2H6NA

Histone h3 recognition and presentation by the wdr5 module of the mll1 complex
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
304
structure length
304
Chain Sequence
VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD-repeat protein 5
publication title Histone H3 recognition and presentation by the WDR5 module of the MLL1 complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 101
structure length 304
sequence length 304
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2h6nA00
1OLZA 4J0XA 4JD2C 3OL2A 4X60B 4K3ID 4XYHA 3BG0A 5FXYA 4D6VA 4ZOVA 3E0CA 3OL2B 1SQ9A 2IUVA 5AJAA 4PC0A 4I79A 2H47A 3N0DA 2CE8A 4OWRA 2Q7QA 3PVWB 3J80g 3IJ1A 3SXTD 1GOTB 5B4WA 4PBZA 2YB8B 2OVRB 4A08A 2PBIB 3DXMC 4EWRA 3KRWB 3PXSD 3C99A 4ERZA 4CY1A 4A2MA 3MKSB 2O9KA 3F3GA 5K1CC 4J79A 5IGOA 3EMHA 3EI3A 3K27A 3L4OD 2P9IC 2IAAA 2CN3A 2GC7A 3OKYA 2XYIA 1FWXA 2HYEA 4BL0A 2H6NA 3U4YA 3A0FA 3I7OA 3B7FA 4FHLA 3SWSD 1GP2B 4QRJA 3JAMg 3F3PA 3MMYA 2XL3A 4J81A 3PVUB 4JXMA 3RMZD 2TRCB 3PSLA 2P9NC 3C75H 2IURA 4X3EA 5CYKA 4LG8A 5FKSA 5CYKB 3RFGA 4O1QD 1N6FA 5IGQA 3IJCA 3MXXA 4GMBA 4J86A 4J77A 1JMZB 5FA5B 4KFMB 5IJ8E 1PGUA 3FM0A 4PBYA 1XIPA 3I8CA 2P9LC 4U7AA 1SQJA 2AGYA 3PXWD 4N14A 1JMXB 2EBSA 2AH0A 3MZKA 3W15A 3AL8A 1JOFA 3NVNA 3AL8B 2J57G 1NEXB 2AQ5A 2HJBA 1XKSA 5HE2B 2CO0C 4GQBB 4K3JB 4X63B 2YBAA 3FGBA 3SBPA 4JSNC 2H6KA 3ULEC 1JJUB 4A7JA 3AL9A 3SMRA 3SHFA 5EMKB 1MG2A 1Q47A 1N6EA 4BH6A 2QC5A 3JRPA 4PXWA 1B9XA 1K8KC 5TDHB 4J84A 2YMUA 3J81g 5FKRA 1QNIA 2GC4A 1U4CA 4GGAA 4OZUA 4J0WA 4BUJC 4E5ZA 5EMMB 4E5ZB 4X61B 5HE1B 5HE3B 4JSVC 1TBGA 3AH8B 3V7DB 4GM9A 4J82A 4O3UB 4Z8LA 4UI9R 4L1QD 4FAVD 3K26A 2IWKA 4O3TB 3I2NA 4CC9A 3UVKA 2I0SA 3I8EA 5A2Qg 4YVDA 5H1MA 4L3GD 2BCJB 4CZYA 4A11B 2AGWA 2OVPB 3C9CA 2HKMA 3I7PA 4LGNA 5TEEA 4CI3A 4MK0B 5I5IA 3N0EA 5FKQA 4GM8A 1GG2B 1PEVA 3V9FA 4A0BA 5GXHA 2J56H 5CXBA 4AEZA 2PM6B 4A0BB 1GXRA 4FA5D 3JZGA 1B9YA 4PSXB 5CXBB 1TYQC 4ERQA 3EWEA 2G99A 4AOWA 3CFSB 3I7KA 5GXIA 1P22A 2CO0A 2IUPA 1YFQA 3EI1B 5FLXg 2CN2A 3I7NA 2PM9A 5C9ZB 2PM9B 2H3XA 3NVXA 2UZYB 5EAPA 4O9DA 4HDJA 5IC7A 4TZ4A 3KRXB 3V5WB 4JT5C 3EI2A 4GQ1A 3EI2B 2W18A 1R5MA 3RN1D 3RSEC 3L4MD 3F3FA 4CI8A 3EI4B 4CZXA 3SN6B 3EG6A 3OW8A 4IMMA 1PI6A 2HJ4A 2J55H 4J8GA 1ERJA 2I0RA 4G56B 3C5MA 4ZOYA 3SLED 2OJYA 5EMJB 3JZHA 3VH0A 4JT6C 1MG3A 4GGCA 2Z2OA 4ZN4A 1VYHC 4QQEA 2H68A 2HXCA 5GSAA 3UVMA 5HYNB 5THAA 4L3HD 3JZNA 4U1EI 4Y7RA 4FAND 2AH1A 4QL1A 5EM2A 5TF2A 2YNNA 5CXCA 5EM2B 4A09B 5CXCB 5GMKn 4H5IA 3NVQA 4IA9A 3IIWA 3MZLA 5HQGA 3I89A 3MKQA 3BWSA 3CFVA 4R7AB 4QT8A 3GFCA 3UVOA 2B4EA 2B5MA 4ERYA 2I3SA 3SVWD 1U2VC 5IJ7E 3JROA 4ESGA 3JB9L 2H6QA 1A0RB 4H5JA 2MTAH 4FA4D 3RFHA 2YNOA 2UZXB 2QXVA 4PSWB 2OVQB 3JPXA 3UVLA 3RN0D 2HKRA 2GNQA 4CY5A 3OKTA 3GREA 2BBKH 3RRMC 4FA9D 3PSCB 5I5JA 4GM3A 2Z2PA 4A11A 4L9OA 4Y5RD 4A0AA 3IKOA 3ORVD 4A0AB 1PBYB 5FQDA 2G9AA 3PXTD 2H9PA 3CIKB 3RLMD 3IJ0A 2H9LA 4D0KA 4A08B 4JSPC 2OK4A 1RI6A 1S4UX 3I7HA 3SBRA 2AGXA 2IWFA 2CNXA 2HESX 3ZWLB 5HE0B 2XU7A 3UKRC 4O45A 5TEFA 2Z2NA 1N6DA 4XYIA 5EAMA 5H17A 2H9MA 3EI1A 3EI3B 4PNKB 5C2VB 3UVNA 1OMWB 1MDAH 2P9PC 4J8BA 5JWZA 4FWWA 2CE9A 3OKYB 3OTTA 2P9SC 3AFCA 2B5LA 5C2WB 3HFQA 3OKWA 2PM7B 4XEIC 3SJLD 2H13A 4CY3A 4GGDA 3SBQA 3UR4A 1SHYB 3DM0A 4CI1A 5KDOB 3EI4A 4ZOZA 2IUQA 5SXMA 4CY2A 1L0QA 4CZVA 2H14A 2XL2A 2I3TA 1K32A 2OK6A 3BG1A 2I0TA 3EU7A 4JSXC 5I5MA 5EARA 4CI2A 3DXKC 3PE7A 3UKUC 4A2LA 3P4FA 4J78A 3SCYA 5EMLB 4FA1D 2H9NA 4A09A 3SFZA 4ES0A 5EALA 3IIYA 5IT9g 5FKTA 2P9UC 1NR0A 3I7LA 3VGZA 2YNPA 4NSXA 4GQ2P 5K19A 2P9KC 3FRXA 5AFU3 3ODTA 2AGLA 4E54A 1XHMA 3DWLC 3VA6A 4E54B 5AMSA 2AGZA 4FB1D 4GZ8A 3DSMA 4J73A 2B5NA 4LG9A 5H14A 2OIZA 4J87A 4ZOXA
