2H6NA

Histone h3 recognition and presentation by the wdr5 module of the mll1 complex
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
304
structure length
304
Chain Sequence
b'VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD-repeat protein 5
publication title Histone H3 recognition and presentation by the WDR5 module of the MLL1 complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 101
structure length 304
sequence length 304
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2h6nA00
2CN2A 2UZXB 2HKMA 3OKYA 3I7PA 1PGUA 2H9MA 3MMYA 3L4MD 2YB8B 3EWEA 4J82A 2CE9A 2IAAA 2YMUA 3GREA 3RFGA 1N6FA 3MKQA 2Z2PA 4IMMA 3UVOA 1S4UX 4H5IA 5HYNB 3PVUB 4UI9R 4PC0A 2H6KA 4FA1D 5THAA 2AH1A 1N6EA 3EMHA 1XHMA 5AMSA 4U1EI 3ZWLB 2AGZA 2MTAH 4O3TB 2TRCB 2QC5A 4FB1D 2Z2NA 4QL1A 4BL0A 1TBGA 1XKSA 5IGQA 4A09B 3RFHA 1GG2B 3E0CA 4CZVA 2CO0C 3PXTD 2EBSA 3V5WB 4CZXA 4A2LA 2Z2OA 4GZ8A 5K1CC 2BCJB 3RLMD 3DWLC 4XYIA 3W15A 4PNKB 2OVQB 5K19A 4AOWA 3EI4B 2H3XA 3I89A 4ESGA 2P9UC 4L3HD 5EM2A 4FHLA 3N0DA 3BG1A 2OK4A 4CY2A 4MK0B 3SWSD 2PM7B 2I0RA 3UKRC 2HESX 4JSPC 5HE1B 2AGLA 2B5LA 4GM3A 4J73A 2H9NA 2CO0A 1JMZB 3ODTA 5I5IA 3CFVA 3EI2A 5CXCB 4J87A 3J81g 2CE8A 2AGYA 2IURA 4CI3A 3AL8A 4KFMB 4GQBB 2H47A 2AGWA 2HJ4A 4X3EA 2AH0A 3RSEC 5FKSA 4NSXA 1N6DA 4O9DA 2OVPB 4GQ1A 3JRPA 2GC7A 3OL2B 3JROA 3I7HA 3SVWD 3SBPA 4J78A 4CC9A 3SJLD 2P9NC 2P9KC 2UZYB 1PI6A 2G99A 4A11A 5FKRA 1XIPA 2J55H 1FWXA 2IUVA 4GGCA 4N14A 2H6QA 3P4FA 1RI6A 3VGZA 5CYKB 5C2VB 4EWRA 4PSWB 1JMXB 5A2Qg 3SCYA 5GSAA 3DXKC 3EI1B 4K3ID 4A0AB 3F3FA 1R5MA 2YNNA 3UVNA 2B5NA 5EAPA 3L4OD 2HYEA 4FAVD 3NVXA 4H5JA 3K27A 5CXBB 3IJ1A 2XL2A 4X61B 4J79A 3PVWB 4X60B 5HQGA 3F3GA 4FA5D 5HE0B 3IJCA 4E5ZA 4CY5A 4E54B 3IJ0A 4JT5C 4HDJA 4PBYA 2I3TA 3IIWA 4FA4D 2YNOA 4D0KA 4L3GD 2P9IC 5KDOB 3OKWA 2P9LC 2P9SC 2H68A 3DM0A 4ZN4A 4A0BA 5B4WA 2IWKA 4GM9A 3C5MA 3SBQA 1U4CA 4QRJA 1JOFA 5TDHB 4A08A 1SQ9A 2GNQA 3JZGA 3N0EA 3SLED 4LGNA 5AJAA 4ZOXA 2QXVA 2OIZA 1NR0A 3RRMC 2GC4A 3U4YA 2PM9B 5IJ8E 3EI3A 3OKYB 5IC7A 4A2MA 3CFSB 2PM6B 4X63B 3FRXA 2IWFA 2HJBA 5EMJB 4JD2C 1A0RB 5H1MA 4PBZA 3BG0A 3C9CA 5I5JA 4J0WA 4Z8LA 1ERJA 5H14A 3EG6A 4J0XA 3F3PA 2H9LA 3AH8B 1YFQA 4O3UB 5EALA 2I0SA 1MG3A 5FKTA 3MZLA 3I2NA 3I7KA 3DXMC 4GMBA 3DSMA 5FQDA 4J8BA 4ES0A 3OTTA 4CZYA 3RMZD 3VA6A 3I7NA 4Y7RA 1SHYB 4J86A 4A7JA 4JT6C 4A09A 3FM0A 2OK6A 3PE7A 5SXMA 3NVQA 3HFQA 1Q47A 2OJYA 5IT9g 3I8EA 3UVMA 5I5MA 4PXWA 4BH6A 4ERYA 4JXMA 2AQ5A 4JSNC 1SQJA 2I3SA 3MZKA 5EM2B 3K26A 3EI4A 1OLZA 3OKTA 4I79A 4CY3A 1OMWB 3FGBA 2IUQA 4FWWA 3JZNA 1GP2B 3MKSB 3GFCA 5GXHA 2H9PA 1GOTB 3AFCA 2Q7QA 3C99A 5EAMA 4GM8A 2HKRA 1K8KC 3EI2B 4LG9A 2HXCA 4D6VA 3ULEC 4ERQA 2CN3A 4K3JB 3AL8B 5IJ7E 3V7DB 1GXRA 1K32A 5CXCA 3EU7A 2CNXA 3PSCB 2J56H 2I0TA 4O45A 4FA9D 1JJUB 5TF2A 3RN1D 3SN6B 5EMMB 5GXIA 3SXTD 1B9XA 4G56B 3J80g 5TEEA 4A11B 4BUJC 3OL2A 1PEVA 4CI2A 3SMRA 3I7OA 4J84A 4CY1A 3B7FA 1U2VC 4AEZA 3KRWB 4JSXC 5EMLB 2J57G 1VYHC 2BBKH 2OVRB 5CYKA 2XYIA 4FAND 2YNPA 3ORVD 1QNIA 5TEFA 4L9OA 4TZ4A 3JZHA 3RN0D 5FA5B 4LG8A 3AL9A 4R7AB 4ZOYA 3EI1A 4PSXB 5HE2B 4A0AA 3VH0A 2H6NA 2W18A 2B4EA 3V9FA 5JWZA 1TYQC 4GQ2P 3KRXB 3JB9L 5EMKB 3I8CA 2IUPA 4U7AA 5C2WB 4O1QD 3I7LA 3PSLA 5CXBA 4E5ZB 3IIYA 3UKUC 2PBIB 4XYHA 3JPXA 4J77A 5FKQA 3NVNA 2XL3A 4QT8A 5IGOA 4ZOVA 3IKOA 4E54A 3SFZA 3A0FA 4J8GA 1B9YA 4IA9A 2YBAA 1L0QA 4CI1A 4JSVC 2G9AA 2XU7A 2P9PC 4GGDA 4CI8A 5C9ZB 5FLXg 3JAMg 1PBYB 4J81A 4A0BB 5EARA 2AGXA 3SBRA 5AFU3 3UVKA 4ZOZA 1MDAH 4A08B 5GMKn 3BWSA 1NEXB 3C75H 3OW8A 4XEIC 5H17A 3CIKB 4OWRA 4YVDA 2H14A 4ERZA 1MG2A 2H13A 3PXSD 1P22A 4QQEA 2B5MA 4Y5RD 4L1QD 3PXWD 4GGAA 4OZUA 5FXYA 3EI3B 3UR4A 3UVLA 3SHFA 5HE3B 2PM9A 2O9KA 3MXXA
