2H6NA

Histone h3 recognition and presentation by the wdr5 module of the mll1 complex
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
304
structure length
304
Chain Sequence
VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords WD-repeat protein 5
publication title Histone H3 recognition and presentation by the WDR5 module of the MLL1 complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 101
structure length 304
sequence length 304
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2h6nA00
2AGWA 2HJ4A 4GQ2P 3OW8A 3AL9A 4L1QD 1PBYB 1B9YA 4IA9A 3DSMA 2B4EA 5EALA 1JMXB 4HDJA 4E5ZB 1Q47A 3P4FA 3W15A 1SQJA 2IUQA 4A7JA 2GNQA 3F3GA 2H6QA 3BG1A 4E54B 5AJAA 2CNXA 3B7FA 4LG8A 1JMZB 3I7OA 2H3XA 3NVXA 3OKYA 4GMBA 5FKTA 3EI2B 4J73A 4D0KA 5C2WB 3EI3A 5A2Qg 2J55H 4LGNA 3A0FA 3SJLD 2BBKH 5EM2A 1JJUB 4CI2A 1PEVA 3KRWB 3I2NA 4JSPC 4R7AB 1N6DA 2IUPA 4A11B 4A09A 4L3HD 3BG0A 2I3TA 2O9KA 3I7HA 3MZKA 5THAA 1S4UX 4D6VA 1L0QA 4ERQA 3OKTA 4K3ID 3UKRC 5FXYA 3EWEA 4IMMA 5H14A 4FA1D 2B5NA 5CYKA 4FAND 2OVPB 5FLXg 2EBSA 5HQGA 4E5ZA 3RMZD 5EMMB 2XL3A 3MZLA 1NEXB 5EARA 4NSXA 1A0RB 4X3EA 4FAVD 2G99A 5I5IA 2YNPA 2J57G 3SBRA 2CO0A 3ULEC 5CXBB 2OVRB 3BWSA 3OKWA 3ZWLB 5SXMA 2IUVA 1NR0A 5HE2B 4CI8A 4JSNC 5IJ7E 4ESGA 3DM0A 2HYEA 4K3JB 1TBGA 4U7AA 2UZXB 2TRCB 3CIKB 3OKYB 3SFZA 5K1CC 3RFHA 5IT9g 3PVUB 3AFCA 3EI3B 3SCYA 5EM2B 2H9LA 2H9NA 2P9LC 2CO0C 3I7KA 4QRJA 4GZ8A 5EMKB 2P9IC 3K26A 3ODTA 1SHYB 5JWZA 3JZNA 4J86A 5IJ8E 2CE8A 4YVDA 2Z2PA 3NVQA 3IKOA 4CY2A 5CYKB 5H17A 4O3UB 3RFGA 5GMKn 3RSEC 3DXKC 3L4MD 5KDOB 3V7DB 4Z8LA 2I0TA 4X61B 4FB1D 1JOFA 1XIPA 1GOTB 5CXBA 4JT5C 2HKMA 2AH0A 3F3FA 5I5JA 4J8BA 3EG6A 5HE3B 5I5MA 4XYIA 3UVKA 5HE1B 2AGLA 2Z2NA 4JXMA 2GC4A 3VGZA 2UZYB 4CY5A 2AQ5A 2W18A 5GXIA 1YFQA 4XEIC 4H5JA 4J77A 1GXRA 4J78A 3VH0A 4A0AA 3J80g 2Q7QA 1N6FA 4ES0A 2XU7A 3AL8B 5FKSA 1SQ9A 2J56H 2MTAH 4JT6C 4FHLA 5TF2A 2HXCA 5TEEA 4FA4D 2P9NC 3RLMD 4BUJC 4KFMB 1ERJA 5FA5B 3OL2A 3PXSD 3KRXB 1P22A 2H9MA 4AOWA 1FWXA 2AGXA 5IGOA 5IC7A 4L9OA 1R5MA 3JZGA 3DWLC 4LG9A 4JD2C 5HE0B 3C5MA 3UVNA 4QL1A 4J81A 3CFVA 1TYQC 3I7PA 3EI4A 4MK0B 3IJCA 4QT8A 4GGDA 4CC9A 4A2LA 4QQEA 1PI6A 2CN3A 3I8CA 1U4CA 4XYHA 3J81g 3I8EA 3DXMC 5EAPA 1XKSA 4U1EI 1GG2B 5EMJB 2HJBA 4PXWA 3FM0A 1N6EA 4OZUA 3I7LA 2HESX 2H6NA 2HKRA 4Y5RD 5C2VB 2OJYA 3SLED 4L3GD 1RI6A 4GGCA 5AMSA 5TDHB 2H14A 4FA9D 3SBPA 4A0BB 3AL8A 2GC7A 2P9UC 4BH6A 5FKRA 4CI1A 2H13A 4BL0A 5GSAA 3IJ1A 3I89A 4A0AB 3SMRA 4TZ4A 2I0RA 5EMLB 4ZOVA 2B5MA 4ZN4A 2PBIB 5IGQA 4EWRA 5K19A 2PM7B 3GFCA 3OL2B 3MKSB 5GXHA 4I79A 4JSVC 4J82A 5TEFA 2IURA 2OK6A 3IIYA 4ZOZA 3IIWA 2BCJB 3EI4B 2I3SA 5C9ZB 4AEZA 3JPXA 4CZVA 3UKUC 5H1MA 3HFQA 3SVWD 3AH8B 3JROA 4CY1A 2I0SA 3F3PA 3JZHA 3N0EA 4CY3A 1OLZA 2YB8B 3RN1D 3PXTD 2CE9A 3EI1B 4J8GA 3PVWB 3SWSD 4ERYA 2YNNA 3RRMC 3C9CA 2PM6B 4A0BA 4CZXA 1MG3A 1B9XA 4H5IA 2H9PA 4A2MA 4OWRA 3ORVD 3JRPA 4A08A 2OIZA 2XL2A 2B5LA 1VYHC 2H68A 5B4WA 3SN6B 3C99A 1QNIA 4FWWA 4PNKB 2P9KC 4X63B 5FQDA 4GGAA 1OMWB 4J87A 4J0XA 2AGYA 4PSWB 1MDAH 4GM3A 4PSXB 3UVLA 2PM9A 2YBAA 5CXCA 1XHMA 2QXVA 3PSLA 3JAMg 2P9SC 3PXWD 3FGBA 4O1QD 3RN0D 1U2VC 4GQBB 4GM8A 3GREA 4ZOXA 2OVQB 3NVNA 4ERZA 2XYIA 4ZOYA 2Z2OA 4J0WA 2IWKA 3CFSB 3I7NA 5FKQA 4O9DA 4X60B 1MG2A 4J84A 3VA6A 4N14A 1GP2B 3MKQA 2OK4A 3EI1A 3IJ0A 3K27A 2CN2A 4GQ1A 2AH1A 3N0DA 2YMUA 4JSXC 4PBZA 1PGUA 3MMYA 3JB9L 3V9FA 3SHFA 2H47A 4FA5D 4O45A 4CI3A 3PSCB 3C75H 4E54A 5EAMA 4Y7RA 5HYNB 3EMHA 3SBQA 3EI2A 4A08B 3MXXA 2H6KA 4O3TB 3PE7A 1K8KC 4PC0A 5AFU3 3L4OD 3UVMA 1K32A 4G56B 3OTTA 2PM9B 4A11A 5CXCB 2QC5A 3UVOA 3UR4A 2G9AA 2IWFA 3E0CA 3EU7A 4J79A 4CZYA 4UI9R 3U4YA 4A09B 2AGZA 3FRXA 3SXTD 3V5WB 2P9PC 2IAAA 2YNOA 4PBYA 4GM9A
