2H6NA

Histone h3 recognition and presentation by the wdr5 module of the mll1 complex
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
304
structure length
304
Chain Sequence
VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Histone H3 recognition and presentation by the WDR5 module of the MLL1 complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
molecule keywords WD-repeat protein 5
total genus 101
structure length 304
sequence length 304
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-05-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2h6nA00
5CXBB 3SFZA 4A11A 4AEZA 4XYHA 4X61B 2HKMA 4UI9R 5GMKn 4JT5C 4GQ2P 4ERZA 5EMJB 5KDOB 1JJUB 2B5NA 1OMWB 2W18A 4ZOVA 3PXWD 5I5MA 2MTAH 2H47A 2YNOA 3NVQA 3CFSB 2PM9B 4QT8A 3EI3B 4PSWB 3ODTA 2B5LA 4JSXC 1JMZB 4CI8A 2J55H 3IKOA 2H6NA 3SBRA 5EARA 4Y5RD 3IIYA 4K3JB 2H6KA 5FA5B 3SCYA 4J8BA 3IJCA 2PBIB 4ZOZA 1TYQC 1GOTB 1JOFA 2H14A 4IMMA 2BCJB 1P22A 4J82A 5CXCA 3I7PA 4FHLA 3RFGA 3UVMA 3SN6B 4EWRA 4JD2C 2HKRA 4QRJA 2B5MA 3JZHA 5HE3B 4GGDA 2P9PC 3VH0A 3UVKA 5IT9g 1SHYB 2I0SA 5IJ7E 1NR0A 1U2VC 2IAAA 1GXRA 3JRPA 2P9LC 5AFU3 2XL3A 4ZOXA 2HXCA 3FRXA 5IC7A 3W15A 4Y7RA 4CC9A 4N14A 1N6FA 3PXSD 1PBYB 2AGXA 1SQ9A 3MKSB 3SHFA 2P9SC 3B7FA 3F3PA 3OTTA 4J81A 3VA6A 4AOWA 2Z2OA 4CY3A 2OJYA 5EMLB 1L0QA 4ESGA 1Q47A 4O1QD 2OK4A 2AGZA 3PE7A 2IUPA 2AH1A 5B4WA 3FM0A 1XHMA 3JPXA 4CI3A 3F3FA 5H14A 3RN0D 2AQ5A 2HJ4A 3DXMC 1K32A 3RRMC 4O3TB 5IGOA 2XU7A 4D6VA 4J0XA 4HDJA 3JB9L 1GG2B 4PBZA 4X3EA 2TRCB 3ULEC 2H9MA 2H3XA 3MKQA 3EG6A 4JT6C 3PSLA 3K26A 3RSEC 4L3GD 2UZXB 3KRWB 3IJ1A 1U4CA 4J87A 5CXCB 2EBSA 2IWFA 2QXVA 5EAMA 4FAVD 4QQEA 5SXMA 2CO0A 5EM2A 3AL8B 2YB8B 2I3SA 4XEIC 2GC4A 5C2WB 3UVLA 2OVRB 4FA5D 3BG0A 3BWSA 3MXXA 3PVUB 1QNIA 1FWXA 3EI2B 4O9DA 4GGAA 1VYHC 4J84A 4H5JA 2HJBA 3F3GA 4GM3A 3SJLD 3OKWA 1TBGA 3J81g 3BG1A 3L4MD 4ZN4A 5FKQA 4JXMA 4J78A 2P9KC 3U4YA 4GQBB 1XKSA 4ES0A 3KRXB 4U7AA 4A11B 4YVDA 4A0AA 2IUQA 2AGLA 5HQGA 2IWKA 3JZGA 2AH0A 2YNNA 2P9IC 2HYEA 4OWRA 2IUVA 2J57G 4J86A 3FGBA 4A08B 4L3HD 5JWZA 3UKUC 3CFVA 5GXIA 4XYIA 4FA1D 3I8EA 5FKSA 2I0TA 4OZUA 2P9UC 5I5JA 3RN1D 3UVNA 3I7OA 3OKYB 5FQDA 4FB1D 3AFCA 2GNQA 4PBYA 1S4UX 4CY1A 5HE0B 3RFHA 5EMKB 1N6EA 3EI1B 3V7DB 5H17A 2Z2PA 5C9ZB 4GM8A 3AL9A 2YBAA 5A2Qg 3A0FA 4LG9A 4H5IA 3L4OD 1JMXB 4E54A 3NVXA 2I3TA 2XYIA 4A0AB 4TZ4A 5CYKB 5THAA 3MMYA 3C5MA 5FKRA 2OVPB 3AH8B 4Z8LA 4A0BA 5EAPA 2CNXA 2CO0C 5IJ8E 4PNKB 5K19A 1YFQA 3DXKC 3EU7A 4A08A 3JROA 5HE1B 1RI6A 4J73A 2UZYB 3HFQA 3RMZD 4A09A 4IA9A 4JSPC 4MK0B 3UR4A 3PSCB 1GP2B 4FAND 2AGWA 4PC0A 1PGUA 4E5ZB 3NVNA 1R5MA 4O45A 4R7AB 4GM9A 3DM0A 2H13A 2O9KA 3N0DA 2Q7QA 3EWEA 5H1MA 4J0WA 3I7HA 4LG8A 4O3UB 2GC7A 3EI4B 4LGNA 3MZLA 5EALA 3C75H 4X63B 2OIZA 3RLMD 3SVWD 5HYNB 3CIKB 2CN3A 5I5IA 3GFCA 5TDHB 2G99A 2CE8A 3SLED 3MZKA 2Z2NA 5TEFA 3DSMA 5C2VB 5TEEA 2H9NA 3SBPA 3AL8A 2PM6B 5EM2B 2B4EA 4CY2A 3ZWLB 4CY5A 4GMBA 4K3ID 5K1CC 2XL2A 1PI6A 4FA4D 5HE2B 2YMUA 4A2LA 4KFMB 2OK6A 4CZVA 4CI1A 5TF2A 4BL0A 5CYKA 1MDAH 3I2NA 5IGQA 3EI3A 3EI4A 3EMHA 2BBKH 3DWLC 4CZYA 3SMRA 5FKTA 4GGCA 2G9AA 3VGZA 3JAMg 1OLZA 2CN2A 3N0EA 4A7JA 4BH6A 2QC5A 4JSNC 4U1EI 4QL1A 5CXBA 5FXYA 5GSAA 4A0BB 3OW8A 4FWWA 4GZ8A 3K27A 4D0KA 3UKRC 4J79A 2H9PA 4A2MA 3OKTA 3JZNA 4FA9D 4ERYA 1ERJA 3GREA 3I7LA 3J80g 2YNPA 2HESX 1SQJA 4J77A 3IJ0A 4G56B 3I7NA 3EI1A 4E5ZA 3UVOA 4L9OA 2I0RA 1PEVA 1XIPA 4E54B 4BUJC 3IIWA 4A09B 3C9CA 3P4FA 5GXHA 5AMSA 2H68A 2PM9A 3E0CA 2CE9A 1A0RB 2PM7B 3V9FA 3OL2B 3ORVD 4ERQA 4L1QD 4PSXB 1MG2A 2H6QA 4NSXA 3EI2A 1B9YA 4J8GA 5EMMB 4JSVC 2P9NC 3OKYA 4PXWA 3SBQA 3SXTD 2IURA 1K8KC 3OL2A 4I79A 3PXTD 1NEXB 5AJAA 3I89A 2J56H 1N6DA 4X60B 4ZOYA 5FLXg 3I7KA 3I8CA 1B9XA 3SWSD 3V5WB 2OVQB 1MG3A 2H9LA 4CI2A 4CZXA 2AGYA 3C99A 3PVWB 4GQ1A