chains in the Genus database with same CATH superfamily
2CN2A 2UZXB 2HKMA 3OKYA 3I7PA 1PGUA 2H9MA 5E6SA 3MMYA 3L4MD 4WJKA 2YB8B 5M5UA 4G1MA 3EWEA 4J82A 2CE9A 2IAAA 3GREA 2YMUA 3RFGA 1N6FA 3MKQA 2Z2PA 4IMMA 5M5RA 3V4VA 3UVOA 1S4UX 4H5IA 3O4JA 5HYNB 3PVUB 3IULA 4UI9R 4PC0A 2H6KA 3FCUA 4FA1D 5THAA 2AH1A 4DNUA 3IURA 4IRZA 1GOFA 1N6EA 3EMHA 1XHMA 5AMSA 4U1EI 3ZWLB 1UOPA 2AGZA 2MTAH 4O3TB 2TRCB 2QC5A 4FB1D 2Z2NA 3K72A 3IUMA 3EQ7A 4QL1A 4BL0A 1TBGA 1XKSA 5IGQA 4A09B 3RFHA 4UM9A 1GG2B 3E0CA 4AX4A 4CZVA 1H2YA 4BP8A 1GOHA 2CO0C 2WQ8A 3PXTD 2EBSA 3V5WB 4CZXA 4A2LA 2Z2OA 4GZ8A 5K1CC 2BCJB 4WK2A 3RLMD 3DWLC 4XYIA 3W15A 4PNKB 3ZE0A 3VI3A 2OVQB 5K19A 4AOWA 3EI4B 2H3XA 3I89A 2VDLA 3IJEA 4RE5A 4ESGA 2P9UC 4L3HD 5EM2A 4FHLA 3N0DA 3IUNA 3BG1A 2OK4A 4CY2A 4MK0B 3SWSD 2PM7B 2VDNA 3O4HA 2I0RA 3UKRC 2HESX 4JSPC 5HE1B 2AGLA 2B5LA 4GM3A 4J73A 2H9NA 2CO0A 1JMZB 4O2WA 3ODTA 5I5IA 3CFVA 4D9SA 3EI2A 5CXCB 4J87A 3J81g 2CE8A 2AGYA 2IURA 4CI3A 2VDMA 3T3MA 3AL8A 4KFMB 4GQBB 2QZPA 2H47A 2AGWA 2HJ4A 1H2ZA 4X3EA 2AH0A 3RSEC 5FKSA 4NSXA 2VDQA 1N6DA 4O9DA 2OVPB 4GQ1A 1O6FA 3JRPA 2GC7A 3OL2B 4G1EA 3JROA 3I7HA 3SVWD 3EQ9A 3SBPA 4J78A 4CC9A 3SJLD 2P9NC 2P9KC 2UZYB 1PI6A 3NIFA 2G99A 4A11A 2XZGA 5FKRA 4NENA 1XIPA 2J55H 4NBMA 1FWXA 2IUVA 4GGCA 4RE6A 3ZE1A 2VZ3A 2H6QA 4N14A 3P4FA 1RI6A 3VGZA 5CYKB 5C2VB 1VE6A 4EWRA 4PSWB 1C9IA 1JMXB 4UM8A 2HU7A 5A2Qg 3SCYA 3ZE2A 3K6SA 5GSAA 1VE7A 3MVDK 3DXKC 1JV2A 3EI1B 4K3ID 2VZ1A 2XDWA 4A0AB 3F3FA 1R5MA 2YNNA 3UVNA 4AN1A 2B5NA 5EAPA 3L4OD 2HYEA 2EIBA 4FAVD 3NVXA 4H5JA 3K27A 3IVMA 5CXBB 3IJ1A 2XL2A 4X61B 4J79A 3PVWB 1UOOA 4X60B 1H2WA 5HQGA 3F3GA 4FA5D 5HE0B 3IJCA 4E5ZA 4CY5A 4E54B 3IJ0A 4JT5C 4HDJA 4PBYA 2I3TA 3MUNA 1UTCA 3IIWA 3IUQA 1A12A 3VI4A 1E8NA 2YNOA 4FA4D 5M5TA 4D0KA 4L3GD 2P9IC 5KDOB 3OKWA 2P9LC 2P9SC 2H68A 3DM0A 4ZN4A 4A0BA 5B4WA 2IWKA 1K3IA 4GM9A 3C5MA 3SBQA 1U4CA 4QRJA 1JOFA 5TDHB 4A08A 1SQ9A 4WK4A 3ZDXA 2GNQA 3JZGA 3N0EA 3SLED 4LGNA 5AJAA 4ZOXA 2QXVA 2OIZA 3GC3B 1NR0A 3RRMC 4O02A 2GC4A 4DNVA 3U4YA 2PM9B 5IJ8E 3EI3A 3OKYB 5IC7A 4A2MA 3CFSB 2PM6B 4X63B 3FRXA 2IWFA 2HJBA 3EQ8A 4NC4A 3ZDYA 5EMJB 4JD2C 1A0RB 5H1MA 4PBZA 4BP9A 3BG0A 1U8CA 3C9CA 5I5JA 4J0WA 4Z8LA 2QR5A 4Z7NA 1ERJA 5H14A 3EG6A 4J0XA 3F3PA 2H9LA 1UOQA 4QAMA 3AH8B 4Z7QA 4AMZA 1M1XA 5HDBA 1YFQA 4O3UB 5EALA 2I0SA 1MG3A 5FKTA 3MZLA 3I2NA 3I7KA 2HU8A 3DXMC 4GMBA 2VDRA 3DSMA 5FQDA 4BCDA 5E6RA 4J8BA 2EIEA 4ES0A 3OTTA 5FFOA 1H2XA 4CZYA 4WK0A 3RMZD 1GOGA 3VA6A 3I7NA 4Y7RA 3KCIA 1SHYB 4J86A 4BCCA 5FFGA 4A7JA 4JT6C 4A09A 3FM0A 3GD1I 2OK6A 3PE7A 3ZDZA 5SXMA 2VDPA 3NVQA 3HFQA 1Q47A 2OJYA 5IT9g 3I8EA 3UVMA 5I5MA 4NAAA 4PXWA 4BH6A 2VDKA 4ERYA 4JXMA 2AQ5A 4JSNC 1SQJA 2I3SA 3IUJA 3MZKA 4MMZA 5EM2B 3K26A 1QFMA 2BKLA 2XE4A 3EI4A 1OLZA 4JHNA 3OKTA 4I79A 4CY3A 1OMWB 3FGBA 2IUQA 4FWWA 3K71A 3JZNA 1VZ2A 1GP2B 3MKSB 3GFCA 3FCSA 5GXHA 2H9PA 1GOTB 3AFCA 2Q7QA 3C99A 3NIDA 5EAMA 1I2MB 4GM8A 2HKRA 1K8KC 3EI2B 4LG9A 2HXCA 4Z7OA 4D6VA 3ULEC 4ERQA 2CN3A 4K3JB 3AL8B 5IJ7E 3V7DB 1GXRA 4MMYA 1K32A 1BPOA 5CXCA 3EU7A 5E6UA 2CNXA 3PSCB 2J56H 2I0TA 4O45A 4FA9D 1JJUB 