chains in the Genus database with same CATH superfamily
5M5VA 2VDRA 1OLZA 4J0XA 4JD2C 3OL2A 4X60B 1QFSA 4K3ID 3BG0A 4XYHA 5FXYA 4ZOVA 4D6VA 3E0CA 3OL2B 2HU8A 3GD1I 1SQ9A 2IUVA 5AJAA 4PC0A 4I79A 2H47A 3N0DA 2VDMA 3NIFA 2CE8A 1VZ2A 2Q7QA 3PVWB 4OWRA 3IJ1A 3SXTD 4AMYA 1GOTB 3J80g 4AX4A 5B4WA 4PBZA 2YB8B 3K72A 2OVRB 4A08A 2PBIB 3KCIA 3DXMC 4EWRA 3KRWB 3PXSD 3C99A 4ERZA 3FCUA 4BP9A 1JTDB 1H2YA 1H2WA 2JKXA 4CY1A 4MMXA 4A2MA 3MKSB 2O9KA 4BCCA 3F3GA 4G55A 1GOFA 2EIDA 4J79A 5K1CC 5IGOA 3EMHA 3EI3A 3K27A 3L4OD 1C9IA 2P9IC 1GOHA 2IAAA 2CN3A 2GC7A 3OKYA 2XYIA 4O2WA 3T3MA 1FWXA 2HYEA 4BL0A 4BCBA 2H6NA 3U4YA 3A0FA 3I7OA 1VE7A 3B7FA 4FHLA 1GP2B 4QRJA 3SWSD 2XE4A 3F3PA 3JAMg 5FFOA 3MMYA 2XL3A 4WJKA 4J81A 3MVDK 3PVUB 4JXMA 3RMZD 2TRCB 3PSLA 2P9NC 3C75H 2IURA 3T3PA 4X3EA 5CYKA 4LG8A 5FKSA 1BPOA 3ZE2A 4JHPC 4L1MA 5CYKB 3RFGA 4NENA 4O1QD 1N6FA 5IGQA 4Z7OA 3IJCA 3MXXA 4GMBA 4J86A 4J77A 1JMZB 1VZ3A 5FA5B 1VE6A 4KFMB 4DNVA 5IJ8E 1PGUA 4UM9A 3FM0A 4PBYA 3O4IA 1JV2A 1H2ZA 1XIPA 3I8CA 2XDWA 2P9LC 4MMYA 4U7AA 1SQJA 2AGYA 3PXWD 4N14A 1JMXB 2EBSA 2AH0A 3IUNA 1E5TA 4Z7QA 1UTCA 3MZKA 3W15A 3AL8A 4WK0A 1JOFA 3IUMA 3NVNA 3AL8B 3IVMA 2J57G 1H2XA 1NEXB 2AQ5A 2HJBA 2VDKA 1XKSA 3DDUA 1E8NA 5HE2B 2CO0C 4O02A 2VDNA 4GQBB 4K3JB 4X63B 1M1XA 2YBAA 3FGBA 4NBMA 3VI3A 3K6SA 3SBPA 4JSNC 2H6KA 3ULEC 1JJUB 4A7JA 3AL9A 3VI4A 3SMRA 3SHFA 5EMKB 1MG2A 1Q47A 1N6EA 4BH6A 2QC5A 4AN0A 3JRPA 4PXWA 1B9XA 1K8KC 5TDHB 4J84A 2YMUA 4DNUA 1E8MA 3J81g 5FKRA 1QNIA 2GC4A 2VDPA 4BCDA 1U4CA 4GGAA 4OZUA 4J0WA 4BUJC 1C9LA 4E5ZA 5EMMB 2EICA 4E5ZB 4MMZA 4X61B 5HE1B 5HE3B 4JSVC 1TBGA 3AH8B 3V7DB 1UOPA 4GM9A 5M5RA 4J82A 4O3UB 4Z8LA 4UI9R 4L1QD 4FAVD 3K26A 2IWKA 2HU5A 4O3TB 3I2NA 4CC9A 3UVKA 2I0SA 3I8EA 5A2Qg 4YVDA 5H1MA 4WK2A 3ZDZA 4UM8A 4L3GD 2BCJB 4CZYA 4A11B 2AGWA 2QR5A 2OVPB 1TYEA 3C9CA 5C92A 2HKMA 3I7PA 3EQ9A 4LGNA 5TEEA 4CI3A 4MK0B 5I5IA 3N0EA 3FCSA 3O4JA 5FKQA 4NC4A 3V4PA 3ZE0A 1U8CA 4GM8A 4JHNA 1GG2B 1PEVA 3IULA 3V9FA 4A0BA 5GXHA 2J56H 5CXBA 4AEZA 2PM6B 4A0BB 1GXRA 4FA5D 3JZGA 5M5SA 1B9YA 4PSXB 5CXBB 1TYQC 4ERQA 3EWEA 4QAMA 2G99A 3O4HA 2EIBA 4AOWA 3CFSB 4BP8A 3I7KA 3IUJA 5GXIA 4Z7NA 1P22A 2CO0A 2IUPA 1YFQA 5E6SA 4D9SA 1QFMA 3EI1B 5FLXg 2CN2A 3I7NA 2PM9A 3MUOA 5C9ZB 5M61A 2PM9B 2H3XA 3K71A 3NVXA 2UZYB 5EAPA 4O9DA 1A12A 4HDJA 5HDBA 5IC7A 4RE5A 3KRXB 4TZ4A 3V5WB 2VC2A 4JT5C 5FFGA 3EI2A 4GQ1A 3EI2B 2W18A 1R5MA 3RN1D 3RSEC 2BKLA 3L4MD 3F3FA 4CI8A 3EI4B 1YR2A 4CZXA 3SN6B 3EG6A 3OW8A 4IMMA 1PI6A 2HJ4A 3NIDA 2J55H 4J8GA 1ERJA 2I0RA 4G56B 3C5MA 4ZOYA 3SLED 2OJYA 5EMJB 3JZHA 3VH0A 4JT6C 1MG3A 4GGCA 2Z2OA 4ZN4A 1VYHC 4QQEA 2H68A 2HXCA 5GSAA 3UVMA 5HYNB 5THAA 4L3HD 3JZNA 4U1EI 1T2XA 3EQ8A 4Y7RA 2AH1A 4FAND 4QL1A 5EM2A 5TF2A 2YNNA 5CXCA 4AN1A 5EM2B 4A09B 5CXCB 5GMKn 4H5IA 3NVQA 4IA9A 3IIWA 3MZLA 5HQGA 3I89A 3OF7A 3MKQA 5C86A 3BWSA 3CFVA 5M5UA 4R7AB 4QT8A 3GFCA 3UVOA 2B4EA 2B5MA 3ZE1A 4ERYA 2I3SA 3EQ7A 1U2VC 5IJ7E 3SVWD 3JROA 4WK4A 4ESGA 3JB9L 2H6QA 3O4GA 1A0RB 4H5JA 2MTAH 4FA4D 3RFHA 2YNOA 2UZXB 2QZPA 2VDOA 2QXVA 4PSWB 2OVQB 3JPXA 3UVLA 3RN0D 2HKRA 4IRZA 2GNQA 4CY5A 