chains in the Genus database with same CATH superfamily
2AGWA 2VDKA 2HJ4A 2XDWA 1E8NA 4GQ2P 3OW8A 3AL9A 4L1QD 1PBYB 1B9YA 4IA9A 3DSMA 2B4EA 4UM8A 3IUMA 5EALA 1JMXB 4HDJA 4E5ZB 1Q47A 3P4FA 3W15A 1SQJA 2IUQA 4A7JA 2GNQA 3F3GA 2H6QA 3BG1A 4E54B 5AJAA 2CNXA 3B7FA 2VZ3A 4LG8A 1JMZB 3I7OA 2VC2A 2H3XA 2EIBA 3NVXA 3OKYA 4GMBA 5FKTA 1VZ2A 4BP9A 3EI2B 4J73A 4D0KA 2QR5A 5E6SA 3T3PA 5C2WB 3EI3A 5A2Qg 2J55H 4LGNA 3A0FA 3SJLD 2BBKH 2VDNA 5EM2A 1JJUB 4CI2A 1PEVA 3KRWB 3I2NA 5M5VA 3O4HA 4JSPC 4R7AB 2VDRA 1N6DA 2IUPA 4A11B 4A09A 4L3HD 3BG0A 2I3TA 2O9KA 3I7HA 3MZKA 5THAA 1S4UX 4D6VA 1L0QA 4ERQA 3OKTA 4K3ID 3UKRC 3NIFA 5FXYA 3EWEA 4IMMA 5H14A 1L5GA 4FA1D 1O6GA 2B5NA 5CYKA 4FAND 2OVPB 5FLXg 2EBSA 5HQGA 3MVDK 2EIDA 4E5ZA 3RMZD 4NENA 5EMMB 2XL3A 3ZDZA 4BCBA 3MZLA 1NEXB 5EARA 3ZE2A 4NSXA 1A0RB 3EQ9A 4X3EA 4FAVD 2G99A 5I5IA 2YNPA 1UOQA 2J57G 3SBRA 1UOPA 4G1EA 2CO0A 3ULEC 5CXBB 2XE4A 2JKXA 2OVRB 1O6FA 4AMYA 3BWSA 3OKWA 3ZWLB 5SXMA 1C9LA 2IUVA 4MMZA 2VDQA 1NR0A 5HE2B 4CI8A 4JSNC 5IJ7E 4ESGA 3IUNA 3DM0A 2HYEA 1TBGA 4K3JB 4U7AA 2UZXB 2TRCB 3CIKB 3OKYB 4QAMA 3SFZA 5K1CC 3RFHA 5IT9g 3PVUB 1K3IA 3AFCA 3EI3B 3SCYA 5EM2B 1BPOA 1JV2A 2H9LA 2H9NA 2P9LC 2CO0C 3I7KA 4QRJA 4GZ8A 1TYEA 4WJKA 5EMKB 2P9IC 3K26A 3ODTA 1SHYB 5JWZA 3JZNA 3GD1I 4O2WA 4J86A 5IJ8E 3ZE0A 2CE8A 4YVDA 2Z2PA 3ZDXA 3NVQA 3IKOA 4NAAA 4CY2A 5CYKB 5H17A 5FFGA 4O3UB 3RFGA 5GMKn 3RSEC 3EQ8A 3DXKC 3L4MD 5KDOB 5M5SA 3V7DB 3VI4A 4Z8LA 3EQ7A 2I0TA 4X61B 4FB1D 1JOFA 1XIPA 1GOTB 5CXBA 1VZ3A 2HKMA 4JT5C 2AH0A 3F3FA 4RE6A 5I5JA 4J8BA 4AX4A 3EG6A 5HE3B 5I5MA 4XYIA 3UVKA 5HE1B 2AGLA 2Z2NA 5HDBA 1T2XA 1VE6A 4JXMA 2GC4A 3VGZA 4D9SA 3V4VA 2UZYB 1GOHA 4CY5A 2AQ5A 2W18A 4AN0A 5GXIA 1YFQA 3T3MA 4XEIC 4H5JA 4J77A 1GXRA 4J78A 3VH0A 4A0AA 3J80g 2Q7QA 4Z7QA 1N6FA 4ES0A 2XU7A 3AL8B 5FKSA 1SQ9A 1VE7A 2J56H 2MTAH 4JT6C 4FHLA 5TF2A 2HXCA 5TEEA 4FA4D 2P9NC 3RLMD 4BUJC 4KFMB 1ERJA 3O4IA 3OL2A 5FA5B 3PXSD 3KRXB 1P22A 2H9MA 4AOWA 1FWXA 2AGXA 5IGOA 5IC7A 4L9OA 1R5MA 3JZGA 1JTDB 3DWLC 4JD2C 4LG9A 5HE0B 3C5MA 3UVNA 4QL1A 4J81A 3CFVA 1E5TA 1I2MB 4NBMA 3FCUA 4MMYA 1TYQC 3I7PA 4O02A 4AMZA 3QHYB 3EI4A 4MK0B 1QFMA 3IJCA 4QT8A 4GGDA 1E8MA 4CC9A 4A2LA 4QQEA 1PI6A 1QFSA 2CN3A 3I8CA 1M1XA 3O4GA 1U4CA 4XYHA 2HU7A 3IVMA 3I8EA 4BCCA 3J81g 3DXMC 5EAPA 2HU5A 4DNUA 1XKSA 4U1EI 1GG2B 5EMJB 2HJBA 2EICA 4PXWA 4BP8A 5C86A 3FM0A 1N6EA 4OZUA 3I7LA 3K71A 2HESX 2H6NA 2HKRA 4Y5RD 5C2VB 2OJYA 3SLED 2VDPA 4L3GD 4Z7NA 1RI6A 4GGCA 1UOOA 5AMSA 5TDHB 4IRZA 2H14A 4FA9D 3SBPA 4A0BB 4Z7OA 3AL8A 2GC7A 2P9UC 4BH6A 5FKRA 4CI1A 3ZE1A 2H13A 1H2XA 1H2WA 4BL0A 5GSAA 3IJ1A 3I89A 4BCDA 4A0AB 3SMRA 4TZ4A 2I0RA 5EMLB 4ZOVA 5C92A 2VDMA 2VDOA 2B5MA 4ZN4A 2PBIB 5IGQA 4UM9A 4EWRA 3K72A 3MUNA 5K19A 4MMXA 2PM7B 3GFCA 3OL2B 5E6RA 3MKSB 4RE5A 5GXHA 4I79A 4JSVC 4J82A 5TEFA 2IURA 2OK6A 2QZPA 3IIYA 1C9IA 4ZOZA 4DNVA 3IIWA 2BCJB 3VI3A 3EI4B 2I3SA 5C9ZB 4AEZA 4NC4A 3JPXA 4CZVA 3UKUC 5H1MA 3HFQA 3SVWD 3AH8B 3K6SA 1YR2A 3JROA 4CY1A 2I0SA 3F3PA 3JZHA 3N0EA 4CY3A 1OLZA 2YB8B 3RN1D 5M5UA 3PXTD 2CE9A 3EI1B 4J8GA 3PVWB 3SWSD 3IUJA 4ERYA 2YNNA 3RRMC 