2XU7A

Structural basis for rbap48 binding to fog-1
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
395
structure length
360
Chain Sequence
VINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTFSIHRLVLGTHTSDEQNHLVIASVQLPNKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords HISTONE-BINDING PROTEIN RBBP4
publication title Insights Into Association of the Nurd Complex with Fog-1 from the Crystal Structure of an Rbap48-Fog- 1 Complex.
pubmed doi rcsb
source organism Homo sapiens
total genus 104
structure length 360
sequence length 395
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
A PF12265 CAF1C_H4-bd Histone-binding protein RBBP4 or subunit C of CAF1 complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2xu7A00
4FA4D 4ES0A 2AGYA 3W15A 2HKMA 4GM9A 3ODTA 3SJLD 2I0TA 3PVUB 2I0RA 3SMRA 2XU7A 3MZKA 3I8EA 4FAND 4K3ID 3EI2A 2IUVA 3OKWA 2H6KA 3J80g 4L9OA 3PXWD 3IKOA 4CZXA 2AH1A 5HE2B 4AOWA 3EU7A 2IAAA 3SXTD 5FXYA 3C5MA 3PSLA 3F3GA 3ULEC 2IUPA 3PXTD 4CI3A 3ORVD 1SQ9A 3MMYA 2OK6A 3JPXA 4PC0A 2OK4A 4J77A 5AMSA 5FQDA 3ZWLB 2P9KC 4A7JA 2YNOA 1MG2A 5EM2B 1GOTB 2HESX 2PM9B 2CO0A 4A11B 3NVNA 4JSNC 2AQ5A 4Y5RD 5H14A 4UI9R 2H47A 1MG3A 4X60B 4CY1A 3CIKB 3U4YA 5IJ8E 3JZHA 3EI1B 3UKUC 1OMWB 4LG8A 1GG2B 3KRXB 3B7FA 4O3UB 3IJ1A 4GQ2P 2UZXB 3DWLC 2I3TA 5HE1B 3RN0D 3BWSA 4E54B 2P9IC 4E5ZB 3SCYA 5TEFA 3SHFA 5HYNB 5IGQA 2IUQA 4ZOZA 1U4CA 2PM9A 3E0CA 4KFMB 3EI3B 2AGZA 4Y7RA 1TYQC 3OW8A 3BG0A 2H6QA 3EI1A 4Z8LA 3RN1D 4OWRA 4K3JB 2AGLA 2MTAH 5FKSA 3RSEC 2OVPB 5CXBB 3RMZD 2CO0C 4E54A 4E5ZA 1B9YA 4A2MA 2P9NC 2XYIA 4X63B 3DM0A 4ERZA 2I0SA 3SVWD 5EMLB 5GMKn 4YVDA 4FWWA 4IMMA 3OKTA 1NR0A 3EI3A 5CYKB 2BCJB 3EI4A 1N6DA 4XYIA 2H14A 3IIYA 2YNPA 2IWFA 3OL2B 3KRWB 4O1QD 4GM3A 4CI8A 5H17A 3MKSB 4AEZA 4ZOXA 1S4UX 2IWKA 3UVKA 1XHMA 4J81A 1B9XA 2PBIB 3P4FA 5CXBA 4PSWB 3JROA 3I2NA 3I8CA 5GSAA 4XEIC 1ERJA 3FM0A 5EAPA 3DXKC 3F3PA 3RRMC 5CYKA 2OJYA 1TBGA 5HE0B 4FA9D 2H68A 3JZNA 3OL2A 4A0AA 5HQGA 2P9PC 2HKRA 3UR4A 3N0DA 2HJ4A 3NVXA 4NSXA 4ZN4A 4J86A 5FKTA 1N6EA 4ZOVA 1SQJA 3AL9A 5TEEA 4J82A 5GXHA 3SWSD 2OVQB 5I5MA 3DXMC 4O3TB 1N6FA 4CY2A 1VYHC 1JJUB 2PM6B 5HE3B 4HDJA 5TF2A 5IGOA 2YNNA 4JSXC 3VA6A 4R7AB 1PGUA 2H9PA 4BL0A 3I7KA 4J73A 5EAMA 4A08A 3OKYB 2YB8B 3UVLA 4X3EA 4A09B 5EARA 2Q7QA 2W18A 3V7DB 4CY3A 2B5NA 2J55H 3JZGA 3RLMD 3UVOA 3J81g 5I5IA 2CE8A 3BG1A 4H5IA 4PXWA 5EMMB 5C2WB 4LGNA 3EI4B 4L3GD 2H9MA 1GXRA 4L1QD 5B4WA 2YBAA 3JRPA 5FA5B 2AGWA 3AL8A 1PI6A 3VH0A 2YMUA 4ERQA 1FWXA 2QC5A 4MK0B 4N14A 3CFSB 3OKYA 3SBQA 4A09A 3PXSD 3V5WB 3GFCA 2J57G 2HYEA 2TRCB 3EMHA 5A2Qg 4ESGA 5GXIA 3MXXA 4JXMA 3GREA 4J87A 1MDAH 1A0RB 4CC9A 3RFHA 2I3SA 2UZYB 2O9KA 4A0AB 3C9CA 3DSMA 1PEVA 4L3HD 2OVRB 3C75H 5AJAA 4JT6C 3FRXA 3EWEA 3JAMg 1K8KC 3NVQA 3I7HA 4FA5D 4J79A 4H5JA 3I7PA 1JOFA 4JSVC 3JB9L 3SBRA 3IJCA 3N0EA 5EMJB 4O9DA 1YFQA 4TZ4A 4BH6A 4JD2C 4CZYA 2B5LA 2Z2OA 4CZVA 1GP2B 3PE7A 4PSXB 1P22A 3K27A 2GNQA 4A0BB 1SHYB 3PSCB 2OIZA 4O45A 5FLXg 3HFQA 4CY5A 4CI2A 3AFCA 2J56H 2IURA 1XKSA 3MKQA 4A08B 3I7LA 4D0KA 1L0QA 4FHLA 2G9AA 5C2VB 4ERYA 4JT5C 2CN3A 4GQ1A 4QRJA 1PBYB 1NEXB 2H13A 5I5JA 5K1CC 4FAVD 1U2VC 5KDOB 1Q47A 2P9UC 4IA9A 5IT9g 4PBZA 3V9FA 3OTTA 2Z2PA 2B5MA 5FKQA 2G99A 5SXMA 4GGDA 5AFU3 4A0BA 2H6NA 3AL8B 3FGBA 3I89A 3PVWB 3IJ0A 3UVNA 4G56B 4GGCA 4U7AA 4GMBA 3L4OD 1JMXB 1XIPA 3UVMA 4X61B 1RI6A 5EMKB 5K19A 4J0WA 4FA1D 2HXCA 4QT8A 4EWRA 3UKRC 