2XU7A

Structural basis for rbap48 binding to fog-1
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
395
structure length
360
Chain Sequence
VINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTFSIHRLVLGTHTSDEQNHLVIASVQLPNKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights Into Association of the Nurd Complex with Fog-1 from the Crystal Structure of an Rbap48-Fog- 1 Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords HISTONE-BINDING PROTEIN RBBP4
total genus 104
structure length 360
sequence length 395
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
A PF12265 CAF1C_H4-bd Histone-binding protein RBBP4 or subunit C of CAF1 complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2xu7A00
5C9ZB 3OW8A 2GC4A 4X63B 3SFZA 3BWSA 4O45A 4CY3A 3EG6A 3EI3B 3MZKA 2H9LA 3PE7A 3RFGA 2QXVA 5IGQA 4J84A 5FKTA 1B9XA 5TDHB 5IT9g 5CXCB 2OJYA 4J8BA 2P9PC 4CZVA 1QNIA 4XEIC 5FLXg 3JROA 5H14A 4GZ8A 2PBIB 4JT5C 4A2MA 3MZLA 2HJBA 2PM7B 3I7OA 3JZGA 2TRCB 3AH8B 1NR0A 1L0QA 5I5IA 5K1CC 5EMMB 3VH0A 1PBYB 1XHMA 2P9NC 4PSWB 3I7NA 5EALA 3GREA 3JPXA 4XYIA 3J80g 5IJ8E 4ZOYA 4H5IA 5EMKB 4J86A 4Y5RD 3ORVD 5CXBA 5CYKA 3SWSD 5FKSA 2G9AA 3IIYA 5GSAA 3KRWB 3EI1A 3MKSB 3RLMD 1U4CA 5CYKB 2CNXA 4Z8LA 2HXCA 4J0WA 4YVDA 3AFCA 4PNKB 5FXYA 5SXMA 4J87A 2CE8A 2O9KA 3VA6A 3RMZD 1XIPA 4J81A 5IC7A 1RI6A 4FAVD 3FRXA 2YNPA 3L4MD 5KDOB 4J78A 3DSMA 2IUVA 3SN6B 3RSEC 2EBSA 4A0AB 4PBZA 3SBQA 3BG0A 4J0XA 2H9PA 4A0AA 1PI6A 2CO0C 1K8KC 5AJAA 3EI3A 1P22A 2H13A 2YBAA 3EU7A 4X61B 2GC7A 4JSXC 4L3GD 3L4OD 2UZXB 2G99A 4L3HD 1JJUB 4QT8A 3IJCA 3MXXA 2I3SA 3B7FA 4JXMA 4K3JB 5EM2A 1JMXB 4BH6A 3PXSD 5HE2B 3SXTD 2I3TA 3SJLD 2Z2PA 3N0EA 4UI9R 3NVXA 4CZXA 2I0SA 4I79A 4A7JA 4FAND 2B4EA 2IUQA 5CXBB 3F3PA 2OK6A 4LG8A 3A0FA 4ERZA 4CI2A 2HESX 3SMRA 4K3ID 4O3UB 3E0CA 4QRJA 5EMLB 4CI8A 4ZN4A 4GGDA 4J79A 1Q47A 4CZYA 1ERJA 4IMMA 2B5NA 2PM9B 2P9KC 3NVQA 3V7DB 5JWZA 4U7AA 5H1MA 5EAPA 4A08A 4O9DA 4N14A 3UVNA 2QC5A 3PSLA 2XL2A 1YFQA 4A09A 4OZUA 4CY2A 4FB1D 3EI4B 4A09B 4FA9D 3EI1B 3I8CA 2J57G 4FA4D 2CO0A 3V9FA 3RRMC 3PVUB 2J56H 4A0BB 4LGNA 4E54A 3ZWLB 4GM3A 2IWKA 3IKOA 2UZYB 4J77A 3DXKC 4PSXB 1XKSA 4BL0A 5GXIA 1JMZB 4GQ1A 4L1QD 2OVQB 2IAAA 1NEXB 4CY5A 4BUJC 2HKMA 3FGBA 4JD2C 5CXCA 4R7AB 4GGAA 4E5ZA 3K26A 2P9SC 4LG9A 4A08B 5K19A 4PXWA 1SHYB 3F3FA 3C5MA 5HYNB 1PGUA 3OKTA 2MTAH 2PM9A 3EMHA 3EWEA 1GOTB 3IJ0A 4J82A 5C2WB 4CI3A 5TEFA 5AFU3 3OTTA 4E54B 3RN0D 1N6EA 2I0TA 4J73A 1GP2B 4D0KA 1TYQC 2Q7QA 5I5JA 1FWXA 4O3TB 5EARA 3JRPA 2Z2NA 4CI1A 4X3EA 3PVWB 2IWFA 4A11B 4H5JA 5TEEA 4ES0A 3PXTD 4IA9A 2H6NA 4EWRA 1JOFA 4GQBB 2AGLA 2YNOA 4GM8A 2Z2OA 3JB9L 3UVKA 5EM2B 2YMUA 4FA5D 5FKQA 4CY1A 2XU7A 4A0BA 5IJ7E 5FQDA 5B4WA 3I7KA 4ERYA 4FA1D 5EMJB 1VYHC 2AH0A 4OWRA 4A2LA 3V5WB 2H6KA 1GXRA 1N6DA 4JT6C 4JSPC 4D6VA 2OIZA 3EI4A 2YB8B 1MDAH 4KFMB 2GNQA 3MKQA 5C2VB 3ULEC 3JAMg 3F3GA 3J81g 3MMYA 2HJ4A 5GMKn 3IJ1A 3U4YA 4NSXA 4QL1A 3P4FA 2XYIA 2J55H 5IGOA 3DM0A 3OKYA 4TZ4A 5EAMA 2H6QA 5HE3B 3FM0A 2BCJB 3N0DA 3NVNA 3I89A 2HYEA 4ZOXA 2AQ5A 3I7PA 2CN2A 3SBPA 3GFCA 1S4UX 5HE1B 2W18A 4AEZA 1MG2A 2CE9A 1MG3A 3KRXB 3W15A 4PC0A 2AGWA 4ESGA 4JSNC 3SLED 2H14A 2BBKH 3SCYA 5I5MA 2AGYA 2B5MA 5FKRA 3UVMA 3K27A 3AL8A 3HFQA 2CN3A 2H3XA 2IURA 4GM9A 5H17A 4JSVC 2XL3A 1TBGA 2H9MA 4AOWA 4GQ2P 4A11A 2PM6B 2IUPA 1GG2B 1B9YA 3ODTA 1U2VC 3RFHA 3EI2B 3UKUC 2B5LA 3CIKB 3OL2A 2AGZA 3PSCB 3C99A 5THAA 1N6FA 3OKYB 4QQEA 4ERQA 3OKWA 4ZOZA 4U1EI 2OK4A 2YNNA 3SVWD 3UVLA 3C9CA 4XYHA 4ZOVA 4J8GA 1SQJA 2OVRB 3UKRC 2I0RA 3I8EA 2H68A 2AH1A 3BG1A 4FWWA 1OLZA 5HE0B 3I7HA 1A0RB 3UVOA 4E5ZB 4X60B 4Y7RA 3EI2A 5GXHA 5AMSA 1R5MA 4GMBA 4GGCA 2AGXA 3UR4A 4HDJA 4CC9A 4FHLA 3I2NA 1OMWB 2OVPB 5HQGA 3SHFA 1K32A 2H9NA 3I7LA 5A2Qg 2P9UC 3OL2B 3AL8B 4L9OA 3VGZA 4MK0B 2P9LC 3CFSB 3RN1D 3PXWD 4G56B 3CFVA 3DWLC 3C75H 3IIWA 2P9IC 3JZHA 2HKRA 1PEVA 1SQ9A 3AL9A 4O1QD 5FA5B 4PBYA 2H47A 3DXMC 3SBRA 3JZNA 5TF2A