5TF2A 3RN1D 3SN6B 5EMMB 5GXIA 3SXTD 1B9XA 5M61A 3V4PA 4G56B 3J80g 5TEEA 4A11B 4BUJC 1E5TA 1PEVA 3OL2A 4CI2A 3SMRA 3I7OA 4J84A 4CY1A 3B7FA 4G55A 1U2VC 4JHPC 4AEZA 3KRWB 4JSXC 5EMLB 2J57G 1VYHC 2BBKH 2OVRB 5CYKA 2XYIA 3QI0A 4AN0A 4FAND 2YNPA 3ORVD 1QNIA 5TEFA 4L9OA 4TZ4A 3JZHA 3RN0D 2EIDA 5FA5B 4LG8A 3AL9A 4R7AB 4ZOYA 3EI1A 4PSXB 5HE2B 4A0AA 3VH0A 1VZ3A 2H6NA 2W18A 2B4EA 3V9FA 5JWZA 1TYQC 4GQ2P 3KRXB 3JB9L 5EMKB 3I8CA 2IUPA 4U7AA 5C2WB 4O1QD 3I7LA 3PSLA 5CXBA 2VC2A 4E5ZB 3IIYA 5C86A 3UKUC 2PBIB 4XYHA 2HU5A 1C9LA 3JPXA 4J77A 3O4GA 5FKQA 3NVNA 1QFSA 2XL3A 2VDOA 4QT8A 5IGOA 4ZOVA 3IKOA 4E54A 1O6GA 3SFZA 1JTDB 3OF7A 3A0FA 1TYEA 1B9YA 4IA9A 4J8GA 2YBAA 1L0QA 4CI1A 5C92A 4JSVC 1YR2A 2G9AA 2XU7A 2P9PC 4GGDA 3DDUA 4DNWA 4CI8A 5C9ZB 5FLXg 3JAMg 1PBYB 4J81A 4A0BB 5EARA 2AGXA 5M5VA 3SBRA 4MMXA 5AFU3 2JKXA 3UVKA 3NIGA 4ZOZA 1MDAH 2EICA 5GMKn 4A08B 3QHYB 3BWSA 3MUOA 1NEXB 1T2XA 3C75H 3OW8A 4XEIC 4L1MA 1E8MA 5H17A 3CIKB 4OWRA 4YVDA 5M5SA 2H14A 4ERZA 1MG2A 2H13A 3PXSD 1P22A 4QQEA 2B5MA 4Y5RD 3O4IA 3PXWD 4L1QD 4GGAA 4BCBA 4OZUA 5FXYA 3EI3B 3UR4A 3UVLA 3SHFA 5HE3B 3T3PA 2PM9A 1L5GA 2O9KA 3MXXA 4AMYA
chains in the Genus database with same CATH topology
2CN2A 2UZXB 2HKMA 3OKYA 3I7PA 1PGUA 2H9MA 3MMYA 3L4MD 2YB8B 3EWEA 4J82A 2CE9A 2IAAA 2YMUA 3GREA 3RFGA 1N6FA 3MKQA 2Z2PA 4IMMA 3UVOA 1S4UX 4H5IA 5HYNB 3PVUB 4UI9R 4PC0A 2H6KA 4FA1D 5THAA 2AH1A 1N6EA 3EMHA 1XHMA 5AMSA 4U1EI 3ZWLB 2AGZA 2MTAH 4O3TB 2TRCB 2QC5A 4FB1D 2Z2NA 4QL1A 4BL0A 1TBGA 1XKSA 5IGQA 4A09B 3RFHA 1GG2B 3E0CA 4CZVA 2CO0C 3PXTD 2EBSA 3V5WB 4CZXA 4A2LA 2Z2OA 4GZ8A 5K1CC 2BCJB 3RLMD 3DWLC 4XYIA 3W15A 4PNKB 2OVQB 5K19A 4AOWA 3EI4B 2H3XA 3I89A 4ESGA 2P9UC 4L3HD 5EM2A 4FHLA 3N0DA 3BG1A 2OK4A 4CY2A 4MK0B 3SWSD 2PM7B 2I0RA 3UKRC 2HESX 4JSPC 5HE1B 2AGLA 2B5LA 4GM3A 4J73A 2H9NA 2CO0A 1JMZB 3ODTA 5I5IA 3CFVA 3EI2A 5CXCB 4J87A 3J81g 2CE8A 2AGYA 2IURA 4CI3A 3AL8A 4KFMB 4GQBB 2H47A 2AGWA 2HJ4A 4X3EA 2AH0A 3RSEC 5FKSA 4NSXA 1N6DA 4O9DA 2OVPB 4GQ1A 3JRPA 2GC7A 3OL2B 3JROA 3I7HA 3SVWD 3SBPA 4J78A 4CC9A 3SJLD 2P9NC 2P9KC 2UZYB 1PI6A 2G99A 4A11A 5FKRA 1XIPA 2J55H 1FWXA 2IUVA 4GGCA 4N14A 2H6QA 3P4FA 1RI6A 3VGZA 5CYKB 5C2VB 4EWRA 4PSWB 1JMXB 5A2Qg 3SCYA 5GSAA 3DXKC 3EI1B 4K3ID 4A0AB 3F3FA 1R5MA 2YNNA 3UVNA 2B5NA 5EAPA 3L4OD 2HYEA 4FAVD 3NVXA 4H5JA 3K27A 5CXBB 3IJ1A 2XL2A 4X61B 4J79A 3PVWB 4X60B 5HQGA 3F3GA 4FA5D 5HE0B 3IJCA 4E5ZA 4CY5A 4E54B 3IJ0A 4JT5C 4HDJA 4PBYA 2I3TA 3IIWA 4FA4D 2YNOA 4D0KA 4L3GD 2P9IC 5KDOB 3OKWA 2P9LC 2P9SC 2H68A 3DM0A 4ZN4A 4A0BA 5B4WA 2IWKA 4GM9A 3C5MA 3SBQA 1U4CA 4QRJA 1JOFA 5TDHB 4A08A 1SQ9A 2GNQA 3JZGA 3N0EA 3SLED 4LGNA 5AJAA 4ZOXA 2QXVA 2OIZA 1NR0A 3RRMC 2GC4A 3U4YA 2PM9B 5IJ8E 3EI3A 3OKYB 5IC7A 4A2MA 3CFSB 2PM6B 4X63B 3FRXA 2IWFA 2HJBA 5EMJB 4JD2C 1A0RB 5H1MA 4PBZA 3BG0A 3C9CA 5I5JA 4J0WA 4Z8LA 1ERJA 5H14A 3EG6A 4J0XA 3F3PA 2H9LA 3AH8B 1YFQA 4O3UB 5EALA 2I0SA 1MG3A 5FKTA 3MZLA 3I2NA 3I7KA 3DXMC 4GMBA 3DSMA 5FQDA 4J8BA 4ES0A 3OTTA 4CZYA 3RMZD 3VA6A 3I7NA 4Y7RA 1SHYB 4J86A 4A7JA 4JT6C 4A09A 3FM0A 2OK6A 3PE7A 5SXMA 3NVQA 3HFQA 1Q47A 2OJYA 5IT9g 3I8EA 3UVMA 5I5MA 4PXWA 4BH6A 4ERYA 4JXMA 2AQ5A 4JSNC 1SQJA 2I3SA 3MZKA 5EM2B 3K26A 3EI4A 1OLZA 3OKTA 4I79A 4CY3A 1OMWB 3FGBA 2IUQA 4FWWA 3JZNA 1GP2B 3MKSB 3GFCA 5GXHA 2H9PA 1GOTB 3AFCA 2Q7QA 3C99A 5EAMA 4GM8A 2HKRA 1K8KC 3EI2B 4LG9A 2HXCA 4D6VA 3ULEC 4ERQA 2CN3A 4K3JB 3AL8B 5IJ7E 