3OKTA 3GREA 2BBKH 3RRMC 4FA9D 3PSCB 5I5JA 4GM3A 2HU7A 2Z2PA 1O6GA 4A11A 4L9OA 4Y5RD 4A0AA 3IKOA 3ORVD 4A0AB 3IJEA 1PBYB 3GC3B 5FQDA 2G9AA 3PXTD 2H9PA 3CIKB 4DNWA 3RLMD 2EIEA 1UOOA 3IJ0A 3ZDXA 2H9LA 4D0KA 4A08B 4JSPC 2OK4A 1RI6A 3IURA 1S4UX 3I7HA 3SBRA 2AGXA 2IWFA 2CNXA 2HESX 2VDQA 3ZWLB 5HE0B 2XU7A 3UKRC 4O45A 5TEFA 2Z2NA 1N6DA 4XYIA 5EAMA 5H17A 2H9MA 3EI1A 3NIGA 3EI3B 3QHYB 4PNKB 5C2VB 3UVNA 1OMWB 1MDAH 2P9PC 4J8BA 3MUNA 5JWZA 4FWWA 2CE9A 3OKYB 3OTTA 3V4VA 2P9SC 3AFCA 2B5LA 5E6UA 5C2WB 3HFQA 1UOQA 3OKWA 2WQ8A 2PM7B 2VDLA 4XEIC 2H13A 3SJLD 4CY3A 4GGDA 3SBQA 1L5GA 3UR4A 1SHYB 3DM0A 4CI1A 5KDOB 3EI4A 4NAAA 4ZOZA 2IUQA 5SXMA 4CY2A 1L0QA 4CZVA 4G1MA 1K3IA 2H14A 2VZ3A 2XL2A 2I3TA 1K32A 2OK6A 3ZDYA 3IUQA 1I2MB 3BG1A 2I0TA 3EU7A 4JSXC 5I5MA 5EARA 4CI2A 3DXKC 3PE7A 3UKUC 4A2LA 3P4FA 2XZGA 4J78A 3SCYA 5M5TA 5EMLB 4FA1D 2H9NA 4RE6A 4A09A 3SFZA 4ES0A 5EALA 3IIYA 1GOGA 5IT9g 5FKTA 2VZ1A 2P9UC 1NR0A 3I7LA 3VGZA 2YNPA 4NSXA 4GQ2P 5K19A 2P9KC 3FRXA 5AFU3 3ODTA 2AGLA 4E54A 1XHMA 3DWLC 3QI0A 3VA6A 4E54B 5AMSA 4G1EA 2AGZA 4FB1D 4GZ8A 5E6RA 3DSMA 4J73A 1O6FA 2B5NA 4LG9A 5H14A 2OIZA 4J87A 4AMZA 4ZOXA
chains in the Genus database with same CATH topology
1OLZA 4J0XA 4JD2C 3OL2A 4X60B 4K3ID 4XYHA 3BG0A 5FXYA 4D6VA 4ZOVA 3E0CA 3OL2B 1SQ9A 2IUVA 5AJAA 4PC0A 4I79A 2H47A 3N0DA 2CE8A 4OWRA 2Q7QA 3PVWB 3J80g 3IJ1A 3SXTD 1GOTB 5B4WA 4PBZA 2YB8B 2OVRB 4A08A 2PBIB 3DXMC 4EWRA 3KRWB 3PXSD 3C99A 4ERZA 4CY1A 4A2MA 3MKSB 2O9KA 3F3GA 5K1CC 4J79A 5IGOA 3EMHA 3EI3A 3K27A 3L4OD 2P9IC 2IAAA 2CN3A 2GC7A 3OKYA 2XYIA 1FWXA 2HYEA 4BL0A 2H6NA 3U4YA 3A0FA 3I7OA 3B7FA 4FHLA 3SWSD 1GP2B 4QRJA 3JAMg 3F3PA 3MMYA 2XL3A 4J81A 3PVUB 4JXMA 3RMZD 2TRCB 3PSLA 2P9NC 3C75H 2IURA 4X3EA 5CYKA 4LG8A 5FKSA 5CYKB 3RFGA 4O1QD 1N6FA 5IGQA 3IJCA 3MXXA 4GMBA 4J86A 4J77A 1JMZB 5FA5B 4KFMB 5IJ8E 1PGUA 3FM0A 4PBYA 1XIPA 3I8CA 2P9LC 4U7AA 1SQJA 2AGYA 3PXWD 4N14A 1JMXB 2EBSA 2AH0A 3MZKA 3W15A 3AL8A 1JOFA 3NVNA 3AL8B 2J57G 1NEXB 2AQ5A 2HJBA 1XKSA 5HE2B 2CO0C 4GQBB 4K3JB 4X63B 2YBAA 3FGBA 3SBPA 4JSNC 2H6KA 3ULEC 1JJUB 4A7JA 3AL9A 3SMRA 3SHFA 5EMKB 1MG2A 1Q47A 1N6EA 4BH6A 2QC5A 3JRPA 4PXWA 1B9XA 1K8KC 5TDHB 4J84A 2YMUA 3J81g 5FKRA 1QNIA 2GC4A 1U4CA 4GGAA 4OZUA 4J0WA 4BUJC 4E5ZA 5EMMB 4E5ZB 4X61B 5HE1B 5HE3B 4JSVC 1TBGA 3AH8B 3V7DB 4GM9A 4J82A 4O3UB 4Z8LA 4UI9R 4L1QD 4FAVD 3K26A 2IWKA 4O3TB 3I2NA 4CC9A 3UVKA 2I0SA 3I8EA 5A2Qg 4YVDA 5H1MA 4L3GD 2BCJB 4CZYA 4A11B 2AGWA 2OVPB 3C9CA 2HKMA 3I7PA 4LGNA 5TEEA 4CI3A 4MK0B 5I5IA 3N0EA 5FKQA 4GM8A 1GG2B 1PEVA 3V9FA 4A0BA 5GXHA 2J56H 5CXBA 4AEZA 2PM6B 4A0BB 1GXRA 4FA5D 3JZGA 1B9YA 4PSXB 5CXBB 1TYQC 4ERQA 3EWEA 2G99A 4AOWA 3CFSB 3I7KA 5GXIA 1P22A 2CO0A 2IUPA 1YFQA 3EI1B 5FLXg 2CN2A 3I7NA 2PM9A 5C9ZB 2PM9B 2H3XA 3NVXA 2UZYB 5EAPA 4O9DA 4HDJA 5IC7A 4TZ4A 3KRXB 3V5WB 4JT5C 3EI2A 4GQ1A 3EI2B 2W18A 1R5MA 3RN1D 3RSEC 3L4MD 3F3FA 4CI8A 3EI4B 4CZXA 3SN6B 3EG6A 3OW8A 4IMMA 1PI6A 2HJ4A 2J55H 4J8GA 1ERJA 2I0RA 4G56B 3C5MA 4ZOYA 3SLED 2OJYA 5EMJB 3JZHA 3VH0A 4JT6C 1MG3A 4GGCA 2Z2OA 4ZN4A 1VYHC 4QQEA 2H68A 2HXCA 5GSAA 3UVMA 5HYNB 5THAA 4L3HD 3JZNA 4U1EI 4Y7RA 4FAND 2AH1A 4QL1A 5EM2A 5TF2A 2YNNA 5CXCA 5EM2B 4A09B 5CXCB 5GMKn 4H5IA 3NVQA 4IA9A 3IIWA 3MZLA 5HQGA 3I89A 3MKQA 3BWSA 3CFVA 4R7AB 4QT8A 3GFCA 3UVOA 2B4EA 2B5MA 4ERYA 2I3SA 3SVWD 1U2VC 5IJ7E 3JROA 4ESGA 3JB9L 2H6QA 1A0RB 4H5JA 2MTAH 4FA4D 3RFHA 2YNOA 2UZXB 2QXVA 