chains in the Genus database with same CATH superfamily
5C9ZB 3OW8A 1GOHA 2GC4A 4X63B 3SFZA 3BWSA 4O45A 4AMYA 4CY3A 3EG6A 3EI3B 3MZKA 2H9LA 1E8NA 3PE7A 3RFGA 3K72A 1GOGA 2QXVA 5IGQA 1JV2A 4J84A 5FKTA 1QFSA 5FFGA 1B9XA 4WK2A 5TDHB 5IT9g 5CXCB 2OJYA 4J8BA 1VZ2A 2P9PC 4CZVA 1QNIA 4XEIC 5FLXg 3JROA 5H14A 4GZ8A 2PBIB 4JT5C 4NENA 4A2MA 3MZLA 1T2XA 3O4GA 2HJBA 2PM7B 3I7OA 1E5TA 3JZGA 2TRCB 5E6UA 3AH8B 1L0QA 1NR0A 5I5IA 5K1CC 5EMMB 2QZPA 1PBYB 3VH0A 4BP8A 3DDUA 1XHMA 2P9NC 4PSWB 3I7NA 5EALA 4JHPC 3GREA 3JPXA 4XYIA 3O4JA 3J80g 5IJ8E 4RE5A 4ZOYA 4NAAA 4Z7NA 4H5IA 5EMKB 4J86A 4Y5RD 3ORVD 5CXBA 5CYKA 3SWSD 5FKSA 2G9AA 3IIYA 4DNVA 5GSAA 3KRWB 3EI1A 3MKSB 3RLMD 1U4CA 4BP9A 5CYKB 2CNXA 3OF7A 4Z8LA 2HXCA 4J0WA 2XZGA 1H2WA 4YVDA 4QAMA 3AFCA 4PNKB 5FXYA 5SXMA 4J87A 3ZE0A 2CE8A 2O9KA 3VA6A 3RMZD 1XIPA 4J81A 5IC7A 1RI6A 4FAVD 3FRXA 2YNPA 3L4MD 5KDOB 4J78A 3DSMA 2IUVA 3SN6B 3RSEC 2EBSA 1H2XA 4A0AB 4PBZA 4G55A 3SBQA 3BG0A 5M5SA 4J0XA 2H9PA 3FCUA 4A0AA 1PI6A 2CO0C 3GC3B 1K8KC 5AJAA 3V4PA 1VZ3A 3EI3A 1P22A 1UOOA 2H13A 4Z7QA 2YBAA 3EU7A 4X61B 2GC7A 4JSXC 4L3GD 3L4OD 2UZXB 2G99A 1I2MB 4NBMA 4L3HD 1JJUB 2EIBA 3IJCA 3MXXA 4K3JB 2I3SA 3B7FA 4JXMA 4QT8A 5EM2A 1JMXB 3ZE1A 4BH6A 3PXSD 5HE2B 3SXTD 2I3TA 3SJLD 2Z2PA 4BCDA 3N0EA 4UI9R 4G1EA 3NVXA 4CZXA 4BCCA 2I0SA 4I79A 4A7JA 4FAND 2B4EA 2IUQA 5CXBB 5E6SA 5HDBA 3F3PA 2OK6A 3IUQA 3A0FA 4LG8A 4CI2A 4ERZA 2HESX 4WJKA 3SMRA 4K3ID 4O3UB 3E0CA 4QRJA 5EMLB 4CI8A 4ZN4A 1O6FA 4GGDA 5FFOA 4J79A 1Q47A 3MUOA 4CZYA 1ERJA 4IMMA 2VDKA 2B5NA 2PM9B 2P9KC 3NVQA 3V7DB 5JWZA 4U7AA 3EQ7A 3ZE2A 5H1MA 5M61A 5EAPA 4A08A 4O9DA 2QR5A 4N14A 3UVNA 4DNUA 3PSLA 2QC5A 2XL2A 4MMYA 1YFQA 4A09A 4OZUA 4CY2A 4FB1D 3EI4B 4A09B 4FA9D 3EI1B 3I8CA 2J57G 4FA4D 2CO0A 3V9FA 4AX4A 3RRMC 4BCBA 3PVUB 2J56H 4A0BB 4LGNA 4E54A 3ZWLB 5E6RA 4GM3A 2IWKA 3IKOA 2UZYB 4J77A 3DXKC 3T3PA 4PSXB 1XKSA 4BL0A 5GXIA 1JMZB 4GQ1A 4L1QD 3GD1I 2HU8A 4WK4A 2OVQB 2IAAA 3IULA 1NEXB 4CY5A 4BUJC 2HKMA 3FGBA 4JD2C 1YR2A 2VDRA 5CXCA 5M5UA 1H2YA 4R7AB 4GGAA 3K6SA 4E5ZA 3K26A 2P9SC 4LG9A 4A08B 5K19A 4PXWA 1SHYB 3F3FA 3C5MA 5HYNB 1PGUA 4L1MA 4IRZA 3OKTA 4Z7OA 2BKLA 2MTAH 2PM9A 1K3IA 3EMHA 3EWEA 1GOTB 3IJ0A 4J82A 5C2WB 4CI3A 5TEFA 3ZDXA 5AFU3 3OTTA 4MMXA 4E54B 3RN0D 3EQ8A 1N6EA 2I0TA 4UM9A 4J73A 3NIFA 1GP2B 4D0KA 3O4HA 4AMZA 1TYQC 2Q7QA 3IUJA 2VDNA 5I5JA 1FWXA 4O3TB 2EICA 3QHYB 5EARA 3JRPA 2Z2NA 4CI1A 4X3EA 3PVWB 2IWFA 4A11B 4H5JA 5TEEA 4UM8A 4ES0A 3PXTD 4IA9A 2H6NA 4EWRA 1JOFA 3ZDYA 4GQBB 2AGLA 2YNOA 4GM8A 2Z2OA 2EIEA 3JB9L 3UVKA 4AN0A 5EM2B 2YMUA 4FA5D 5FKQA 4CY1A 3IVMA 2XU7A 4A0BA 5IJ7E 5FQDA 4O02A 5B4WA 3FCSA 3I7KA 4ERYA 4FA1D 5EMJB 1VYHC 2AH0A 4OWRA 4A2LA 3V5WB 2H6KA 2VZ3A 3KCIA 3ZDZA 1GXRA 1N6DA 4JT6C 4JHNA 4JSPC 4D6VA 1L5GA 2OIZA 1UTCA 3EI4A 4NC4A 2YB8B 1MDAH 1C9LA 4KFMB 2GNQA 3MKQA 5C2VB 3ULEC 3JAMg 3F3GA 1VE7A 4MMZA 3J81g 3MMYA 1UOPA 2HJ4A 3IURA 5GMKn 3IJ1A 3U4YA 4NSXA 4QL1A 3P4FA 