chains in the Genus database with same CATH superfamily
5CXBB 3SFZA 1A12A 4A11A 4AEZA 4XYHA 4X61B 2HKMA 4UI9R 5GMKn 4JT5C 4GQ2P 4ERZA 5EMJB 5KDOB 1JJUB 2B5NA 3EQ9A 1OMWB 4UM8A 1H2YA 2W18A 4ZOVA 3PXWD 5I5MA 2MTAH 2H47A 4Z7NA 2YNOA 3NVQA 3CFSB 2PM9B 2JKXA 4QT8A 3K71A 3EI3B 4PSWB 4MMYA 2EICA 3O4GA 3ODTA 2B5LA 4JSXC 5HDBA 1JMZB 4CI8A 2J55H 3IKOA 2H6NA 3SBRA 5EARA 2EIBA 4Y5RD 3IIYA 2VZ1A 4K3JB 2H6KA 5FA5B 4AMZA 3ZE0A 3SCYA 4J8BA 3IJCA 4NC4A 2PBIB 4ZOZA 1TYQC 1GOTB 4DNWA 1JOFA 3NIGA 2H14A 4IMMA 2BCJB 3IJEA 1P22A 4J82A 5CXCA 3I7PA 4MMZA 1K3IA 4FHLA 3RFGA 3UVMA 3SN6B 4EWRA 4JD2C 2HKRA 3IUMA 2B5MA 3NIFA 3JZHA 4QRJA 5HE3B 3K72A 4G55A 4GGDA 2P9PC 3NIDA 3VH0A 3UVKA 5IT9g 1SHYB 2I0SA 1L5GA 5IJ7E 1NR0A 1U2VC 2IAAA 1GXRA 3JRPA 2P9LC 5AFU3 2XL3A 2EIEA 4ZOXA 2HXCA 3FRXA 5IC7A 3W15A 4Y7RA 4CC9A 4N14A 1JV2A 1N6FA 3PXSD 1PBYB 2AGXA 1SQ9A 4WK2A 3MKSB 3SHFA 2P9SC 3B7FA 3F3PA 3OTTA 4J81A 3VA6A 4AOWA 2Z2OA 2VDRA 3EQ7A 4CY3A 2OJYA 5EMLB 1L0QA 4ESGA 1Q47A 4O1QD 2WQ8A 2OK4A 2AGZA 3PE7A 2IUPA 2AH1A 1GOFA 5B4WA 3FM0A 1XHMA 3JPXA 4G1EA 4CI3A 5M5VA 3F3FA 2VDLA 5H14A 3RN0D 1I2MB 2AQ5A 2HJ4A 1VZ2A 3DXMC 1K32A 3RRMC 5E6SA 5E6RA 4O3TB 5IGOA 2XU7A 4D6VA 4J0XA 4HDJA 3JB9L 1GG2B 4PBZA 4X3EA 2TRCB 3ULEC 2H9MA 2QR5A 2H3XA 3MKQA 3EG6A 4JT6C 3PSLA 3K26A 5M61A 3GC3B 5C92A 3RSEC 4L3GD 2UZXB 1M1XA 3KRWB 4WK4A 3OF7A 3IJ1A 4JHNA 2XDWA 3ZE1A 1U4CA 4J87A 3O4IA 5CXCB 4RE6A 4NBMA 3IUJA 3ZDYA 2EBSA 2BKLA 2IWFA 2QXVA 5EAMA 3T3PA 4FAVD 4QQEA 1C9LA 5SXMA 2CO0A 5EM2A 1UOQA 3AL8B 2YB8B 2I3SA 4XEIC 2GC4A 5C2WB 3MUNA 3UVLA 2OVRB 4FA5D 3BG0A 3BWSA 3MXXA 3PVUB 4O02A 1QNIA 1FWXA 3EI2B 4O9DA 4GGAA 1VYHC 2VZ3A 4J84A 5FFOA 4H5JA 2HJBA 3F3GA 4GM3A 3SJLD 3DDUA 1TBGA 3OKWA 3V4PA 3J81g 3BG1A 3L4MD 4NAAA 4ZN4A 5FKQA 3T3MA 1T2XA 3IURA 4JXMA 4J78A 2P9KC 3U4YA 4GQBB 1XKSA 4ES0A 3KRXB 4U7AA 4A11B 4YVDA 4G1MA 4A0AA 2IUQA 2AGLA 5HQGA 5M5UA 2IWKA 3JZGA 2AH0A 2VDMA 2XE4A 2YNNA 1JTDB 2P9IC 3KCIA 3ZE2A 2HYEA 4OWRA 2VDNA 2IUVA 2J57G 4J86A 3FGBA 4A08B 4L3HD 5JWZA 2HU5A 3UKUC 3CFVA 5GXIA 4XYIA 4BP9A 4FA1D 3I8EA 2VDPA 5FKSA 4WJKA 2I0TA 4OZUA 1E8MA 2P9UC 1TYEA 4AN1A 5I5JA 3RN1D 1VE7A 3UVNA 4Z7OA 3I7OA 3OKYB 3V4VA 4IRZA 4BP8A 5FQDA 4FB1D 3AFCA 5M5RA 2GNQA 4PBYA 1S4UX 4CY1A 5HE0B 3RFHA 5EMKB 1QFMA 1N6EA 3EI1B 3V7DB 5H17A 2Z2PA 5C9ZB 4GM8A 3AL9A 3ZDZA 2YBAA 5A2Qg 3A0FA 4BCBA 5E6UA 4LG9A 4H5IA 3L4OD 1JMXB 4E54A 3NVXA 2I3TA 2XYIA 4A0AB 4TZ4A 5CYKB 5THAA 3MMYA 3C5MA 5FKRA 1UOPA 1GOGA 2OVPB 3AH8B 4L1MA 4Z8LA 4A0BA 5EAPA 4Z7QA 2CNXA 2CO0C 5IJ8E 4PNKB 5K19A 3VI4A 1YFQA 3DXKC 3EU7A 4A08A 3JROA 5HE1B 1RI6A 4J73A 3IVMA 2UZYB 3HFQA 3RMZD 4A09A 4IA9A 4JSPC 4GQ1A 4MK0B 3PSCB 3UR4A 1GP2B 4FAND 2AGWA 4PC0A 1PGUA 4E5ZB 3NVNA 1R5MA 4O45A 4R7AB 2HU8A 4GM9A 4D9SA 4DNUA 3DM0A 2H13A 1H2ZA 2O9KA 3N0DA 2Q7QA 3EWEA 5H1MA 4J0WA 4BCDA 3I7HA 4LG8A 4O3UB 3O4JA 4UM9A 2VDKA 2GC7A 3EI4B 1H2WA 4LGNA 4AMYA 3MZLA 5EALA 1VE6A 3C75H 2HU7A 4X63B 2OIZA 3RLMD 3SVWD 5HYNB 3CIKB 4O2WA 3GD1I 2CN3A 5I5IA 3O4HA 3GFCA 5TDHB 3MVDK 4JHPC 2G99A 2CE8A 3SLED 1VZ3A 3MZKA 