4EWRA 3PVUB 3GREA 3PSLA 2AH0A 2P9LC 5TDHB 2B4EA 1S4UX 2PM9A 1N6FA 3J81g 3EI2A 2BCJB 5EM2A 1GP2B 5EM2B 2I3TA 4Y7RA 2J56H 3NVQA 2H68A 3OKTA 5C2VB 1SHYB 4JSVC 5HE1B 4QT8A 3JZNA 3I7NA 5FKRA 3PVWB 2CNXA 2G9AA 3K27A 3SBQA 3JZGA 4ERZA 1N6DA 3NVNA 3MKQA 1N6EA 2UZYB 4PBZA 4FA5D 4X61B 5FA5B 4E54B 5HE0B 4AOWA 3EG6A 3SBRA 3BWSA 2PM6B 4CI1A 4UI9R 4FA9D 2W18A 3I7PA 5TF2A 4CZVA 5AMSA 4CI8A 2H6QA 4PSXB 3EWEA 3MZKA 3E0CA 4BL0A 5FXYA 1QNIA 3EI3B 4GGDA 2H6NA 1JMZB 4K3JB 3UKUC 5HYNB 5I5MA 2PM9B 4FAND 4K3ID 3V9FA 5CXBB 2AQ5A 4QL1A 3OTTA 3DM0A 4J86A 4QRJA 3RRMC 3L4MD 5EALA 4A0BA 4GMBA 4GQ2P 1MG3A 1JOFA 3FM0A 3U4YA 2AGYA 3JRPA 3RFHA 3SLED 4A7JA 4X3EA 2G99A 2I0RA 5IC7A 4CI2A 4GM8A 3UR4A 3SXTD 2XL3A 3N0DA 3PXSD 4A09B 4A0AA 4CY3A 3EU7A 4OWRA 5KDOB 2OVPB 3OKWA 4X60B 3F3FA 4LG9A 5EAMA 4GZ8A 1L0QA 5EARA 1VYHC 4J81A 3A0FA 3VH0A 2P9KC 2AH1A 3HFQA 4YVDA 2P9UC 2OK4A 2UZXB 3ULEC 1XKSA 2P9NC 3DXMC 5TEFA 4O3TB 4H5JA 3UVKA 2XL2A 2YNOA 3OW8A 4J8GA 4ZOVA 3I7OA 3OKYB 3EI2B 4GQ1A 2YBAA 4Y5RD 4E54A 3JROA 5CXCB 2H9NA 5FKQA 2AGXA 2OJYA 4JT5C 3SVWD 3AL9A 2H6KA
chains in the Genus database with same CATH superfamily
2HJ4A 4ES0A 5IJ8E 3RMZD 4CZXA 2AGLA 5I5IA 4E5ZA 4DNWA 2VDPA 1U2VC 2H47A 4L1QD 3I89A 4MK0B 1E5TA 4JSXC 2QXVA 2CN3A 4AMYA 4U1EI 5AJAA 3JZHA 3DXKC 2VDNA 1MG2A 4KFMB 5HQGA 3AL8B 2I3SA 3CFVA 3SCYA 2HU8A 3MKSB 4L3GD 5H14A 5HE2B 2H14A 1SQJA 3F3GA 2HESX 4UM9A 4A0AB 3IJCA 4J77A 2H9LA 2YNNA 2B5LA 5FLXg 4QAMA 3IUNA 5IGOA 3DDUA 4FWWA 4XYIA 1XIPA 4XYHA 4ERQA 4PC0A 1K8KC 5FFOA 4BCBA 3T3PA 1RI6A 1TYQC 3VI3A 4J79A 2Z2PA 3NVXA 4J84A 4FHLA 4A2LA 1M1XA 4X63B 4PXWA 4GGAA 3VA6A 4XEIC 3O4IA 2EICA 4GQBB 4IMMA 2H9MA 5CXCA 3EQ8A 5CXBA 4CY1A 4AN0A 1E8NA 4L3HD 5B4WA 3C99A 4A0BB 3PXTD 3C75H 3ZDZA 2HYEA 3FGBA 5C2WB 3MMYA 4JXMA 1A0RB 1E8MA 4CC9A 4ZN4A 4O45A 1UOQA 4D0KA 4D6VA 2CO0A 2IUQA 3SBPA 3MUOA 3K71A 1O6FA 2GC7A 4ZOYA 2HJBA 2J55H 3EI3A 5H17A 4GM3A 4NSXA 5HDBA 3AL8A 2QZPA 3SMRA 3UVLA 5M5TA 4O3UB 4BCDA 5C86A 2XU7A 4FA4D 2EIDA 3OKYA 2EIEA 1B9YA 1Q47A 5E6RA 1UOOA 3VGZA 3AFCA 4J73A 2VDQA 3IJ1A 5FQDA 4Z7QA 5IT9g 4ERYA 1FWXA 2Z2OA 2XYIA 2J57G 2IWKA 3ZE0A 1R5MA 3PSCB 2O9KA 3IKOA 4J8BA 5M5RA 4AEZA 5EAPA 3NIDA 3IIWA 2P9IC 3BG1A 4JT6C 5H1MA 3ORVD 1JTDB 3MXXA 4IA9A 4D9SA 3FCSA 3PXWD 1YR2A 1C9IA 5EMKB 3W15A 2H9PA 5M5SA 3UKRC 3AH8B 4BUJC 4Z8LA 4BH6A 4UM8A 4J78A 2PM7B 2YNPA 3RN1D 2VDMA 4J82A 4JSPC 2H3XA 4LGNA 3C9CA 2OIZA 4LG8A 3RFGA 3RN0D 4ZOXA 2XE4A 3ZDXA 1PEVA 1ERJA 2YB8B 4PNKB 2B5NA 5CYKB 1JJUB 5CYKA 5FKTA 1B9XA 2CO0C 3DWLC 1YFQA 3SJLD 4A11B 4FA1D 2EIBA 5C9ZB 3IJ0A 3VI4A 5M61A 1NEXB 2HXCA 2GNQA 3BG0A 4U7AA 4A09A 1GOHA 2P9SC 3GC3B 4L9OA 4CZYA 3IUJA 3T3MA 1OLZA 3I7HA 2IWFA 2CE8A 3EMHA 4J0WA 3MZLA 3V7DB 5GSAA 4PSWB 3UVMA 3IIYA 3I8CA 4JD2C 2MTAH 1TBGA 2Z2NA 2CE9A 3KCIA 2PBIB 2H13A 2VDLA 3V5WB 5EMLB 4BCCA 4CY5A 4ESGA 3ZWLB 3EI4B 4A08A 1U8CA 1OMWB 3N0EA 1U4CA 1GXRA 2IUVA 4GM9A 4CI3A 2BBKH 4CY2A 2AGZA 1C9LA 1MDAH 5GMKn 5IJ7E 4G56B 5THAA 3SFZA 3JB9L 3SHFA 4HDJA 4OZUA 1GOTB 1NR0A 4RE5A 1SQ9A 4FAVD 5K19A 4FB1D 4JHPC 2B5MA 3L4OD 4QQEA 2I0TA 4H5IA 