2XYIA 2J55H 5IGOA 3DM0A 3OKYA 4TZ4A 2HU5A 5EAMA 2H6QA 5HE3B 3FM0A 3N0DA 2BCJB 1O6GA 3NVNA 3I89A 2HYEA 3QI0A 4ZOXA 1UOQA 2AQ5A 3I7PA 2CN2A 3SBPA 1VE6A 3GFCA 1S4UX 5HE1B 2W18A 3VI4A 4AEZA 1MG2A 1H2ZA 2CE9A 1MG3A 3KRXB 3W15A 4PC0A 5M5RA 2AGWA 4ESGA 2VDOA 4JSNC 3SLED 2H14A 3VI3A 2BBKH 3SCYA 5I5MA 2AGYA 2B5MA 1C9IA 5FKRA 3UVMA 3NIGA 5M5TA 3K27A 3AL8A 3HFQA 5C86A 2CN3A 2H3XA 2IURA 1E8MA 4GM9A 5H17A 4JSVC 2XL3A 1TBGA 2H9MA 4AOWA 4GQ2P 4A11A 2PM6B 2IUPA 1GG2B 1B9YA 3ODTA 1U2VC 5C92A 2VDQA 3RFHA 3EI2B 3UKUC 2B5LA 3CIKB 4G1MA 3OL2A 2XDWA 2AGZA 3PSCB 3C99A 5THAA 1N6FA 2VDLA 3OKYB 4QQEA 4ERQA 3OKWA 4ZOZA 4U1EI 2OK4A 2VZ1A 2YNNA 3SVWD 3UVLA 1A12A 3C9CA 4XYHA 4ZOVA 2EIDA 4J8GA 1SQJA 2OVRB 4RE6A 3UKRC 3T3MA 2I0RA 3I8EA 2H68A 1BPOA 2AH1A 1QFMA 3BG1A 3MUNA 4FWWA 3V4VA 1OLZA 3IUMA 5HE0B 3IJEA 3I7HA 1A0RB 2VDPA 3UVOA 4E5ZB 2XE4A 4X60B 1U8CA 4Y7RA 3EI2A 5GXHA 5AMSA 1R5MA 4DNWA 4GMBA 4GGCA 2AGXA 2VC2A 3O4IA 3MVDK 3UR4A 4HDJA 4CC9A 4FHLA 4O2WA 1M1XA 3NIDA 2JKXA 2WQ8A 3I2NA 2VDMA 1OMWB 2OVPB 2HU7A 5HQGA 4WK0A 3SHFA 4D9SA 1K32A 2H9NA 3I7LA 1JTDB 5A2Qg 3IUNA 2P9UC 3OL2B 4AN1A 3AL8B 4L9OA 3VGZA 4MK0B 2P9LC 3CFSB 3RN1D 3PXWD 1GOFA 4G56B 3CFVA 3DWLC 3C75H 3IIWA 2P9IC 3JZHA 2HKRA 1PEVA 1SQ9A 3AL9A 3K71A 4O1QD 5M5VA 1TYEA 5FA5B 4PBYA 2H47A 3DXMC 3SBRA 3JZNA 3EQ9A 5TF2A
chains in the Genus database with same CATH topology
5C9ZB 3OW8A 2GC4A 4X63B 3SFZA 3BWSA 4O45A 4CY3A 3EG6A 3EI3B 3MZKA 2H9LA 3PE7A 3RFGA 2QXVA 5IGQA 4J84A 5FKTA 1B9XA 5TDHB 5IT9g 5CXCB 2OJYA 4J8BA 2P9PC 4CZVA 1QNIA 4XEIC 5FLXg 3JROA 5H14A 4GZ8A 2PBIB 4JT5C 4A2MA 3MZLA 2HJBA 2PM7B 3I7OA 3JZGA 2TRCB 3AH8B 1NR0A 1L0QA 5I5IA 5K1CC 5EMMB 3VH0A 1PBYB 1XHMA 2P9NC 4PSWB 3I7NA 5EALA 3GREA 3JPXA 4XYIA 3J80g 5IJ8E 4ZOYA 4H5IA 5EMKB 4J86A 4Y5RD 3ORVD 5CXBA 5CYKA 3SWSD 5FKSA 2G9AA 3IIYA 5GSAA 3KRWB 3EI1A 3MKSB 3RLMD 1U4CA 5CYKB 2CNXA 4Z8LA 2HXCA 4J0WA 4YVDA 3AFCA 4PNKB 5FXYA 5SXMA 4J87A 2CE8A 2O9KA 3VA6A 3RMZD 1XIPA 4J81A 5IC7A 1RI6A 4FAVD 3FRXA 2YNPA 3L4MD 5KDOB 4J78A 3DSMA 2IUVA 3SN6B 3RSEC 2EBSA 4A0AB 4PBZA 3SBQA 3BG0A 4J0XA 2H9PA 4A0AA 1PI6A 2CO0C 1K8KC 5AJAA 3EI3A 1P22A 2H13A 2YBAA 3EU7A 4X61B 2GC7A 4JSXC 4L3GD 3L4OD 2UZXB 2G99A 4L3HD 1JJUB 4QT8A 3IJCA 3MXXA 2I3SA 3B7FA 4JXMA 4K3JB 5EM2A 1JMXB 4BH6A 3PXSD 5HE2B 3SXTD 2I3TA 3SJLD 2Z2PA 3N0EA 4UI9R 3NVXA 4CZXA 2I0SA 4I79A 4A7JA 4FAND 2B4EA 2IUQA 5CXBB 3F3PA 2OK6A 4LG8A 3A0FA 4ERZA 4CI2A 2HESX 3SMRA 4K3ID 4O3UB 3E0CA 4QRJA 5EMLB 4CI8A 4ZN4A 4GGDA 4J79A 1Q47A 4CZYA 1ERJA 4IMMA 2B5NA 2PM9B 2P9KC 3NVQA 3V7DB 5JWZA 4U7AA 5H1MA 5EAPA 4A08A 4O9DA 4N14A 3UVNA 2QC5A 3PSLA 2XL2A 1YFQA 4A09A 4OZUA 4CY2A 4FB1D 3EI4B 4A09B 4FA9D 3EI1B 3I8CA 2J57G 4FA4D 2CO0A 3V9FA 3RRMC 3PVUB 2J56H 4A0BB 4LGNA 4E54A 3ZWLB 4GM3A 2IWKA 3IKOA 2UZYB 4J77A 3DXKC 4PSXB 1XKSA 4BL0A 5GXIA 1JMZB 4GQ1A 4L1QD 2OVQB 2IAAA 1NEXB 4CY5A 4BUJC 2HKMA 3FGBA 4JD2C 5CXCA 4R7AB 4GGAA 4E5ZA 3K26A 2P9SC 4LG9A 4A08B 5K19A 4PXWA 1SHYB 3F3FA 3C5MA 5HYNB 1PGUA 3OKTA 2MTAH 2PM9A 3EMHA 3EWEA 1GOTB 3IJ0A 4J82A 5C2WB 4CI3A 5TEFA 5AFU3 3OTTA 4E54B 3RN0D 1N6EA 2I0TA 4J73A 1GP2B 4D0KA 1TYQC 2Q7QA 5I5JA 1FWXA 4O3TB 5EARA 3JRPA 2Z2NA 4CI1A 4X3EA 3PVWB 2IWFA 4A11B 4H5JA 5TEEA 4ES0A 3PXTD 4IA9A 2H6NA 4EWRA 1JOFA 4GQBB 2AGLA 2YNOA 4GM8A 2Z2OA 3JB9L 3UVKA 5EM2B 2YMUA 4FA5D 5FKQA 4CY1A 2XU7A 4A0BA 5IJ7E 5FQDA 5B4WA 3I7KA 4ERYA 4FA1D 5EMJB 1VYHC 2AH0A 4OWRA 4A2LA 3V5WB 2H6KA 1GXRA 1N6DA 