2Z2NA 5TEFA 3DSMA 5C2VB 4BCCA 5TEEA 4AN0A 2H9NA 3SBPA 3AL8A 2PM6B 5EM2B 2B4EA 4CY2A 3ZWLB 4CY5A 4GMBA 4K3ID 3MUOA 5K1CC 2XL2A 1PI6A 4FA4D 5HE2B 2YMUA 5M5TA 4A2LA 4KFMB 2OK6A 3IUQA 4CZVA 4CI1A 1UOOA 5TF2A 4BL0A 5CYKA 1H2XA 1MDAH 3I2NA 5IGQA 3EI3A 5M5SA 3EI4A 3EMHA 2BBKH 4MMXA 3DWLC 4CZYA 3SMRA 3FCUA 5FKTA 4GGCA 2G9AA 3VGZA 3JAMg 1OLZA 2CN2A 1GOHA 3IULA 1E5TA 3N0EA 4A7JA 4BH6A 2QC5A 4JSNC 2XZGA 4U1EI 4QL1A 5CXBA 5FXYA 5GSAA 4A0BB 3OW8A 4FWWA 4GZ8A 3K27A 4D0KA 2VDQA 3UKRC 4J79A 2H9PA 4A2MA 3OKTA 3JZNA 3VI3A 4FA9D 4ERYA 1ERJA 3GREA 2VDOA 4DNVA 3I7LA 3J80g 2YNPA 3ZDXA 2HESX 1SQJA 4J77A 1YR2A 3IJ0A 3QI0A 4G56B 3I7NA 3EI1A 4RE5A 3EQ8A 4E5ZA 3UVOA 2EIDA 4L9OA 2I0RA 1PEVA 1XIPA 4E54B 4BUJC 3IIWA 4A09B 3C9CA 3P4FA 5C86A 5GXHA 5AMSA 2H68A 2QZPA 2PM9A 3E0CA 2CE9A 1A0RB 2PM7B 3V9FA 3OL2B 1QFSA 3ORVD 4ERQA 4L1QD 4PSXB 1BPOA 1U8CA 1MG2A 1UTCA 5FFGA 2H6QA 4NSXA 3EI2A 1B9YA 3QHYB 4J8GA 5EMMB 4JSVC 4QAMA 2P9NC 3OKYA 4PXWA 3SBQA 1E8NA 3SXTD 2IURA 1K8KC 3OL2A 1O6GA 3FCSA 4I79A 3PXTD 1NEXB 5AJAA 3I89A 2VC2A 2J56H 3K6SA 1N6DA 4X60B 4ZOYA 5FLXg 3I7KA 4WK0A 3I8CA 4NENA 1B9XA 3SWSD 3V5WB 2OVQB 1MG3A 2H9LA 4CI2A 4CZXA 2AGYA 3IUNA 3C99A 4AX4A 3PVWB 1O6FA 1C9IA
chains in the Genus database with same CATH topology
5CXBB 3SFZA 4A11A 4AEZA 4XYHA 4X61B 2HKMA 4UI9R 5GMKn 4JT5C 4GQ2P 4ERZA 5EMJB 5KDOB 1JJUB 2B5NA 1OMWB 2W18A 4ZOVA 3PXWD 5I5MA 2MTAH 2H47A 2YNOA 3NVQA 3CFSB 2PM9B 4QT8A 3EI3B 4PSWB 3ODTA 2B5LA 4JSXC 1JMZB 4CI8A 2J55H 3IKOA 2H6NA 3SBRA 5EARA 4Y5RD 3IIYA 4K3JB 2H6KA 5FA5B 3SCYA 4J8BA 3IJCA 2PBIB 4ZOZA 1TYQC 1GOTB 1JOFA 2H14A 4IMMA 2BCJB 1P22A 4J82A 5CXCA 3I7PA 4FHLA 3RFGA 3UVMA 3SN6B 4EWRA 4JD2C 2HKRA 4QRJA 2B5MA 3JZHA 5HE3B 4GGDA 2P9PC 3VH0A 3UVKA 5IT9g 1SHYB 2I0SA 5IJ7E 1NR0A 1U2VC 2IAAA 1GXRA 3JRPA 2P9LC 5AFU3 2XL3A 4ZOXA 2HXCA 3FRXA 5IC7A 3W15A 4Y7RA 4CC9A 4N14A 1N6FA 3PXSD 1PBYB 2AGXA 1SQ9A 3MKSB 3SHFA 2P9SC 3B7FA 3F3PA 3OTTA 4J81A 3VA6A 4AOWA 2Z2OA 4CY3A 2OJYA 5EMLB 1L0QA 4ESGA 1Q47A 4O1QD 2OK4A 2AGZA 3PE7A 2IUPA 2AH1A 5B4WA 3FM0A 1XHMA 3JPXA 4CI3A 3F3FA 5H14A 3RN0D 2AQ5A 2HJ4A 3DXMC 1K32A 3RRMC 4O3TB 5IGOA 2XU7A 4D6VA 4J0XA 4HDJA 3JB9L 1GG2B 4PBZA 4X3EA 2TRCB 3ULEC 2H9MA 2H3XA 3MKQA 3EG6A 4JT6C 3PSLA 3K26A 3RSEC 4L3GD 2UZXB 3KRWB 3IJ1A 1U4CA 4J87A 5CXCB 2EBSA 2IWFA 2QXVA 5EAMA 4FAVD 4QQEA 5SXMA 2CO0A 5EM2A 3AL8B 2YB8B 2I3SA 4XEIC 2GC4A 5C2WB 3UVLA 2OVRB 4FA5D 3BG0A 3BWSA 3MXXA 3PVUB 1QNIA 1FWXA 3EI2B 4O9DA 4GGAA 1VYHC 4J84A 4H5JA 2HJBA 3F3GA 4GM3A 3SJLD 3OKWA 1TBGA 3J81g 3BG1A 3L4MD 4ZN4A 5FKQA 4JXMA 4J78A 2P9KC 3U4YA 4GQBB 1XKSA 4ES0A 3KRXB 4U7AA 4A11B 4YVDA 4A0AA 2IUQA 2AGLA 5HQGA 2IWKA 3JZGA 2AH0A 2YNNA 2P9IC 2HYEA 4OWRA 2IUVA 2J57G 4J86A 3FGBA 4A08B 4L3HD 5JWZA 3UKUC 3CFVA 5GXIA 4XYIA 4FA1D 3I8EA 5FKSA 2I0TA 4OZUA 2P9UC 5I5JA 3RN1D 3UVNA 3I7OA 3OKYB 5FQDA 4FB1D 3AFCA 2GNQA 4PBYA 1S4UX 4CY1A 5HE0B 3RFHA 5EMKB 1N6EA 3EI1B 3V7DB 5H17A 2Z2PA 5C9ZB 4GM8A 3AL9A 2YBAA 5A2Qg 3A0FA 4LG9A 4H5IA 3L4OD 1JMXB 4E54A 3NVXA 2I3TA 2XYIA 4A0AB 4TZ4A 5CYKB 5THAA 3MMYA 3C5MA 5FKRA 2OVPB 3AH8B 4Z8LA 4A0BA 5EAPA 2CNXA 2CO0C 5IJ8E 4PNKB 5K19A 1YFQA 3DXKC 3EU7A 4A08A 3JROA 5HE1B 1RI6A 4J73A 2UZYB 3HFQA 3RMZD 4A09A 4IA9A 4JSPC 4MK0B 3UR4A 3PSCB 1GP2B 4FAND 2AGWA 4PC0A 1PGUA 4E5ZB 3NVNA 1R5MA 4O45A 4R7AB 4GM9A 3DM0A 2H13A 2O9KA 3N0DA 2Q7QA 3EWEA 5H1MA 4J0WA 3I7HA 4LG8A 4O3UB 2GC7A 3EI4B 4LGNA 3MZLA 5EALA 3C75H 