4PSWB 2OVQB 3JPXA 3UVLA 3RN0D 2HKRA 2GNQA 4CY5A 3OKTA 3GREA 2BBKH 3RRMC 4FA9D 3PSCB 5I5JA 4GM3A 2Z2PA 4A11A 4L9OA 4Y5RD 4A0AA 3IKOA 3ORVD 4A0AB 1PBYB 5FQDA 2G9AA 3PXTD 2H9PA 3CIKB 3RLMD 3IJ0A 2H9LA 4D0KA 4A08B 4JSPC 2OK4A 1RI6A 1S4UX 3I7HA 3SBRA 2AGXA 2IWFA 2CNXA 2HESX 3ZWLB 5HE0B 2XU7A 3UKRC 4O45A 5TEFA 2Z2NA 1N6DA 4XYIA 5EAMA 5H17A 2H9MA 3EI1A 3EI3B 4PNKB 5C2VB 3UVNA 1OMWB 1MDAH 2P9PC 4J8BA 5JWZA 4FWWA 2CE9A 3OKYB 3OTTA 2P9SC 3AFCA 2B5LA 5C2WB 3HFQA 3OKWA 2PM7B 4XEIC 3SJLD 2H13A 4CY3A 4GGDA 3SBQA 3UR4A 1SHYB 3DM0A 4CI1A 5KDOB 3EI4A 4ZOZA 2IUQA 5SXMA 4CY2A 1L0QA 4CZVA 2H14A 2XL2A 2I3TA 1K32A 2OK6A 3BG1A 2I0TA 3EU7A 4JSXC 5I5MA 5EARA 4CI2A 3DXKC 3PE7A 3UKUC 4A2LA 3P4FA 4J78A 3SCYA 5EMLB 4FA1D 2H9NA 4A09A 3SFZA 4ES0A 5EALA 3IIYA 5IT9g 5FKTA 2P9UC 1NR0A 3I7LA 3VGZA 2YNPA 4NSXA 4GQ2P 5K19A 2P9KC 3FRXA 5AFU3 3ODTA 2AGLA 4E54A 1XHMA 3DWLC 3VA6A 4E54B 5AMSA 2AGZA 4FB1D 4GZ8A 3DSMA 4J73A 2B5NA 4LG9A 5H14A 2OIZA 4J87A 4ZOXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OLZ A;  4J0X A;  4JD2 C;  3OL2 A;  4X60 B;  4K3I D;  4XYH A;  3BG0 A;  5FXY A;  4D6V A;  4ZOV A;  3E0C A;  3OL2 B;  1SQ9 A;  2IUV A;  5AJA A;  4PC0 A;  4I79 A;  2H47 A;  3N0D A;  2CE8 A;  4OWR A;  2Q7Q A;  3PVW B;  3J80 g;  3IJ1 A;  3SXT D;  1GOT B;  5B4W A;  4PBZ A;  2YB8 B;  2OVR B;  4A08 A;  2PBI B;  3DXM C;  4EWR A;  3KRW B;  3PXS D;  3C99 A;  4ERZ A;  4CY1 A;  4A2M A;  3MKS B;  2O9K A;  3F3G A;  5K1C C;  4J79 A;  5IGO A;  3EMH A;  3EI3 A;  3K27 A;  3L4O D;  2P9I C;  2IAA A;  2CN3 A;  2GC7 A;  3OKY A;  2XYI A;  1FWX A;  2HYE A;  4BL0 A;  2H6N A;  3U4Y A;  3A0F A;  3I7O A;  3B7F A;  4FHL A;  3SWS D;  1GP2 B;  4QRJ A;  3JAM g;  3F3P A;  3MMY A;  2XL3 A;  4J81 A;  3PVU B;  4JXM A;  3RMZ D;  2TRC B;  3PSL A;  2P9N C;  3C75 H;  2IUR A;  4X3E A;  5CYK A;  4LG8 A;  5FKS A;  5CYK B;  3RFG A;  4O1Q D;  1N6F A;  5IGQ A;  3IJC A;  3MXX A;  4GMB A;  4J86 A;  4J77 A;  1JMZ B;  5FA5 B;  4KFM B;  5IJ8 E;  1PGU A;  3FM0 A;  4PBY A;  1XIP A;  3I8C A;  2P9L C;  4U7A A;  1SQJ A;  2AGY A;  3PXW D;  4N14 A;  1JMX B;  2EBS A;  2AH0 A;  3MZK A;  3W15 A;  3AL8 A;  1JOF A;  3NVN A;  3AL8 B;  2J57 G;  1NEX B;  2AQ5 A;  2HJB A;  1XKS A;  5HE2 B;  2CO0 C;  4GQB B;  4K3J B;  4X63 B;  2YBA A;  3FGB A;  3SBP A;  4JSN C;  2H6K A;  3ULE C;  1JJU B;  4A7J A;  3AL9 A;  3SMR A;  3SHF A;  5EMK B;  1MG2 A;  1Q47 A;  1N6E A;  4BH6 A;  2QC5 A;  3JRP A;  4PXW A;  1B9X A;  1K8K C;  5TDH B;  4J84 A;  2YMU A;  3J81 g;  5FKR A;  1QNI A;  2GC4 A;  1U4C A;  4GGA A;  4OZU A;  4J0W A;  4BUJ C;  4E5Z A;  5EMM B;  4E5Z B;  4X61 B;  5HE1 B;  5HE3 B;  4JSV C;  1TBG A;  3AH8 B;  3V7D B;  4GM9 A;  4J82 A;  4O3U B;  4Z8L A;  4UI9 R;  4L1Q D;  4FAV D;  3K26 A;  2IWK A;  4O3T B;  3I2N A;  4CC9 A;  3UVK A;  2I0S A;  3I8E A;  5A2Q g;  4YVD A;  5H1M A;  4L3G D;  2BCJ B;  4CZY A;  4A11 B;  2AGW A;  2OVP B;  3C9C A;  2HKM A;  3I7P A;  4LGN A;  5TEE A;  4CI3 A;  4MK0 B;  5I5I A;  3N0E A;  5FKQ A;  4GM8 A;  1GG2 B;  1PEV A;  3V9F A;  4A0B A;  5GXH A;  2J56 H;  5CXB A;  4AEZ A;  2PM6 B;  4A0B B;  1GXR A;  4FA5 D;  3JZG A;  1B9Y A;  4PSX B;  5CXB B;  1TYQ C;  4ERQ A;  3EWE A;  2G99 A;  4AOW A;  3CFS B;  3I7K A;  5GXI A;  1P22 A;  2CO0 A;  2IUP A;  1YFQ A;  3EI1 B;  5FLX g;  2CN2 A;  3I7N A;  2PM9 A;  5C9Z B;  2PM9 B;  2H3X A;  3NVX A;  2UZY B;  5EAP A;  4O9D A;  4HDJ A;  5IC7 A;  4TZ4 A;  3KRX B;  3V5W B;  4JT5 C;  3EI2 A;  4GQ1 A;  3EI2 B;  2W18 A;  1R5M A;  3RN1 D;  3RSE C;  3L4M D;  3F3F A;  4CI8 A;  3EI4 B;  4CZX A;  3SN6 B;  3EG6 A;  3OW8 A;  4IMM A;  1PI6 A;  2HJ4 A;  2J55 H;  4J8G A;  1ERJ A;  2I0R A;  4G56 B;  3C5M A;  4ZOY A;  3SLE D;  2OJY A;  5EMJ B;  3JZH A;  3VH0 A;  4JT6 C;  1MG3 A;  4GGC A;  2Z2O A;  4ZN4 A;  1VYH C;  4QQE A;  2H68 A;  2HXC A;  5GSA A;  3UVM A;  5HYN B;  5THA A;  4L3H D;  3JZN A;  4U1E I;  4Y7R A;  4FAN D;  2AH1 A;  4QL1 A;  5EM2 A;  5TF2 A;  2YNN A;  5CXC A;  5EM2 B;  4A09 B;  5CXC B;  5GMK n;  4H5I A;  3NVQ A;  4IA9 A;  3IIW A;  3MZL A;  5HQG A;  3I89 A;  3MKQ A;  3BWS A;  3CFV A;  4R7A B;  4QT8 A;  3GFC A;  3UVO A;  2B4E A;  2B5M A;  4ERY A;  2I3S A;  3SVW D;  1U2V C;  5IJ7 E;  3JRO A;  4ESG A;  3JB9 L;  2H6Q A;  1A0R B;  4H5J A;  2MTA H;  4FA4 D;  3RFH A;  2YNO A;  2UZX B;  2QXV A;  4PSW B;  2OVQ B;  3JPX A;  3UVL A;  3RN0 D;  2HKR A;  2GNQ A;  4CY5 A;  3OKT A;  3GRE A;  2BBK H;  3RRM C;  4FA9 D;  3PSC B;  5I5J A;  4GM3 A;  2Z2P A;  4A11 A;  4L9O A;  4Y5R D;  4A0A A;  3IKO A;  3ORV D;  4A0A B;  1PBY B;  5FQD A;  2G9A A;  3PXT D;  2H9P A;  3CIK B;  3RLM D;  3IJ0 A;  2H9L A;  4D0K A;  4A08 B;  4JSP C;  2OK4 A;  1RI6 A;  1S4U X;  3I7H A;  3SBR A;  2AGX A;  2IWF A;  2CNX A;  2HES X;  3ZWL B;  5HE0 B;  2XU7 A;  3UKR C;  4O45 A;  5TEF A;  2Z2N A;  1N6D A;  4XYI A;  5EAM A;  5H17 A;  2H9M A;  3EI1 A;  3EI3 B;  4PNK B;  5C2V B;  3UVN A;  1OMW B;  1MDA H;  2P9P C;  4J8B A;  5JWZ A;  4FWW A;  2CE9 A;  3OKY B;  3OTT A;  2P9S C;  3AFC A;  2B5L A;  5C2W B;  3HFQ A;  3OKW A;  2PM7 B;  4XEI C;  3SJL D;  2H13 A;  4CY3 A;  4GGD A;  3SBQ A;  3UR4 A;  1SHY B;  3DM0 A;  4CI1 A;  5KDO B;  3EI4 A;  4ZOZ A;  2IUQ A;  5SXM A;  4CY2 A;  1L0Q A;  4CZV A;  2H14 A;  2XL2 A;  2I3T A;  1K32 A;  2OK6 A;  3BG1 A;  2I0T A;  3EU7 A;  4JSX C;  5I5M A;  5EAR A;  4CI2 A;  3DXK C;  3PE7 A;  3UKU C;  4A2L A;  3P4F A;  4J78 A;  3SCY A;  5EML B;  4FA1 D;  2H9N A;  4A09 A;  3SFZ A;  4ES0 A;  5EAL A;  3IIY A;  5IT9 g;  5FKT A;  2P9U C;  1NR0 A;  3I7L A;  3VGZ A;  2YNP A;  4NSX A;  4GQ2 P;  5K19 A;  2P9K C;  3FRX A;  5AFU 3;  3ODT A;  2AGL A;  4E54 A;  1XHM A;  3DWL C;  3VA6 A;  4E54 B;  5AMS A;  2AGZ A;  4FB1 D;  4GZ8 A;  3DSM A;  4J73 A;  2B5N A;  4LG9 A;  5H14 A;  2OIZ A;  4J87 A;  4ZOX A; 
#chains in the Genus database with same CATH topology
 5M5V A;  2VDR A;  1OLZ A;  4J0X A;  4JD2 C;  3OL2 A;  4X60 B;  1QFS A;  4K3I D;  3BG0 A;  4XYH A;  5FXY A;  4ZOV A;  4D6V A;  3E0C A;  3OL2 B;  2HU8 A;  3GD1 I;  1SQ9 A;  2IUV A;  5AJA A;  4PC0 A;  4I79 A;  2H47 A;  3N0D A;  2VDM A;  3NIF A;  2CE8 A;  1VZ2 A;  2Q7Q A;  3PVW B;  4OWR A;  3IJ1 A;  3SXT D;  4AMY A;  1GOT B;  3J80 g;  4AX4 A;  5B4W A;  4PBZ A;  2YB8 B;  3K72 A;  2OVR B;  4A08 A;  2PBI B;  3KCI A;  3DXM C;  4EWR A;  3KRW B;  3PXS D;  3C99 A;  4ERZ A;  3FCU A;  4BP9 A;  1JTD B;  1H2Y A;  1H2W A;  2JKX A;  4CY1 A;  4MMX A;  4A2M A;  3MKS B;  2O9K A;  4BCC A;  3F3G A;  4G55 A;  1GOF A;  2EID A;  4J79 A;  5K1C C;  5IGO A;  3EMH A;  3EI3 A;  3K27 A;  3L4O D;  1C9I A;  2P9I C;  1GOH A;  2IAA A;  2CN3 A;  2GC7 A;  3OKY A;  2XYI A;  4O2W A;  3T3M A;  1FWX A;  2HYE A;  4BL0 A;  4BCB A;  2H6N A;  3U4Y A;  3A0F A;  3I7O A;  1VE7 A;  3B7F A;  4FHL A;  1GP2 B;  4QRJ A;  3SWS D;  2XE4 A;  3F3P A;  