1U8CA 3C9CA 5M5TA 2PM6B 4DNWA 4A0BA 4CZXA 1MG3A 1B9XA 1A12A 4H5IA 3MUOA 2H9PA 4A2MA 4OWRA 2HU8A 3ORVD 3JRPA 4A08A 3GC3B 2OIZA 2XL2A 2B5LA 1VYHC 2H68A 5B4WA 3SN6B 2EIEA 3C99A 1QNIA 4FWWA 4PNKB 2P9KC 4X63B 5FQDA 4GGAA 1OMWB 4J87A 4J0XA 2AGYA 4G55A 1MDAH 4PSWB 4GM3A 4PSXB 5M5RA 2VZ1A 3UVLA 2PM9A 1H2ZA 2VDLA 2YBAA 5CXCA 1XHMA 2QXVA 3PSLA 3JAMg 3IUQA 2P9SC 1UTCA 3FGBA 3PXWD 4O1QD 5FFOA 3RN0D 1U2VC 4GQBB 4GM8A 1H2YA 3NIDA 3GREA 4ZOXA 2OVQB 3NVNA 4ERZA 2BKLA 2XYIA 4ZOYA 2Z2OA 4G1MA 4J0WA 1GOGA 2IWKA 3CFSB 3FCSA 3I7NA 5FKQA 4O9DA 4X60B 1MG2A 4J84A 3VA6A 4JHNA 4N14A 1GP2B 3MKQA 2OK4A 3O4JA 3EI1A 3IJ0A 3K27A 3OF7A 2CN2A 3DDUA 4GQ1A 2AH1A 3N0DA 2YMUA 4JSXC 3QI0A 4PBZA 1PGUA 3MMYA 3JB9L 3V9FA 1GOFA 3SHFA 2H47A 4FA5D 4O45A 4WK4A 3PSCB 5M61A 4CI3A 3C75H 2XZGA 4E54A 5EAMA 4Y7RA 5HYNB 3EMHA 4JHPC 3SBQA 3EI2A 4A08B 3MXXA 2H6KA 4O3TB 3PE7A 1K8KC 4PC0A 5AFU3 3IJEA 4AN1A 3L4OD 3UVMA 1K32A 4WK0A 4L1MA 4G56B 3OTTA 3NIGA 4WK2A 2PM9B 3KCIA 4A11A 5CXCB 2QC5A 3ZDYA 3UVOA 3UR4A 2G9AA 2IWFA 3E0CA 3EU7A 2WQ8A 4J79A 3V4PA 4CZYA 3IULA 5E6UA 3IURA 4UI9R 3U4YA 4A09B 2AGZA 3FRXA 3SXTD 3V5WB 2P9PC 2IAAA 2YNOA 4PBYA 4GM9A
chains in the Genus database with same CATH topology
2AGWA 2HJ4A 4GQ2P 3OW8A 3AL9A 4L1QD 1PBYB 1B9YA 4IA9A 3DSMA 2B4EA 5EALA 1JMXB 4HDJA 4E5ZB 1Q47A 3P4FA 3W15A 1SQJA 2IUQA 4A7JA 2GNQA 3F3GA 2H6QA 3BG1A 4E54B 5AJAA 2CNXA 3B7FA 4LG8A 1JMZB 3I7OA 2H3XA 3NVXA 3OKYA 4GMBA 5FKTA 3EI2B 4J73A 4D0KA 5C2WB 3EI3A 5A2Qg 2J55H 4LGNA 3A0FA 3SJLD 2BBKH 5EM2A 1JJUB 4CI2A 1PEVA 3KRWB 3I2NA 4JSPC 4R7AB 1N6DA 2IUPA 4A11B 4A09A 4L3HD 3BG0A 2I3TA 2O9KA 3I7HA 3MZKA 5THAA 1S4UX 4D6VA 1L0QA 4ERQA 3OKTA 4K3ID 3UKRC 5FXYA 3EWEA 4IMMA 5H14A 4FA1D 2B5NA 5CYKA 4FAND 2OVPB 5FLXg 2EBSA 5HQGA 4E5ZA 3RMZD 5EMMB 2XL3A 3MZLA 1NEXB 5EARA 4NSXA 1A0RB 4X3EA 4FAVD 2G99A 5I5IA 2YNPA 2J57G 3SBRA 2CO0A 3ULEC 5CXBB 2OVRB 3BWSA 3OKWA 3ZWLB 5SXMA 2IUVA 1NR0A 5HE2B 4CI8A 4JSNC 5IJ7E 4ESGA 3DM0A 2HYEA 4K3JB 1TBGA 4U7AA 2UZXB 2TRCB 3CIKB 3OKYB 3SFZA 5K1CC 3RFHA 5IT9g 3PVUB 3AFCA 3EI3B 3SCYA 5EM2B 2H9LA 2H9NA 2P9LC 2CO0C 3I7KA 4QRJA 4GZ8A 5EMKB 2P9IC 3K26A 3ODTA 1SHYB 5JWZA 3JZNA 4J86A 5IJ8E 2CE8A 4YVDA 2Z2PA 3NVQA 3IKOA 4CY2A 5CYKB 5H17A 4O3UB 3RFGA 5GMKn 3RSEC 3DXKC 3L4MD 5KDOB 3V7DB 4Z8LA 2I0TA 4X61B 4FB1D 1JOFA 1XIPA 1GOTB 5CXBA 4JT5C 2HKMA 2AH0A 3F3FA 5I5JA 4J8BA 3EG6A 5HE3B 5I5MA 4XYIA 3UVKA 5HE1B 2AGLA 2Z2NA 4JXMA 2GC4A 3VGZA 2UZYB 4CY5A 2AQ5A 2W18A 5GXIA 1YFQA 4XEIC 4H5JA 4J77A 1GXRA 4J78A 3VH0A 4A0AA 3J80g 2Q7QA 1N6FA 4ES0A 2XU7A 3AL8B 5FKSA 1SQ9A 2J56H 2MTAH 4JT6C 4FHLA 5TF2A 2HXCA 5TEEA 4FA4D 2P9NC 3RLMD 4BUJC 4KFMB 1ERJA 5FA5B 3OL2A 3PXSD 3KRXB 1P22A 2H9MA 4AOWA 1FWXA 2AGXA 5IGOA 5IC7A 4L9OA 1R5MA 3JZGA 3DWLC 4LG9A 4JD2C 5HE0B 3C5MA 3UVNA 4QL1A 4J81A 3CFVA 1TYQC 3I7PA 3EI4A 4MK0B 3IJCA 4QT8A 4GGDA 4CC9A 4A2LA 4QQEA 1PI6A 2CN3A 3I8CA 1U4CA 4XYHA 3J81g 3I8EA 3DXMC 5EAPA 1XKSA 4U1EI 1GG2B 5EMJB 2HJBA 4PXWA 3FM0A 1N6EA 4OZUA 3I7LA 2HESX 2H6NA 2HKRA 4Y5RD 5C2VB 2OJYA 3SLED 4L3GD 1RI6A 4GGCA 5AMSA 5TDHB 2H14A 4FA9D 3SBPA 4A0BB 3AL8A 2GC7A 2P9UC 4BH6A 5FKRA 4CI1A 2H13A 4BL0A 5GSAA 3IJ1A 3I89A 4A0AB 3SMRA 4TZ4A 2I0RA 5EMLB 4ZOVA 2B5MA 4ZN4A 2PBIB 5IGQA 4EWRA 5K19A 2PM7B 3GFCA 3OL2B 3MKSB 5GXHA 4I79A 4JSVC 4J82A 5TEFA 2IURA 2OK6A 3IIYA 4ZOZA 3IIWA 2BCJB 3EI4B 2I3SA 5C9ZB 4AEZA 3JPXA 4CZVA 3UKUC 5H1MA 3HFQA 3SVWD 3AH8B 3JROA 4CY1A 2I0SA 3F3PA 3JZHA 3N0EA 4CY3A 1OLZA 2YB8B 3RN1D 3PXTD 2CE9A 3EI1B 4J8GA 3PVWB 3SWSD 4ERYA 2YNNA 3RRMC 3C9CA 2PM6B 4A0BA 4CZXA 1MG3A 1B9XA 4H5IA 2H9PA 4A2MA 4OWRA 3ORVD 3JRPA 4A08A 2OIZA 2XL2A 2B5LA 1VYHC 2H68A 5B4WA 3SN6B 3C99A 1QNIA 4FWWA 4PNKB 2P9KC 4X63B 5FQDA 4GGAA 1OMWB 4J87A 4J0XA 2AGYA 4PSWB 1MDAH 4GM3A 4PSXB 3UVLA 2PM9A 2YBAA 5CXCA 1XHMA 2QXVA 3PSLA 3JAMg 2P9SC 3PXWD 3FGBA 4O1QD 3RN0D 1U2VC 4GQBB 4GM8A 3GREA 4ZOXA 2OVQB 3NVNA 4ERZA 2XYIA 4ZOYA 2Z2OA 4J0WA 2IWKA 3CFSB 3I7NA 5FKQA 4O9DA 4X60B 1MG2A 4J84A 3VA6A 4N14A 1GP2B 3MKQA 2OK4A 3EI1A 3IJ0A 3K27A 2CN2A 4GQ1A 2AH1A 3N0DA 2YMUA 4JSXC 4PBZA 1PGUA 3MMYA 3JB9L 3V9FA 3SHFA 2H47A 4FA5D 4O45A 4CI3A 3PSCB 3C75H 4E54A 5EAMA 4Y7RA 5HYNB 3EMHA 3SBQA 3EI2A 4A08B 3MXXA 2H6KA 4O3TB 3PE7A 1K8KC 4PC0A 5AFU3 3L4OD 3UVMA 1K32A 4G56B 3OTTA 2PM9B 4A11A 5CXCB 2QC5A 3UVOA 3UR4A 2G9AA 2IWFA 3E0CA 3EU7A 4J79A 4CZYA 4UI9R 3U4YA 4A09B 2AGZA 3FRXA 3SXTD 3V5WB 2P9PC 2IAAA 2YNOA 4PBYA 4GM9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AGW A;  2HJ4 A;  4GQ2 P;  3OW8 A;  3AL9 A;  4L1Q D;  1PBY B;  1B9Y A;  4IA9 A;  3DSM A;  2B4E A;  5EAL A;  1JMX B;  4HDJ A;  4E5Z B;  1Q47 A;  3P4F A;  3W15 A;  1SQJ A;  2IUQ A;  4A7J A;  2GNQ A;  3F3G A;  2H6Q A;  3BG1 A;  4E54 B;  5AJA A;  2CNX A;  3B7F A;  4LG8 A;  1JMZ B;  3I7O A;  2H3X A;  3NVX A;  3OKY A;  4GMB A;  5FKT A;  3EI2 B;  4J73 A;  4D0K A;  5C2W B;  3EI3 A;  5A2Q g;  2J55 H;  4LGN A;  3A0F A;  3SJL D;  2BBK H;  5EM2 A;  1JJU B;  4CI2 A;  1PEV A;  3KRW B;  3I2N A;  4JSP C;  4R7A B;  1N6D A;  2IUP A;  4A11 B;  4A09 A;  4L3H D;  3BG0 A;  2I3T A;  2O9K A;  3I7H A;  3MZK A;  5THA A;  1S4U X;  4D6V A;  1L0Q A;  4ERQ A;  3OKT A;  4K3I D;  3UKR C;  5FXY A;  3EWE A;  4IMM A;  5H14 A;  4FA1 D;  2B5N A;  5CYK A;  4FAN D;  2OVP B;  5FLX g;  2EBS A;  5HQG A;  4E5Z A;  3RMZ D;  5EMM B;  2XL3 A;  3MZL A;  1NEX B;  5EAR A;  4NSX A;  1A0R B;  4X3E A;  4FAV D;  2G99 A;  5I5I A;  2YNP A;  2J57 G;  3SBR A;  2CO0 A;  3ULE C;  5CXB B;  2OVR B;  3BWS A;  3OKW A;  3ZWL B;  5SXM A;  2IUV A;  1NR0 A;  5HE2 B;  4CI8 A;  4JSN C;  5IJ7 E;  4ESG A;  3DM0 A;  2HYE A;  4K3J B;  1TBG A;  4U7A A;  2UZX B;  2TRC B;  3CIK B;  3OKY B;  3SFZ A;  5K1C C;  3RFH A;  5IT9 g;  3PVU B;  3AFC A;  3EI3 B;  3SCY A;  5EM2 B;  2H9L A;  2H9N A;  2P9L C;  2CO0 C;  3I7K A;  4QRJ A;  4GZ8 A;  5EMK B;  2P9I C;  3K26 A;  3ODT A;  1SHY B;  5JWZ A;  3JZN A;  4J86 A;  5IJ8 E;  2CE8 A;  4YVD A;  2Z2P A;  3NVQ A;  3IKO A;  4CY2 A;  5CYK B;  5H17 A;  4O3U B;  3RFG A;  5GMK n;  3RSE C;  3DXK C;  3L4M D;  5KDO B;  3V7D B;  4Z8L A;  2I0T A;  4X61 B;  4FB1 D;  1JOF A;  1XIP A;  1GOT B;  5CXB A;  4JT5 C;  2HKM A;  2AH0 A;  3F3F A;  5I5J A;  4J8B A;  3EG6 A;  5HE3 B;  5I5M A;  4XYI A;  3UVK A;  5HE1 B;  2AGL A;  2Z2N A;  4JXM A;  2GC4 A;  3VGZ A;  2UZY B;  4CY5 A;  2AQ5 A;  2W18 A;  5GXI A;  1YFQ A;  4XEI C;  4H5J A;  4J77 A;  1GXR A;  4J78 A;  3VH0 A;  4A0A A;  3J80 g;  2Q7Q A;  1N6F A;  4ES0 A;  2XU7 A;  3AL8 B;  5FKS A;  1SQ9 A;  2J56 H;  2MTA H;  4JT6 C;  4FHL A;  5TF2 A;  2HXC A;  5TEE A;  4FA4 D;  2P9N C;  3RLM D;  4BUJ C;  4KFM B;  1ERJ A;  5FA5 B;  3OL2 A;  3PXS D;  3KRX B;  1P22 A;  2H9M A;  4AOW A;  1FWX A;  2AGX A;  5IGO A;  5IC7 A;  4L9O A;  1R5M A;  3JZG A;  3DWL C;  4LG9 A;  4JD2 C;  5HE0 B;  3C5M A;  3UVN A;  4QL1 A;  4J81 A;  3CFV A;  