4JT6C 4JSPC 4D6VA 2OIZA 3EI4A 2YB8B 1MDAH 4KFMB 2GNQA 3MKQA 5C2VB 3ULEC 3JAMg 3F3GA 3J81g 3MMYA 2HJ4A 5GMKn 3IJ1A 3U4YA 4NSXA 4QL1A 3P4FA 2XYIA 2J55H 5IGOA 3DM0A 3OKYA 4TZ4A 5EAMA 2H6QA 5HE3B 3FM0A 2BCJB 3N0DA 3NVNA 3I89A 2HYEA 4ZOXA 2AQ5A 3I7PA 2CN2A 3SBPA 3GFCA 1S4UX 5HE1B 2W18A 4AEZA 1MG2A 2CE9A 1MG3A 3KRXB 3W15A 4PC0A 2AGWA 4ESGA 4JSNC 3SLED 2H14A 2BBKH 3SCYA 5I5MA 2AGYA 2B5MA 5FKRA 3UVMA 3K27A 3AL8A 3HFQA 2CN3A 2H3XA 2IURA 4GM9A 5H17A 4JSVC 2XL3A 1TBGA 2H9MA 4AOWA 4GQ2P 4A11A 2PM6B 2IUPA 1GG2B 1B9YA 3ODTA 1U2VC 3RFHA 3EI2B 3UKUC 2B5LA 3CIKB 3OL2A 2AGZA 3PSCB 3C99A 5THAA 1N6FA 3OKYB 4QQEA 4ERQA 3OKWA 4ZOZA 4U1EI 2OK4A 2YNNA 3SVWD 3UVLA 3C9CA 4XYHA 4ZOVA 4J8GA 1SQJA 2OVRB 3UKRC 2I0RA 3I8EA 2H68A 2AH1A 3BG1A 4FWWA 1OLZA 5HE0B 3I7HA 1A0RB 3UVOA 4E5ZB 4X60B 4Y7RA 3EI2A 5GXHA 5AMSA 1R5MA 4GMBA 4GGCA 2AGXA 3UR4A 4HDJA 4CC9A 4FHLA 3I2NA 1OMWB 2OVPB 5HQGA 3SHFA 1K32A 2H9NA 3I7LA 5A2Qg 2P9UC 3OL2B 3AL8B 4L9OA 3VGZA 4MK0B 2P9LC 3CFSB 3RN1D 3PXWD 4G56B 3CFVA 3DWLC 3C75H 3IIWA 2P9IC 3JZHA 2HKRA 1PEVA 1SQ9A 3AL9A 4O1QD 5FA5B 4PBYA 2H47A 3DXMC 3SBRA 3JZNA 5TF2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C9Z B;  3OW8 A;  2GC4 A;  4X63 B;  3SFZ A;  3BWS A;  4O45 A;  4CY3 A;  3EG6 A;  3EI3 B;  3MZK A;  2H9L A;  3PE7 A;  3RFG A;  2QXV A;  5IGQ A;  4J84 A;  5FKT A;  1B9X A;  5TDH B;  5IT9 g;  5CXC B;  2OJY A;  4J8B A;  2P9P C;  4CZV A;  1QNI A;  4XEI C;  5FLX g;  3JRO A;  5H14 A;  4GZ8 A;  2PBI B;  4JT5 C;  4A2M A;  3MZL A;  2HJB A;  2PM7 B;  3I7O A;  3JZG A;  2TRC B;  3AH8 B;  1NR0 A;  1L0Q A;  5I5I A;  5K1C C;  5EMM B;  3VH0 A;  1PBY B;  1XHM A;  2P9N C;  4PSW B;  3I7N A;  5EAL A;  3GRE A;  3JPX A;  4XYI A;  3J80 g;  5IJ8 E;  4ZOY A;  4H5I A;  5EMK B;  4J86 A;  4Y5R D;  3ORV D;  5CXB A;  5CYK A;  3SWS D;  5FKS A;  2G9A A;  3IIY A;  5GSA A;  3KRW B;  3EI1 A;  3MKS B;  3RLM D;  1U4C A;  5CYK B;  2CNX A;  4Z8L A;  2HXC A;  4J0W A;  4YVD A;  3AFC A;  4PNK B;  5FXY A;  5SXM A;  4J87 A;  2CE8 A;  2O9K A;  3VA6 A;  3RMZ D;  1XIP A;  4J81 A;  5IC7 A;  1RI6 A;  4FAV D;  3FRX A;  2YNP A;  3L4M D;  5KDO B;  4J78 A;  3DSM A;  2IUV A;  3SN6 B;  3RSE C;  2EBS A;  4A0A B;  4PBZ A;  3SBQ A;  3BG0 A;  4J0X A;  2H9P A;  4A0A A;  1PI6 A;  2CO0 C;  1K8K C;  5AJA A;  3EI3 A;  1P22 A;  2H13 A;  2YBA A;  3EU7 A;  4X61 B;  2GC7 A;  4JSX C;  4L3G D;  3L4O D;  2UZX B;  2G99 A;  4L3H D;  1JJU B;  4QT8 A;  3IJC A;  3MXX A;  2I3S A;  3B7F A;  4JXM A;  4K3J B;  5EM2 A;  1JMX B;  4BH6 A;  3PXS D;  5HE2 B;  3SXT D;  2I3T A;  3SJL D;  2Z2P A;  3N0E A;  4UI9 R;  3NVX A;  4CZX A;  2I0S A;  4I79 A;  4A7J A;  4FAN D;  2B4E A;  2IUQ A;  5CXB B;  3F3P A;  2OK6 A;  4LG8 A;  3A0F A;  4ERZ A;  4CI2 A;  2HES X;  3SMR A;  4K3I D;  4O3U B;  3E0C A;  4QRJ A;  5EML B;  4CI8 A;  4ZN4 A;  4GGD A;  4J79 A;  1Q47 A;  4CZY A;  1ERJ A;  4IMM A;  2B5N A;  2PM9 B;  2P9K C;  3NVQ A;  3V7D B;  5JWZ A;  4U7A A;  5H1M A;  5EAP A;  4A08 A;  4O9D A;  4N14 A;  3UVN A;  2QC5 A;  3PSL A;  2XL2 A;  1YFQ A;  4A09 A;  4OZU A;  4CY2 A;  4FB1 D;  3EI4 B;  4A09 B;  4FA9 D;  3EI1 B;  3I8C A;  2J57 G;  4FA4 D;  2CO0 A;  3V9F A;  3RRM C;  3PVU B;  2J56 H;  4A0B B;  4LGN A;  4E54 A;  3ZWL B;  4GM3 A;  2IWK A;  3IKO A;  2UZY B;  4J77 A;  3DXK C;  4PSX B;  1XKS A;  4BL0 A;  5GXI A;  1JMZ B;  4GQ1 A;  4L1Q D;  2OVQ B;  2IAA A;  1NEX B;  4CY5 A;  4BUJ C;  2HKM A;  3FGB A;  4JD2 