3JAM g;  5FFO A;  3MMY A;  2XL3 A;  4WJK A;  4J81 A;  3MVD K;  3PVU B;  4JXM A;  3RMZ D;  2TRC B;  3PSL A;  2P9N C;  3C75 H;  2IUR A;  3T3P A;  4X3E A;  5CYK A;  4LG8 A;  5FKS A;  1BPO A;  3ZE2 A;  4JHP C;  4L1M A;  5CYK B;  3RFG A;  4NEN A;  4O1Q D;  1N6F A;  5IGQ A;  4Z7O A;  3IJC A;  3MXX A;  4GMB A;  4J86 A;  4J77 A;  1JMZ B;  1VZ3 A;  5FA5 B;  1VE6 A;  4KFM B;  4DNV A;  5IJ8 E;  1PGU A;  4UM9 A;  3FM0 A;  4PBY A;  3O4I A;  1JV2 A;  1H2Z A;  1XIP A;  3I8C A;  2XDW A;  2P9L C;  4MMY A;  4U7A A;  1SQJ A;  2AGY A;  3PXW D;  4N14 A;  1JMX B;  2EBS A;  2AH0 A;  3IUN A;  1E5T A;  4Z7Q A;  1UTC A;  3MZK A;  3W15 A;  3AL8 A;  4WK0 A;  1JOF A;  3IUM A;  3NVN A;  3AL8 B;  3IVM A;  2J57 G;  1H2X A;  1NEX B;  2AQ5 A;  2HJB A;  2VDK A;  1XKS A;  3DDU A;  1E8N A;  5HE2 B;  2CO0 C;  4O02 A;  2VDN A;  4GQB B;  4K3J B;  4X63 B;  1M1X A;  2YBA A;  3FGB A;  4NBM A;  3VI3 A;  3K6S A;  3SBP A;  4JSN C;  2H6K A;  3ULE C;  1JJU B;  4A7J A;  3AL9 A;  3VI4 A;  3SMR A;  3SHF A;  5EMK B;  1MG2 A;  1Q47 A;  1N6E A;  4BH6 A;  2QC5 A;  4AN0 A;  3JRP A;  4PXW A;  1B9X A;  1K8K C;  5TDH B;  4J84 A;  2YMU A;  4DNU A;  1E8M A;  3J81 g;  5FKR A;  1QNI A;  2GC4 A;  2VDP A;  4BCD A;  1U4C A;  4GGA A;  4OZU A;  4J0W A;  4BUJ C;  1C9L A;  4E5Z A;  5EMM B;  2EIC A;  4E5Z B;  4MMZ A;  4X61 B;  5HE1 B;  5HE3 B;  4JSV C;  1TBG A;  3AH8 B;  3V7D B;  1UOP A;  4GM9 A;  5M5R A;  4J82 A;  4O3U B;  4Z8L A;  4UI9 R;  4L1Q D;  4FAV D;  3K26 A;  2IWK A;  2HU5 A;  4O3T B;  3I2N A;  4CC9 A;  3UVK A;  2I0S A;  3I8E A;  5A2Q g;  4YVD A;  5H1M A;  4WK2 A;  3ZDZ A;  4UM8 A;  4L3G D;  2BCJ B;  4CZY A;  4A11 B;  2AGW A;  2QR5 A;  2OVP B;  1TYE A;  3C9C A;  5C92 A;  2HKM A;  3I7P A;  3EQ9 A;  4LGN A;  5TEE A;  4CI3 A;  4MK0 B;  5I5I A;  3N0E A;  3FCS A;  3O4J A;  5FKQ A;  4NC4 A;  3V4P A;  3ZE0 A;  1U8C A;  4GM8 A;  4JHN A;  1GG2 B;  1PEV A;  3IUL A;  3V9F A;  4A0B A;  5GXH A;  2J56 H;  5CXB A;  4AEZ A;  2PM6 B;  4A0B B;  1GXR A;  4FA5 D;  3JZG A;  5M5S A;  1B9Y A;  4PSX B;  5CXB B;  1TYQ C;  4ERQ A;  3EWE A;  4QAM A;  2G99 A;  3O4H A;  2EIB A;  4AOW A;  3CFS B;  4BP8 A;  3I7K A;  3IUJ A;  5GXI A;  4Z7N A;  1P22 A;  2CO0 A;  2IUP A;  1YFQ A;  5E6S A;  4D9S A;  1QFM A;  3EI1 B;  5FLX g;  2CN2 A;  3I7N A;  2PM9 A;  3MUO A;  5C9Z B;  5M61 A;  2PM9 B;  2H3X A;  3K71 A;  3NVX A;  2UZY B;  5EAP A;  4O9D A;  1A12 A;  4HDJ A;  5HDB A;  5IC7 A;  4RE5 A;  3KRX B;  4TZ4 A;  3V5W B;  2VC2 A;  4JT5 C;  5FFG A;  3EI2 A;  4GQ1 A;  3EI2 B;  2W18 A;  1R5M A;  3RN1 D;  3RSE C;  2BKL A;  3L4M D;  3F3F A;  4CI8 A;  3EI4 B;  1YR2 A;  4CZX A;  3SN6 B;  3EG6 A;  3OW8 A;  4IMM A;  1PI6 A;  2HJ4 A;  3NID A;  2J55 H;  4J8G A;  1ERJ A;  2I0R A;  4G56 B;  3C5M A;  4ZOY A;  3SLE D;  2OJY A;  5EMJ B;  3JZH A;  3VH0 A;  4JT6 C;  1MG3 A;  4GGC A;  2Z2O A;  4ZN4 A;  1VYH C;  4QQE A;  2H68 A;  2HXC A;  5GSA A;  3UVM A;  5HYN B;  5THA A;  4L3H D;  3JZN A;  4U1E I;  1T2X A;  3EQ8 A;  4Y7R A;  2AH1 A;  4FAN D;  4QL1 A;  5EM2 A;  5TF2 A;  2YNN A;  5CXC A;  4AN1 A;  5EM2 B;  4A09 B;  5CXC B;  5GMK n;  4H5I A;  3NVQ A;  4IA9 A;  3IIW A;  3MZL A;  5HQG A;  3I89 A;  3OF7 A;  3MKQ A;  5C86 A;  3BWS A;  3CFV A;  5M5U A;  4R7A B;  4QT8 A;  3GFC A;  3UVO A;  2B4E A;  2B5M A;  3ZE1 A;  4ERY A;  2I3S A;  3EQ7 A;  1U2V C;  5IJ7 E;  3SVW D;  3JRO A;  4WK4 A;  4ESG A;  3JB9 