4X63B 2OIZA 3RLMD 3SVWD 5HYNB 3CIKB 2CN3A 5I5IA 3GFCA 5TDHB 2G99A 2CE8A 3SLED 3MZKA 2Z2NA 5TEFA 3DSMA 5C2VB 5TEEA 2H9NA 3SBPA 3AL8A 2PM6B 5EM2B 2B4EA 4CY2A 3ZWLB 4CY5A 4GMBA 4K3ID 5K1CC 2XL2A 1PI6A 4FA4D 5HE2B 2YMUA 4A2LA 4KFMB 2OK6A 4CZVA 4CI1A 5TF2A 4BL0A 5CYKA 1MDAH 3I2NA 5IGQA 3EI3A 3EI4A 3EMHA 2BBKH 3DWLC 4CZYA 3SMRA 5FKTA 4GGCA 2G9AA 3VGZA 3JAMg 1OLZA 2CN2A 3N0EA 4A7JA 4BH6A 2QC5A 4JSNC 4U1EI 4QL1A 5CXBA 5FXYA 5GSAA 4A0BB 3OW8A 4FWWA 4GZ8A 3K27A 4D0KA 3UKRC 4J79A 2H9PA 4A2MA 3OKTA 3JZNA 4FA9D 4ERYA 1ERJA 3GREA 3I7LA 3J80g 2YNPA 2HESX 1SQJA 4J77A 3IJ0A 4G56B 3I7NA 3EI1A 4E5ZA 3UVOA 4L9OA 2I0RA 1PEVA 1XIPA 4E54B 4BUJC 3IIWA 4A09B 3C9CA 3P4FA 5GXHA 5AMSA 2H68A 2PM9A 3E0CA 2CE9A 1A0RB 2PM7B 3V9FA 3OL2B 3ORVD 4ERQA 4L1QD 4PSXB 1MG2A 2H6QA 4NSXA 3EI2A 1B9YA 4J8GA 5EMMB 4JSVC 2P9NC 3OKYA 4PXWA 3SBQA 3SXTD 2IURA 1K8KC 3OL2A 4I79A 3PXTD 1NEXB 5AJAA 3I89A 2J56H 1N6DA 4X60B 4ZOYA 5FLXg 3I7KA 3I8CA 1B9XA 3SWSD 3V5WB 2OVQB 1MG3A 2H9LA 4CI2A 4CZXA 2AGYA 3C99A 3PVWB 4GQ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CXB B;  3SFZ A;  4A11 A;  4AEZ A;  4XYH A;  4X61 B;  2HKM A;  4UI9 R;  5GMK n;  4JT5 C;  4GQ2 P;  4ERZ A;  5EMJ B;  5KDO B;  1JJU B;  2B5N A;  1OMW B;  2W18 A;  4ZOV A;  3PXW D;  5I5M A;  2MTA H;  2H47 A;  2YNO A;  3NVQ A;  3CFS B;  2PM9 B;  4QT8 A;  3EI3 B;  4PSW B;  3ODT A;  2B5L A;  4JSX C;  1JMZ B;  4CI8 A;  2J55 H;  3IKO A;  2H6N A;  3SBR A;  5EAR A;  4Y5R D;  3IIY A;  4K3J B;  2H6K A;  5FA5 B;  3SCY A;  4J8B A;  3IJC A;  2PBI B;  4ZOZ A;  1TYQ C;  1GOT B;  1JOF A;  2H14 A;  4IMM A;  2BCJ B;  1P22 A;  4J82 A;  5CXC A;  3I7P A;  4FHL A;  3RFG A;  3UVM A;  3SN6 B;  4EWR A;  4JD2 C;  2HKR A;  4QRJ A;  2B5M A;  3JZH A;  5HE3 B;  4GGD A;  2P9P C;  3VH0 A;  3UVK A;  5IT9 g;  1SHY B;  2I0S A;  5IJ7 E;  1NR0 A;  1U2V C;  2IAA A;  1GXR A;  3JRP A;  2P9L C;  5AFU 3;  2XL3 A;  4ZOX A;  2HXC A;  3FRX A;  5IC7 A;  3W15 A;  4Y7R A;  4CC9 A;  4N14 A;  1N6F A;  3PXS D;  1PBY B;  2AGX A;  1SQ9 A;  3MKS B;  3SHF A;  2P9S C;  3B7F A;  3F3P A;  3OTT A;  4J81 A;  3VA6 A;  4AOW A;  2Z2O A;  4CY3 A;  2OJY A;  5EML B;  1L0Q A;  4ESG A;  1Q47 A;  4O1Q D;  2OK4 A;  2AGZ A;  3PE7 A;  2IUP A;  2AH1 A;  5B4W A;  3FM0 A;  1XHM A;  3JPX A;  4CI3 A;  3F3F A;  5H14 A;  3RN0 D;  2AQ5 A;  2HJ4 A;  3DXM C;  1K32 A;  3RRM C;  4O3T B;  5IGO A;  2XU7 A;  4D6V A;  4J0X A;  4HDJ A;  3JB9 L;  1GG2 B;  4PBZ A;  4X3E A;  2TRC B;  3ULE C;  2H9M A;  2H3X A;  3MKQ A;  3EG6 A;  4JT6 C;  3PSL A;  3K26 A;  3RSE C;  4L3G D;  2UZX B;  3KRW B;  3IJ1 A;  1U4C A;  4J87 A;  5CXC B;  2EBS A;  2IWF A;  2QXV A;  5EAM A;  4FAV D;  4QQE A;  5SXM A;  2CO0 A;  5EM2 A;  3AL8 B;  2YB8 B;  2I3S A;  4XEI C;  2GC4 A;  5C2W B;  3UVL A;  2OVR B;  4FA5 D;  3BG0 A;  3BWS A;  3MXX A;  3PVU B;  1QNI A;  1FWX A;  3EI2 B;  4O9D A;  4GGA A;  1VYH C;  4J84 A;  4H5J A;  2HJB A;  3F3G A;  4GM3 A;  3SJL D;  3OKW A;  1TBG A;  3J81 g;  3BG1 A;  3L4M D;  4ZN4 A;  5FKQ A;  4JXM A;  4J78 A;  2P9K C;  3U4Y A;  4GQB B;  1XKS A;  4ES0 A;  3KRX B;  4U7A A;  4A11 B;  4YVD A;  4A0A A;  2IUQ A;  2AGL A;  5HQG A;  2IWK A;  3JZG A;  2AH0 A;  2YNN A;  2P9I C;  2HYE A;  4OWR A;  2IUV A;  2J57 G;  4J86 A;  3FGB A;  4A08 B;  4L3H D;  5JWZ A;  3UKU C;  3CFV A;  5GXI A;  4XYI A;  4FA1 D;  3I8E A;  5FKS A;  2I0T A;  4OZU A;  2P9U C;  5I5J A;  3RN1 D;  3UVN A;  3I7O