3O4HA 2VZ3A 3DSMA 3EQ7A 3I7LA 4ZOZA 1P22A 3C5MA 2EBSA 3EI1B 3EI1A 2TRCB 5AFU3 4R7AB 2YMUA 3SN6B 1VZ3A 4O1QD 5GXHA 1PI6A 3IUQA 3O4JA 1GOFA 4A2MA 5SXMA 5K1CC 3I2NA 5HE3B 3B7FA 5TEEA 3F3PA 4J0XA 3J80g 4JSNC 1GG2B 5A2Qg 4RE6A 2VDKA 2IURA 3FRXA 3OL2B 2BKLA 3OL2A 1O6GA 2GC4A 3KRWB 5FKSA 3RLMD 2IAAA 1K32A 3FCUA 2Q7QA 3JPXA 3P4FA 5FFGA 5GXIA 2I0SA 3KRXB 2OVRB 1T2XA 4NAAA 4O9DA 3K26A 4G55A 2JKXA 3I8EA 1VE6A 2IUPA 3PE7A 4MMYA 3UVNA 5IGQA 3EI4A 3JAMg 4A08B 4J87A 2CN2A 2HKRA 2QC5A 1H2ZA 1JMXB 3ZDYA 1K3IA 1PGUA 4TZ4A 5JWZA 4Z7NA 4PBYA 4N14A 1I2MB 2OK6A 4AMZA 2HKMA 2HU7A 4AN1A 3NIFA 3CIKB 3O4GA 5EMJB 4G1EA 3GFCA 1PBYB 2OVQB 3SWSD 3MVDK 2HU5A 1GOGA 2VC2A 4E5ZB 5EMMB 3ODTA 5I5JA 2P9PC 1H2YA 3RSEC 3K72A 2AGWA 3UVOA 3GD1I 4I79A 4GGCA 3CFSB 1XHMA 3I7KA 4A11A 4EWRA 3PVUB 3GREA 3PSLA 2AH0A 4G1MA 2P9LC 3EQ9A 5TDHB 2B4EA 1S4UX 2PM9A 1N6FA 3J81g 3EI2A 2BCJB 1A12A 5EM2A 1GP2B 4WK4A 3NIGA 5EM2B 2I3TA 4DNVA 4Y7RA 2J56H 3NVQA 3IURA 1TYEA 2H68A 4WK0A 3OKTA 5C2VB 3ZE1A 1SHYB 4JSVC 5HE1B 4QT8A 3JZNA 3I7NA 5FKRA 3PVWB 2WQ8A 2CNXA 2G9AA 3K27A 3SBQA 1VE7A 3JZGA 4ERZA 1N6DA 3NVNA 3MKQA 1N6EA 2UZYB 3IUMA 4PBZA 4FA5D 3K6SA 4X61B 5FA5B 4E54B 5HE0B 4AOWA 3EG6A 3SBRA 5C92A 3BWSA 2PM6B 4CI1A 4UI9R 4FA9D 2W18A 3I7PA 3QHYB 5TF2A 1UOPA 4CZVA 5AMSA 4CI8A 2VDRA 2H6QA 4PSXB 3MUNA 3EWEA 3MZKA 3E0CA 4BL0A 5FXYA 1QNIA 4Z7OA 3EI3B 4GGDA 1QFMA 3QI0A 2H6NA 1JMZB 2VZ1A 4BP8A 4K3JB 3UKUC 5HYNB 4DNUA 5I5MA 2PM9B 4FAND 3V4PA 4K3ID 2XZGA 4BP9A 3V9FA 5E6SA 4MMXA 5CXBB 1VZ2A 2AQ5A 4QL1A 3OTTA 1UTCA 3DM0A 4J86A 4QRJA 3RRMC 5M5VA 2VDOA 1QFSA 3L4MD 3OF7A 5EALA 4A0BA 4GMBA 4GQ2P 1MG3A 1JOFA 5E6UA 3ZE2A 3FM0A 3U4YA 2AGYA 4AX4A 3JRPA 3RFHA 3SLED 4A7JA 4WK2A 4X3EA 2G99A 2I0RA 4NC4A 4NENA 5IC7A 4JHNA 4CI2A 3V4VA 4GM8A 3UR4A 3SXTD 2XL3A 3N0DA 4WJKA 3PXSD 3IVMA 4A09B 1BPOA 4A0AA 1L5GA 2QR5A 4CY3A 3EU7A 2XDWA 4OWRA 5KDOB 2OVPB 3OKWA 4X60B 3F3FA 1H2WA 4LG9A 4IRZA 5EAMA 4GZ8A 1L0QA 5EARA 1VYHC 4J81A 3A0FA 3VH0A 2P9KC 2AH1A 3HFQA 4YVDA 2P9UC 2OK4A 2UZXB 3ULEC 1XKSA 2P9NC 3DXMC 5TEFA 1JV2A 4O3TB 4H5JA 4NBMA 4O2WA 3IJEA 3UVKA 2XL2A 2YNOA 3OW8A 4J8GA 4ZOVA 3I7OA 4L1MA 3IULA 1H2XA 3OKYB 3EI2B 4GQ1A 2YBAA 4O02A 5M5UA 4Y5RD 4MMZA 4E54A 3JROA 5CXCB 2H9NA 5FKQA 2AGXA 2OJYA 4JT5C 3SVWD 3AL9A 2H6KA
chains in the Genus database with same CATH topology
2HJ4A 4ES0A 5IJ8E 3RMZD 4CZXA 2AGLA 5I5IA 4E5ZA 1U2VC 2H47A 4L1QD 3I89A 4MK0B 4JSXC 2QXVA 2CN3A 4U1EI 5AJAA 3JZHA 3DXKC 1MG2A 4KFMB 5HQGA 3AL8B 2I3SA 3CFVA 3SCYA 3MKSB 4L3GD 5H14A 5HE2B 2H14A 1SQJA 3F3GA 2HESX 4A0AB 3IJCA 4J77A 2H9LA 2YNNA 2B5LA 5FLXg 5IGOA 4FWWA 4XYIA 1XIPA 4XYHA 4ERQA 4PC0A 1K8KC 1RI6A 1TYQC 4J79A 2Z2PA 3NVXA 4J84A 4FHLA 4A2LA 4X63B 4PXWA 4GGAA 3VA6A 4XEIC 4GQBB 4IMMA 2H9MA 5CXCA 5CXBA 4CY1A 4L3HD 5B4WA 3C99A 4A0BB 3PXTD 3C75H 2HYEA 3FGBA 5C2WB 3MMYA 4JXMA 1A0RB 4CC9A 4ZN4A 4O45A 4D0KA 4D6VA 2CO0A 2IUQA 3SBPA 2GC7A 4ZOYA 2HJBA 2J55H 3EI3A 5H17A 4GM3A 4NSXA 3AL8A 3SMRA 3UVLA 4O3UB 2XU7A 4FA4D 3OKYA 1B9YA 1Q47A 3VGZA 3AFCA 4J73A 3IJ1A 5FQDA 5IT9g 4ERYA 1FWXA 2Z2OA 2XYIA 2J57G 2IWKA 