L;  2H6Q A;  3O4G A;  1A0R B;  4H5J A;  2MTA H;  4FA4 D;  3RFH A;  2YNO A;  2UZX B;  2QZP A;  2VDO A;  2QXV A;  4PSW B;  2OVQ B;  3JPX A;  3UVL A;  3RN0 D;  2HKR A;  4IRZ A;  2GNQ A;  4CY5 A;  3OKT A;  3GRE A;  2BBK H;  3RRM C;  4FA9 D;  3PSC B;  5I5J A;  4GM3 A;  2HU7 A;  2Z2P A;  1O6G A;  4A11 A;  4L9O A;  4Y5R D;  4A0A A;  3IKO A;  3ORV D;  4A0A B;  3IJE A;  1PBY B;  3GC3 B;  5FQD A;  2G9A A;  3PXT D;  2H9P A;  3CIK B;  4DNW A;  3RLM D;  2EIE A;  1UOO A;  3IJ0 A;  3ZDX A;  2H9L A;  4D0K A;  4A08 B;  4JSP C;  2OK4 A;  1RI6 A;  3IUR A;  1S4U X;  3I7H A;  3SBR A;  2AGX A;  2IWF A;  2CNX A;  2HES X;  2VDQ A;  3ZWL B;  5HE0 B;  2XU7 A;  3UKR C;  4O45 A;  5TEF A;  2Z2N A;  1N6D A;  4XYI A;  5EAM A;  5H17 A;  2H9M A;  3EI1 A;  3NIG A;  3EI3 B;  3QHY B;  4PNK B;  5C2V B;  3UVN A;  1OMW B;  1MDA H;  2P9P C;  4J8B A;  3MUN A;  5JWZ A;  4FWW A;  2CE9 A;  3OKY B;  3OTT A;  3V4V A;  2P9S C;  3AFC A;  2B5L A;  5E6U A;  5C2W B;  3HFQ A;  1UOQ A;  3OKW A;  2WQ8 A;  2PM7 B;  2VDL A;  4XEI C;  2H13 A;  3SJL D;  4CY3 A;  4GGD A;  3SBQ A;  1L5G A;  3UR4 A;  1SHY B;  3DM0 A;  4CI1 A;  5KDO B;  3EI4 A;  4NAA A;  4ZOZ A;  2IUQ A;  5SXM A;  4CY2 A;  1L0Q A;  4CZV A;  4G1M A;  1K3I A;  2H14 A;  2VZ3 A;  2XL2 A;  2I3T A;  1K32 A;  2OK6 A;  3ZDY A;  3IUQ A;  1I2M B;  3BG1 A;  2I0T A;  3EU7 A;  4JSX C;  5I5M A;  5EAR A;  4CI2 A;  3DXK C;  3PE7 A;  3UKU C;  4A2L A;  3P4F A;  2XZG A;  4J78 A;  3SCY A;  5M5T A;  5EML B;  4FA1 D;  2H9N A;  4RE6 A;  4A09 A;  3SFZ A;  4ES0 A;  5EAL A;  3IIY A;  1GOG A;  5IT9 g;  5FKT A;  2VZ1 A;  2P9U C;  1NR0 A;  3I7L A;  3VGZ A;  2YNP A;  4NSX A;  4GQ2 P;  5K19 A;  2P9K C;  3FRX A;  5AFU 3;  3ODT A;  2AGL A;  4E54 A;  1XHM A;  3DWL C;  3QI0 A;  3VA6 A;  4E54 B;  5AMS A;  4G1E A;  2AGZ A;  4FB1 D;  4GZ8 A;  5E6R A;  3DSM A;  4J73 A;  1O6F A;  2B5N A;  4LG9 A;  5H14 A;  2OIZ A;  4J87 A;  4AMZ A;  4ZOX A; 
#chains in the Genus database with same CATH homology
 1OLZ A;  4J0X A;  4JD2 C;  3OL2 A;  4X60 B;  4K3I D;  4XYH A;  3BG0 A;  5FXY A;  4D6V A;  4ZOV A;  3E0C A;  3OL2 B;  1SQ9 A;  2IUV A;  5AJA A;  4PC0 A;  4I79 A;  2H47 A;  3N0D A;  2CE8 A;  4OWR A;  2Q7Q A;  3PVW B;  3J80 g;  3IJ1 A;  3SXT D;  1GOT B;  5B4W A;  4PBZ A;  2YB8 B;  2OVR B;  4A08 A;  2PBI B;  3DXM C;  4EWR A;  3KRW B;  3PXS D;  3C99 A;  4ERZ A;  4CY1 A;  4A2M A;  3MKS B;  2O9K A;  3F3G A;  5K1C C;  4J79 A;  5IGO A;  3EMH A;  3EI3 A;  3K27 A;  3L4O D;  2P9I C;  2IAA A;  2CN3 A;  2GC7 A;  3OKY A;  2XYI A;  1FWX A;  2HYE A;  4BL0 A;  2H6N A;  3U4Y A;  3A0F A;  3I7O A;  3B7F A;  4FHL A;  3SWS D;  1GP2 B;  4QRJ A;  3JAM g;  3F3P A;  3MMY A;  2XL3 A;  4J81 A;  3PVU B;  4JXM A;  3RMZ D;  2TRC B;  3PSL A;  2P9N C;  3C75 H;  2IUR A;  4X3E A;  5CYK A;  4LG8 A;  5FKS A;  5CYK B;  3RFG A;  4O1Q D;  1N6F A;  5IGQ A;  3IJC A;  3MXX A;  4GMB A;  4J86 A;  4J77 A;  1JMZ B;  5FA5 B;  4KFM B;  5IJ8 E;  1PGU A;  3FM0 A;  4PBY A;  1XIP A;  3I8C A;  2P9L C;  4U7A A;  1SQJ A;  2AGY A;  3PXW D;  4N14 A;  1JMX B;  2EBS A;  2AH0 A;  3MZK A;  3W15 A;  3AL8 A;  1JOF A;  3NVN A;  3AL8 B;  2J57 G;  1NEX B;  2AQ5 A;  2HJB A;  1XKS A;  5HE2 B;  2CO0 C;  4GQB B;  4K3J B;  4X63 B;  2YBA A;  3FGB A;  3SBP A;  4JSN C;  2H6K A;  3ULE C;  1JJU B;  4A7J A;  3AL9 A;  3SMR A;  3SHF A;  5EMK B;  1MG2 A;  1Q47 A;  1N6E A;  4BH6 A;  2QC5 A;  