C;  5CXC A;  4R7A B;  4GGA A;  4E5Z A;  3K26 A;  2P9S C;  4LG9 A;  4A08 B;  5K19 A;  4PXW A;  1SHY B;  3F3F A;  3C5M A;  5HYN B;  1PGU A;  3OKT A;  2MTA H;  2PM9 A;  3EMH A;  3EWE A;  1GOT B;  3IJ0 A;  4J82 A;  5C2W B;  4CI3 A;  5TEF A;  5AFU 3;  3OTT A;  4E54 B;  3RN0 D;  1N6E A;  2I0T A;  4J73 A;  1GP2 B;  4D0K A;  1TYQ C;  2Q7Q A;  5I5J A;  1FWX A;  4O3T B;  5EAR A;  3JRP A;  2Z2N A;  4CI1 A;  4X3E A;  3PVW B;  2IWF A;  4A11 B;  4H5J A;  5TEE A;  4ES0 A;  3PXT D;  4IA9 A;  2H6N A;  4EWR A;  1JOF A;  4GQB B;  2AGL A;  2YNO A;  4GM8 A;  2Z2O A;  3JB9 L;  3UVK A;  5EM2 B;  2YMU A;  4FA5 D;  5FKQ A;  4CY1 A;  2XU7 A;  4A0B A;  5IJ7 E;  5FQD A;  5B4W A;  3I7K A;  4ERY A;  4FA1 D;  5EMJ B;  1VYH C;  2AH0 A;  4OWR A;  4A2L A;  3V5W B;  2H6K A;  1GXR A;  1N6D A;  4JT6 C;  4JSP C;  4D6V A;  2OIZ A;  3EI4 A;  2YB8 B;  1MDA H;  4KFM B;  2GNQ A;  3MKQ A;  5C2V B;  3ULE C;  3JAM g;  3F3G A;  3J81 g;  3MMY A;  2HJ4 A;  5GMK n;  3IJ1 A;  3U4Y A;  4NSX A;  4QL1 A;  3P4F A;  2XYI A;  2J55 H;  5IGO A;  3DM0 A;  3OKY A;  4TZ4 A;  5EAM A;  2H6Q A;  5HE3 B;  3FM0 A;  2BCJ B;  3N0D A;  3NVN A;  3I89 A;  2HYE A;  4ZOX A;  2AQ5 A;  3I7P A;  2CN2 A;  3SBP A;  3GFC A;  1S4U X;  5HE1 B;  2W18 A;  4AEZ A;  1MG2 A;  2CE9 A;  1MG3 A;  3KRX B;  3W15 A;  4PC0 A;  2AGW A;  4ESG A;  4JSN C;  3SLE D;  2H14 A;  2BBK H;  3SCY A;  5I5M A;  2AGY A;  2B5M A;  5FKR A;  3UVM A;  3K27 A;  3AL8 A;  3HFQ A;  2CN3 A;  2H3X A;  2IUR A;  4GM9 A;  5H17 A;  4JSV C;  2XL3 A;  1TBG A;  2H9M A;  4AOW A;  4GQ2 P;  4A11 A;  2PM6 B;  2IUP A;  1GG2 B;  1B9Y A;  3ODT A;  1U2V C;  3RFH A;  3EI2 B;  3UKU C;  2B5L A;  3CIK B;  3OL2 A;  2AGZ A;  3PSC B;  3C99 A;  5THA A;  1N6F A;  3OKY B;  4QQE A;  4ERQ A;  3OKW A;  4ZOZ A;  4U1E I;  2OK4 A;  2YNN A;  3SVW D;  3UVL A;  3C9C A;  4XYH A;  4ZOV A;  4J8G A;  1SQJ A;  2OVR B;  3UKR C;  2I0R A;  3I8E A;  2H68 A;  2AH1 A;  3BG1 A;  4FWW A;  1OLZ A;  5HE0 B;  3I7H A;  1A0R B;  3UVO A;  4E5Z B;  4X60 B;  4Y7R A;  3EI2 A;  5GXH A;  5AMS A;  1R5M A;  4GMB A;  4GGC A;  2AGX A;  3UR4 A;  4HDJ A;  4CC9 A;  4FHL A;  3I2N A;  1OMW B;  2OVP B;  5HQG A;  3SHF A;  1K32 A;  2H9N A;  3I7L A;  5A2Q g;  2P9U C;  3OL2 B;  3AL8 B;  4L9O A;  3VGZ A;  4MK0 B;  2P9L C;  3CFS B;  3RN1 D;  3PXW D;  4G56 B;  3CFV A;  3DWL C;  3C75 H;  3IIW A;  2P9I C;  3JZH A;  2HKR A;  1PEV A;  1SQ9 A;  3AL9 A;  4O1Q D;  5FA5 B;  4PBY A;  2H47 A;  3DXM C;  3SBR A;  3JZN A;  5TF2 A; 
#chains in the Genus database with same CATH topology
 5C9Z B;  3OW8 A;  1GOH A;  2GC4 A;  4X63 B;  3SFZ A;  3BWS A;  4O45 A;  4AMY A;  4CY3 A;  3EG6 A;  3EI3 B;  3MZK A;  2H9L A;  1E8N A;  3PE7 A;  3RFG A;  3K72 A;  1GOG A;  2QXV A;  5IGQ A;  1JV2 A;  4J84 A;  5FKT A;  1QFS A;  5FFG A;  1B9X A;  4WK2 A;  5TDH B;  5IT9 g;  5CXC B;  2OJY A;  4J8B A;  1VZ2 A;  2P9P C;  4CZV A;  1QNI A;  4XEI C;  5FLX g;  3JRO A;  5H14 A;  4GZ8 A;  2PBI B;  4JT5 C;  4NEN A;  4A2M A;  3MZL A;  1T2X A;  3O4G A;  2HJB A;  2PM7 B;  3I7O A;  1E5T A;  3JZG A;  2TRC B;  5E6U A;  3AH8 B;  1L0Q A;  1NR0 A;  5I5I A;  5K1C C;  5EMM B;  2QZP A;  1PBY B;  3VH0 A;  4BP8 A;  3DDU A;  1XHM A;  2P9N C;  4PSW B;  3I7N A;  5EAL A;  4JHP C;  3GRE A;  3JPX A;  4XYI A;  3O4J A;  3J80 g;  5IJ8 E;  4RE5 A;  4ZOY A;  4NAA A;  4Z7N A;  4H5I A;  5EMK B;  4J86 A;  4Y5R D;  3ORV D;  5CXB A;  5CYK A;  3SWS D;  5FKS A;  