1R5MA 3PSCB 2O9KA 3IKOA 4J8BA 4AEZA 5EAPA 3IIWA 2P9IC 3BG1A 4JT6C 5H1MA 3ORVD 3MXXA 4IA9A 3PXWD 5EMKB 3W15A 2H9PA 3UKRC 3AH8B 4BUJC 4Z8LA 4BH6A 4J78A 2PM7B 2YNPA 3RN1D 4J82A 4JSPC 2H3XA 4LGNA 3C9CA 2OIZA 4LG8A 3RFGA 3RN0D 4ZOXA 1PEVA 1ERJA 2YB8B 4PNKB 2B5NA 5CYKB 1JJUB 5CYKA 5FKTA 1B9XA 2CO0C 3DWLC 1YFQA 3SJLD 4A11B 4FA1D 5C9ZB 3IJ0A 1NEXB 2HXCA 2GNQA 3BG0A 4U7AA 4A09A 4L9OA 2P9SC 4CZYA 1OLZA 3I7HA 2IWFA 2CE8A 3EMHA 4J0WA 3MZLA 3V7DB 5GSAA 4PSWB 3UVMA 3IIYA 3I8CA 4JD2C 2MTAH 1TBGA 2Z2NA 2CE9A 2PBIB 2H13A 3V5WB 5EMLB 4CY5A 4ESGA 3ZWLB 3EI4B 4A08A 1OMWB 1U4CA 2IUVA 1GXRA 3N0EA 4GM9A 4CI3A 2BBKH 4CY2A 2AGZA 1MDAH 5GMKn 5IJ7E 4G56B 5THAA 3SFZA 3JB9L 3SHFA 4HDJA 4OZUA 1GOTB 1NR0A 1SQ9A 4FAVD 5K19A 4FB1D 2B5MA 3L4OD 4QQEA 2I0TA 4H5IA 3DSMA 3I7LA 4ZOZA 1P22A 3C5MA 2EBSA 3EI1B 3EI1A 2TRCB 5AFU3 4R7AB 2YMUA 3SN6B 5GXHA 4O1QD 1PI6A 4A2MA 5SXMA 5K1CC 3I2NA 5HE3B 3B7FA 5TEEA 3F3PA 4J0XA 3J80g 4JSNC 1GG2B 5A2Qg 2IURA 3FRXA 3OL2B 3OL2A 2GC4A 3KRWB 5FKSA 3RLMD 2IAAA 1K32A 3JPXA 2Q7QA 5GXIA 3P4FA 2I0SA 3KRXB 2OVRB 4O9DA 3K26A 3I8EA 2IUPA 3PE7A 3UVNA 5IGQA 3EI4A 3JAMg 4A08B 4J87A 2CN2A 2HKRA 2QC5A 1JMXB 1PGUA 4TZ4A 5JWZA 4PBYA 4N14A 2OK6A 2HKMA 3CIKB 5EMJB 3GFCA 1PBYB 2OVQB 3SWSD 4E5ZB 5EMMB 3ODTA 5I5JA 2P9PC 3RSEC 2AGWA 3UVOA 4I79A 4GGCA 3CFSB 1XHMA 3I7KA 4A11A 4EWRA 3PVUB 3GREA 3PSLA 2AH0A 2P9LC 5TDHB 2B4EA 1S4UX 2PM9A 1N6FA 3J81g 3EI2A 2BCJB 5EM2A 1GP2B 5EM2B 2I3TA 4Y7RA 2J56H 3NVQA 2H68A 3OKTA 5C2VB 1SHYB 4JSVC 5HE1B 4QT8A 3JZNA 3I7NA 5FKRA 3PVWB 2CNXA 2G9AA 3K27A 3SBQA 3JZGA 4ERZA 1N6DA 3NVNA 3MKQA 1N6EA 2UZYB 4PBZA 4FA5D 4X61B 5FA5B 4E54B 5HE0B 4AOWA 3EG6A 3SBRA 3BWSA 2PM6B 4CI1A 4UI9R 4FA9D 2W18A 3I7PA 5TF2A 4CZVA 5AMSA 4CI8A 2H6QA 4PSXB 3EWEA 3MZKA 3E0CA 4BL0A 5FXYA 1QNIA 3EI3B 4GGDA 2H6NA 1JMZB 4K3JB 3UKUC 5HYNB 5I5MA 2PM9B 4FAND 4K3ID 3V9FA 5CXBB 2AQ5A 4QL1A 3OTTA 3DM0A 4J86A 4QRJA 3RRMC 3L4MD 5EALA 4A0BA 4GMBA 4GQ2P 1MG3A 1JOFA 3FM0A 3U4YA 2AGYA 3JRPA 3RFHA 3SLED 4A7JA 4X3EA 2G99A 2I0RA 5IC7A 4CI2A 4GM8A 3UR4A 3SXTD 2XL3A 3N0DA 3PXSD 4A09B 4A0AA 4CY3A 3EU7A 4OWRA 5KDOB 2OVPB 3OKWA 4X60B 3F3FA 4LG9A 5EAMA 4GZ8A 1L0QA 5EARA 1VYHC 4J81A 3A0FA 3VH0A 2P9KC 2AH1A 3HFQA 4YVDA 2P9UC 2OK4A 2UZXB 3ULEC 1XKSA 2P9NC 3DXMC 5TEFA 4O3TB 4H5JA 3UVKA 2XL2A 2YNOA 3OW8A 4J8GA 4ZOVA 3I7OA 3OKYB 3EI2B 4GQ1A 2YBAA 4Y5RD 4E54A 3JROA 5CXCB 2H9NA 5FKQA 2AGXA 2OJYA 4JT5C 3SVWD 3AL9A 2H6KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HJ4 A;  4ES0 A;  5IJ8 E;  3RMZ D;  4CZX A;  2AGL A;  5I5I A;  4E5Z A;  1U2V C;  2H47 A;  4L1Q D;  3I89 A;  4MK0 B;  4JSX C;  2QXV A;  2CN3 A;  4U1E I;  5AJA A;  3JZH A;  3DXK C;  1MG2 A;  4KFM B;  5HQG A;  3AL8 B;  2I3S A;  3CFV A;  3SCY A;  3MKS B;  4L3G D;  5H14 A;  5HE2 B;  2H14 A;  1SQJ A;  3F3G A;  2HES X;  4A0A B;  3IJC A;  4J77 A;  2H9L A;  2YNN A;  2B5L A;  5FLX g;  5IGO A;  4FWW A;  4XYI A;  1XIP A;  4XYH A;  4ERQ A;  4PC0 A;  1K8K C;  1RI6 A;  1TYQ C;  4J79 A;  2Z2P A;  3NVX A;  4J84 A;  4FHL A;  4A2L A;  4X63 B;  4PXW A;  4GGA A;  3VA6 A;  4XEI C;  4GQB