3V7DB 1GXRA 1K32A 5CXCA 3EU7A 2CNXA 3PSCB 2J56H 2I0TA 4O45A 4FA9D 1JJUB 5TF2A 3RN1D 3SN6B 5EMMB 5GXIA 3SXTD 1B9XA 4G56B 3J80g 5TEEA 4A11B 4BUJC 3OL2A 1PEVA 4CI2A 3SMRA 3I7OA 4J84A 4CY1A 3B7FA 1U2VC 4AEZA 3KRWB 4JSXC 5EMLB 2J57G 1VYHC 2BBKH 2OVRB 5CYKA 2XYIA 4FAND 2YNPA 3ORVD 1QNIA 5TEFA 4L9OA 4TZ4A 3JZHA 3RN0D 5FA5B 4LG8A 3AL9A 4R7AB 4ZOYA 3EI1A 4PSXB 5HE2B 4A0AA 3VH0A 2H6NA 2W18A 2B4EA 3V9FA 5JWZA 1TYQC 4GQ2P 3KRXB 3JB9L 5EMKB 3I8CA 2IUPA 4U7AA 5C2WB 4O1QD 3I7LA 3PSLA 5CXBA 4E5ZB 3IIYA 3UKUC 2PBIB 4XYHA 3JPXA 4J77A 5FKQA 3NVNA 2XL3A 4QT8A 5IGOA 4ZOVA 3IKOA 4E54A 3SFZA 3A0FA 4J8GA 1B9YA 4IA9A 2YBAA 1L0QA 4CI1A 4JSVC 2G9AA 2XU7A 2P9PC 4GGDA 4CI8A 5C9ZB 5FLXg 3JAMg 1PBYB 4J81A 4A0BB 5EARA 2AGXA 3SBRA 5AFU3 3UVKA 4ZOZA 1MDAH 4A08B 5GMKn 3BWSA 1NEXB 3C75H 3OW8A 4XEIC 5H17A 3CIKB 4OWRA 4YVDA 2H14A 4ERZA 1MG2A 2H13A 3PXSD 1P22A 4QQEA 2B5MA 4Y5RD 4L1QD 3PXWD 4GGAA 4OZUA 5FXYA 3EI3B 3UR4A 3UVLA 3SHFA 5HE3B 2PM9A 2O9KA 3MXXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CN2 A;  2UZX B;  2HKM A;  3OKY A;  3I7P A;  1PGU A;  2H9M A;  3MMY A;  3L4M D;  2YB8 B;  3EWE A;  4J82 A;  2CE9 A;  2IAA A;  2YMU A;  3GRE A;  3RFG A;  1N6F A;  3MKQ A;  2Z2P A;  4IMM A;  3UVO A;  1S4U X;  4H5I A;  5HYN B;  3PVU B;  4UI9 R;  4PC0 A;  2H6K A;  4FA1 D;  5THA A;  2AH1 A;  1N6E A;  3EMH A;  1XHM A;  5AMS A;  4U1E I;  3ZWL B;  2AGZ A;  2MTA H;  4O3T B;  2TRC B;  2QC5 A;  4FB1 D;  2Z2N A;  4QL1 A;  4BL0 A;  1TBG A;  1XKS A;  5IGQ A;  4A09 B;  3RFH A;  1GG2 B;  3E0C A;  4CZV A;  2CO0 C;  3PXT D;  2EBS A;  3V5W B;  4CZX A;  4A2L A;  2Z2O A;  4GZ8 A;  5K1C C;  2BCJ B;  3RLM D;  3DWL C;  4XYI A;  3W15 A;  4PNK B;  2OVQ B;  5K19 A;  4AOW A;  3EI4 B;  2H3X A;  3I89 A;  4ESG A;  2P9U C;  4L3H D;  5EM2 A;  4FHL A;  3N0D A;  3BG1 A;  2OK4 A;  4CY2 A;  4MK0 B;  3SWS D;  2PM7 B;  2I0R A;  3UKR C;  2HES X;  4JSP C;  5HE1 B;  2AGL A;  2B5L A;  4GM3 A;  4J73 A;  2H9N A;  2CO0 A;  1JMZ B;  3ODT A;  5I5I A;  3CFV A;  3EI2 A;  5CXC B;  4J87 A;  3J81 g;  2CE8 A;  2AGY A;  2IUR A;  4CI3 A;  3AL8 A;  4KFM B;  4GQB B;  2H47 A;  2AGW A;  2HJ4 A;  4X3E A;  2AH0 A;  3RSE C;  5FKS A;  4NSX A;  1N6D A;  4O9D A;  2OVP B;  4GQ1 A;  3JRP A;  2GC7 A;  3OL2 B;  3JRO A;  3I7H A;  3SVW D;  3SBP A;  4J78 A;  4CC9 A;  3SJL D;  2P9N C;  2P9K C;  2UZY B;  1PI6 A;  2G99 A;  4A11 A;  5FKR A;  1XIP A;  2J55 H;  1FWX A;  2IUV A;  4GGC A;  4N14 A;  2H6Q A;  3P4F A;  1RI6 A;  3VGZ A;  5CYK B;  5C2V B;  4EWR A;  4PSW B;  1JMX B;  5A2Q g;  3SCY A;  5GSA A;  3DXK C;  3EI1 B;  4K3I D;  4A0A B;  3F3F A;  1R5M A;  2YNN A;  3UVN A;  2B5N A;  5EAP A;  3L4O D;  2HYE A;  4FAV D;  3NVX A;  4H5J A;  3K27 A;  5CXB B;  3IJ1 A;  2XL2 A;  4X61 B;  4J79 A;  3PVW B;  4X60 B;  5HQG A;  3F3G A;  4FA5 D;  5HE0 B;  3IJC A;  4E5Z A;  4CY5 A;  4E54 B;  3IJ0 A;  4JT5 C;  4HDJ A;  4PBY A;  2I3T A;  3IIW A;  4FA4 D;  2YNO A;  4D0K A;  4L3G D;  2P9I C;  5KDO B;  3OKW A;  2P9L C;  2P9S C;  2H68 A;  3DM0 A;  4ZN4 A;  4A0B A;  5B4W A;  2IWK A;  4GM9 A;  3C5M A;  3SBQ A;  1U4C A;  4QRJ A;  1JOF A;  5TDH B;  4A08 A;  1SQ9 A;  2GNQ A;  3JZG A;  3N0E A;  3SLE D;  4LGN A;  5AJA A;  4ZOX A;  2QXV A;  2OIZ A;  1NR0 A;  3RRM C;  2GC4 A;  3U4Y A;  2PM9 B;  5IJ8 E;  3EI3 A;  3OKY B;  5IC7 A;  4A2M A;  3CFS B;  2PM6 B;  4X63 B;  3FRX A;  2IWF A;  2HJB A;  5EMJ B;  4JD2 C;  1A0R