5THAA 2XL2A 4J8GA 2CE9A 4D6VA 5CXCB 4A2LA 3A0FA 2HJBA 5JWZA 3SN6B 5H1MA 2H3XA 4U1EI 3CFVA 4J78A 4QL1A 2BBKH 4GGAA 3I7OA 4XYHA 1K32A 3EG6A 2PM7B 1QNIA 2P9SC 4J8BA 3C99A 4GM8A 3MZLA 5EM2A 2P9LC 4J0XA 2Z2NA 2B4EA 4GZ8A 5IJ7E 3IIWA 2GC4A 4A11A 2CN2A 2H9LA 5FKRA 3I7NA 2H9NA 5TDHB 3SBPA 4I79A 2AGXA 3L4MD 5CXCA 4J84A 2XL3A 4BUJC 4OZUA 2AH0A 4JSPC 5C9ZB 5EALA 3F3FA 2QXVA 1JMZB 1R5MA 4QQEA 4FB1D 3EI2B 3RFGA 4PNKB 2CNXA 4CI1A 2EBSA 3SFZA 4GQBB 1OLZA 2GC7A 4PBYA 3AH8B 3VGZA 3SLED 5IC7A 3K26A 4ZOYA 4LG9A
chains in the Genus database with same CATH superfamily
4FA4D 4ES0A 2AGYA 5M5RA 3VI4A 3W15A 2HKMA 4NENA 4IRZA 4GM9A 3ODTA 3SJLD 2I0TA 3PVUB 2I0RA 3SMRA 4AX4A 2XU7A 3MZKA 4WK2A 3I8EA 3DDUA 4FAND 4K3ID 3EI2A 2IUVA 3OKWA 2H6KA 3J80g 4L9OA 3PXWD 3IKOA 4CZXA 2QZPA 2VDKA 2AH1A 5HE2B 4AOWA 3EU7A 2IAAA 3OF7A 5C86A 3SXTD 5FXYA 5M5SA 3C5MA 3PSLA 3F3GA 5FFOA 3ULEC 1VZ3A 2IUPA 3PXTD 4CI3A 3ORVD 1SQ9A 3MMYA 2OK6A 3JPXA 3K6SA 3IUQA 4PC0A 2OK4A 4J77A 4BCDA 5AMSA 5FQDA 3ZWLB 2P9KC 4A7JA 1QFSA 2YNOA 1MG2A 5EM2B 1GOTB 2HESX 2PM9B 2CO0A 4A11B 3NVNA 4JSNC 2AQ5A 4Y5RD 1VE6A 5H14A 4UI9R 2H47A 1MG3A 1O6GA 4X60B 4CY1A 3CIKB 3U4YA 3ZE2A 5IJ8E 4BP9A 3JZHA 3EI1B 3UKUC 1OMWB 3NIDA 4LG8A 1GG2B 3KRXB 3B7FA 4O3UB 2HU8A 3IJ1A 3ZE1A 4GQ2P 2UZXB 3DWLC 3EQ9A 2I3TA 5HE1B 1E5TA 3RN0D 3BWSA 4E54B 2P9IC 4E5ZB 3SCYA 1GOFA 5TEFA 3SHFA 3NIGA 5HYNB 5IGQA 4G1EA 2IUQA 4ZOZA 1U4CA 4D9SA 2PM9A 3E0CA 3O4HA 4KFMB 3EI3B 1BPOA 2AGZA 3MUOA 4Y7RA 1TYQC 3OW8A 3BG0A 2H6QA 3EI1A 1A12A 4Z8LA 3RN1D 3IULA 4OWRA 4K3JB 3IURA 2AGLA 2HU5A 2MTAH 3IVMA 5FKSA 3RSEC 3T3PA 2OVPB 5CXBB 3RMZD 2CO0C 4E54A 4E5ZA 1B9YA 4A2MA 2P9NC 2XYIA 4X63B 3DM0A 4ERZA 1E8NA 3V4VA 2I0SA 3SVWD 5EMLB 4Z7OA 5GMKn 3IUJA 4YVDA 4FWWA 3FCUA 4IMMA 4WK4A 3OKTA 1NR0A 3EI3A 5CYKB 2BCJB 3EI4A 1N6DA 4XYIA 2H14A 3IIYA 2YNPA 3QI0A 2IWFA 3OL2B 3KRWB 4O1QD 4GM3A 4CI8A 3KCIA 5H17A 3MKSB 4AEZA 4MMZA 4ZOXA 1S4UX 2IWKA 3UVKA 1XHMA 4NAAA 4J81A 1B9XA 2PBIB 3P4FA 3K71A 4WK0A 1UOOA 4BCBA 5CXBA 4PSWB 3JROA 3I2NA 3I8CA 2BKLA 3O4IA 5GSAA 4XEIC 4NBMA 4JHNA 1ERJA 4AN1A 3FM0A 5EAPA 3DXKC 3F3PA 4WJKA 3RRMC 5CYKA 5M5UA 1QFMA 2OJYA 1TBGA 5HE0B 4FA9D 2H68A 1VZ2A 1E8MA 1H2ZA 3JZNA 4DNWA 3OL2A 4A0AA 1T2XA 1UTCA 5HQGA 2P9PC 2HKRA 3UR4A 3N0DA 4NC4A 2VDMA 2HJ4A 3NVXA 4NSXA 4ZN4A 4J86A 5FKTA 1N6EA 4ZOVA 1SQJA 3AL9A 5TEEA 4J82A 5GXHA 4Z7NA 1C9IA 3SWSD 2OVQB 5I5MA 3DXMC 4O3TB 1N6FA 4CY2A 1VYHC 4DNVA 1JJUB 2PM6B 3O4GA 5HE3B 4HDJA 2VDRA 5M5VA 5TF2A 3ZE0A 2VDPA 5IGOA 2YNNA 4JSXC 3VA6A 4R7AB 1PGUA 2H9PA 4BL0A 3I7KA 4J73A 5EAMA 4A08A 3OKYB 2YB8B 5E6SA 3UVLA 4X3EA 4A09B 5EARA 2Q7QA 2W18A 3V7DB 4CY3A 2B5NA 2J55H 1H2YA 3JZGA 3ZDYA 3RLMD 3UVOA 3J81g 5I5IA 2CE8A 3BG1A 5M61A 4H5IA 4PXWA 2EIEA 5EMMB 5C2WB 4LGNA 4UM9A 3EI4B 1GOHA 1GOGA 4L3GD 2H9MA 1GXRA 4L1QD 5HDBA 5B4WA 2YBAA 3JRPA 5FA5B 2AGWA 5M5TA 3AL8A 2VDOA 1PI6A 3VH0A 2YMUA 4ERQA 1FWXA 2QC5A 4MK0B 4L1MA 1I2MB 4G1MA 4N14A 3CFSB 3OKYA 3SBQA 4BCCA 2HU7A 4A09A 3PXSD 2EIBA 2EIDA 3V5WB 3GFCA 2J57G 2HYEA 3QHYB 2TRCB 3EMHA 5A2Qg 4ESGA 5GXIA 3MXXA 4JXMA 3GREA 1H2XA 4J87A 1MDAH 1A0RB 4CC9A 3RFHA 2I3SA 2UZYB 2O9KA 4A0AB 3C9CA 3DSMA 1PEVA 4O02A 4BP8A 3MUNA 3ZDXA 4L3HD 2OVRB 3C75H 5AJAA 4JT6C 3FRXA 3EWEA 3JAMg 1K8KC 3NVQA 4O2WA 3I7HA 4FA5D 5E6UA 4J79A 4H5JA 3I7PA 1JOFA 4JSVC 3JB9L 3SBRA 3IJCA 3N0EA 4QAMA 2WQ8A 5EMJB 4O9DA 1YFQA 4TZ4A 4BH6A 4JD2C 4CZYA 2B5LA 3EQ8A 4AMYA 2Z2OA 3IUNA 4CZVA 1GP2B 3PE7A 4PSXB 1P22A 