2G9A A;  3IIY A;  4DNV A;  5GSA A;  3KRW B;  3EI1 A;  3MKS B;  3RLM D;  1U4C A;  4BP9 A;  5CYK B;  2CNX A;  3OF7 A;  4Z8L A;  2HXC A;  4J0W A;  2XZG A;  1H2W A;  4YVD A;  4QAM A;  3AFC A;  4PNK B;  5FXY A;  5SXM A;  4J87 A;  3ZE0 A;  2CE8 A;  2O9K A;  3VA6 A;  3RMZ D;  1XIP A;  4J81 A;  5IC7 A;  1RI6 A;  4FAV D;  3FRX A;  2YNP A;  3L4M D;  5KDO B;  4J78 A;  3DSM A;  2IUV A;  3SN6 B;  3RSE C;  2EBS A;  1H2X A;  4A0A B;  4PBZ A;  4G55 A;  3SBQ A;  3BG0 A;  5M5S A;  4J0X A;  2H9P A;  3FCU A;  4A0A A;  1PI6 A;  2CO0 C;  3GC3 B;  1K8K C;  5AJA A;  3V4P A;  1VZ3 A;  3EI3 A;  1P22 A;  1UOO A;  2H13 A;  4Z7Q A;  2YBA A;  3EU7 A;  4X61 B;  2GC7 A;  4JSX C;  4L3G D;  3L4O D;  2UZX B;  2G99 A;  1I2M B;  4NBM A;  4L3H D;  1JJU B;  2EIB A;  3IJC A;  3MXX A;  4K3J B;  2I3S A;  3B7F A;  4JXM A;  4QT8 A;  5EM2 A;  1JMX B;  3ZE1 A;  4BH6 A;  3PXS D;  5HE2 B;  3SXT D;  2I3T A;  3SJL D;  2Z2P A;  4BCD A;  3N0E A;  4UI9 R;  4G1E A;  3NVX A;  4CZX A;  4BCC A;  2I0S A;  4I79 A;  4A7J A;  4FAN D;  2B4E A;  2IUQ A;  5CXB B;  5E6S A;  5HDB A;  3F3P A;  2OK6 A;  3IUQ A;  3A0F A;  4LG8 A;  4CI2 A;  4ERZ A;  2HES X;  4WJK A;  3SMR A;  4K3I D;  4O3U B;  3E0C A;  4QRJ A;  5EML B;  4CI8 A;  4ZN4 A;  1O6F A;  4GGD A;  5FFO A;  4J79 A;  1Q47 A;  3MUO A;  4CZY A;  1ERJ A;  4IMM A;  2VDK A;  2B5N A;  2PM9 B;  2P9K C;  3NVQ A;  3V7D B;  5JWZ A;  4U7A A;  3EQ7 A;  3ZE2 A;  5H1M A;  5M61 A;  5EAP A;  4A08 A;  4O9D A;  2QR5 A;  4N14 A;  3UVN A;  4DNU A;  3PSL A;  2QC5 A;  2XL2 A;  4MMY A;  1YFQ A;  4A09 A;  4OZU A;  4CY2 A;  4FB1 D;  3EI4 B;  4A09 B;  4FA9 D;  3EI1 B;  3I8C A;  2J57 G;  4FA4 D;  2CO0 A;  3V9F A;  4AX4 A;  3RRM C;  4BCB A;  3PVU B;  2J56 H;  4A0B B;  4LGN A;  4E54 A;  3ZWL B;  5E6R A;  4GM3 A;  2IWK A;  3IKO A;  2UZY B;  4J77 A;  3DXK C;  3T3P A;  4PSX B;  1XKS A;  4BL0 A;  5GXI A;  1JMZ B;  4GQ1 A;  4L1Q D;  3GD1 I;  2HU8 A;  4WK4 A;  2OVQ B;  2IAA A;  3IUL A;  1NEX B;  4CY5 A;  4BUJ C;  2HKM A;  3FGB A;  4JD2 C;  1YR2 A;  2VDR A;  5CXC A;  5M5U A;  1H2Y A;  4R7A B;  4GGA A;  3K6S A;  4E5Z A;  3K26 A;  2P9S C;  4LG9 A;  4A08 B;  5K19 A;  4PXW A;  1SHY B;  3F3F A;  3C5M A;  5HYN B;  1PGU A;  4L1M A;  4IRZ A;  3OKT A;  4Z7O A;  2BKL A;  2MTA H;  2PM9 A;  1K3I A;  3EMH A;  3EWE A;  1GOT B;  3IJ0 A;  4J82 A;  5C2W B;  4CI3 A;  5TEF A;  3ZDX A;  5AFU 3;  3OTT A;  4MMX A;  4E54 B;  3RN0 D;  3EQ8 A;  1N6E A;  2I0T A;  4UM9 A;  4J73 A;  3NIF A;  1GP2 B;  4D0K A;  3O4H A;  4AMZ A;  1TYQ C;  2Q7Q A;  3IUJ A;  2VDN A;  5I5J A;  1FWX A;  4O3T B;  2EIC A;  3QHY B;  5EAR A;  3JRP A;  2Z2N A;  4CI1 A;  4X3E A;  3PVW B;  2IWF A;  4A11 B;  4H5J A;  5TEE A;  4UM8 A;  4ES0 A;  3PXT D;  4IA9 A;  2H6N A;  4EWR A;  1JOF A;  3ZDY A;  4GQB B;  2AGL A;  2YNO A;  4GM8 A;  2Z2O A;  2EIE A;  3JB9 L;  3UVK A;  4AN0 A;  5EM2 B;  2YMU A;  4FA5 D;  5FKQ A;  4CY1 A;  3IVM A;  2XU7 A;  4A0B A;  5IJ7 E;  5FQD A;  4O02 A;  5B4W A;  3FCS A;  3I7K A;  4ERY A;  4FA1 D;  5EMJ B;  1VYH C;  2AH0 A;  4OWR A;  4A2L A;  3V5W B;  2H6K A;  2VZ3 A;  3KCI A;  3ZDZ A;  1GXR A;  1N6D A;  4JT6 C;  4JHN A;  4JSP C;  4D6V A;  1L5G A;  2OIZ A;  1UTC A;  3EI4 A;  4NC4 A;  2YB8 B;  1MDA H;  1C9L A;  4KFM B;  2GNQ A;  3MKQ A;  5C2V B;  3ULE C;  3JAM g;  3F3G A;  1VE7 A;  4MMZ A;  3J81 g;  3MMY A;  1UOP A;  2HJ4 A;  3IUR A;  5GMK n;  3IJ1 A;  3U4Y A;  4NSX A;  4QL1 A;  3P4F