B;  5H1M A;  4PBZ A;  3BG0 A;  3C9C A;  5I5J A;  4J0W A;  4Z8L A;  1ERJ A;  5H14 A;  3EG6 A;  4J0X A;  3F3P A;  2H9L A;  3AH8 B;  1YFQ A;  4O3U B;  5EAL A;  2I0S A;  1MG3 A;  5FKT A;  3MZL A;  3I2N A;  3I7K A;  3DXM C;  4GMB A;  3DSM A;  5FQD A;  4J8B A;  4ES0 A;  3OTT A;  4CZY A;  3RMZ D;  3VA6 A;  3I7N A;  4Y7R A;  1SHY B;  4J86 A;  4A7J A;  4JT6 C;  4A09 A;  3FM0 A;  2OK6 A;  3PE7 A;  5SXM A;  3NVQ A;  3HFQ A;  1Q47 A;  2OJY A;  5IT9 g;  3I8E A;  3UVM A;  5I5M A;  4PXW A;  4BH6 A;  4ERY A;  4JXM A;  2AQ5 A;  4JSN C;  1SQJ A;  2I3S A;  3MZK A;  5EM2 B;  3K26 A;  3EI4 A;  1OLZ A;  3OKT A;  4I79 A;  4CY3 A;  1OMW B;  3FGB A;  2IUQ A;  4FWW A;  3JZN A;  1GP2 B;  3MKS B;  3GFC A;  5GXH A;  2H9P A;  1GOT B;  3AFC A;  2Q7Q A;  3C99 A;  5EAM A;  4GM8 A;  2HKR A;  1K8K C;  3EI2 B;  4LG9 A;  2HXC A;  4D6V A;  3ULE C;  4ERQ A;  2CN3 A;  4K3J B;  3AL8 B;  5IJ7 E;  3V7D B;  1GXR A;  1K32 A;  5CXC A;  3EU7 A;  2CNX A;  3PSC B;  2J56 H;  2I0T A;  4O45 A;  4FA9 D;  1JJU B;  5TF2 A;  3RN1 D;  3SN6 B;  5EMM B;  5GXI A;  3SXT D;  1B9X A;  4G56 B;  3J80 g;  5TEE A;  4A11 B;  4BUJ C;  3OL2 A;  1PEV A;  4CI2 A;  3SMR A;  3I7O A;  4J84 A;  4CY1 A;  3B7F A;  1U2V C;  4AEZ A;  3KRW B;  4JSX C;  5EML B;  2J57 G;  1VYH C;  2BBK H;  2OVR B;  5CYK A;  2XYI A;  4FAN D;  2YNP A;  3ORV D;  1QNI A;  5TEF A;  4L9O A;  4TZ4 A;  3JZH A;  3RN0 D;  5FA5 B;  4LG8 A;  3AL9 A;  4R7A B;  4ZOY A;  3EI1 A;  4PSX B;  5HE2 B;  4A0A A;  3VH0 A;  2H6N A;  2W18 A;  2B4E A;  3V9F A;  5JWZ A;  1TYQ C;  4GQ2 P;  3KRX B;  3JB9 L;  5EMK B;  3I8C A;  2IUP A;  4U7A A;  5C2W B;  4O1Q D;  3I7L A;  3PSL A;  5CXB A;  4E5Z B;  3IIY A;  3UKU C;  2PBI B;  4XYH A;  3JPX A;  4J77 A;  5FKQ A;  3NVN A;  2XL3 A;  4QT8 A;  5IGO A;  4ZOV A;  3IKO A;  4E54 A;  3SFZ A;  3A0F A;  4J8G A;  1B9Y A;  4IA9 A;  2YBA A;  1L0Q A;  4CI1 A;  4JSV C;  2G9A A;  2XU7 A;  2P9P C;  4GGD A;  4CI8 A;  5C9Z B;  5FLX g;  3JAM g;  1PBY B;  4J81 A;  4A0B B;  5EAR A;  2AGX A;  3SBR A;  5AFU 3;  3UVK A;  4ZOZ A;  1MDA H;  4A08 B;  5GMK n;  3BWS A;  1NEX B;  3C75 H;  3OW8 A;  4XEI C;  5H17 A;  3CIK B;  4OWR A;  4YVD A;  2H14 A;  4ERZ A;  1MG2 A;  2H13 A;  3PXS D;  1P22 A;  4QQE A;  2B5M A;  4Y5R D;  4L1Q D;  3PXW D;  4GGA A;  4OZU A;  5FXY A;  3EI3 B;  3UR4 A;  3UVL A;  3SHF A;  5HE3 B;  2PM9 A;  2O9K A;  3MXX A; 
#chains in the Genus database with same CATH topology
 2CN2 A;  2UZX B;  2HKM A;  3OKY A;  3I7P A;  1PGU A;  2H9M A;  5E6S A;  3MMY A;  3L4M D;  4WJK A;  2YB8 B;  5M5U A;  4G1M A;  3EWE A;  4J82 A;  2CE9 A;  2IAA A;  3GRE A;  2YMU A;  3RFG A;  1N6F A;  3MKQ A;  2Z2P A;  4IMM A;  5M5R A;  3V4V A;  3UVO A;  1S4U X;  4H5I A;  3O4J A;  5HYN B;  3PVU B;  3IUL A;  4UI9 R;  4PC0 A;  2H6K A;  3FCU A;  4FA1 D;  5THA A;  2AH1 A;  4DNU A;  3IUR A;  4IRZ A;  1GOF A;  1N6E A;  3EMH A;  1XHM A;  5AMS A;  4U1E I;  3ZWL B;  1UOP A;  2AGZ A;  2MTA H;  4O3T B;  2TRC B;  2QC5 A;  4FB1 D;  2Z2N A;  3K72 A;  3IUM A;  3EQ7 A;  4QL1 A;  4BL0 A;  1TBG A;  1XKS A;  5IGQ A;  4A09 B;  3RFH A;  4UM9 A;  1GG2 B;  3E0C A;  4AX4 A;  4CZV A;  1H2Y A;  4BP8 A;  1GOH A;  2CO0 C;  2WQ8 A;  3PXT D;  2EBS A;  3V5W B;  4CZX A;  4A2L A;  2Z2O A;  4GZ8 A;  5K1C C;  2BCJ B;  4WK2 A;  3RLM D;  3DWL C;  4XYI A;  3W15 A;  4PNK B;  3ZE0 A;  3VI3 A;  2OVQ B;  5K19 A;  4AOW A;  3EI4 B;  2H3X A;  