B;  4IMM A;  2H9M A;  5CXC A;  5CXB A;  4CY1 A;  4L3H D;  5B4W A;  3C99 A;  4A0B B;  3PXT D;  3C75 H;  2HYE A;  3FGB A;  5C2W B;  3MMY A;  4JXM A;  1A0R B;  4CC9 A;  4ZN4 A;  4O45 A;  4D0K A;  4D6V A;  2CO0 A;  2IUQ A;  3SBP A;  2GC7 A;  4ZOY A;  2HJB A;  2J55 H;  3EI3 A;  5H17 A;  4GM3 A;  4NSX A;  3AL8 A;  3SMR A;  3UVL A;  4O3U B;  2XU7 A;  4FA4 D;  3OKY A;  1B9Y A;  1Q47 A;  3VGZ A;  3AFC A;  4J73 A;  3IJ1 A;  5FQD A;  5IT9 g;  4ERY A;  1FWX A;  2Z2O A;  2XYI A;  2J57 G;  2IWK A;  1R5M A;  3PSC B;  2O9K A;  3IKO A;  4J8B A;  4AEZ A;  5EAP A;  3IIW A;  2P9I C;  3BG1 A;  4JT6 C;  5H1M A;  3ORV D;  3MXX A;  4IA9 A;  3PXW D;  5EMK B;  3W15 A;  2H9P A;  3UKR C;  3AH8 B;  4BUJ C;  4Z8L A;  4BH6 A;  4J78 A;  2PM7 B;  2YNP A;  3RN1 D;  4J82 A;  4JSP C;  2H3X A;  4LGN A;  3C9C A;  2OIZ A;  4LG8 A;  3RFG A;  3RN0 D;  4ZOX A;  1PEV A;  1ERJ A;  2YB8 B;  4PNK B;  2B5N A;  5CYK B;  1JJU B;  5CYK A;  5FKT A;  1B9X A;  2CO0 C;  3DWL C;  1YFQ A;  3SJL D;  4A11 B;  4FA1 D;  5C9Z B;  3IJ0 A;  1NEX B;  2HXC A;  2GNQ A;  3BG0 A;  4U7A A;  4A09 A;  4L9O A;  2P9S C;  4CZY A;  1OLZ A;  3I7H A;  2IWF A;  2CE8 A;  3EMH A;  4J0W A;  3MZL A;  3V7D B;  5GSA A;  4PSW B;  3UVM A;  3IIY A;  3I8C A;  4JD2 C;  2MTA H;  1TBG A;  2Z2N A;  2CE9 A;  2PBI B;  2H13 A;  3V5W B;  5EML B;  4CY5 A;  4ESG A;  3ZWL B;  3EI4 B;  4A08 A;  1OMW B;  1U4C A;  2IUV A;  1GXR A;  3N0E A;  4GM9 A;  4CI3 A;  2BBK H;  4CY2 A;  2AGZ A;  1MDA H;  5GMK n;  5IJ7 E;  4G56 B;  5THA A;  3SFZ A;  3JB9 L;  3SHF A;  4HDJ A;  4OZU A;  1GOT B;  1NR0 A;  1SQ9 A;  4FAV D;  5K19 A;  4FB1 D;  2B5M A;  3L4O D;  4QQE A;  2I0T A;  4H5I A;  3DSM A;  3I7L A;  4ZOZ A;  1P22 A;  3C5M A;  2EBS A;  3EI1 B;  3EI1 A;  2TRC B;  5AFU 3;  4R7A B;  2YMU A;  3SN6 B;  5GXH A;  4O1Q D;  1PI6 A;  4A2M A;  5SXM A;  5K1C C;  3I2N A;  5HE3 B;  3B7F A;  5TEE A;  3F3P A;  4J0X A;  3J80 g;  4JSN C;  1GG2 B;  5A2Q g;  2IUR A;  3FRX A;  3OL2 B;  3OL2 A;  2GC4 A;  3KRW B;  5FKS A;  3RLM D;  2IAA A;  1K32 A;  3JPX A;  2Q7Q A;  5GXI A;  3P4F A;  2I0S A;  3KRX B;  2OVR B;  4O9D A;  3K26 A;  3I8E A;  2IUP A;  3PE7 A;  3UVN A;  5IGQ A;  3EI4 A;  3JAM g;  4A08 B;  4J87 A;  2CN2 A;  2HKR A;  2QC5 A;  1JMX B;  1PGU A;  4TZ4 A;  5JWZ A;  4PBY A;  4N14 A;  2OK6 A;  2HKM A;  3CIK B;  5EMJ B;  3GFC A;  1PBY B;  2OVQ B;  3SWS D;  4E5Z B;  5EMM B;  3ODT A;  5I5J A;  2P9P C;  3RSE C;  2AGW A;  3UVO A;  4I79 A;  4GGC A;  3CFS B;  1XHM A;  3I7K A;  4A11 A;  4EWR A;  3PVU B;  3GRE A;  3PSL A;  2AH0 A;  2P9L C;  5TDH B;  2B4E A;  1S4U X;  2PM9 A;  1N6F A;  3J81 g;  3EI2 A;  2BCJ B;  5EM2 A;  1GP2 B;  5EM2 B;  2I3T A;  4Y7R A;  2J56 H;  3NVQ A;  2H68 A;  3OKT A;  5C2V B;  1SHY B;  4JSV C;  5HE1 B;  4QT8 A;  3JZN A;  3I7N A;  5FKR A;  3PVW B;  2CNX A;  2G9A A;  3K27 A;  3SBQ A;  3JZG A;  4ERZ A;  1N6D A;  3NVN A;  3MKQ A;  1N6E A;  2UZY B;  4PBZ A;  4FA5 D;  4X61 B;  5FA5 B;  4E54 B;  5HE0 B;  4AOW A;  3EG6 A;  3SBR A;  3BWS A;  2PM6 B;  4CI1 A;  4UI9 R;  4FA9 D;  2W18 A;  3I7P