3K27A 2GNQA 4DNUA 2JKXA 2VDLA 4A0BB 1SHYB 3PSCB 2OIZA 4O45A 5FLXg 3HFQA 4CY5A 4CI2A 3AFCA 2J56H 2IURA 1XKSA 2VDQA 3MKQA 4A08B 4AN0A 3I7LA 1O6FA 4D0KA 2VZ3A 1L0QA 4MMXA 4FHLA 3GD1I 2G9AA 5C2VB 4ERYA 3O4JA 4JT5C 2CN3A 4GQ1A 1YR2A 1C9LA 1PBYB 4QRJA 1NEXB 2H13A 5I5JA 5K1CC 4FAVD 1U2VC 5KDOB 1UOPA 1Q47A 2QR5A 2P9UC 4IA9A 5IT9g 4PBZA 3V9FA 3OTTA 2Z2PA 2B5MA 5FKQA 2G99A 5SXMA 4GGDA 5AFU3 4A0BA 1U8CA 2H6NA 3AL8B 3FGBA 3I89A 3PVWB 3IJ0A 3UVNA 4G56B 4GGCA 4U7AA 4GMBA 3L4OD 1JMXB 2VZ1A 1XIPA 3V4PA 3UVMA 4X61B 1RI6A 5FFGA 5EMKB 1L5GA 5K19A 4J0WA 4FA1D 2HXCA 4QT8A 4EWRA 3UKRC 1H2WA 3VI3A 5THAA 2XL2A 5C92A 4AMZA 4J8GA 3IUMA 2CE9A 4D6VA 5CXCB 1JTDB 4A2LA 3A0FA 2HJBA 5JWZA 4Z7QA 3SN6B 5H1MA 2H3XA 3IJEA 4U1EI 3CFVA 4J78A 4QL1A 2BBKH 4GGAA 3I7OA 4XYHA 1K32A 3EG6A 2PM7B 1QNIA 2P9SC 4J8BA 4RE5A 3C99A 4GM8A 3MZLA 4G55A 5EM2A 2P9LC 4J0XA 2Z2NA 2B4EA 4GZ8A 5IJ7E 3IIWA 3NIFA 2GC4A 4A11A 2CN2A 2H9LA 1K3IA 4RE6A 4MMYA 5FKRA 3I7NA 2H9NA 2XZGA 5TDHB 3SBPA 3ZDZA 4I79A 2AGXA 3L4MD 3T3MA 5CXCA 3GC3B 1UOQA 4J84A 2XDWA 2XL3A 4BUJC 3MVDK 4OZUA 2VDNA 2AH0A 1TYEA 4JHPC 4JSPC 5C9ZB 5EALA 2EICA 3F3FA 1VE7A 2QXVA 5E6RA 1JMZB 3EQ7A 1R5MA 4QQEA 4FB1D 3EI2B 3RFGA 4PNKB 2CNXA 2VC2A 4CI1A 2EBSA 3SFZA 2XE4A 4GQBB 3FCSA 1M1XA 1OLZA 2GC7A 4PBYA 3AH8B 3VGZA 3SLED 5IC7A 3K72A 1JV2A 3K26A 4UM8A 4ZOYA 4LG9A
chains in the Genus database with same CATH topology
4FA4D 4ES0A 2AGYA 3W15A 2HKMA 4GM9A 3ODTA 3SJLD 2I0TA 3PVUB 2I0RA 3SMRA 2XU7A 3MZKA 3I8EA 4FAND 4K3ID 3EI2A 2IUVA 3OKWA 2H6KA 3J80g 4L9OA 3PXWD 3IKOA 4CZXA 2AH1A 5HE2B 4AOWA 3EU7A 2IAAA 3SXTD 5FXYA 3C5MA 3PSLA 3F3GA 3ULEC 2IUPA 3PXTD 4CI3A 3ORVD 1SQ9A 3MMYA 2OK6A 3JPXA 4PC0A 2OK4A 4J77A 5AMSA 5FQDA 3ZWLB 2P9KC 4A7JA 2YNOA 1MG2A 5EM2B 1GOTB 2HESX 2PM9B 2CO0A 4A11B 3NVNA 4JSNC 2AQ5A 4Y5RD 5H14A 4UI9R 2H47A 1MG3A 4X60B 4CY1A 3CIKB 3U4YA 5IJ8E 3JZHA 3EI1B 3UKUC 1OMWB 4LG8A 1GG2B 3KRXB 3B7FA 4O3UB 3IJ1A 4GQ2P 2UZXB 3DWLC 2I3TA 5HE1B 3RN0D 3BWSA 4E54B 2P9IC 4E5ZB 3SCYA 5TEFA 3SHFA 5HYNB 5IGQA 2IUQA 4ZOZA 1U4CA 2PM9A 3E0CA 4KFMB 3EI3B 2AGZA 4Y7RA 1TYQC 3OW8A 3BG0A 2H6QA 3EI1A 4Z8LA 3RN1D 4OWRA 4K3JB 2AGLA 2MTAH 5FKSA 3RSEC 2OVPB 5CXBB 3RMZD 2CO0C 4E54A 4E5ZA 1B9YA 4A2MA 2P9NC 2XYIA 4X63B 3DM0A 4ERZA 2I0SA 3SVWD 5EMLB 5GMKn 4YVDA 4FWWA 4IMMA 3OKTA 1NR0A 3EI3A 5CYKB 2BCJB 3EI4A 1N6DA 4XYIA 2H14A 3IIYA 2YNPA 2IWFA 3OL2B 3KRWB 4O1QD 4GM3A 4CI8A 5H17A 3MKSB 4AEZA 4ZOXA 1S4UX 2IWKA 3UVKA 1XHMA 4J81A 1B9XA 2PBIB 3P4FA 5CXBA 4PSWB 3JROA 3I2NA 3I8CA 5GSAA 4XEIC 1ERJA 3FM0A 5EAPA 3DXKC 3F3PA 3RRMC 5CYKA 2OJYA 1TBGA 5HE0B 4FA9D 2H68A 3JZNA 3OL2A 4A0AA 5HQGA 2P9PC 2HKRA 3UR4A 3N0DA 2HJ4A 3NVXA 4NSXA 4ZN4A 4J86A 5FKTA 1N6EA 4ZOVA 1SQJA 3AL9A 5TEEA 4J82A 5GXHA 3SWSD 2OVQB 5I5MA 3DXMC 4O3TB 1N6FA 4CY2A 1VYHC 1JJUB 2PM6B 5HE3B 4HDJA 5TF2A 5IGOA 2YNNA 4JSXC 3VA6A 4R7AB 1PGUA 2H9PA 4BL0A 3I7KA 4J73A 5EAMA 4A08A 3OKYB 2YB8B 3UVLA 4X3EA 4A09B 5EARA 2Q7QA 2W18A 3V7DB 4CY3A 2B5NA 2J55H 3JZGA 3RLMD 3UVOA 3J81g 5I5IA 2CE8A 3BG1A 4H5IA 4PXWA 5EMMB 5C2WB 4LGNA 3EI4B 4L3GD 2H9MA 1GXRA 4L1QD 5B4WA 2YBAA 3JRPA 5FA5B 2AGWA 3AL8A 1PI6A 3VH0A 2YMUA 4ERQA 1FWXA 2QC5A 4MK0B 4N14A 3CFSB 3OKYA 3SBQA 4A09A 3PXSD 3V5WB 3GFCA 2J57G 2HYEA 2TRCB 3EMHA 5A2Qg 4ESGA 5GXIA 3MXXA 4JXMA 3GREA 4J87A 1MDAH 1A0RB 4CC9A 3RFHA 2I3SA 2UZYB 2O9KA 4A0AB 3C9CA 3DSMA 1PEVA 4L3HD 2OVRB 3C75H 5AJAA 4JT6C 3FRXA 3EWEA 3JAMg 1K8KC 3NVQA 3I7HA 4FA5D 4J79A 4H5JA 