A;  3OKY B;  5FQD A;  4FB1 D;  3AFC A;  2GNQ A;  4PBY A;  1S4U X;  4CY1 A;  5HE0 B;  3RFH A;  5EMK B;  1N6E A;  3EI1 B;  3V7D B;  5H17 A;  2Z2P A;  5C9Z B;  4GM8 A;  3AL9 A;  2YBA A;  5A2Q g;  3A0F A;  4LG9 A;  4H5I A;  3L4O D;  1JMX B;  4E54 A;  3NVX A;  2I3T A;  2XYI A;  4A0A B;  4TZ4 A;  5CYK B;  5THA A;  3MMY A;  3C5M A;  5FKR A;  2OVP B;  3AH8 B;  4Z8L A;  4A0B A;  5EAP A;  2CNX A;  2CO0 C;  5IJ8 E;  4PNK B;  5K19 A;  1YFQ A;  3DXK C;  3EU7 A;  4A08 A;  3JRO A;  5HE1 B;  1RI6 A;  4J73 A;  2UZY B;  3HFQ A;  3RMZ D;  4A09 A;  4IA9 A;  4JSP C;  4MK0 B;  3UR4 A;  3PSC B;  1GP2 B;  4FAN D;  2AGW A;  4PC0 A;  1PGU A;  4E5Z B;  3NVN A;  1R5M A;  4O45 A;  4R7A B;  4GM9 A;  3DM0 A;  2H13 A;  2O9K A;  3N0D A;  2Q7Q A;  3EWE A;  5H1M A;  4J0W A;  3I7H A;  4LG8 A;  4O3U B;  2GC7 A;  3EI4 B;  4LGN A;  3MZL A;  5EAL A;  3C75 H;  4X63 B;  2OIZ A;  3RLM D;  3SVW D;  5HYN B;  3CIK B;  2CN3 A;  5I5I A;  3GFC A;  5TDH B;  2G99 A;  2CE8 A;  3SLE D;  3MZK A;  2Z2N A;  5TEF A;  3DSM A;  5C2V B;  5TEE A;  2H9N A;  3SBP A;  3AL8 A;  2PM6 B;  5EM2 B;  2B4E A;  4CY2 A;  3ZWL B;  4CY5 A;  4GMB A;  4K3I D;  5K1C C;  2XL2 A;  1PI6 A;  4FA4 D;  5HE2 B;  2YMU A;  4A2L A;  4KFM B;  2OK6 A;  4CZV A;  4CI1 A;  5TF2 A;  4BL0 A;  5CYK A;  1MDA H;  3I2N A;  5IGQ A;  3EI3 A;  3EI4 A;  3EMH A;  2BBK H;  3DWL C;  4CZY A;  3SMR A;  5FKT A;  4GGC A;  2G9A A;  3VGZ A;  3JAM g;  1OLZ A;  2CN2 A;  3N0E A;  4A7J A;  4BH6 A;  2QC5 A;  4JSN C;  4U1E I;  4QL1 A;  5CXB A;  5FXY A;  5GSA A;  4A0B B;  3OW8 A;  4FWW A;  4GZ8 A;  3K27 A;  4D0K A;  3UKR C;  4J79 A;  2H9P A;  4A2M A;  3OKT A;  3JZN A;  4FA9 D;  4ERY A;  1ERJ A;  3GRE A;  3I7L A;  3J80 g;  2YNP A;  2HES X;  1SQJ A;  4J77 A;  3IJ0 A;  4G56 B;  3I7N A;  3EI1 A;  4E5Z A;  3UVO A;  4L9O A;  2I0R A;  1PEV A;  1XIP A;  4E54 B;  4BUJ C;  3IIW A;  4A09 B;  3C9C A;  3P4F A;  5GXH A;  5AMS A;  2H68 A;  2PM9 A;  3E0C A;  2CE9 A;  1A0R B;  2PM7 B;  3V9F A;  3OL2 B;  3ORV D;  4ERQ A;  4L1Q D;  4PSX B;  1MG2 A;  2H6Q A;  4NSX A;  3EI2 A;  1B9Y A;  4J8G A;  5EMM B;  4JSV C;  2P9N C;  3OKY A;  4PXW A;  3SBQ A;  3SXT D;  2IUR A;  1K8K C;  3OL2 A;  4I79 A;  3PXT D;  1NEX B;  5AJA A;  3I89 A;  2J56 H;  1N6D A;  4X60 B;  4ZOY A;  5FLX g;  3I7K A;  3I8C A;  1B9X A;  3SWS D;  3V5W B;  2OVQ B;  1MG3 A;  2H9L A;  4CI2 A;  4CZX A;  2AGY A;  3C99 A;  3PVW B;  4GQ1 A; 
#chains in the Genus database with same CATH topology
 5CXB B;  3SFZ A;  1A12 A;  4A11 A;  4AEZ A;  4XYH A;  4X61 B;  2HKM A;  4UI9 R;  5GMK n;  4JT5 C;  4GQ2 P;  4ERZ A;  5EMJ B;  5KDO B;  1JJU B;  2B5N A;  3EQ9 A;  1OMW B;  4UM8 A;  1H2Y A;  2W18 A;  4ZOV A;  3PXW D;  5I5M A;  2MTA H;  2H47 A;  4Z7N A;  2YNO A;  3NVQ A;  3CFS B;  2PM9 B;  2JKX A;  4QT8 A;  3K71 A;  3EI3 B;  4PSW B;  4MMY A;  2EIC A;  3O4G A;  3ODT A;  2B5L A;  4JSX C;  5HDB A;  1JMZ B;  4CI8 A;  2J55 H;  3IKO A;  2H6N A;  3SBR A;  5EAR A;  2EIB A;  4Y5R D;  3IIY A;  2VZ1 A;  4K3J B;  2H6K A;  5FA5 B;  4AMZ A;  3ZE0 A;  3SCY A;  4J8B A;  3IJC A;  4NC4 A;  2PBI B;  4ZOZ A;  1TYQ C;  1GOT B;  4DNW A;  1JOF A;  3NIG A;  2H14 A;  4IMM A;  2BCJ B;  3IJE A;  1P22 A;  4J82 A;  5CXC A;  3I7P A;  4MMZ A;  1K3I A;  4FHL A;  3RFG A;  3UVM A;  3SN6 B;  4EWR A;  4JD2 C;  2HKR A;  3IUM A;  2B5M A;  3NIF A;  3JZH A;  4QRJ A;  5HE3 B;  3K72 A;  4G55 A;  4GGD A;  2P9P C;  