1TYQ C;  3I7P A;  3EI4 A;  4MK0 B;  3IJC A;  4QT8 A;  4GGD A;  4CC9 A;  4A2L A;  4QQE A;  1PI6 A;  2CN3 A;  3I8C A;  1U4C A;  4XYH A;  3J81 g;  3I8E A;  3DXM C;  5EAP A;  1XKS A;  4U1E I;  1GG2 B;  5EMJ B;  2HJB A;  4PXW A;  3FM0 A;  1N6E A;  4OZU A;  3I7L A;  2HES X;  2H6N A;  2HKR A;  4Y5R D;  5C2V B;  2OJY A;  3SLE D;  4L3G D;  1RI6 A;  4GGC A;  5AMS A;  5TDH B;  2H14 A;  4FA9 D;  3SBP A;  4A0B B;  3AL8 A;  2GC7 A;  2P9U C;  4BH6 A;  5FKR A;  4CI1 A;  2H13 A;  4BL0 A;  5GSA A;  3IJ1 A;  3I89 A;  4A0A B;  3SMR A;  4TZ4 A;  2I0R A;  5EML B;  4ZOV A;  2B5M A;  4ZN4 A;  2PBI B;  5IGQ A;  4EWR A;  5K19 A;  2PM7 B;  3GFC A;  3OL2 B;  3MKS B;  5GXH A;  4I79 A;  4JSV C;  4J82 A;  5TEF A;  2IUR A;  2OK6 A;  3IIY A;  4ZOZ A;  3IIW A;  2BCJ B;  3EI4 B;  2I3S A;  5C9Z B;  4AEZ A;  3JPX A;  4CZV A;  3UKU C;  5H1M A;  3HFQ A;  3SVW D;  3AH8 B;  3JRO A;  4CY1 A;  2I0S A;  3F3P A;  3JZH A;  3N0E A;  4CY3 A;  1OLZ A;  2YB8 B;  3RN1 D;  3PXT D;  2CE9 A;  3EI1 B;  4J8G A;  3PVW B;  3SWS D;  4ERY A;  2YNN A;  3RRM C;  3C9C A;  2PM6 B;  4A0B A;  4CZX A;  1MG3 A;  1B9X A;  4H5I A;  2H9P A;  4A2M A;  4OWR A;  3ORV D;  3JRP A;  4A08 A;  2OIZ A;  2XL2 A;  2B5L A;  1VYH C;  2H68 A;  5B4W A;  3SN6 B;  3C99 A;  1QNI A;  4FWW A;  4PNK B;  2P9K C;  4X63 B;  5FQD A;  4GGA A;  1OMW B;  4J87 A;  4J0X A;  2AGY A;  4PSW B;  1MDA H;  4GM3 A;  4PSX B;  3UVL A;  2PM9 A;  2YBA A;  5CXC A;  1XHM A;  2QXV A;  3PSL A;  3JAM g;  2P9S C;  3PXW D;  3FGB A;  4O1Q D;  3RN0 D;  1U2V C;  4GQB B;  4GM8 A;  3GRE A;  4ZOX A;  2OVQ B;  3NVN A;  4ERZ A;  2XYI A;  4ZOY A;  2Z2O A;  4J0W A;  2IWK A;  3CFS B;  3I7N A;  5FKQ A;  4O9D A;  4X60 B;  1MG2 A;  4J84 A;  3VA6 A;  4N14 A;  1GP2 B;  3MKQ A;  2OK4 A;  3EI1 A;  3IJ0 A;  3K27 A;  2CN2 A;  4GQ1 A;  2AH1 A;  3N0D A;  2YMU A;  4JSX C;  4PBZ A;  1PGU A;  3MMY A;  3JB9 L;  3V9F A;  3SHF A;  2H47 A;  4FA5 D;  4O45 A;  4CI3 A;  3PSC B;  3C75 H;  4E54 A;  5EAM A;  4Y7R A;  5HYN B;  3EMH A;  3SBQ A;  3EI2 A;  4A08 B;  3MXX A;  2H6K A;  4O3T B;  3PE7 A;  1K8K C;  4PC0 A;  5AFU 3;  3L4O D;  3UVM A;  1K32 A;  4G56 B;  3OTT A;  2PM9 B;  4A11 A;  5CXC B;  2QC5 A;  3UVO A;  3UR4 A;  2G9A A;  2IWF A;  3E0C A;  3EU7 A;  4J79 A;  4CZY A;  4UI9 R;  3U4Y A;  4A09 B;  2AGZ A;  3FRX A;  3SXT D;  3V5W B;  2P9P C;  2IAA A;  2YNO A;  4PBY A;  4GM9 A; 
#chains in the Genus database with same CATH topology
 2AGW A;  2VDK A;  2HJ4 A;  2XDW A;  1E8N A;  4GQ2 P;  3OW8 A;  3AL9 A;  4L1Q D;  1PBY B;  1B9Y A;  4IA9 A;  3DSM A;  2B4E A;  4UM8 A;  3IUM A;  5EAL A;  1JMX B;  4HDJ A;  4E5Z B;  1Q47 A;  3P4F A;  3W15 A;  1SQJ A;  2IUQ A;  4A7J A;  2GNQ A;  3F3G A;  2H6Q A;  3BG1 A;  4E54 B;  5AJA A;  2CNX A;  3B7F A;  2VZ3 A;  4LG8 A;  1JMZ B;  3I7O A;  2VC2 A;  2H3X A;  2EIB A;  3NVX A;  3OKY A;  4GMB A;  5FKT A;  1VZ2 A;  4BP9 A;  3EI2 B;  4J73 A;  4D0K A;  2QR5 A;  5E6S A;  3T3P A;  5C2W B;  3EI3 A;  5A2Q g;  2J55 H;  4LGN A;  3A0F A;  3SJL D;  2BBK H;  2VDN A;  5EM2 A;  1JJU B;  4CI2 A;  1PEV A;  3KRW B;  3I2N A;  5M5V A;  3O4H A;  4JSP C;  4R7A B;  2VDR A;  1N6D A;  2IUP A;  4A11 B;  4A09 A;  4L3H D;  3BG0 A;  2I3T A;  2O9K A;  3I7H A;  3MZK A;  5THA A;  1S4U X;  4D6V A;  1L0Q A;  4ERQ A;  3OKT A;  4K3I D;  3UKR C;  3NIF A;  5FXY A;  3EWE A;  4IMM A;  5H14 A;  1L5G A;  4FA1 D;  1O6G A;  2B5N A;  5CYK A;  