3I7PA 1JOFA 4JSVC 3JB9L 3SBRA 3IJCA 3N0EA 5EMJB 4O9DA 1YFQA 4TZ4A 4BH6A 4JD2C 4CZYA 2B5LA 2Z2OA 4CZVA 1GP2B 3PE7A 4PSXB 1P22A 3K27A 2GNQA 4A0BB 1SHYB 3PSCB 2OIZA 4O45A 5FLXg 3HFQA 4CY5A 4CI2A 3AFCA 2J56H 2IURA 1XKSA 3MKQA 4A08B 3I7LA 4D0KA 1L0QA 4FHLA 2G9AA 5C2VB 4ERYA 4JT5C 2CN3A 4GQ1A 4QRJA 1PBYB 1NEXB 2H13A 5I5JA 5K1CC 4FAVD 1U2VC 5KDOB 1Q47A 2P9UC 4IA9A 5IT9g 4PBZA 3V9FA 3OTTA 2Z2PA 2B5MA 5FKQA 2G99A 5SXMA 4GGDA 5AFU3 4A0BA 2H6NA 3AL8B 3FGBA 3I89A 3PVWB 3IJ0A 3UVNA 4G56B 4GGCA 4U7AA 4GMBA 3L4OD 1JMXB 1XIPA 3UVMA 4X61B 1RI6A 5EMKB 5K19A 4J0WA 4FA1D 2HXCA 4QT8A 4EWRA 3UKRC 5THAA 2XL2A 4J8GA 2CE9A 4D6VA 5CXCB 4A2LA 3A0FA 2HJBA 5JWZA 3SN6B 5H1MA 2H3XA 4U1EI 3CFVA 4J78A 4QL1A 2BBKH 4GGAA 3I7OA 4XYHA 1K32A 3EG6A 2PM7B 1QNIA 2P9SC 4J8BA 3C99A 4GM8A 3MZLA 5EM2A 2P9LC 4J0XA 2Z2NA 2B4EA 4GZ8A 5IJ7E 3IIWA 2GC4A 4A11A 2CN2A 2H9LA 5FKRA 3I7NA 2H9NA 5TDHB 3SBPA 4I79A 2AGXA 3L4MD 5CXCA 4J84A 2XL3A 4BUJC 4OZUA 2AH0A 4JSPC 5C9ZB 5EALA 3F3FA 2QXVA 1JMZB 1R5MA 4QQEA 4FB1D 3EI2B 3RFGA 4PNKB 2CNXA 4CI1A 2EBSA 3SFZA 4GQBB 1OLZA 2GC7A 4PBYA 3AH8B 3VGZA 3SLED 5IC7A 3K26A 4ZOYA 4LG9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FA4 D;  4ES0 A;  2AGY A;  3W15 A;  2HKM A;  4GM9 A;  3ODT A;  3SJL D;  2I0T A;  3PVU B;  2I0R A;  3SMR A;  2XU7 A;  3MZK A;  3I8E A;  4FAN D;  4K3I D;  3EI2 A;  2IUV A;  3OKW A;  2H6K A;  3J80 g;  4L9O A;  3PXW D;  3IKO A;  4CZX A;  2AH1 A;  5HE2 B;  4AOW A;  3EU7 A;  2IAA A;  3SXT D;  5FXY A;  3C5M A;  3PSL A;  3F3G A;  3ULE C;  2IUP A;  3PXT D;  4CI3 A;  3ORV D;  1SQ9 A;  3MMY A;  2OK6 A;  3JPX A;  4PC0 A;  2OK4 A;  4J77 A;  5AMS A;  5FQD A;  3ZWL B;  2P9K C;  4A7J A;  2YNO A;  1MG2 A;  5EM2 B;  1GOT B;  2HES X;  2PM9 B;  2CO0 A;  4A11 B;  3NVN A;  4JSN C;  2AQ5 A;  4Y5R D;  5H14 A;  4UI9 R;  2H47 A;  1MG3 A;  4X60 B;  4CY1 A;  3CIK B;  3U4Y A;  5IJ8 E;  3JZH A;  3EI1 B;  3UKU C;  1OMW B;  4LG8 A;  1GG2 B;  3KRX B;  3B7F A;  4O3U B;  3IJ1 A;  4GQ2 P;  2UZX B;  3DWL C;  2I3T A;  5HE1 B;  3RN0 D;  3BWS A;  4E54 B;  2P9I C;  4E5Z B;  3SCY A;  5TEF A;  3SHF A;  5HYN B;  5IGQ A;  2IUQ A;  4ZOZ A;  1U4C A;  2PM9 A;  3E0C A;  4KFM B;  3EI3 B;  2AGZ A;  4Y7R A;  1TYQ C;  3OW8 A;  3BG0 A;  2H6Q A;  3EI1 A;  4Z8L A;  3RN1 D;  4OWR A;  4K3J B;  2AGL A;  2MTA H;  5FKS A;  3RSE C;  2OVP B;  5CXB B;  3RMZ D;  2CO0 C;  4E54 A;  4E5Z A;  1B9Y A;  4A2M A;  2P9N C;  2XYI A;  4X63 B;  3DM0 A;  4ERZ A;  2I0S A;  3SVW D;  5EML B;  5GMK n;  4YVD A;  4FWW A;  4IMM A;  3OKT A;  1NR0 A;  3EI3 A;  5CYK B;  2BCJ B;  3EI4 A;  1N6D A;  4XYI A;  2H14 A;  3IIY A;  2YNP A;  2IWF A;  3OL2 B;  3KRW B;  4O1Q D;  4GM3 A;  4CI8 A;  5H17 A;  3MKS B;  4AEZ A;  4ZOX A;  1S4U X;  2IWK A;  3UVK A;  1XHM A;  4J81 A;  1B9X A;  2PBI B;  3P4F A;  5CXB A;  4PSW B;  3JRO A;  3I2N A;  3I8C A;  5GSA A;  4XEI C;  1ERJ A;  3FM0 A;  5EAP A;  3DXK C;  3F3P A;  3RRM C;  5CYK A;  2OJY A;  1TBG A;  5HE0 B;  4FA9 D;  2H68 A;  3JZN A;  3OL2 A;  4A0A A;  5HQG A;  2P9P C;  2HKR A;  3UR4 A;  3N0D A;  2HJ4 A;  3NVX A;  4NSX A;  4ZN4 A;  4J86 A;  5FKT A;  1N6E A;  4ZOV A;  1SQJ A;  3AL9 A;  5TEE A;  4J82 A;  5GXH A;  3SWS D;  2OVQ B;  5I5M A;  3DXM C;  4O3T B;  1N6F A;  4CY2 A;  1VYH C;  1JJU B;  2PM6 B;  5HE3 B;  4HDJ A;  5TF2 A;  5IGO A;  2YNN A;  4JSX C;  3VA6 A;  4R7A B;  1PGU A;  2H9P A;  4BL0 A;  3I7K A;  4J73 A;  5EAM A;  4A08 A;  3OKY B;  2YB8 