3NID A;  3VH0 A;  3UVK A;  5IT9 g;  1SHY B;  2I0S A;  1L5G A;  5IJ7 E;  1NR0 A;  1U2V C;  2IAA A;  1GXR A;  3JRP A;  2P9L C;  5AFU 3;  2XL3 A;  2EIE A;  4ZOX A;  2HXC A;  3FRX A;  5IC7 A;  3W15 A;  4Y7R A;  4CC9 A;  4N14 A;  1JV2 A;  1N6F A;  3PXS D;  1PBY B;  2AGX A;  1SQ9 A;  4WK2 A;  3MKS B;  3SHF A;  2P9S C;  3B7F A;  3F3P A;  3OTT A;  4J81 A;  3VA6 A;  4AOW A;  2Z2O A;  2VDR A;  3EQ7 A;  4CY3 A;  2OJY A;  5EML B;  1L0Q A;  4ESG A;  1Q47 A;  4O1Q D;  2WQ8 A;  2OK4 A;  2AGZ A;  3PE7 A;  2IUP A;  2AH1 A;  1GOF A;  5B4W A;  3FM0 A;  1XHM A;  3JPX A;  4G1E A;  4CI3 A;  5M5V A;  3F3F A;  2VDL A;  5H14 A;  3RN0 D;  1I2M B;  2AQ5 A;  2HJ4 A;  1VZ2 A;  3DXM C;  1K32 A;  3RRM C;  5E6S A;  5E6R A;  4O3T B;  5IGO A;  2XU7 A;  4D6V A;  4J0X A;  4HDJ A;  3JB9 L;  1GG2 B;  4PBZ A;  4X3E A;  2TRC B;  3ULE C;  2H9M A;  2QR5 A;  2H3X A;  3MKQ A;  3EG6 A;  4JT6 C;  3PSL A;  3K26 A;  5M61 A;  3GC3 B;  5C92 A;  3RSE C;  4L3G D;  2UZX B;  1M1X A;  3KRW B;  4WK4 A;  3OF7 A;  3IJ1 A;  4JHN A;  2XDW A;  3ZE1 A;  1U4C A;  4J87 A;  3O4I A;  5CXC B;  4RE6 A;  4NBM A;  3IUJ A;  3ZDY A;  2EBS A;  2BKL A;  2IWF A;  2QXV A;  5EAM A;  3T3P A;  4FAV D;  4QQE A;  1C9L A;  5SXM A;  2CO0 A;  5EM2 A;  1UOQ A;  3AL8 B;  2YB8 B;  2I3S A;  4XEI C;  2GC4 A;  5C2W B;  3MUN A;  3UVL A;  2OVR B;  4FA5 D;  3BG0 A;  3BWS A;  3MXX A;  3PVU B;  4O02 A;  1QNI A;  1FWX A;  3EI2 B;  4O9D A;  4GGA A;  1VYH C;  2VZ3 A;  4J84 A;  5FFO A;  4H5J A;  2HJB A;  3F3G A;  4GM3 A;  3SJL D;  3DDU A;  1TBG A;  3OKW A;  3V4P A;  3J81 g;  3BG1 A;  3L4M D;  4NAA A;  4ZN4 A;  5FKQ A;  3T3M A;  1T2X A;  3IUR A;  4JXM A;  4J78 A;  2P9K C;  3U4Y A;  4GQB B;  1XKS A;  4ES0 A;  3KRX B;  4U7A A;  4A11 B;  4YVD A;  4G1M A;  4A0A A;  2IUQ A;  2AGL A;  5HQG A;  5M5U A;  2IWK A;  3JZG A;  2AH0 A;  2VDM A;  2XE4 A;  2YNN A;  1JTD B;  2P9I C;  3KCI A;  3ZE2 A;  2HYE A;  4OWR A;  2VDN A;  2IUV A;  2J57 G;  4J86 A;  3FGB A;  4A08 B;  4L3H D;  5JWZ A;  2HU5 A;  3UKU C;  3CFV A;  5GXI A;  4XYI A;  4BP9 A;  4FA1 D;  3I8E A;  2VDP A;  5FKS A;  4WJK A;  2I0T A;  4OZU A;  1E8M A;  2P9U C;  1TYE A;  4AN1 A;  5I5J A;  3RN1 D;  1VE7 A;  3UVN A;  4Z7O A;  3I7O A;  3OKY B;  3V4V A;  4IRZ A;  4BP8 A;  5FQD A;  4FB1 D;  3AFC A;  5M5R A;  2GNQ A;  4PBY A;  1S4U X;  4CY1 A;  5HE0 B;  3RFH A;  5EMK B;  1QFM A;  1N6E A;  3EI1 B;  3V7D B;  5H17 A;  2Z2P A;  5C9Z B;  4GM8 A;  3AL9 A;  3ZDZ A;  2YBA A;  5A2Q g;  3A0F A;  4BCB A;  5E6U A;  4LG9 A;  4H5I A;  3L4O D;  1JMX B;  4E54 A;  3NVX A;  2I3T A;  2XYI A;  4A0A B;  4TZ4 A;  5CYK B;  5THA A;  3MMY A;  3C5M A;  5FKR A;  1UOP A;  1GOG A;  2OVP B;  3AH8 B;  4L1M A;  4Z8L A;  4A0B A;  5EAP A;  4Z7Q A;  2CNX A;  2CO0 C;  5IJ8 E;  4PNK B;  5K19 A;  3VI4 A;  1YFQ A;  3DXK C;  3EU7 A;  4A08 A;  3JRO A;  5HE1 B;  1RI6 A;  4J73 A;  3IVM A;  2UZY B;  3HFQ A;  3RMZ D;  4A09 A;  4IA9 A;  4JSP C;  4GQ1 A;  4MK0 B;  3PSC B;  3UR4 A;  1GP2 B;  4FAN D;  2AGW A;  4PC0 A;  1PGU A;  4E5Z B;  3NVN A;  1R5M A;  4O45 A;  4R7A B;  2HU8 A;  4GM9 A;  4D9S A;  4DNU A;  3DM0 A;  2H13 A;  1H2Z A;  2O9K A;  3N0D A;  2Q7Q A;  3EWE A;  5H1M A;  4J0W A;  4BCD A;  3I7H A;  4LG8 A;  4O3U B;  3O4J A;  4UM9 A;  2VDK A;  2GC7 A;  3EI4 B;  1H2W A;  4LGN A;  4AMY A;  3MZL A;  5EAL A;  1VE6 A;  3C75 H;  2HU7 A;  4X63 B;  2OIZ A;  3RLM D;  3SVW D;  5HYN B;  3CIK