4FAN D;  2OVP B;  5FLX g;  2EBS A;  5HQG A;  3MVD K;  2EID A;  4E5Z A;  3RMZ D;  4NEN A;  5EMM B;  2XL3 A;  3ZDZ A;  4BCB A;  3MZL A;  1NEX B;  5EAR A;  3ZE2 A;  4NSX A;  1A0R B;  3EQ9 A;  4X3E A;  4FAV D;  2G99 A;  5I5I A;  2YNP A;  1UOQ A;  2J57 G;  3SBR A;  1UOP A;  4G1E A;  2CO0 A;  3ULE C;  5CXB B;  2XE4 A;  2JKX A;  2OVR B;  1O6F A;  4AMY A;  3BWS A;  3OKW A;  3ZWL B;  5SXM A;  1C9L A;  2IUV A;  4MMZ A;  2VDQ A;  1NR0 A;  5HE2 B;  4CI8 A;  4JSN C;  5IJ7 E;  4ESG A;  3IUN A;  3DM0 A;  2HYE A;  1TBG A;  4K3J B;  4U7A A;  2UZX B;  2TRC B;  3CIK B;  3OKY B;  4QAM A;  3SFZ A;  5K1C C;  3RFH A;  5IT9 g;  3PVU B;  1K3I A;  3AFC A;  3EI3 B;  3SCY A;  5EM2 B;  1BPO A;  1JV2 A;  2H9L A;  2H9N A;  2P9L C;  2CO0 C;  3I7K A;  4QRJ A;  4GZ8 A;  1TYE A;  4WJK A;  5EMK B;  2P9I C;  3K26 A;  3ODT A;  1SHY B;  5JWZ A;  3JZN A;  3GD1 I;  4O2W A;  4J86 A;  5IJ8 E;  3ZE0 A;  2CE8 A;  4YVD A;  2Z2P A;  3ZDX A;  3NVQ A;  3IKO A;  4NAA A;  4CY2 A;  5CYK B;  5H17 A;  5FFG A;  4O3U B;  3RFG A;  5GMK n;  3RSE C;  3EQ8 A;  3DXK C;  3L4M D;  5KDO B;  5M5S A;  3V7D B;  3VI4 A;  4Z8L A;  3EQ7 A;  2I0T A;  4X61 B;  4FB1 D;  1JOF A;  1XIP A;  1GOT B;  5CXB A;  1VZ3 A;  2HKM A;  4JT5 C;  2AH0 A;  3F3F A;  4RE6 A;  5I5J A;  4J8B A;  4AX4 A;  3EG6 A;  5HE3 B;  5I5M A;  4XYI A;  3UVK A;  5HE1 B;  2AGL A;  2Z2N A;  5HDB A;  1T2X A;  1VE6 A;  4JXM A;  2GC4 A;  3VGZ A;  4D9S A;  3V4V A;  2UZY B;  1GOH A;  4CY5 A;  2AQ5 A;  2W18 A;  4AN0 A;  5GXI A;  1YFQ A;  3T3M A;  4XEI C;  4H5J A;  4J77 A;  1GXR A;  4J78 A;  3VH0 A;  4A0A A;  3J80 g;  2Q7Q A;  4Z7Q A;  1N6F A;  4ES0 A;  2XU7 A;  3AL8 B;  5FKS A;  1SQ9 A;  1VE7 A;  2J56 H;  2MTA H;  4JT6 C;  4FHL A;  5TF2 A;  2HXC A;  5TEE A;  4FA4 D;  2P9N C;  3RLM D;  4BUJ C;  4KFM B;  1ERJ A;  3O4I A;  3OL2 A;  5FA5 B;  3PXS D;  3KRX B;  1P22 A;  2H9M A;  4AOW A;  1FWX A;  2AGX A;  5IGO A;  5IC7 A;  4L9O A;  1R5M A;  3JZG A;  1JTD B;  3DWL C;  4JD2 C;  4LG9 A;  5HE0 B;  3C5M A;  3UVN A;  4QL1 A;  4J81 A;  3CFV A;  1E5T A;  1I2M B;  4NBM A;  3FCU A;  4MMY A;  1TYQ C;  3I7P A;  4O02 A;  4AMZ A;  3QHY B;  3EI4 A;  4MK0 B;  1QFM A;  3IJC A;  4QT8 A;  4GGD A;  1E8M A;  4CC9 A;  4A2L A;  4QQE A;  1PI6 A;  1QFS A;  2CN3 A;  3I8C A;  1M1X A;  3O4G A;  1U4C A;  4XYH A;  2HU7 A;  3IVM A;  3I8E A;  4BCC A;  3J81 g;  3DXM C;  5EAP A;  2HU5 A;  4DNU A;  1XKS A;  4U1E I;  1GG2 B;  5EMJ B;  2HJB A;  2EIC A;  4PXW A;  4BP8 A;  5C86 A;  3FM0 A;  1N6E A;  4OZU A;  3I7L A;  3K71 A;  2HES X;  2H6N A;  2HKR A;  4Y5R D;  5C2V B;  2OJY A;  3SLE D;  2VDP A;  4L3G D;  4Z7N A;  1RI6 A;  4GGC A;  1UOO A;  5AMS A;  5TDH B;  4IRZ A;  2H14 A;  4FA9 D;  3SBP A;  4A0B B;  4Z7O A;  3AL8 A;  2GC7 A;  2P9U C;  4BH6 A;  5FKR A;  4CI1 A;  3ZE1 A;  2H13 A;  1H2X A;  1H2W A;  4BL0 A;  5GSA A;  3IJ1 A;  3I89 A;  4BCD A;  4A0A B;  3SMR A;  4TZ4 A;  2I0R A;  5EML B;  4ZOV A;  5C92 A;  2VDM A;  2VDO A;  2B5M A;  4ZN4 A;  2PBI B;  5IGQ A;  4UM9 A;  4EWR A;  3K72 A;  3MUN A;  5K19 A;  4MMX A;  2PM7 B;  3GFC A;  3OL2 B;  5E6R A;  3MKS B;  4RE5 A;  5GXH A;  4I79 A;  4JSV C;  4J82 A;  5TEF A;  2IUR A;  2OK6 A;  2QZP A;  3IIY A;  1C9I A;  4ZOZ A;  4DNV A;  3IIW A;  2BCJ B;  3VI3 A;  3EI4 B;  2I3S A;  5C9Z B;  4AEZ A;  4NC4 A;  3JPX A;  4CZV A;  3UKU C;  5H1M A;  3HFQ A;  3SVW D;  3AH8 B;  3K6S A;  1YR2 A;  3JRO