B;  3UVL A;  4X3E A;  4A09 B;  5EAR A;  2Q7Q A;  2W18 A;  3V7D B;  4CY3 A;  2B5N A;  2J55 H;  3JZG A;  3RLM D;  3UVO A;  3J81 g;  5I5I A;  2CE8 A;  3BG1 A;  4H5I A;  4PXW A;  5EMM B;  5C2W B;  4LGN A;  3EI4 B;  4L3G D;  2H9M A;  1GXR A;  4L1Q D;  5B4W A;  2YBA A;  3JRP A;  5FA5 B;  2AGW A;  3AL8 A;  1PI6 A;  3VH0 A;  2YMU A;  4ERQ A;  1FWX A;  2QC5 A;  4MK0 B;  4N14 A;  3CFS B;  3OKY A;  3SBQ A;  4A09 A;  3PXS D;  3V5W B;  3GFC A;  2J57 G;  2HYE A;  2TRC B;  3EMH A;  5A2Q g;  4ESG A;  5GXI A;  3MXX A;  4JXM A;  3GRE A;  4J87 A;  1MDA H;  1A0R B;  4CC9 A;  3RFH A;  2I3S A;  2UZY B;  2O9K A;  4A0A B;  3C9C A;  3DSM A;  1PEV A;  4L3H D;  2OVR B;  3C75 H;  5AJA A;  4JT6 C;  3FRX A;  3EWE A;  3JAM g;  1K8K C;  3NVQ A;  3I7H A;  4FA5 D;  4J79 A;  4H5J A;  3I7P A;  1JOF A;  4JSV C;  3JB9 L;  3SBR A;  3IJC A;  3N0E A;  5EMJ B;  4O9D A;  1YFQ A;  4TZ4 A;  4BH6 A;  4JD2 C;  4CZY A;  2B5L A;  2Z2O A;  4CZV A;  1GP2 B;  3PE7 A;  4PSX B;  1P22 A;  3K27 A;  2GNQ A;  4A0B B;  1SHY B;  3PSC B;  2OIZ A;  4O45 A;  5FLX g;  3HFQ A;  4CY5 A;  4CI2 A;  3AFC A;  2J56 H;  2IUR A;  1XKS A;  3MKQ A;  4A08 B;  3I7L A;  4D0K A;  1L0Q A;  4FHL A;  2G9A A;  5C2V B;  4ERY A;  4JT5 C;  2CN3 A;  4GQ1 A;  4QRJ A;  1PBY B;  1NEX B;  2H13 A;  5I5J A;  5K1C C;  4FAV D;  1U2V C;  5KDO B;  1Q47 A;  2P9U C;  4IA9 A;  5IT9 g;  4PBZ A;  3V9F A;  3OTT A;  2Z2P A;  2B5M A;  5FKQ A;  2G99 A;  5SXM A;  4GGD A;  5AFU 3;  4A0B A;  2H6N A;  3AL8 B;  3FGB A;  3I89 A;  3PVW B;  3IJ0 A;  3UVN A;  4G56 B;  4GGC A;  4U7A A;  4GMB A;  3L4O D;  1JMX B;  1XIP A;  3UVM A;  4X61 B;  1RI6 A;  5EMK B;  5K19 A;  4J0W A;  4FA1 D;  2HXC A;  4QT8 A;  4EWR A;  3UKR C;  5THA A;  2XL2 A;  4J8G A;  2CE9 A;  4D6V A;  5CXC B;  4A2L A;  3A0F A;  2HJB A;  5JWZ A;  3SN6 B;  5H1M A;  2H3X A;  4U1E I;  3CFV A;  4J78 A;  4QL1 A;  2BBK H;  4GGA A;  3I7O A;  4XYH A;  1K32 A;  3EG6 A;  2PM7 B;  1QNI A;  2P9S C;  4J8B A;  3C99 A;  4GM8 A;  3MZL A;  5EM2 A;  2P9L C;  4J0X A;  2Z2N A;  2B4E A;  4GZ8 A;  5IJ7 E;  3IIW A;  2GC4 A;  4A11 A;  2CN2 A;  2H9L A;  5FKR A;  3I7N A;  2H9N A;  5TDH B;  3SBP A;  4I79 A;  2AGX A;  3L4M D;  5CXC A;  4J84 A;  2XL3 A;  4BUJ C;  4OZU A;  2AH0 A;  4JSP C;  5C9Z B;  5EAL A;  3F3F A;  2QXV A;  1JMZ B;  1R5M A;  4QQE A;  4FB1 D;  3EI2 B;  3RFG A;  4PNK B;  2CNX A;  4CI1 A;  2EBS A;  3SFZ A;  4GQB B;  1OLZ A;  2GC7 A;  4PBY A;  3AH8 B;  3VGZ A;  3SLE D;  5IC7 A;  3K26 A;  4ZOY A;  4LG9 A; 
#chains in the Genus database with same CATH topology
 4FA4 D;  4ES0 A;  2AGY A;  5M5R A;  3VI4 A;  3W15 A;  2HKM A;  4NEN A;  4IRZ A;  4GM9 A;  3ODT A;  3SJL D;  2I0T A;  3PVU B;  2I0R A;  3SMR A;  4AX4 A;  2XU7 A;  3MZK A;  4WK2 A;  3I8E A;  3DDU A;  4FAN D;  4K3I D;  3EI2 A;  2IUV A;  3OKW A;  2H6K A;  3J80 g;  4L9O A;  3PXW D;  3IKO A;  4CZX A;  2QZP A;  2VDK A;  2AH1 A;  5HE2 B;  4AOW A;  3EU7 A;  2IAA A;  3OF7 A;  5C86 A;  3SXT D;  5FXY A;  5M5S A;  3C5M A;  3PSL A;  3F3G A;  5FFO A;  3ULE C;  1VZ3 A;  2IUP A;  3PXT D;  4CI3 A;  3ORV D;  1SQ9 A;  3MMY A;  2OK6 A;  3JPX A;  3K6S A;  3IUQ A;  4PC0 A;  2OK4 A;  4J77 A;  4BCD A;  5AMS A;  5FQD A;  3ZWL B;  2P9K C;  4A7J A;  1QFS A;  2YNO A;  1MG2 A;  5EM2 B;  1GOT B;  2HES X;  2PM9 B;  2CO0 A;  4A11 B;  3NVN A;  4JSN C;  2AQ5 A;  4Y5R D;  1VE6 A;  5H14 A;  4UI9 R;  2H47 A;  1MG3 A;  1O6G A;  4X60 B;  4CY1 A;  