A;  5TF2 A;  4CZV A;  5AMS A;  4CI8 A;  2H6Q A;  4PSX B;  3EWE A;  3MZK A;  3E0C A;  4BL0 A;  5FXY A;  1QNI A;  3EI3 B;  4GGD A;  2H6N A;  1JMZ B;  4K3J B;  3UKU C;  5HYN B;  5I5M A;  2PM9 B;  4FAN D;  4K3I D;  3V9F A;  5CXB B;  2AQ5 A;  4QL1 A;  3OTT A;  3DM0 A;  4J86 A;  4QRJ A;  3RRM C;  3L4M D;  5EAL A;  4A0B A;  4GMB A;  4GQ2 P;  1MG3 A;  1JOF A;  3FM0 A;  3U4Y A;  2AGY A;  3JRP A;  3RFH A;  3SLE D;  4A7J A;  4X3E A;  2G99 A;  2I0R A;  5IC7 A;  4CI2 A;  4GM8 A;  3UR4 A;  3SXT D;  2XL3 A;  3N0D A;  3PXS D;  4A09 B;  4A0A A;  4CY3 A;  3EU7 A;  4OWR A;  5KDO B;  2OVP B;  3OKW A;  4X60 B;  3F3F A;  4LG9 A;  5EAM A;  4GZ8 A;  1L0Q A;  5EAR A;  1VYH C;  4J81 A;  3A0F A;  3VH0 A;  2P9K C;  2AH1 A;  3HFQ A;  4YVD A;  2P9U C;  2OK4 A;  2UZX B;  3ULE C;  1XKS A;  2P9N C;  3DXM C;  5TEF A;  4O3T B;  4H5J A;  3UVK A;  2XL2 A;  2YNO A;  3OW8 A;  4J8G A;  4ZOV A;  3I7O A;  3OKY B;  3EI2 B;  4GQ1 A;  2YBA A;  4Y5R D;  4E54 A;  3JRO A;  5CXC B;  2H9N A;  5FKQ A;  2AGX A;  2OJY A;  4JT5 C;  3SVW D;  3AL9 A;  2H6K A; 
#chains in the Genus database with same CATH topology
 2HJ4 A;  4ES0 A;  5IJ8 E;  3RMZ D;  4CZX A;  2AGL A;  5I5I A;  4E5Z A;  4DNW A;  2VDP A;  1U2V C;  2H47 A;  4L1Q D;  3I89 A;  4MK0 B;  1E5T A;  4JSX C;  2QXV A;  2CN3 A;  4AMY A;  4U1E I;  5AJA A;  3JZH A;  3DXK C;  2VDN A;  1MG2 A;  4KFM B;  5HQG A;  3AL8 B;  2I3S A;  3CFV A;  3SCY A;  2HU8 A;  3MKS B;  4L3G D;  5H14 A;  5HE2 B;  2H14 A;  1SQJ A;  3F3G A;  2HES X;  4UM9 A;  4A0A B;  3IJC A;  4J77 A;  2H9L A;  2YNN A;  2B5L A;  5FLX g;  4QAM A;  3IUN A;  5IGO A;  3DDU A;  4FWW A;  4XYI A;  1XIP A;  4XYH A;  4ERQ A;  4PC0 A;  1K8K C;  5FFO A;  4BCB A;  3T3P A;  1RI6 A;  1TYQ C;  3VI3 A;  4J79 A;  2Z2P A;  3NVX A;  4J84 A;  4FHL A;  4A2L A;  1M1X A;  4X63 B;  4PXW A;  4GGA A;  3VA6 A;  4XEI C;  3O4I A;  2EIC A;  4GQB B;  4IMM A;  2H9M A;  5CXC A;  3EQ8 A;  5CXB A;  4CY1 A;  4AN0 A;  1E8N A;  4L3H D;  5B4W A;  3C99 A;  4A0B B;  3PXT D;  3C75 H;  3ZDZ A;  2HYE A;  3FGB A;  5C2W B;  3MMY A;  4JXM A;  1A0R B;  1E8M A;  4CC9 A;  4ZN4 A;  4O45 A;  1UOQ A;  4D0K A;  4D6V A;  2CO0 A;  2IUQ A;  3SBP A;  3MUO A;  3K71 A;  1O6F A;  2GC7 A;  4ZOY A;  2HJB A;  2J55 H;  3EI3 A;  5H17 A;  4GM3 A;  4NSX A;  5HDB A;  3AL8 A;  2QZP A;  3SMR A;  3UVL A;  5M5T A;  4O3U B;  4BCD A;  5C86 A;  2XU7 A;  4FA4 D;  2EID A;  3OKY A;  2EIE A;  1B9Y A;  1Q47 A;  5E6R A;  1UOO A;  3VGZ A;  3AFC A;  4J73 A;  2VDQ A;  3IJ1 A;  5FQD A;  4Z7Q A;  5IT9 g;  4ERY A;  1FWX A;  2Z2O A;  2XYI A;  2J57 G;  2IWK A;  3ZE0 A;  1R5M A;  3PSC B;  2O9K A;  3IKO A;  4J8B A;  5M5R A;  4AEZ A;  5EAP A;  3NID A;  3IIW A;  2P9I C;  3BG1 A;  4JT6 C;  5H1M A;  3ORV D;  1JTD B;  3MXX A;  4IA9 A;  4D9S A;  3FCS A;  3PXW D;  1YR2 A;  1C9I A;  5EMK B;  3W15 A;  2H9P A;  5M5S A;  3UKR C;  3AH8 B;  4BUJ C;  4Z8L A;  4BH6 A;  4UM8 A;  4J78 A;  2PM7 B;  2YNP A;  3RN1 D;  2VDM A;  4J82 A;  4JSP C;  2H3X A;  4LGN A;  3C9C A;  2OIZ A;  4LG8 A;  3RFG A;  3RN0 D;  4ZOX A;  2XE4 