3I89 A;  2VDL A;  3IJE A;  4RE5 A;  4ESG A;  2P9U C;  4L3H D;  5EM2 A;  4FHL A;  3N0D A;  3IUN A;  3BG1 A;  2OK4 A;  4CY2 A;  4MK0 B;  3SWS D;  2PM7 B;  2VDN A;  3O4H A;  2I0R A;  3UKR C;  2HES X;  4JSP C;  5HE1 B;  2AGL A;  2B5L A;  4GM3 A;  4J73 A;  2H9N A;  2CO0 A;  1JMZ B;  4O2W A;  3ODT A;  5I5I A;  3CFV A;  4D9S A;  3EI2 A;  5CXC B;  4J87 A;  3J81 g;  2CE8 A;  2AGY A;  2IUR A;  4CI3 A;  2VDM A;  3T3M A;  3AL8 A;  4KFM B;  4GQB B;  2QZP A;  2H47 A;  2AGW A;  2HJ4 A;  1H2Z A;  4X3E A;  2AH0 A;  3RSE C;  5FKS A;  4NSX A;  2VDQ A;  1N6D A;  4O9D A;  2OVP B;  4GQ1 A;  1O6F A;  3JRP A;  2GC7 A;  3OL2 B;  4G1E A;  3JRO A;  3I7H A;  3SVW D;  3EQ9 A;  3SBP A;  4J78 A;  4CC9 A;  3SJL D;  2P9N C;  2P9K C;  2UZY B;  1PI6 A;  3NIF A;  2G99 A;  4A11 A;  2XZG A;  5FKR A;  4NEN A;  1XIP A;  2J55 H;  4NBM A;  1FWX A;  2IUV A;  4GGC A;  4RE6 A;  3ZE1 A;  2VZ3 A;  2H6Q A;  4N14 A;  3P4F A;  1RI6 A;  3VGZ A;  5CYK B;  5C2V B;  1VE6 A;  4EWR A;  4PSW B;  1C9I A;  1JMX B;  4UM8 A;  2HU7 A;  5A2Q g;  3SCY A;  3ZE2 A;  3K6S A;  5GSA A;  1VE7 A;  3MVD K;  3DXK C;  1JV2 A;  3EI1 B;  4K3I D;  2VZ1 A;  2XDW A;  4A0A B;  3F3F A;  1R5M A;  2YNN A;  3UVN A;  4AN1 A;  2B5N A;  5EAP A;  3L4O D;  2HYE A;  2EIB A;  4FAV D;  3NVX A;  4H5J A;  3K27 A;  3IVM A;  5CXB B;  3IJ1 A;  2XL2 A;  4X61 B;  4J79 A;  3PVW B;  1UOO A;  4X60 B;  1H2W A;  5HQG A;  3F3G A;  4FA5 D;  5HE0 B;  3IJC A;  4E5Z A;  4CY5 A;  4E54 B;  3IJ0 A;  4JT5 C;  4HDJ A;  4PBY A;  2I3T A;  3MUN A;  1UTC A;  3IIW A;  3IUQ A;  1A12 A;  3VI4 A;  1E8N A;  2YNO A;  4FA4 D;  5M5T A;  4D0K A;  4L3G D;  2P9I C;  5KDO B;  3OKW A;  2P9L C;  2P9S C;  2H68 A;  3DM0 A;  4ZN4 A;  4A0B A;  5B4W A;  2IWK A;  1K3I A;  4GM9 A;  3C5M A;  3SBQ A;  1U4C A;  4QRJ A;  1JOF A;  5TDH B;  4A08 A;  1SQ9 A;  4WK4 A;  3ZDX A;  2GNQ A;  3JZG A;  3N0E A;  3SLE D;  4LGN A;  5AJA A;  4ZOX A;  2QXV A;  2OIZ A;  3GC3 B;  1NR0 A;  3RRM C;  4O02 A;  2GC4 A;  4DNV A;  3U4Y A;  2PM9 B;  5IJ8 E;  3EI3 A;  3OKY B;  5IC7 A;  4A2M A;  3CFS B;  2PM6 B;  4X63 B;  3FRX A;  2IWF A;  2HJB A;  3EQ8 A;  4NC4 A;  3ZDY A;  5EMJ B;  4JD2 C;  1A0R B;  5H1M A;  4PBZ A;  4BP9 A;  3BG0 A;  1U8C A;  3C9C A;  5I5J A;  4J0W A;  4Z8L A;  2QR5 A;  4Z7N A;  1ERJ A;  5H14 A;  3EG6 A;  4J0X A;  3F3P A;  2H9L A;  1UOQ A;  4QAM A;  3AH8 B;  4Z7Q A;  4AMZ A;  1M1X A;  5HDB A;  1YFQ A;  4O3U B;  5EAL A;  2I0S A;  1MG3 A;  5FKT A;  3MZL A;  3I2N A;  3I7K A;  2HU8 A;  3DXM C;  4GMB A;  2VDR A;  3DSM A;  5FQD A;  4BCD A;  5E6R A;  4J8B A;  2EIE A;  4ES0 A;  3OTT A;  5FFO A;  1H2X A;  4CZY A;  4WK0 A;  3RMZ D;  1GOG A;  3VA6 A;  3I7N A;  4Y7R A;  3KCI A;  1SHY B;  4J86 A;  4BCC A;  5FFG A;  4A7J A;  4JT6 C;  4A09 A;  3FM0 A;  3GD1 I;  2OK6 A;  3PE7 A;  3ZDZ A;  5SXM A;  2VDP A;  3NVQ A;  3HFQ A;  1Q47 A;  2OJY A;  5IT9 g;  3I8E A;  3UVM A;  5I5M A;  4NAA A;  4PXW A;  4BH6 A;  2VDK A;  4ERY A;  4JXM A;  2AQ5 A;  4JSN C;  1SQJ A;  2I3S A;  3IUJ A;  3MZK A;  4MMZ A;  5EM2 B;  3K26 A;  1QFM A;  2BKL A;  2XE4 A;  3EI4 A;  1OLZ A;  4JHN A;  3OKT A;  4I79 A;  4CY3 A;  1OMW B;  3FGB A;  2IUQ A;  4FWW A;  3K71 A;  3JZN A;  1VZ2 A;  1GP2 B;  3MKS B;  3GFC A;  3FCS A;  5GXH A;  2H9P A;  1GOT B;  3AFC A;  2Q7Q A;  3C99 A;  3NID A;  5EAM A;  1I2M B;  4GM8 A;  2HKR A;  1K8K C;  3EI2 B;  4LG9 A;  2HXC A;  4Z7O A;  4D6V