3CIK B;  3U4Y A;  3ZE2 A;  5IJ8 E;  4BP9 A;  3JZH A;  3EI1 B;  3UKU C;  1OMW B;  3NID A;  4LG8 A;  1GG2 B;  3KRX B;  3B7F A;  4O3U B;  2HU8 A;  3IJ1 A;  3ZE1 A;  4GQ2 P;  2UZX B;  3DWL C;  3EQ9 A;  2I3T A;  5HE1 B;  1E5T A;  3RN0 D;  3BWS A;  4E54 B;  2P9I C;  4E5Z B;  3SCY A;  1GOF A;  5TEF A;  3SHF A;  3NIG A;  5HYN B;  5IGQ A;  4G1E A;  2IUQ A;  4ZOZ A;  1U4C A;  4D9S A;  2PM9 A;  3E0C A;  3O4H A;  4KFM B;  3EI3 B;  1BPO A;  2AGZ A;  3MUO A;  4Y7R A;  1TYQ C;  3OW8 A;  3BG0 A;  2H6Q A;  3EI1 A;  1A12 A;  4Z8L A;  3RN1 D;  3IUL A;  4OWR A;  4K3J B;  3IUR A;  2AGL A;  2HU5 A;  2MTA H;  3IVM A;  5FKS A;  3RSE C;  3T3P A;  2OVP B;  5CXB B;  3RMZ D;  2CO0 C;  4E54 A;  4E5Z A;  1B9Y A;  4A2M A;  2P9N C;  2XYI A;  4X63 B;  3DM0 A;  4ERZ A;  1E8N A;  3V4V A;  2I0S A;  3SVW D;  5EML B;  4Z7O A;  5GMK n;  3IUJ A;  4YVD A;  4FWW A;  3FCU A;  4IMM A;  4WK4 A;  3OKT A;  1NR0 A;  3EI3 A;  5CYK B;  2BCJ B;  3EI4 A;  1N6D A;  4XYI A;  2H14 A;  3IIY A;  2YNP A;  3QI0 A;  2IWF A;  3OL2 B;  3KRW B;  4O1Q D;  4GM3 A;  4CI8 A;  3KCI A;  5H17 A;  3MKS B;  4AEZ A;  4MMZ A;  4ZOX A;  1S4U X;  2IWK A;  3UVK A;  1XHM A;  4NAA A;  4J81 A;  1B9X A;  2PBI B;  3P4F A;  3K71 A;  4WK0 A;  1UOO A;  4BCB A;  5CXB A;  4PSW B;  3JRO A;  3I2N A;  3I8C A;  2BKL A;  3O4I A;  5GSA A;  4XEI C;  4NBM A;  4JHN A;  1ERJ A;  4AN1 A;  3FM0 A;  5EAP A;  3DXK C;  3F3P A;  4WJK A;  3RRM C;  5CYK A;  5M5U A;  1QFM A;  2OJY A;  1TBG A;  5HE0 B;  4FA9 D;  2H68 A;  1VZ2 A;  1E8M A;  1H2Z A;  3JZN A;  4DNW A;  3OL2 A;  4A0A A;  1T2X A;  1UTC A;  5HQG A;  2P9P C;  2HKR A;  3UR4 A;  3N0D A;  4NC4 A;  2VDM A;  2HJ4 A;  3NVX A;  4NSX A;  4ZN4 A;  4J86 A;  5FKT A;  1N6E A;  4ZOV A;  1SQJ A;  3AL9 A;  5TEE A;  4J82 A;  5GXH A;  4Z7N A;  1C9I A;  3SWS D;  2OVQ B;  5I5M A;  3DXM C;  4O3T B;  1N6F A;  4CY2 A;  1VYH C;  4DNV A;  1JJU B;  2PM6 B;  3O4G A;  5HE3 B;  4HDJ A;  2VDR A;  5M5V A;  5TF2 A;  3ZE0 A;  2VDP A;  5IGO A;  2YNN A;  4JSX C;  3VA6 A;  4R7A B;  1PGU A;  2H9P A;  4BL0 A;  3I7K A;  4J73 A;  5EAM A;  4A08 A;  3OKY B;  2YB8 B;  5E6S A;  3UVL A;  4X3E A;  4A09 B;  5EAR A;  2Q7Q A;  2W18 A;  3V7D B;  4CY3 A;  2B5N A;  2J55 H;  1H2Y A;  3JZG A;  3ZDY A;  3RLM D;  3UVO A;  3J81 g;  5I5I A;  2CE8 A;  3BG1 A;  5M61 A;  4H5I A;  4PXW A;  2EIE A;  5EMM B;  5C2W B;  4LGN A;  4UM9 A;  3EI4 B;  1GOH A;  1GOG A;  4L3G D;  2H9M A;  1GXR A;  4L1Q D;  5HDB A;  5B4W A;  2YBA A;  3JRP A;  5FA5 B;  2AGW A;  5M5T A;  3AL8 A;  2VDO A;  1PI6 A;  3VH0 A;  2YMU A;  4ERQ A;  1FWX A;  2QC5 A;  4MK0 B;  4L1M A;  1I2M B;  4G1M A;  4N14 A;  3CFS B;  3OKY A;  3SBQ A;  4BCC A;  2HU7 A;  4A09 A;  3PXS D;  2EIB A;  2EID A;  3V5W B;  3GFC A;  2J57 G;  2HYE A;  3QHY B;  2TRC B;  3EMH A;  5A2Q g;  4ESG A;  5GXI A;  3MXX A;  4JXM A;  3GRE A;  1H2X A;  4J87 A;  1MDA H;  1A0R B;  4CC9 A;  3RFH A;  2I3S A;  2UZY B;  2O9K A;  4A0A B;  3C9C A;  3DSM A;  1PEV A;  4O02 A;  4BP8 A;  3MUN A;  3ZDX A;  4L3H D;  2OVR B;  3C75 H;  5AJA A;  4JT6 C;  3FRX A;  3EWE A;  3JAM g;  1K8K C;  3NVQ A;  4O2W A;  3I7H A;  4FA5 D;  5E6U A;  4J79 A;  4H5J A;  3I7P A;  1JOF A;  4JSV C;  3JB9 L;  3SBR A;  3IJC A;  3N0E A;  4QAM A;  2WQ8 A;  5EMJ B;  4O9D A;  1YFQ A;  4TZ4 A;  4BH6 A;  4JD2 C;  4CZY A;  2B5L A;  3EQ8 A;  4AMY A;  2Z2O A;  3IUN A;  4CZV A;  1GP2 B;  3PE7 A;  4PSX B;  1P22 A;  3K27 A;  2GNQ A;  