A;  4CY1 A;  2I0S A;  3F3P A;  3JZH A;  3N0E A;  4CY3 A;  1OLZ A;  2YB8 B;  3RN1 D;  5M5U A;  3PXT D;  2CE9 A;  3EI1 B;  4J8G A;  3PVW B;  3SWS D;  3IUJ A;  4ERY A;  2YNN A;  3RRM C;  1U8C A;  3C9C A;  5M5T A;  2PM6 B;  4DNW A;  4A0B A;  4CZX A;  1MG3 A;  1B9X A;  1A12 A;  4H5I A;  3MUO A;  2H9P A;  4A2M A;  4OWR A;  2HU8 A;  3ORV D;  3JRP A;  4A08 A;  3GC3 B;  2OIZ A;  2XL2 A;  2B5L A;  1VYH C;  2H68 A;  5B4W A;  3SN6 B;  2EIE A;  3C99 A;  1QNI A;  4FWW A;  4PNK B;  2P9K C;  4X63 B;  5FQD A;  4GGA A;  1OMW B;  4J87 A;  4J0X A;  2AGY A;  4G55 A;  1MDA H;  4PSW B;  4GM3 A;  4PSX B;  5M5R A;  2VZ1 A;  3UVL A;  2PM9 A;  1H2Z A;  2VDL A;  2YBA A;  5CXC A;  1XHM A;  2QXV A;  3PSL A;  3JAM g;  3IUQ A;  2P9S C;  1UTC A;  3FGB A;  3PXW D;  4O1Q D;  5FFO A;  3RN0 D;  1U2V C;  4GQB B;  4GM8 A;  1H2Y A;  3NID A;  3GRE A;  4ZOX A;  2OVQ B;  3NVN A;  4ERZ A;  2BKL A;  2XYI A;  4ZOY A;  2Z2O A;  4G1M A;  4J0W A;  1GOG A;  2IWK A;  3CFS B;  3FCS A;  3I7N A;  5FKQ A;  4O9D A;  4X60 B;  1MG2 A;  4J84 A;  3VA6 A;  4JHN A;  4N14 A;  1GP2 B;  3MKQ A;  2OK4 A;  3O4J A;  3EI1 A;  3IJ0 A;  3K27 A;  3OF7 A;  2CN2 A;  3DDU A;  4GQ1 A;  2AH1 A;  3N0D A;  2YMU A;  4JSX C;  3QI0 A;  4PBZ A;  1PGU A;  3MMY A;  3JB9 L;  3V9F A;  1GOF A;  3SHF A;  2H47 A;  4FA5 D;  4O45 A;  4WK4 A;  3PSC B;  5M61 A;  4CI3 A;  3C75 H;  2XZG A;  4E54 A;  5EAM A;  4Y7R A;  5HYN B;  3EMH A;  4JHP C;  3SBQ A;  3EI2 A;  4A08 B;  3MXX A;  2H6K A;  4O3T B;  3PE7 A;  1K8K C;  4PC0 A;  5AFU 3;  3IJE A;  4AN1 A;  3L4O D;  3UVM A;  1K32 A;  4WK0 A;  4L1M A;  4G56 B;  3OTT A;  3NIG A;  4WK2 A;  2PM9 B;  3KCI A;  4A11 A;  5CXC B;  2QC5 A;  3ZDY A;  3UVO A;  3UR4 A;  2G9A A;  2IWF A;  3E0C A;  3EU7 A;  2WQ8 A;  4J79 A;  3V4P A;  4CZY A;  3IUL A;  5E6U A;  3IUR A;  4UI9 R;  3U4Y A;  4A09 B;  2AGZ A;  3FRX A;  3SXT D;  3V5W B;  2P9P C;  2IAA A;  2YNO A;  4PBY A;  4GM9 A; 
#chains in the Genus database with same CATH homology
 2AGW A;  2HJ4 A;  4GQ2 P;  3OW8 A;  3AL9 A;  4L1Q D;  1PBY B;  1B9Y A;  4IA9 A;  3DSM A;  2B4E A;  5EAL A;  1JMX B;  4HDJ A;  4E5Z B;  1Q47 A;  3P4F A;  3W15 A;  1SQJ A;  2IUQ A;  4A7J A;  2GNQ A;  3F3G A;  2H6Q A;  3BG1 A;  4E54 B;  5AJA A;  2CNX A;  3B7F A;  4LG8 A;  1JMZ B;  3I7O A;  2H3X A;  3NVX A;  3OKY A;  4GMB A;  5FKT A;  3EI2 B;  4J73 A;  4D0K A;  5C2W B;  3EI3 A;  5A2Q g;  2J55 H;  4LGN A;  3A0F A;  3SJL D;  2BBK H;  5EM2 A;  1JJU B;  4CI2 A;  1PEV A;  3KRW B;  3I2N A;  4JSP C;  4R7A B;  1N6D A;  2IUP A;  4A11 B;  4A09 A;  4L3H D;  3BG0 A;  2I3T A;  2O9K A;  3I7H A;  3MZK A;  5THA A;  1S4U X;  4D6V A;  1L0Q A;  4ERQ A;  3OKT A;  4K3I D;  3UKR C;  5FXY A;  3EWE A;  4IMM A;  5H14 A;  4FA1 D;  2B5N A;  5CYK A;  4FAN D;  2OVP B;  5FLX g;  2EBS A;  5HQG A;  4E5Z A;  3RMZ D;  5EMM B;  2XL3 A;  3MZL A;  1NEX B;  5EAR A;  4NSX A;  1A0R B;  4X3E A;  4FAV D;  2G99 A;  5I5I A;  2YNP A;  2J57 G;  3SBR A;  2CO0 A;  3ULE C;  5CXB B;  2OVR B;  3BWS A;  3OKW A;  3ZWL B;  5SXM A;  2IUV A;  1NR0 A;  5HE2 B;  4CI8 A;  4JSN C;  5IJ7 E;  4ESG A;  3DM0 A;  2HYE A;  4K3J B;  1TBG A;  4U7A A;  2UZX B;  2TRC B;  3CIK B;  3OKY B;  3SFZ A;  5K1C C;  3RFH A;  5IT9 g;  3PVU B;  3AFC A;  3EI3 B;  3SCY A;  5EM2 B;  2H9L A;  2H9N A;  2P9L C;  2CO0 C;  3I7K A;  4QRJ A;  4GZ8 A;  5EMK B;  2P9I C;  3K26 A;  3ODT A;  1SHY B;  5JWZ A;  