A;  3ZDX A;  1PEV A;  1ERJ A;  2YB8 B;  4PNK B;  2B5N A;  5CYK B;  1JJU B;  5CYK A;  5FKT A;  1B9X A;  2CO0 C;  3DWL C;  1YFQ A;  3SJL D;  4A11 B;  4FA1 D;  2EIB A;  5C9Z B;  3IJ0 A;  3VI4 A;  5M61 A;  1NEX B;  2HXC A;  2GNQ A;  3BG0 A;  4U7A A;  4A09 A;  1GOH A;  2P9S C;  3GC3 B;  4L9O A;  4CZY A;  3IUJ A;  3T3M A;  1OLZ A;  3I7H A;  2IWF A;  2CE8 A;  3EMH A;  4J0W A;  3MZL A;  3V7D B;  5GSA A;  4PSW B;  3UVM A;  3IIY A;  3I8C A;  4JD2 C;  2MTA H;  1TBG A;  2Z2N A;  2CE9 A;  3KCI A;  2PBI B;  2H13 A;  2VDL A;  3V5W B;  5EML B;  4BCC A;  4CY5 A;  4ESG A;  3ZWL B;  3EI4 B;  4A08 A;  1U8C A;  1OMW B;  3N0E A;  1U4C A;  1GXR A;  2IUV A;  4GM9 A;  4CI3 A;  2BBK H;  4CY2 A;  2AGZ A;  1C9L A;  1MDA H;  5GMK n;  5IJ7 E;  4G56 B;  5THA A;  3SFZ A;  3JB9 L;  3SHF A;  4HDJ A;  4OZU A;  1GOT B;  1NR0 A;  4RE5 A;  1SQ9 A;  4FAV D;  5K19 A;  4FB1 D;  4JHP C;  2B5M A;  3L4O D;  4QQE A;  2I0T A;  4H5I A;  3O4H A;  2VZ3 A;  3DSM A;  3EQ7 A;  3I7L A;  4ZOZ A;  1P22 A;  3C5M A;  2EBS A;  3EI1 B;  3EI1 A;  2TRC B;  5AFU 3;  4R7A B;  2YMU A;  3SN6 B;  1VZ3 A;  4O1Q D;  5GXH A;  1PI6 A;  3IUQ A;  3O4J A;  1GOF A;  4A2M A;  5SXM A;  5K1C C;  3I2N A;  5HE3 B;  3B7F A;  5TEE A;  3F3P A;  4J0X A;  3J80 g;  4JSN C;  1GG2 B;  5A2Q g;  4RE6 A;  2VDK A;  2IUR A;  3FRX A;  3OL2 B;  2BKL A;  3OL2 A;  1O6G A;  2GC4 A;  3KRW B;  5FKS A;  3RLM D;  2IAA A;  1K32 A;  3FCU A;  2Q7Q A;  3JPX A;  3P4F A;  5FFG A;  5GXI A;  2I0S A;  3KRX B;  2OVR B;  1T2X A;  4NAA A;  4O9D A;  3K26 A;  4G55 A;  2JKX A;  3I8E A;  1VE6 A;  2IUP A;  3PE7 A;  4MMY A;  3UVN A;  5IGQ A;  3EI4 A;  3JAM g;  4A08 B;  4J87 A;  2CN2 A;  2HKR A;  2QC5 A;  1H2Z A;  1JMX B;  3ZDY A;  1K3I A;  1PGU A;  4TZ4 A;  5JWZ A;  4Z7N A;  4PBY A;  4N14 A;  1I2M B;  2OK6 A;  4AMZ A;  2HKM A;  2HU7 A;  4AN1 A;  3NIF A;  3CIK B;  3O4G A;  5EMJ B;  4G1E A;  3GFC A;  1PBY B;  2OVQ B;  3SWS D;  3MVD K;  2HU5 A;  1GOG A;  2VC2 A;  4E5Z B;  5EMM B;  3ODT A;  5I5J A;  2P9P C;  1H2Y A;  3RSE C;  3K72 A;  2AGW A;  3UVO A;  3GD1 I;  4I79 A;  4GGC A;  3CFS B;  1XHM A;  3I7K A;  4A11 A;  4EWR A;  3PVU B;  3GRE A;  3PSL A;  2AH0 A;  4G1M A;  2P9L C;  3EQ9 A;  5TDH B;  2B4E A;  1S4U X;  2PM9 A;  1N6F A;  3J81 g;  3EI2 A;  2BCJ B;  1A12 A;  5EM2 A;  1GP2 B;  4WK4 A;  3NIG A;  5EM2 B;  2I3T A;  4DNV A;  4Y7R A;  2J56 H;  3NVQ A;  3IUR A;  1TYE A;  2H68 A;  4WK0 A;  3OKT A;  5C2V B;  3ZE1 A;  1SHY B;  4JSV C;  5HE1 B;  4QT8 A;  3JZN A;  3I7N A;  5FKR A;  3PVW B;  2WQ8 A;  2CNX A;  2G9A A;  3K27 A;  3SBQ A;  1VE7 A;  3JZG A;  4ERZ A;  1N6D A;  3NVN A;  3MKQ A;  1N6E A;  2UZY B;  3IUM A;  4PBZ A;  4FA5 D;  3K6S A;  4X61 B;  5FA5 B;  4E54 B;  5HE0 B;  4AOW A;  3EG6 A;  3SBR A;  5C92 A;  3BWS A;  2PM6 B;  4CI1 A;  4UI9 R;  4FA9 D;  2W18 A;  3I7P A;  3QHY B;  5TF2 A;  1UOP A;  4CZV A;  5AMS A;  4CI8 A;  2VDR A;  2H6Q A;  4PSX B;  3MUN A;  3EWE A;  3MZK A;  3E0C A;  4BL0 A;  5FXY A;  1QNI A;  4Z7O A;  3EI3 B;  4GGD A;  1QFM A;  3QI0 A;  2H6N A;  1JMZ B;  2VZ1 A;  4BP8 