B;  4O2W A;  3GD1 I;  2CN3 A;  5I5I A;  3O4H A;  3GFC A;  5TDH B;  3MVD K;  4JHP C;  2G99 A;  2CE8 A;  3SLE D;  1VZ3 A;  3MZK A;  2Z2N A;  5TEF A;  3DSM A;  5C2V B;  4BCC A;  5TEE A;  4AN0 A;  2H9N A;  3SBP A;  3AL8 A;  2PM6 B;  5EM2 B;  2B4E A;  4CY2 A;  3ZWL B;  4CY5 A;  4GMB A;  4K3I D;  3MUO A;  5K1C C;  2XL2 A;  1PI6 A;  4FA4 D;  5HE2 B;  2YMU A;  5M5T A;  4A2L A;  4KFM B;  2OK6 A;  3IUQ A;  4CZV A;  4CI1 A;  1UOO A;  5TF2 A;  4BL0 A;  5CYK A;  1H2X A;  1MDA H;  3I2N A;  5IGQ A;  3EI3 A;  5M5S A;  3EI4 A;  3EMH A;  2BBK H;  4MMX A;  3DWL C;  4CZY A;  3SMR A;  3FCU A;  5FKT A;  4GGC A;  2G9A A;  3VGZ A;  3JAM g;  1OLZ A;  2CN2 A;  1GOH A;  3IUL A;  1E5T A;  3N0E A;  4A7J A;  4BH6 A;  2QC5 A;  4JSN C;  2XZG A;  4U1E I;  4QL1 A;  5CXB A;  5FXY A;  5GSA A;  4A0B B;  3OW8 A;  4FWW A;  4GZ8 A;  3K27 A;  4D0K A;  2VDQ A;  3UKR C;  4J79 A;  2H9P A;  4A2M A;  3OKT A;  3JZN A;  3VI3 A;  4FA9 D;  4ERY A;  1ERJ A;  3GRE A;  2VDO A;  4DNV A;  3I7L A;  3J80 g;  2YNP A;  3ZDX A;  2HES X;  1SQJ A;  4J77 A;  1YR2 A;  3IJ0 A;  3QI0 A;  4G56 B;  3I7N A;  3EI1 A;  4RE5 A;  3EQ8 A;  4E5Z A;  3UVO A;  2EID A;  4L9O A;  2I0R A;  1PEV A;  1XIP A;  4E54 B;  4BUJ C;  3IIW A;  4A09 B;  3C9C A;  3P4F A;  5C86 A;  5GXH A;  5AMS A;  2H68 A;  2QZP A;  2PM9 A;  3E0C A;  2CE9 A;  1A0R B;  2PM7 B;  3V9F A;  3OL2 B;  1QFS A;  3ORV D;  4ERQ A;  4L1Q D;  4PSX B;  1BPO A;  1U8C A;  1MG2 A;  1UTC A;  5FFG A;  2H6Q A;  4NSX A;  3EI2 A;  1B9Y A;  3QHY B;  4J8G A;  5EMM B;  4JSV C;  4QAM A;  2P9N C;  3OKY A;  4PXW A;  3SBQ A;  1E8N A;  3SXT D;  2IUR A;  1K8K C;  3OL2 A;  1O6G A;  3FCS A;  4I79 A;  3PXT D;  1NEX B;  5AJA A;  3I89 A;  2VC2 A;  2J56 H;  3K6S A;  1N6D A;  4X60 B;  4ZOY A;  5FLX g;  3I7K A;  4WK0 A;  3I8C A;  4NEN A;  1B9X A;  3SWS D;  3V5W B;  2OVQ B;  1MG3 A;  2H9L A;  4CI2 A;  4CZX A;  2AGY A;  3IUN A;  3C99 A;  4AX4 A;  3PVW B;  1O6F A;  1C9I A; 
#chains in the Genus database with same CATH homology
 5CXB B;  3SFZ A;  4A11 A;  4AEZ A;  4XYH A;  4X61 B;  2HKM A;  4UI9 R;  5GMK n;  4JT5 C;  4GQ2 P;  4ERZ A;  5EMJ B;  5KDO B;  1JJU B;  2B5N A;  1OMW B;  2W18 A;  4ZOV A;  3PXW D;  5I5M A;  2MTA H;  2H47 A;  2YNO A;  3NVQ A;  3CFS B;  2PM9 B;  4QT8 A;  3EI3 B;  4PSW B;  3ODT A;  2B5L A;  4JSX C;  1JMZ B;  4CI8 A;  2J55 H;  3IKO A;  2H6N A;  3SBR A;  5EAR A;  4Y5R D;  3IIY A;  4K3J B;  2H6K A;  5FA5 B;  3SCY A;  4J8B A;  3IJC A;  2PBI B;  4ZOZ A;  1TYQ C;  1GOT B;  1JOF A;  2H14 A;  4IMM A;  2BCJ B;  1P22 A;  4J82 A;  5CXC A;  3I7P A;  4FHL A;  3RFG A;  3UVM A;  3SN6 B;  4EWR A;  4JD2 C;  2HKR A;  4QRJ A;  2B5M A;  3JZH A;  5HE3 B;  4GGD A;  2P9P C;  3VH0 A;  3UVK A;  5IT9 g;  1SHY B;  2I0S A;  5IJ7 E;  1NR0 A;  1U2V C;  2IAA A;  1GXR A;  3JRP A;  2P9L C;  5AFU 3;  2XL3 A;  4ZOX A;  2HXC A;  3FRX A;  5IC7 A;  3W15 A;  4Y7R A;  4CC9 A;  4N14 A;  1N6F A;  3PXS D;  1PBY B;  2AGX A;  1SQ9 A;  3MKS B;  3SHF A;  2P9S C;  3B7F A;  3F3P A;  3OTT A;  4J81 A;  3VA6 A;  4AOW A;  2Z2O A;  4CY3 A;  2OJY A;  5EML B;  1L0Q A;  4ESG A;  1Q47 A;  4O1Q D;  2OK4 A;  2AGZ A;  3PE7 A;  2IUP A;  2AH1 A;  5B4W A;  3FM0 A;  1XHM A;  3JPX A;  4CI3 A;  3F3F A;  5H14 A;  3RN0 D;  2AQ5 A;  2HJ4 A;  3DXM C;  1K32 A;  3RRM C;  4O3T B;  5IGO A;  2XU7 A;  4D6V A;  4J0X A;  4HDJ A;  3JB9 L;  1GG2 B;  4PBZ A;  4X3E A;  2TRC B;  3ULE C;  