A;  3ULE C;  4ERQ A;  2CN3 A;  4K3J B;  3AL8 B;  5IJ7 E;  3V7D B;  1GXR A;  4MMY A;  1K32 A;  1BPO A;  5CXC A;  3EU7 A;  5E6U A;  2CNX A;  3PSC B;  2J56 H;  2I0T A;  4O45 A;  4FA9 D;  1JJU B;  5TF2 A;  3RN1 D;  3SN6 B;  5EMM B;  5GXI A;  3SXT D;  1B9X A;  5M61 A;  3V4P A;  4G56 B;  3J80 g;  5TEE A;  4A11 B;  4BUJ C;  1E5T A;  1PEV A;  3OL2 A;  4CI2 A;  3SMR A;  3I7O A;  4J84 A;  4CY1 A;  3B7F A;  4G55 A;  1U2V C;  4JHP C;  4AEZ A;  3KRW B;  4JSX C;  5EML B;  2J57 G;  1VYH C;  2BBK H;  2OVR B;  5CYK A;  2XYI A;  3QI0 A;  4AN0 A;  4FAN D;  2YNP A;  3ORV D;  1QNI A;  5TEF A;  4L9O A;  4TZ4 A;  3JZH A;  3RN0 D;  2EID A;  5FA5 B;  4LG8 A;  3AL9 A;  4R7A B;  4ZOY A;  3EI1 A;  4PSX B;  5HE2 B;  4A0A A;  3VH0 A;  1VZ3 A;  2H6N A;  2W18 A;  2B4E A;  3V9F A;  5JWZ A;  1TYQ C;  4GQ2 P;  3KRX B;  3JB9 L;  5EMK B;  3I8C A;  2IUP A;  4U7A A;  5C2W B;  4O1Q D;  3I7L A;  3PSL A;  5CXB A;  2VC2 A;  4E5Z B;  3IIY A;  5C86 A;  3UKU C;  2PBI B;  4XYH A;  2HU5 A;  1C9L A;  3JPX A;  4J77 A;  3O4G A;  5FKQ A;  3NVN A;  1QFS A;  2XL3 A;  2VDO A;  4QT8 A;  5IGO A;  4ZOV A;  3IKO A;  4E54 A;  1O6G A;  3SFZ A;  1JTD B;  3OF7 A;  3A0F A;  1TYE A;  1B9Y A;  4IA9 A;  4J8G A;  2YBA A;  1L0Q A;  4CI1 A;  5C92 A;  4JSV C;  1YR2 A;  2G9A A;  2XU7 A;  2P9P C;  4GGD A;  3DDU A;  4DNW A;  4CI8 A;  5C9Z B;  5FLX g;  3JAM g;  1PBY B;  4J81 A;  4A0B B;  5EAR A;  2AGX A;  5M5V A;  3SBR A;  4MMX A;  5AFU 3;  2JKX A;  3UVK A;  3NIG A;  4ZOZ A;  1MDA H;  2EIC A;  5GMK n;  4A08 B;  3QHY B;  3BWS A;  3MUO A;  1NEX B;  1T2X A;  3C75 H;  3OW8 A;  4XEI C;  4L1M A;  1E8M A;  5H17 A;  3CIK B;  4OWR A;  4YVD A;  5M5S A;  2H14 A;  4ERZ A;  1MG2 A;  2H13 A;  3PXS D;  1P22 A;  4QQE A;  2B5M A;  4Y5R D;  3O4I A;  3PXW D;  4L1Q D;  4GGA A;  4BCB A;  4OZU A;  5FXY A;  3EI3 B;  3UR4 A;  3UVL A;  3SHF A;  5HE3 B;  3T3P A;  2PM9 A;  1L5G A;  2O9K A;  3MXX A;  4AMY A; 
#chains in the Genus database with same CATH homology
 2CN2 A;  2UZX B;  2HKM A;  3OKY A;  3I7P A;  1PGU A;  2H9M A;  3MMY A;  3L4M D;  2YB8 B;  3EWE A;  4J82 A;  2CE9 A;  2IAA A;  2YMU A;  3GRE A;  3RFG A;  1N6F A;  3MKQ A;  2Z2P A;  4IMM A;  3UVO A;  1S4U X;  4H5I A;  5HYN B;  3PVU B;  4UI9 R;  4PC0 A;  2H6K A;  4FA1 D;  5THA A;  2AH1 A;  1N6E A;  3EMH A;  1XHM A;  5AMS A;  4U1E I;  3ZWL B;  2AGZ A;  2MTA H;  4O3T B;  2TRC B;  2QC5 A;  4FB1 D;  2Z2N A;  4QL1 A;  4BL0 A;  1TBG A;  1XKS A;  5IGQ A;  4A09 B;  3RFH A;  1GG2 B;  3E0C A;  4CZV A;  2CO0 C;  3PXT D;  2EBS A;  3V5W B;  4CZX A;  4A2L A;  2Z2O A;  4GZ8 A;  5K1C C;  2BCJ B;  3RLM D;  3DWL C;  4XYI A;  3W15 A;  4PNK B;  2OVQ B;  5K19 A;  4AOW A;  3EI4 B;  2H3X A;  3I89 A;  4ESG A;  2P9U C;  4L3H D;  5EM2 A;  4FHL A;  3N0D A;  3BG1 A;  2OK4 A;  4CY2 A;  4MK0 B;  3SWS D;  2PM7 B;  2I0R A;  3UKR C;  2HES X;  4JSP C;  5HE1 B;  2AGL A;  2B5L A;  4GM3 A;  4J73 A;  2H9N A;  2CO0 A;  1JMZ B;  3ODT A;  5I5I A;  3CFV A;  3EI2 A;  5CXC B;  4J87 A;  3J81 g;  2CE8 A;  2AGY A;  2IUR A;  4CI3 A;  3AL8 A;  4KFM B;  4GQB B;  2H47 A;  2AGW A;  2HJ4 A;  4X3E A;  2AH0 A;  3RSE C;  5FKS A;  4NSX A;  1N6D A;  4O9D A;  2OVP B;  4GQ1 A;  3JRP A;  2GC7 A;  3OL2 B;  3JRO A;  3I7H A;  3SVW D;  3SBP A;  4J78 A;  4CC9 A;  3SJL D;  2P9N C;  2P9K C;  2UZY B;  1PI6 A;  2G99 A;  4A11 A;  5FKR A;  1XIP A;  2J55 H;  1FWX A;  2IUV A;  4GGC A;  