A;  4K3J B;  3UKU C;  5HYN B;  4DNU A;  5I5M A;  2PM9 B;  4FAN D;  3V4P A;  4K3I D;  2XZG A;  4BP9 A;  3V9F A;  5E6S A;  4MMX A;  5CXB B;  1VZ2 A;  2AQ5 A;  4QL1 A;  3OTT A;  1UTC A;  3DM0 A;  4J86 A;  4QRJ A;  3RRM C;  5M5V A;  2VDO A;  1QFS A;  3L4M D;  3OF7 A;  5EAL A;  4A0B A;  4GMB A;  4GQ2 P;  1MG3 A;  1JOF A;  5E6U A;  3ZE2 A;  3FM0 A;  3U4Y A;  2AGY A;  4AX4 A;  3JRP A;  3RFH A;  3SLE D;  4A7J A;  4WK2 A;  4X3E A;  2G99 A;  2I0R A;  4NC4 A;  4NEN A;  5IC7 A;  4JHN A;  4CI2 A;  3V4V A;  4GM8 A;  3UR4 A;  3SXT D;  2XL3 A;  3N0D A;  4WJK A;  3PXS D;  3IVM A;  4A09 B;  1BPO A;  4A0A A;  1L5G A;  2QR5 A;  4CY3 A;  3EU7 A;  2XDW A;  4OWR A;  5KDO B;  2OVP B;  3OKW A;  4X60 B;  3F3F A;  1H2W A;  4LG9 A;  4IRZ A;  5EAM A;  4GZ8 A;  1L0Q A;  5EAR A;  1VYH C;  4J81 A;  3A0F A;  3VH0 A;  2P9K C;  2AH1 A;  3HFQ A;  4YVD A;  2P9U C;  2OK4 A;  2UZX B;  3ULE C;  1XKS A;  2P9N C;  3DXM C;  5TEF A;  1JV2 A;  4O3T B;  4H5J A;  4NBM A;  4O2W A;  3IJE A;  3UVK A;  2XL2 A;  2YNO A;  3OW8 A;  4J8G A;  4ZOV A;  3I7O A;  4L1M A;  3IUL A;  1H2X A;  3OKY B;  3EI2 B;  4GQ1 A;  2YBA A;  4O02 A;  5M5U A;  4Y5R D;  4MMZ A;  4E54 A;  3JRO A;  5CXC B;  2H9N A;  5FKQ A;  2AGX A;  2OJY A;  4JT5 C;  3SVW D;  3AL9 A;  2H6K A; 
#chains in the Genus database with same CATH homology
 2HJ4 A;  4ES0 A;  5IJ8 E;  3RMZ D;  4CZX A;  2AGL A;  5I5I A;  4E5Z A;  1U2V C;  2H47 A;  4L1Q D;  3I89 A;  4MK0 B;  4JSX C;  2QXV A;  2CN3 A;  4U1E I;  5AJA A;  3JZH A;  3DXK C;  1MG2 A;  4KFM B;  5HQG A;  3AL8 B;  2I3S A;  3CFV A;  3SCY A;  3MKS B;  4L3G D;  5H14 A;  5HE2 B;  2H14 A;  1SQJ A;  3F3G A;  2HES X;  4A0A B;  3IJC A;  4J77 A;  2H9L A;  2YNN A;  2B5L A;  5FLX g;  5IGO A;  4FWW A;  4XYI A;  1XIP A;  4XYH A;  4ERQ A;  4PC0 A;  1K8K C;  1RI6 A;  1TYQ C;  4J79 A;  2Z2P A;  3NVX A;  4J84 A;  4FHL A;  4A2L A;  4X63 B;  4PXW A;  4GGA A;  3VA6 A;  4XEI C;  4GQB B;  4IMM A;  2H9M A;  5CXC A;  5CXB A;  4CY1 A;  4L3H D;  5B4W A;  3C99 A;  4A0B B;  3PXT D;  3C75 H;  2HYE A;  3FGB A;  5C2W B;  3MMY A;  4JXM A;  1A0R B;  4CC9 A;  4ZN4 A;  4O45 A;  4D0K A;  4D6V A;  2CO0 A;  2IUQ A;  3SBP A;  2GC7 A;  4ZOY A;  2HJB A;  2J55 H;  3EI3 A;  5H17 A;  4GM3 A;  4NSX A;  3AL8 A;  3SMR A;  3UVL A;  4O3U B;  2XU7 A;  4FA4 D;  3OKY A;  1B9Y A;  1Q47 A;  3VGZ A;  3AFC A;  4J73 A;  3IJ1 A;  5FQD A;  5IT9 g;  4ERY A;  1FWX A;  2Z2O A;  2XYI A;  2J57 G;  2IWK A;  1R5M A;  3PSC B;  2O9K A;  3IKO A;  4J8B A;  4AEZ A;  5EAP A;  3IIW A;  2P9I C;  3BG1 A;  4JT6 C;  5H1M A;  3ORV D;  3MXX A;  4IA9 A;  3PXW D;  5EMK B;  3W15 A;  2H9P A;  3UKR C;  3AH8 B;  4BUJ C;  4Z8L A;  4BH6 A;  4J78 A;  2PM7 B;  2YNP A;  3RN1 D;  4J82 A;  4JSP C;  2H3X A;  4LGN A;  3C9C A;  2OIZ A;  4LG8 A;  3RFG A;  3RN0 D;  4ZOX A;  1PEV A;  1ERJ A;  2YB8 B;  4PNK B;  2B5N A;  5CYK B;  1JJU B;  5CYK A;  5FKT A;  1B9X A;  2CO0 C;  3DWL C;  1YFQ A;  3SJL D;  4A11 B;  4FA1 D;  5C9Z B;  3IJ0 A;  1NEX B;  2HXC A;  2GNQ A;  3BG0 A;  4U7A A;  4A09 A;  4L9O A;  2P9S C;  4CZY