3JZN A;  4J86 A;  5IJ8 E;  2CE8 A;  4YVD A;  2Z2P A;  3NVQ A;  3IKO A;  4CY2 A;  5CYK B;  5H17 A;  4O3U B;  3RFG A;  5GMK n;  3RSE C;  3DXK C;  3L4M D;  5KDO B;  3V7D B;  4Z8L A;  2I0T A;  4X61 B;  4FB1 D;  1JOF A;  1XIP A;  1GOT B;  5CXB A;  4JT5 C;  2HKM A;  2AH0 A;  3F3F A;  5I5J A;  4J8B A;  3EG6 A;  5HE3 B;  5I5M A;  4XYI A;  3UVK A;  5HE1 B;  2AGL A;  2Z2N A;  4JXM A;  2GC4 A;  3VGZ A;  2UZY B;  4CY5 A;  2AQ5 A;  2W18 A;  5GXI A;  1YFQ A;  4XEI C;  4H5J A;  4J77 A;  1GXR A;  4J78 A;  3VH0 A;  4A0A A;  3J80 g;  2Q7Q A;  1N6F A;  4ES0 A;  2XU7 A;  3AL8 B;  5FKS A;  1SQ9 A;  2J56 H;  2MTA H;  4JT6 C;  4FHL A;  5TF2 A;  2HXC A;  5TEE A;  4FA4 D;  2P9N C;  3RLM D;  4BUJ C;  4KFM B;  1ERJ A;  5FA5 B;  3OL2 A;  3PXS D;  3KRX B;  1P22 A;  2H9M A;  4AOW A;  1FWX A;  2AGX A;  5IGO A;  5IC7 A;  4L9O A;  1R5M A;  3JZG A;  3DWL C;  4LG9 A;  4JD2 C;  5HE0 B;  3C5M A;  3UVN A;  4QL1 A;  4J81 A;  3CFV A;  1TYQ C;  3I7P A;  3EI4 A;  4MK0 B;  3IJC A;  4QT8 A;  4GGD A;  4CC9 A;  4A2L A;  4QQE A;  1PI6 A;  2CN3 A;  3I8C A;  1U4C A;  4XYH A;  3J81 g;  3I8E A;  3DXM C;  5EAP A;  1XKS A;  4U1E I;  1GG2 B;  5EMJ B;  2HJB A;  4PXW A;  3FM0 A;  1N6E A;  4OZU A;  3I7L A;  2HES X;  2H6N A;  2HKR A;  4Y5R D;  5C2V B;  2OJY A;  3SLE D;  4L3G D;  1RI6 A;  4GGC A;  5AMS A;  5TDH B;  2H14 A;  4FA9 D;  3SBP A;  4A0B B;  3AL8 A;  2GC7 A;  2P9U C;  4BH6 A;  5FKR A;  4CI1 A;  2H13 A;  4BL0 A;  5GSA A;  3IJ1 A;  3I89 A;  4A0A B;  3SMR A;  4TZ4 A;  2I0R A;  5EML B;  4ZOV A;  2B5M A;  4ZN4 A;  2PBI B;  5IGQ A;  4EWR A;  5K19 A;  2PM7 B;  3GFC A;  3OL2 B;  3MKS B;  5GXH A;  4I79 A;  4JSV C;  4J82 A;  5TEF A;  2IUR A;  2OK6 A;  3IIY A;  4ZOZ A;  3IIW A;  2BCJ B;  3EI4 B;  2I3S A;  5C9Z B;  4AEZ A;  3JPX A;  4CZV A;  3UKU C;  5H1M A;  3HFQ A;  3SVW D;  3AH8 B;  3JRO A;  4CY1 A;  2I0S A;  3F3P A;  3JZH A;  3N0E A;  4CY3 A;  1OLZ A;  2YB8 B;  3RN1 D;  3PXT D;  2CE9 A;  3EI1 B;  4J8G A;  3PVW B;  3SWS D;  4ERY A;  2YNN A;  3RRM C;  3C9C A;  2PM6 B;  4A0B A;  4CZX A;  1MG3 A;  1B9X A;  4H5I A;  2H9P A;  4A2M A;  4OWR A;  3ORV D;  3JRP A;  4A08 A;  2OIZ A;  2XL2 A;  2B5L A;  1VYH C;  2H68 A;  5B4W A;  3SN6 B;  3C99 A;  1QNI A;  4FWW A;  4PNK B;  2P9K C;  4X63 B;  5FQD A;  4GGA A;  1OMW B;  4J87 A;  4J0X A;  2AGY A;  4PSW B;  1MDA H;  4GM3 A;  4PSX B;  3UVL A;  2PM9 A;  2YBA A;  5CXC A;  1XHM A;  2QXV A;  3PSL A;  3JAM g;  2P9S C;  3PXW D;  3FGB A;  4O1Q D;  3RN0 D;  1U2V C;  4GQB B;  4GM8 A;  3GRE A;  4ZOX A;  2OVQ B;  3NVN A;  4ERZ A;  2XYI A;  4ZOY A;  2Z2O A;  4J0W A;  2IWK A;  3CFS B;  3I7N A;  5FKQ A;  4O9D A;  4X60 B;  1MG2 A;  4J84 A;  3VA6 A;  4N14 A;  1GP2 B;  3MKQ A;  2OK4 A;  3EI1 A;  3IJ0 A;  3K27 A;  2CN2 A;  4GQ1 A;  2AH1 A;  3N0D A;  2YMU A;  4JSX C;  4PBZ A;  1PGU A;  3MMY A;  3JB9 L;  3V9F A;  3SHF A;  2H47 A;  4FA5 D;  4O45 A;  4CI3 A;  3PSC B;  3C75 H;  4E54 A;  5EAM A;  4Y7R A;  5HYN B;  3EMH A;  3SBQ A;  3EI2 A;  4A08 B;  3MXX A;  2H6K A;  4O3T B;  3PE7 A;  1K8K C;  4PC0 A;  5AFU 3;  3L4O D;  3UVM A;  1K32 A;  4G56 B;  3OTT A;  2PM9 B;  4A11 A;  5CXC B;  2QC5 A;  3UVO A;  3UR4 A;  2G9A A;  2IWF A;  3E0C A;  3EU7 A;  4J79 A;  4CZY A;  4UI9 R;  3U4Y A;  4A09 B;  2AGZ A;  3FRX A;  3SXT D;  3V5W B;  2P9P C;  2IAA A;  2YNO A;  4PBY A;  4GM9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...