4DNU A;  2JKX A;  2VDL A;  4A0B B;  1SHY B;  3PSC B;  2OIZ A;  4O45 A;  5FLX g;  3HFQ A;  4CY5 A;  4CI2 A;  3AFC A;  2J56 H;  2IUR A;  1XKS A;  2VDQ A;  3MKQ A;  4A08 B;  4AN0 A;  3I7L A;  1O6F A;  4D0K A;  2VZ3 A;  1L0Q A;  4MMX A;  4FHL A;  3GD1 I;  2G9A A;  5C2V B;  4ERY A;  3O4J A;  4JT5 C;  2CN3 A;  4GQ1 A;  1YR2 A;  1C9L A;  1PBY B;  4QRJ A;  1NEX B;  2H13 A;  5I5J A;  5K1C C;  4FAV D;  1U2V C;  5KDO B;  1UOP A;  1Q47 A;  2QR5 A;  2P9U C;  4IA9 A;  5IT9 g;  4PBZ A;  3V9F A;  3OTT A;  2Z2P A;  2B5M A;  5FKQ A;  2G99 A;  5SXM A;  4GGD A;  5AFU 3;  4A0B A;  1U8C A;  2H6N A;  3AL8 B;  3FGB A;  3I89 A;  3PVW B;  3IJ0 A;  3UVN A;  4G56 B;  4GGC A;  4U7A A;  4GMB A;  3L4O D;  1JMX B;  2VZ1 A;  1XIP A;  3V4P A;  3UVM A;  4X61 B;  1RI6 A;  5FFG A;  5EMK B;  1L5G A;  5K19 A;  4J0W A;  4FA1 D;  2HXC A;  4QT8 A;  4EWR A;  3UKR C;  1H2W A;  3VI3 A;  5THA A;  2XL2 A;  5C92 A;  4AMZ A;  4J8G A;  3IUM A;  2CE9 A;  4D6V A;  5CXC B;  1JTD B;  4A2L A;  3A0F A;  2HJB A;  5JWZ A;  4Z7Q A;  3SN6 B;  5H1M A;  2H3X A;  3IJE A;  4U1E I;  3CFV A;  4J78 A;  4QL1 A;  2BBK H;  4GGA A;  3I7O A;  4XYH A;  1K32 A;  3EG6 A;  2PM7 B;  1QNI A;  2P9S C;  4J8B A;  4RE5 A;  3C99 A;  4GM8 A;  3MZL A;  4G55 A;  5EM2 A;  2P9L C;  4J0X A;  2Z2N A;  2B4E A;  4GZ8 A;  5IJ7 E;  3IIW A;  3NIF A;  2GC4 A;  4A11 A;  2CN2 A;  2H9L A;  1K3I A;  4RE6 A;  4MMY A;  5FKR A;  3I7N A;  2H9N A;  2XZG A;  5TDH B;  3SBP A;  3ZDZ A;  4I79 A;  2AGX A;  3L4M D;  3T3M A;  5CXC A;  3GC3 B;  1UOQ A;  4J84 A;  2XDW A;  2XL3 A;  4BUJ C;  3MVD K;  4OZU A;  2VDN A;  2AH0 A;  1TYE A;  4JHP C;  4JSP C;  5C9Z B;  5EAL A;  2EIC A;  3F3F A;  1VE7 A;  2QXV A;  5E6R A;  1JMZ B;  3EQ7 A;  1R5M A;  4QQE A;  4FB1 D;  3EI2 B;  3RFG A;  4PNK B;  2CNX A;  2VC2 A;  4CI1 A;  2EBS A;  3SFZ A;  2XE4 A;  4GQB B;  3FCS A;  1M1X A;  1OLZ A;  2GC7 A;  4PBY A;  3AH8 B;  3VGZ A;  3SLE D;  5IC7 A;  3K72 A;  1JV2 A;  3K26 A;  4UM8 A;  4ZOY A;  4LG9 A; 
#chains in the Genus database with same CATH homology
 4FA4 D;  4ES0 A;  2AGY A;  3W15 A;  2HKM A;  4GM9 A;  3ODT A;  3SJL D;  2I0T A;  3PVU B;  2I0R A;  3SMR A;  2XU7 A;  3MZK A;  3I8E A;  4FAN D;  4K3I D;  3EI2 A;  2IUV A;  3OKW A;  2H6K A;  3J80 g;  4L9O A;  3PXW D;  3IKO A;  4CZX A;  2AH1 A;  5HE2 B;  4AOW A;  3EU7 A;  2IAA A;  3SXT D;  5FXY A;  3C5M A;  3PSL A;  3F3G A;  3ULE C;  2IUP A;  3PXT D;  4CI3 A;  3ORV D;  1SQ9 A;  3MMY A;  2OK6 A;  3JPX A;  4PC0 A;  2OK4 A;  4J77 A;  5AMS A;  5FQD A;  3ZWL B;  2P9K C;  4A7J A;  2YNO A;  1MG2 A;  5EM2 B;  1GOT B;  2HES X;  2PM9 B;  2CO0 A;  4A11 B;  3NVN A;  4JSN C;  2AQ5 A;  4Y5R D;  5H14 A;  4UI9 R;  2H47 A;  1MG3 A;  4X60 B;  4CY1 A;  3CIK B;  3U4Y A;  5IJ8 E;  3JZH A;  3EI1 B;  3UKU C;  1OMW B;  4LG8 A;  1GG2 B;  3KRX B;  3B7F A;  4O3U B;  3IJ1 A;  4GQ2 P;  2UZX B;  3DWL C;  2I3T A;  5HE1 B;  3RN0 D;  3BWS A;  4E54 B;  2P9I C;  4E5Z B;  3SCY A;  5TEF A;  3SHF A;  5HYN B;  5IGQ A;  2IUQ A;  4ZOZ A;  1U4C A;  2PM9 A;  3E0C A;  4KFM B;  3EI3 B;  2AGZ A;  4Y7R A;  1TYQ C;  3OW8 A;  3BG0 A;  2H6Q A;  3EI1 A;  4Z8L A;  3RN1 D;  4OWR A;  4K3J B;  2AGL A;  2MTA H;  5FKS A;  3RSE C;  2OVP B;  5CXB B;  3RMZ D;  2CO0 C;  4E54 A;  4E5Z A;  1B9Y A;  4A2M A;  2P9N C;  2XYI A;  4X63 B;  3DM0 A;  4ERZ A;  2I0S A;  3SVW D;  5EML B;  5GMK n;  4YVD A;  4FWW A;  4IMM A;  3OKT A;  1NR0 A;  3EI3 A;  5CYK