A;  1OLZ A;  3I7H A;  2IWF A;  2CE8 A;  3EMH A;  4J0W A;  3MZL A;  3V7D B;  5GSA A;  4PSW B;  3UVM A;  3IIY A;  3I8C A;  4JD2 C;  2MTA H;  1TBG A;  2Z2N A;  2CE9 A;  2PBI B;  2H13 A;  3V5W B;  5EML B;  4CY5 A;  4ESG A;  3ZWL B;  3EI4 B;  4A08 A;  1OMW B;  1U4C A;  2IUV A;  1GXR A;  3N0E A;  4GM9 A;  4CI3 A;  2BBK H;  4CY2 A;  2AGZ A;  1MDA H;  5GMK n;  5IJ7 E;  4G56 B;  5THA A;  3SFZ A;  3JB9 L;  3SHF A;  4HDJ A;  4OZU A;  1GOT B;  1NR0 A;  1SQ9 A;  4FAV D;  5K19 A;  4FB1 D;  2B5M A;  3L4O D;  4QQE A;  2I0T A;  4H5I A;  3DSM A;  3I7L A;  4ZOZ A;  1P22 A;  3C5M A;  2EBS A;  3EI1 B;  3EI1 A;  2TRC B;  5AFU 3;  4R7A B;  2YMU A;  3SN6 B;  5GXH A;  4O1Q D;  1PI6 A;  4A2M A;  5SXM A;  5K1C C;  3I2N A;  5HE3 B;  3B7F A;  5TEE A;  3F3P A;  4J0X A;  3J80 g;  4JSN C;  1GG2 B;  5A2Q g;  2IUR A;  3FRX A;  3OL2 B;  3OL2 A;  2GC4 A;  3KRW B;  5FKS A;  3RLM D;  2IAA A;  1K32 A;  3JPX A;  2Q7Q A;  5GXI A;  3P4F A;  2I0S A;  3KRX B;  2OVR B;  4O9D A;  3K26 A;  3I8E A;  2IUP A;  3PE7 A;  3UVN A;  5IGQ A;  3EI4 A;  3JAM g;  4A08 B;  4J87 A;  2CN2 A;  2HKR A;  2QC5 A;  1JMX B;  1PGU A;  4TZ4 A;  5JWZ A;  4PBY A;  4N14 A;  2OK6 A;  2HKM A;  3CIK B;  5EMJ B;  3GFC A;  1PBY B;  2OVQ B;  3SWS D;  4E5Z B;  5EMM B;  3ODT A;  5I5J A;  2P9P C;  3RSE C;  2AGW A;  3UVO A;  4I79 A;  4GGC A;  3CFS B;  1XHM A;  3I7K A;  4A11 A;  4EWR A;  3PVU B;  3GRE A;  3PSL A;  2AH0 A;  2P9L C;  5TDH B;  2B4E A;  1S4U X;  2PM9 A;  1N6F A;  3J81 g;  3EI2 A;  2BCJ B;  5EM2 A;  1GP2 B;  5EM2 B;  2I3T A;  4Y7R A;  2J56 H;  3NVQ A;  2H68 A;  3OKT A;  5C2V B;  1SHY B;  4JSV C;  5HE1 B;  4QT8 A;  3JZN A;  3I7N A;  5FKR A;  3PVW B;  2CNX A;  2G9A A;  3K27 A;  3SBQ A;  3JZG A;  4ERZ A;  1N6D A;  3NVN A;  3MKQ A;  1N6E A;  2UZY B;  4PBZ A;  4FA5 D;  4X61 B;  5FA5 B;  4E54 B;  5HE0 B;  4AOW A;  3EG6 A;  3SBR A;  3BWS A;  2PM6 B;  4CI1 A;  4UI9 R;  4FA9 D;  2W18 A;  3I7P A;  5TF2 A;  4CZV A;  5AMS A;  4CI8 A;  2H6Q A;  4PSX B;  3EWE A;  3MZK A;  3E0C A;  4BL0 A;  5FXY A;  1QNI A;  3EI3 B;  4GGD A;  2H6N A;  1JMZ B;  4K3J B;  3UKU C;  5HYN B;  5I5M A;  2PM9 B;  4FAN D;  4K3I D;  3V9F A;  5CXB B;  2AQ5 A;  4QL1 A;  3OTT A;  3DM0 A;  4J86 A;  4QRJ A;  3RRM C;  3L4M D;  5EAL A;  4A0B A;  4GMB A;  4GQ2 P;  1MG3 A;  1JOF A;  3FM0 A;  3U4Y A;  2AGY A;  3JRP A;  3RFH A;  3SLE D;  4A7J A;  4X3E A;  2G99 A;  2I0R A;  5IC7 A;  4CI2 A;  4GM8 A;  3UR4 A;  3SXT D;  2XL3 A;  3N0D A;  3PXS D;  4A09 B;  4A0A A;  4CY3 A;  3EU7 A;  4OWR A;  5KDO B;  2OVP B;  3OKW A;  4X60 B;  3F3F A;  4LG9 A;  5EAM A;  4GZ8 A;  1L0Q A;  5EAR A;  1VYH C;  4J81 A;  3A0F A;  3VH0 A;  2P9K C;  2AH1 A;  3HFQ A;  4YVD A;  2P9U C;  2OK4 A;  2UZX B;  3ULE C;  1XKS A;  2P9N C;  3DXM C;  5TEF A;  4O3T B;  4H5J A;  3UVK A;  2XL2 A;  2YNO A;  3OW8 A;  4J8G A;  4ZOV A;  3I7O A;  3OKY B;  3EI2 B;  4GQ1 A;  2YBA A;  4Y5R D;  4E54 A;  3JRO A;  5CXC B;  2H9N A;  5FKQ A;  2AGX A;  2OJY A;  4JT5 C;  3SVW D;  3AL9 A;  2H6K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...