4N14 A;  2H6Q A;  3P4F A;  1RI6 A;  3VGZ A;  5CYK B;  5C2V B;  4EWR A;  4PSW B;  1JMX B;  5A2Q g;  3SCY A;  5GSA A;  3DXK C;  3EI1 B;  4K3I D;  4A0A B;  3F3F A;  1R5M A;  2YNN A;  3UVN A;  2B5N A;  5EAP A;  3L4O D;  2HYE A;  4FAV D;  3NVX A;  4H5J A;  3K27 A;  5CXB B;  3IJ1 A;  2XL2 A;  4X61 B;  4J79 A;  3PVW B;  4X60 B;  5HQG A;  3F3G A;  4FA5 D;  5HE0 B;  3IJC A;  4E5Z A;  4CY5 A;  4E54 B;  3IJ0 A;  4JT5 C;  4HDJ A;  4PBY A;  2I3T A;  3IIW A;  4FA4 D;  2YNO A;  4D0K A;  4L3G D;  2P9I C;  5KDO B;  3OKW A;  2P9L C;  2P9S C;  2H68 A;  3DM0 A;  4ZN4 A;  4A0B A;  5B4W A;  2IWK A;  4GM9 A;  3C5M A;  3SBQ A;  1U4C A;  4QRJ A;  1JOF A;  5TDH B;  4A08 A;  1SQ9 A;  2GNQ A;  3JZG A;  3N0E A;  3SLE D;  4LGN A;  5AJA A;  4ZOX A;  2QXV A;  2OIZ A;  1NR0 A;  3RRM C;  2GC4 A;  3U4Y A;  2PM9 B;  5IJ8 E;  3EI3 A;  3OKY B;  5IC7 A;  4A2M A;  3CFS B;  2PM6 B;  4X63 B;  3FRX A;  2IWF A;  2HJB A;  5EMJ B;  4JD2 C;  1A0R B;  5H1M A;  4PBZ A;  3BG0 A;  3C9C A;  5I5J A;  4J0W A;  4Z8L A;  1ERJ A;  5H14 A;  3EG6 A;  4J0X A;  3F3P A;  2H9L A;  3AH8 B;  1YFQ A;  4O3U B;  5EAL A;  2I0S A;  1MG3 A;  5FKT A;  3MZL A;  3I2N A;  3I7K A;  3DXM C;  4GMB A;  3DSM A;  5FQD A;  4J8B A;  4ES0 A;  3OTT A;  4CZY A;  3RMZ D;  3VA6 A;  3I7N A;  4Y7R A;  1SHY B;  4J86 A;  4A7J A;  4JT6 C;  4A09 A;  3FM0 A;  2OK6 A;  3PE7 A;  5SXM A;  3NVQ A;  3HFQ A;  1Q47 A;  2OJY A;  5IT9 g;  3I8E A;  3UVM A;  5I5M A;  4PXW A;  4BH6 A;  4ERY A;  4JXM A;  2AQ5 A;  4JSN C;  1SQJ A;  2I3S A;  3MZK A;  5EM2 B;  3K26 A;  3EI4 A;  1OLZ A;  3OKT A;  4I79 A;  4CY3 A;  1OMW B;  3FGB A;  2IUQ A;  4FWW A;  3JZN A;  1GP2 B;  3MKS B;  3GFC A;  5GXH A;  2H9P A;  1GOT B;  3AFC A;  2Q7Q A;  3C99 A;  5EAM A;  4GM8 A;  2HKR A;  1K8K C;  3EI2 B;  4LG9 A;  2HXC A;  4D6V A;  3ULE C;  4ERQ A;  2CN3 A;  4K3J B;  3AL8 B;  5IJ7 E;  3V7D B;  1GXR A;  1K32 A;  5CXC A;  3EU7 A;  2CNX A;  3PSC B;  2J56 H;  2I0T A;  4O45 A;  4FA9 D;  1JJU B;  5TF2 A;  3RN1 D;  3SN6 B;  5EMM B;  5GXI A;  3SXT D;  1B9X A;  4G56 B;  3J80 g;  5TEE A;  4A11 B;  4BUJ C;  3OL2 A;  1PEV A;  4CI2 A;  3SMR A;  3I7O A;  4J84 A;  4CY1 A;  3B7F A;  1U2V C;  4AEZ A;  3KRW B;  4JSX C;  5EML B;  2J57 G;  1VYH C;  2BBK H;  2OVR B;  5CYK A;  2XYI A;  4FAN D;  2YNP A;  3ORV D;  1QNI A;  5TEF A;  4L9O A;  4TZ4 A;  3JZH A;  3RN0 D;  5FA5 B;  4LG8 A;  3AL9 A;  4R7A B;  4ZOY A;  3EI1 A;  4PSX B;  5HE2 B;  4A0A A;  3VH0 A;  2H6N A;  2W18 A;  2B4E A;  3V9F A;  5JWZ A;  1TYQ C;  4GQ2 P;  3KRX B;  3JB9 L;  5EMK B;  3I8C A;  2IUP A;  4U7A A;  5C2W B;  4O1Q D;  3I7L A;  3PSL A;  5CXB A;  4E5Z B;  3IIY A;  3UKU C;  2PBI B;  4XYH A;  3JPX A;  4J77 A;  5FKQ A;  3NVN A;  2XL3 A;  4QT8 A;  5IGO A;  4ZOV A;  3IKO A;  4E54 A;  3SFZ A;  3A0F A;  4J8G A;  1B9Y A;  4IA9 A;  2YBA A;  1L0Q A;  4CI1 A;  4JSV C;  2G9A A;  2XU7 A;  2P9P C;  4GGD A;  4CI8 A;  5C9Z B;  5FLX g;  3JAM g;  1PBY B;  4J81 A;  4A0B B;  5EAR A;  2AGX A;  3SBR A;  5AFU 3;  3UVK A;  4ZOZ A;  1MDA H;  4A08 B;  5GMK n;  3BWS A;  1NEX B;  3C75 H;  3OW8 A;  4XEI C;  5H17 A;  3CIK B;  4OWR A;  4YVD A;  2H14 A;  4ERZ A;  1MG2 A;  2H13 A;  3PXS D;  1P22 A;  4QQE A;  2B5M A;  4Y5R D;  4L1Q D;  3PXW D;  4GGA A;  4OZU A;  5FXY A;  3EI3 B;  3UR4 A;  3UVL A;  3SHF A;  5HE3 B;  2PM9 A;  2O9K A;  3MXX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...