3JRP A;  4PXW A;  1B9X A;  1K8K C;  5TDH B;  4J84 A;  2YMU A;  3J81 g;  5FKR A;  1QNI A;  2GC4 A;  1U4C A;  4GGA A;  4OZU A;  4J0W A;  4BUJ C;  4E5Z A;  5EMM B;  4E5Z B;  4X61 B;  5HE1 B;  5HE3 B;  4JSV C;  1TBG A;  3AH8 B;  3V7D B;  4GM9 A;  4J82 A;  4O3U B;  4Z8L A;  4UI9 R;  4L1Q D;  4FAV D;  3K26 A;  2IWK A;  4O3T B;  3I2N A;  4CC9 A;  3UVK A;  2I0S A;  3I8E A;  5A2Q g;  4YVD A;  5H1M A;  4L3G D;  2BCJ B;  4CZY A;  4A11 B;  2AGW A;  2OVP B;  3C9C A;  2HKM A;  3I7P A;  4LGN A;  5TEE A;  4CI3 A;  4MK0 B;  5I5I A;  3N0E A;  5FKQ A;  4GM8 A;  1GG2 B;  1PEV A;  3V9F A;  4A0B A;  5GXH A;  2J56 H;  5CXB A;  4AEZ A;  2PM6 B;  4A0B B;  1GXR A;  4FA5 D;  3JZG A;  1B9Y A;  4PSX B;  5CXB B;  1TYQ C;  4ERQ A;  3EWE A;  2G99 A;  4AOW A;  3CFS B;  3I7K A;  5GXI A;  1P22 A;  2CO0 A;  2IUP A;  1YFQ A;  3EI1 B;  5FLX g;  2CN2 A;  3I7N A;  2PM9 A;  5C9Z B;  2PM9 B;  2H3X A;  3NVX A;  2UZY B;  5EAP A;  4O9D A;  4HDJ A;  5IC7 A;  4TZ4 A;  3KRX B;  3V5W B;  4JT5 C;  3EI2 A;  4GQ1 A;  3EI2 B;  2W18 A;  1R5M A;  3RN1 D;  3RSE C;  3L4M D;  3F3F A;  4CI8 A;  3EI4 B;  4CZX A;  3SN6 B;  3EG6 A;  3OW8 A;  4IMM A;  1PI6 A;  2HJ4 A;  2J55 H;  4J8G A;  1ERJ A;  2I0R A;  4G56 B;  3C5M A;  4ZOY A;  3SLE D;  2OJY A;  5EMJ B;  3JZH A;  3VH0 A;  4JT6 C;  1MG3 A;  4GGC A;  2Z2O A;  4ZN4 A;  1VYH C;  4QQE A;  2H68 A;  2HXC A;  5GSA A;  3UVM A;  5HYN B;  5THA A;  4L3H D;  3JZN A;  4U1E I;  4Y7R A;  4FAN D;  2AH1 A;  4QL1 A;  5EM2 A;  5TF2 A;  2YNN A;  5CXC A;  5EM2 B;  4A09 B;  5CXC B;  5GMK n;  4H5I A;  3NVQ A;  4IA9 A;  3IIW A;  3MZL A;  5HQG A;  3I89 A;  3MKQ A;  3BWS A;  3CFV A;  4R7A B;  4QT8 A;  3GFC A;  3UVO A;  2B4E A;  2B5M A;  4ERY A;  2I3S A;  3SVW D;  1U2V C;  5IJ7 E;  3JRO A;  4ESG A;  3JB9 L;  2H6Q A;  1A0R B;  4H5J A;  2MTA H;  4FA4 D;  3RFH A;  2YNO A;  2UZX B;  2QXV A;  4PSW B;  2OVQ B;  3JPX A;  3UVL A;  3RN0 D;  2HKR A;  2GNQ A;  4CY5 A;  3OKT A;  3GRE A;  2BBK H;  3RRM C;  4FA9 D;  3PSC B;  5I5J A;  4GM3 A;  2Z2P A;  4A11 A;  4L9O A;  4Y5R D;  4A0A A;  3IKO A;  3ORV D;  4A0A B;  1PBY B;  5FQD A;  2G9A A;  3PXT D;  2H9P A;  3CIK B;  3RLM D;  3IJ0 A;  2H9L A;  4D0K A;  4A08 B;  4JSP C;  2OK4 A;  1RI6 A;  1S4U X;  3I7H A;  3SBR A;  2AGX A;  2IWF A;  2CNX A;  2HES X;  3ZWL B;  5HE0 B;  2XU7 A;  3UKR C;  4O45 A;  5TEF A;  2Z2N A;  1N6D A;  4XYI A;  5EAM A;  5H17 A;  2H9M A;  3EI1 A;  3EI3 B;  4PNK B;  5C2V B;  3UVN A;  1OMW B;  1MDA H;  2P9P C;  4J8B A;  5JWZ A;  4FWW A;  2CE9 A;  3OKY B;  3OTT A;  2P9S C;  3AFC A;  2B5L A;  5C2W B;  3HFQ A;  3OKW A;  2PM7 B;  4XEI C;  3SJL D;  2H13 A;  4CY3 A;  4GGD A;  3SBQ A;  3UR4 A;  1SHY B;  3DM0 A;  4CI1 A;  5KDO B;  3EI4 A;  4ZOZ A;  2IUQ A;  5SXM A;  4CY2 A;  1L0Q A;  4CZV A;  2H14 A;  2XL2 A;  2I3T A;  1K32 A;  2OK6 A;  3BG1 A;  2I0T A;  3EU7 A;  4JSX C;  5I5M A;  5EAR A;  4CI2 A;  3DXK C;  3PE7 A;  3UKU C;  4A2L A;  3P4F A;  4J78 A;  3SCY A;  5EML B;  4FA1 D;  2H9N A;  4A09 A;  3SFZ A;  4ES0 A;  5EAL A;  3IIY A;  5IT9 g;  5FKT A;  2P9U C;  1NR0 A;  3I7L A;  3VGZ A;  2YNP A;  4NSX A;  4GQ2 P;  5K19 A;  2P9K C;  3FRX A;  5AFU 3;  3ODT A;  2AGL A;  4E54 A;  1XHM A;  3DWL C;  3VA6 A;  4E54 B;  5AMS A;  2AGZ A;  4FB1 D;  4GZ8 A;  3DSM A;  4J73 A;  2B5N A;  4LG9 A;  5H14 A;  2OIZ A;  4J87 A;  4ZOX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...