B;  2BCJ B;  3EI4 A;  1N6D A;  4XYI A;  2H14 A;  3IIY A;  2YNP A;  2IWF A;  3OL2 B;  3KRW B;  4O1Q D;  4GM3 A;  4CI8 A;  5H17 A;  3MKS B;  4AEZ A;  4ZOX A;  1S4U X;  2IWK A;  3UVK A;  1XHM A;  4J81 A;  1B9X A;  2PBI B;  3P4F A;  5CXB A;  4PSW B;  3JRO A;  3I2N A;  3I8C A;  5GSA A;  4XEI C;  1ERJ A;  3FM0 A;  5EAP A;  3DXK C;  3F3P A;  3RRM C;  5CYK A;  2OJY A;  1TBG A;  5HE0 B;  4FA9 D;  2H68 A;  3JZN A;  3OL2 A;  4A0A A;  5HQG A;  2P9P C;  2HKR A;  3UR4 A;  3N0D A;  2HJ4 A;  3NVX A;  4NSX A;  4ZN4 A;  4J86 A;  5FKT A;  1N6E A;  4ZOV A;  1SQJ A;  3AL9 A;  5TEE A;  4J82 A;  5GXH A;  3SWS D;  2OVQ B;  5I5M A;  3DXM C;  4O3T B;  1N6F A;  4CY2 A;  1VYH C;  1JJU B;  2PM6 B;  5HE3 B;  4HDJ A;  5TF2 A;  5IGO A;  2YNN A;  4JSX C;  3VA6 A;  4R7A B;  1PGU A;  2H9P A;  4BL0 A;  3I7K A;  4J73 A;  5EAM A;  4A08 A;  3OKY B;  2YB8 B;  3UVL A;  4X3E A;  4A09 B;  5EAR A;  2Q7Q A;  2W18 A;  3V7D B;  4CY3 A;  2B5N A;  2J55 H;  3JZG A;  3RLM D;  3UVO A;  3J81 g;  5I5I A;  2CE8 A;  3BG1 A;  4H5I A;  4PXW A;  5EMM B;  5C2W B;  4LGN A;  3EI4 B;  4L3G D;  2H9M A;  1GXR A;  4L1Q D;  5B4W A;  2YBA A;  3JRP A;  5FA5 B;  2AGW A;  3AL8 A;  1PI6 A;  3VH0 A;  2YMU A;  4ERQ A;  1FWX A;  2QC5 A;  4MK0 B;  4N14 A;  3CFS B;  3OKY A;  3SBQ A;  4A09 A;  3PXS D;  3V5W B;  3GFC A;  2J57 G;  2HYE A;  2TRC B;  3EMH A;  5A2Q g;  4ESG A;  5GXI A;  3MXX A;  4JXM A;  3GRE A;  4J87 A;  1MDA H;  1A0R B;  4CC9 A;  3RFH A;  2I3S A;  2UZY B;  2O9K A;  4A0A B;  3C9C A;  3DSM A;  1PEV A;  4L3H D;  2OVR B;  3C75 H;  5AJA A;  4JT6 C;  3FRX A;  3EWE A;  3JAM g;  1K8K C;  3NVQ A;  3I7H A;  4FA5 D;  4J79 A;  4H5J A;  3I7P A;  1JOF A;  4JSV C;  3JB9 L;  3SBR A;  3IJC A;  3N0E A;  5EMJ B;  4O9D A;  1YFQ A;  4TZ4 A;  4BH6 A;  4JD2 C;  4CZY A;  2B5L A;  2Z2O A;  4CZV A;  1GP2 B;  3PE7 A;  4PSX B;  1P22 A;  3K27 A;  2GNQ A;  4A0B B;  1SHY B;  3PSC B;  2OIZ A;  4O45 A;  5FLX g;  3HFQ A;  4CY5 A;  4CI2 A;  3AFC A;  2J56 H;  2IUR A;  1XKS A;  3MKQ A;  4A08 B;  3I7L A;  4D0K A;  1L0Q A;  4FHL A;  2G9A A;  5C2V B;  4ERY A;  4JT5 C;  2CN3 A;  4GQ1 A;  4QRJ A;  1PBY B;  1NEX B;  2H13 A;  5I5J A;  5K1C C;  4FAV D;  1U2V C;  5KDO B;  1Q47 A;  2P9U C;  4IA9 A;  5IT9 g;  4PBZ A;  3V9F A;  3OTT A;  2Z2P A;  2B5M A;  5FKQ A;  2G99 A;  5SXM A;  4GGD A;  5AFU 3;  4A0B A;  2H6N A;  3AL8 B;  3FGB A;  3I89 A;  3PVW B;  3IJ0 A;  3UVN A;  4G56 B;  4GGC A;  4U7A A;  4GMB A;  3L4O D;  1JMX B;  1XIP A;  3UVM A;  4X61 B;  1RI6 A;  5EMK B;  5K19 A;  4J0W A;  4FA1 D;  2HXC A;  4QT8 A;  4EWR A;  3UKR C;  5THA A;  2XL2 A;  4J8G A;  2CE9 A;  4D6V A;  5CXC B;  4A2L A;  3A0F A;  2HJB A;  5JWZ A;  3SN6 B;  5H1M A;  2H3X A;  4U1E I;  3CFV A;  4J78 A;  4QL1 A;  2BBK H;  4GGA A;  3I7O A;  4XYH A;  1K32 A;  3EG6 A;  2PM7 B;  1QNI A;  2P9S C;  4J8B A;  3C99 A;  4GM8 A;  3MZL A;  5EM2 A;  2P9L C;  4J0X A;  2Z2N A;  2B4E A;  4GZ8 A;  5IJ7 E;  3IIW A;  2GC4 A;  4A11 A;  2CN2 A;  2H9L A;  5FKR A;  3I7N A;  2H9N A;  5TDH B;  3SBP A;  4I79 A;  2AGX A;  3L4M D;  5CXC A;  4J84 A;  2XL3 A;  4BUJ C;  4OZU A;  2AH0 A;  4JSP C;  5C9Z B;  5EAL A;  3F3F A;  2QXV A;  1JMZ B;  1R5M A;  4QQE A;  4FB1 D;  3EI2 B;  3RFG A;  4PNK B;  2CNX A;  4CI1 A;  2EBS A;  3SFZ A;  4GQB B;  1OLZ A;  2GC7 A;  4PBY A;  3AH8 B;  3VGZ A;  3SLE D;  5IC7 A;  3K26 A;  4ZOY A;  4LG9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...