A;  2XYI A;  2J55 H;  5IGO A;  3DM0 A;  3OKY A;  4TZ4 A;  2HU5 A;  5EAM A;  2H6Q A;  5HE3 B;  3FM0 A;  3N0D A;  2BCJ B;  1O6G A;  3NVN A;  3I89 A;  2HYE A;  3QI0 A;  4ZOX A;  1UOQ A;  2AQ5 A;  3I7P A;  2CN2 A;  3SBP A;  1VE6 A;  3GFC A;  1S4U X;  5HE1 B;  2W18 A;  3VI4 A;  4AEZ A;  1MG2 A;  1H2Z A;  2CE9 A;  1MG3 A;  3KRX B;  3W15 A;  4PC0 A;  5M5R A;  2AGW A;  4ESG A;  2VDO A;  4JSN C;  3SLE D;  2H14 A;  3VI3 A;  2BBK H;  3SCY A;  5I5M A;  2AGY A;  2B5M A;  1C9I A;  5FKR A;  3UVM A;  3NIG A;  5M5T A;  3K27 A;  3AL8 A;  3HFQ A;  5C86 A;  2CN3 A;  2H3X A;  2IUR A;  1E8M A;  4GM9 A;  5H17 A;  4JSV C;  2XL3 A;  1TBG A;  2H9M A;  4AOW A;  4GQ2 P;  4A11 A;  2PM6 B;  2IUP A;  1GG2 B;  1B9Y A;  3ODT A;  1U2V C;  5C92 A;  2VDQ A;  3RFH A;  3EI2 B;  3UKU C;  2B5L A;  3CIK B;  4G1M A;  3OL2 A;  2XDW A;  2AGZ A;  3PSC B;  3C99 A;  5THA A;  1N6F A;  2VDL A;  3OKY B;  4QQE A;  4ERQ A;  3OKW A;  4ZOZ A;  4U1E I;  2OK4 A;  2VZ1 A;  2YNN A;  3SVW D;  3UVL A;  1A12 A;  3C9C A;  4XYH A;  4ZOV A;  2EID A;  4J8G A;  1SQJ A;  2OVR B;  4RE6 A;  3UKR C;  3T3M A;  2I0R A;  3I8E A;  2H68 A;  1BPO A;  2AH1 A;  1QFM A;  3BG1 A;  3MUN A;  4FWW A;  3V4V A;  1OLZ A;  3IUM A;  5HE0 B;  3IJE A;  3I7H A;  1A0R B;  2VDP A;  3UVO A;  4E5Z B;  2XE4 A;  4X60 B;  1U8C A;  4Y7R A;  3EI2 A;  5GXH A;  5AMS A;  1R5M A;  4DNW A;  4GMB A;  4GGC A;  2AGX A;  2VC2 A;  3O4I A;  3MVD K;  3UR4 A;  4HDJ A;  4CC9 A;  4FHL A;  4O2W A;  1M1X A;  3NID A;  2JKX A;  2WQ8 A;  3I2N A;  2VDM A;  1OMW B;  2OVP B;  2HU7 A;  5HQG A;  4WK0 A;  3SHF A;  4D9S A;  1K32 A;  2H9N A;  3I7L A;  1JTD B;  5A2Q g;  3IUN A;  2P9U C;  3OL2 B;  4AN1 A;  3AL8 B;  4L9O A;  3VGZ A;  4MK0 B;  2P9L C;  3CFS B;  3RN1 D;  3PXW D;  1GOF A;  4G56 B;  3CFV A;  3DWL C;  3C75 H;  3IIW A;  2P9I C;  3JZH A;  2HKR A;  1PEV A;  1SQ9 A;  3AL9 A;  3K71 A;  4O1Q D;  5M5V A;  1TYE A;  5FA5 B;  4PBY A;  2H47 A;  3DXM C;  3SBR A;  3JZN A;  3EQ9 A;  5TF2 A; 
#chains in the Genus database with same CATH homology
 5C9Z B;  3OW8 A;  2GC4 A;  4X63 B;  3SFZ A;  3BWS A;  4O45 A;  4CY3 A;  3EG6 A;  3EI3 B;  3MZK A;  2H9L A;  3PE7 A;  3RFG A;  2QXV A;  5IGQ A;  4J84 A;  5FKT A;  1B9X A;  5TDH B;  5IT9 g;  5CXC B;  2OJY A;  4J8B A;  2P9P C;  4CZV A;  1QNI A;  4XEI C;  5FLX g;  3JRO A;  5H14 A;  4GZ8 A;  2PBI B;  4JT5 C;  4A2M A;  3MZL A;  2HJB A;  2PM7 B;  3I7O A;  3JZG A;  2TRC B;  3AH8 B;  1NR0 A;  1L0Q A;  5I5I A;  5K1C C;  5EMM B;  3VH0 A;  1PBY B;  1XHM A;  2P9N C;  4PSW B;  3I7N A;  5EAL A;  3GRE A;  3JPX A;  4XYI A;  3J80 g;  5IJ8 E;  4ZOY A;  4H5I A;  5EMK B;  4J86 A;  4Y5R D;  3ORV D;  5CXB A;  5CYK A;  3SWS D;  5FKS A;  2G9A A;  3IIY A;  5GSA A;  3KRW B;  3EI1 A;  3MKS B;  3RLM D;  1U4C A;  5CYK B;  2CNX A;  4Z8L A;  2HXC A;  4J0W A;  4YVD A;  3AFC A;  4PNK B;  5FXY A;  5SXM A;  4J87 A;  2CE8 A;  2O9K A;  3VA6 A;  3RMZ D;  1XIP A;  4J81 A;  5IC7 A;  1RI6 A;  4FAV D;  3FRX A;  2YNP A;  3L4M D;  5KDO B;  4J78 A;  3DSM A;  2IUV A;  3SN6 B;  3RSE C;  2EBS A;  4A0A B;  4PBZ A;  3SBQ A;  3BG0 A;  4J0X A;  2H9P A;  4A0A A;  1PI6 A;  2CO0 C;  1K8K C;  5AJA A;  3EI3 A;  1P22 A;  2H13 A;  2YBA A;  3EU7 A;  4X61 B;  2GC7 A;  4JSX C;  4L3G D;  3L4O D;  2UZX B;  2G99 A;  4L3H D;  1JJU B;  4QT8 A;  3IJC A;  3MXX A;  2I3S A;  3B7F A;  4JXM A;  4K3J B;  5EM2 A;  1JMX B;  4BH6 A;  3PXS D;  5HE2 B;  3SXT D;  