2H9M A;  2H3X A;  3MKQ A;  3EG6 A;  4JT6 C;  3PSL A;  3K26 A;  3RSE C;  4L3G D;  2UZX B;  3KRW B;  3IJ1 A;  1U4C A;  4J87 A;  5CXC B;  2EBS A;  2IWF A;  2QXV A;  5EAM A;  4FAV D;  4QQE A;  5SXM A;  2CO0 A;  5EM2 A;  3AL8 B;  2YB8 B;  2I3S A;  4XEI C;  2GC4 A;  5C2W B;  3UVL A;  2OVR B;  4FA5 D;  3BG0 A;  3BWS A;  3MXX A;  3PVU B;  1QNI A;  1FWX A;  3EI2 B;  4O9D A;  4GGA A;  1VYH C;  4J84 A;  4H5J A;  2HJB A;  3F3G A;  4GM3 A;  3SJL D;  3OKW A;  1TBG A;  3J81 g;  3BG1 A;  3L4M D;  4ZN4 A;  5FKQ A;  4JXM A;  4J78 A;  2P9K C;  3U4Y A;  4GQB B;  1XKS A;  4ES0 A;  3KRX B;  4U7A A;  4A11 B;  4YVD A;  4A0A A;  2IUQ A;  2AGL A;  5HQG A;  2IWK A;  3JZG A;  2AH0 A;  2YNN A;  2P9I C;  2HYE A;  4OWR A;  2IUV A;  2J57 G;  4J86 A;  3FGB A;  4A08 B;  4L3H D;  5JWZ A;  3UKU C;  3CFV A;  5GXI A;  4XYI A;  4FA1 D;  3I8E A;  5FKS A;  2I0T A;  4OZU A;  2P9U C;  5I5J A;  3RN1 D;  3UVN A;  3I7O A;  3OKY B;  5FQD A;  4FB1 D;  3AFC A;  2GNQ A;  4PBY A;  1S4U X;  4CY1 A;  5HE0 B;  3RFH A;  5EMK B;  1N6E A;  3EI1 B;  3V7D B;  5H17 A;  2Z2P A;  5C9Z B;  4GM8 A;  3AL9 A;  2YBA A;  5A2Q g;  3A0F A;  4LG9 A;  4H5I A;  3L4O D;  1JMX B;  4E54 A;  3NVX A;  2I3T A;  2XYI A;  4A0A B;  4TZ4 A;  5CYK B;  5THA A;  3MMY A;  3C5M A;  5FKR A;  2OVP B;  3AH8 B;  4Z8L A;  4A0B A;  5EAP A;  2CNX A;  2CO0 C;  5IJ8 E;  4PNK B;  5K19 A;  1YFQ A;  3DXK C;  3EU7 A;  4A08 A;  3JRO A;  5HE1 B;  1RI6 A;  4J73 A;  2UZY B;  3HFQ A;  3RMZ D;  4A09 A;  4IA9 A;  4JSP C;  4MK0 B;  3UR4 A;  3PSC B;  1GP2 B;  4FAN D;  2AGW A;  4PC0 A;  1PGU A;  4E5Z B;  3NVN A;  1R5M A;  4O45 A;  4R7A B;  4GM9 A;  3DM0 A;  2H13 A;  2O9K A;  3N0D A;  2Q7Q A;  3EWE A;  5H1M A;  4J0W A;  3I7H A;  4LG8 A;  4O3U B;  2GC7 A;  3EI4 B;  4LGN A;  3MZL A;  5EAL A;  3C75 H;  4X63 B;  2OIZ A;  3RLM D;  3SVW D;  5HYN B;  3CIK B;  2CN3 A;  5I5I A;  3GFC A;  5TDH B;  2G99 A;  2CE8 A;  3SLE D;  3MZK A;  2Z2N A;  5TEF A;  3DSM A;  5C2V B;  5TEE A;  2H9N A;  3SBP A;  3AL8 A;  2PM6 B;  5EM2 B;  2B4E A;  4CY2 A;  3ZWL B;  4CY5 A;  4GMB A;  4K3I D;  5K1C C;  2XL2 A;  1PI6 A;  4FA4 D;  5HE2 B;  2YMU A;  4A2L A;  4KFM B;  2OK6 A;  4CZV A;  4CI1 A;  5TF2 A;  4BL0 A;  5CYK A;  1MDA H;  3I2N A;  5IGQ A;  3EI3 A;  3EI4 A;  3EMH A;  2BBK H;  3DWL C;  4CZY A;  3SMR A;  5FKT A;  4GGC A;  2G9A A;  3VGZ A;  3JAM g;  1OLZ A;  2CN2 A;  3N0E A;  4A7J A;  4BH6 A;  2QC5 A;  4JSN C;  4U1E I;  4QL1 A;  5CXB A;  5FXY A;  5GSA A;  4A0B B;  3OW8 A;  4FWW A;  4GZ8 A;  3K27 A;  4D0K A;  3UKR C;  4J79 A;  2H9P A;  4A2M A;  3OKT A;  3JZN A;  4FA9 D;  4ERY A;  1ERJ A;  3GRE A;  3I7L A;  3J80 g;  2YNP A;  2HES X;  1SQJ A;  4J77 A;  3IJ0 A;  4G56 B;  3I7N A;  3EI1 A;  4E5Z A;  3UVO A;  4L9O A;  2I0R A;  1PEV A;  1XIP A;  4E54 B;  4BUJ C;  3IIW A;  4A09 B;  3C9C A;  3P4F A;  5GXH A;  5AMS A;  2H68 A;  2PM9 A;  3E0C A;  2CE9 A;  1A0R B;  2PM7 B;  3V9F A;  3OL2 B;  3ORV D;  4ERQ A;  4L1Q D;  4PSX B;  1MG2 A;  2H6Q A;  4NSX A;  3EI2 A;  1B9Y A;  4J8G A;  5EMM B;  4JSV C;  2P9N C;  3OKY A;  4PXW A;  3SBQ A;  3SXT D;  2IUR A;  1K8K C;  3OL2 A;  4I79 A;  3PXT D;  1NEX B;  5AJA A;  3I89 A;  2J56 H;  1N6D A;  4X60 B;  4ZOY A;  5FLX g;  3I7K A;  3I8C A;  1B9X A;  3SWS D;  3V5W B;  2OVQ B;  1MG3 A;  2H9L A;  4CI2 A;  4CZX A;  2AGY A;  3C99 A;  3PVW B;  4GQ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...