2I3T A;  3SJL D;  2Z2P A;  3N0E A;  4UI9 R;  3NVX A;  4CZX A;  2I0S A;  4I79 A;  4A7J A;  4FAN D;  2B4E A;  2IUQ A;  5CXB B;  3F3P A;  2OK6 A;  4LG8 A;  3A0F A;  4ERZ A;  4CI2 A;  2HES X;  3SMR A;  4K3I D;  4O3U B;  3E0C A;  4QRJ A;  5EML B;  4CI8 A;  4ZN4 A;  4GGD A;  4J79 A;  1Q47 A;  4CZY A;  1ERJ A;  4IMM A;  2B5N A;  2PM9 B;  2P9K C;  3NVQ A;  3V7D B;  5JWZ A;  4U7A A;  5H1M A;  5EAP A;  4A08 A;  4O9D A;  4N14 A;  3UVN A;  2QC5 A;  3PSL A;  2XL2 A;  1YFQ A;  4A09 A;  4OZU A;  4CY2 A;  4FB1 D;  3EI4 B;  4A09 B;  4FA9 D;  3EI1 B;  3I8C A;  2J57 G;  4FA4 D;  2CO0 A;  3V9F A;  3RRM C;  3PVU B;  2J56 H;  4A0B B;  4LGN A;  4E54 A;  3ZWL B;  4GM3 A;  2IWK A;  3IKO A;  2UZY B;  4J77 A;  3DXK C;  4PSX B;  1XKS A;  4BL0 A;  5GXI A;  1JMZ B;  4GQ1 A;  4L1Q D;  2OVQ B;  2IAA A;  1NEX B;  4CY5 A;  4BUJ C;  2HKM A;  3FGB A;  4JD2 C;  5CXC A;  4R7A B;  4GGA A;  4E5Z A;  3K26 A;  2P9S C;  4LG9 A;  4A08 B;  5K19 A;  4PXW A;  1SHY B;  3F3F A;  3C5M A;  5HYN B;  1PGU A;  3OKT A;  2MTA H;  2PM9 A;  3EMH A;  3EWE A;  1GOT B;  3IJ0 A;  4J82 A;  5C2W B;  4CI3 A;  5TEF A;  5AFU 3;  3OTT A;  4E54 B;  3RN0 D;  1N6E A;  2I0T A;  4J73 A;  1GP2 B;  4D0K A;  1TYQ C;  2Q7Q A;  5I5J A;  1FWX A;  4O3T B;  5EAR A;  3JRP A;  2Z2N A;  4CI1 A;  4X3E A;  3PVW B;  2IWF A;  4A11 B;  4H5J A;  5TEE A;  4ES0 A;  3PXT D;  4IA9 A;  2H6N A;  4EWR A;  1JOF A;  4GQB B;  2AGL A;  2YNO A;  4GM8 A;  2Z2O A;  3JB9 L;  3UVK A;  5EM2 B;  2YMU A;  4FA5 D;  5FKQ A;  4CY1 A;  2XU7 A;  4A0B A;  5IJ7 E;  5FQD A;  5B4W A;  3I7K A;  4ERY A;  4FA1 D;  5EMJ B;  1VYH C;  2AH0 A;  4OWR A;  4A2L A;  3V5W B;  2H6K A;  1GXR A;  1N6D A;  4JT6 C;  4JSP C;  4D6V A;  2OIZ A;  3EI4 A;  2YB8 B;  1MDA H;  4KFM B;  2GNQ A;  3MKQ A;  5C2V B;  3ULE C;  3JAM g;  3F3G A;  3J81 g;  3MMY A;  2HJ4 A;  5GMK n;  3IJ1 A;  3U4Y A;  4NSX A;  4QL1 A;  3P4F A;  2XYI A;  2J55 H;  5IGO A;  3DM0 A;  3OKY A;  4TZ4 A;  5EAM A;  2H6Q A;  5HE3 B;  3FM0 A;  2BCJ B;  3N0D A;  3NVN A;  3I89 A;  2HYE A;  4ZOX A;  2AQ5 A;  3I7P A;  2CN2 A;  3SBP A;  3GFC A;  1S4U X;  5HE1 B;  2W18 A;  4AEZ A;  1MG2 A;  2CE9 A;  1MG3 A;  3KRX B;  3W15 A;  4PC0 A;  2AGW A;  4ESG A;  4JSN C;  3SLE D;  2H14 A;  2BBK H;  3SCY A;  5I5M A;  2AGY A;  2B5M A;  5FKR A;  3UVM A;  3K27 A;  3AL8 A;  3HFQ A;  2CN3 A;  2H3X A;  2IUR A;  4GM9 A;  5H17 A;  4JSV C;  2XL3 A;  1TBG A;  2H9M A;  4AOW A;  4GQ2 P;  4A11 A;  2PM6 B;  2IUP A;  1GG2 B;  1B9Y A;  3ODT A;  1U2V C;  3RFH A;  3EI2 B;  3UKU C;  2B5L A;  3CIK B;  3OL2 A;  2AGZ A;  3PSC B;  3C99 A;  5THA A;  1N6F A;  3OKY B;  4QQE A;  4ERQ A;  3OKW A;  4ZOZ A;  4U1E I;  2OK4 A;  2YNN A;  3SVW D;  3UVL A;  3C9C A;  4XYH A;  4ZOV A;  4J8G A;  1SQJ A;  2OVR B;  3UKR C;  2I0R A;  3I8E A;  2H68 A;  2AH1 A;  3BG1 A;  4FWW A;  1OLZ A;  5HE0 B;  3I7H A;  1A0R B;  3UVO A;  4E5Z B;  4X60 B;  4Y7R A;  3EI2 A;  5GXH A;  5AMS A;  1R5M A;  4GMB A;  4GGC A;  2AGX A;  3UR4 A;  4HDJ A;  4CC9 A;  4FHL A;  3I2N A;  1OMW B;  2OVP B;  5HQG A;  3SHF A;  1K32 A;  2H9N A;  3I7L A;  5A2Q g;  2P9U C;  3OL2 B;  3AL8 B;  4L9O A;  3VGZ A;  4MK0 B;  2P9L C;  3CFS B;  3RN1 D;  3PXW D;  4G56 B;  3CFV A;  3DWL C;  3C75 H;  3IIW A;  2P9I C;  3JZH A;  2HKR A;  1PEV A;  1SQ9 A;  3AL9 A;  4O1Q D;  5FA5 B;  4PBY A;  2H47 A;  3DXM C;  3SBR A;  3JZN A;  5TF2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...