2XU7A

Structural basis for rbap48 binding to fog-1
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
395
structure length
360
Chain Sequence
VINEEYKIWKKNTPFLYDLVMTHALEWPSLTAQWLPDVTFSIHRLVLGTHTSDEQNHLVIASVQLPNKIEIEIKINHEGEVNRARYMPQNPCIIATKTPSSDVLVFDYTKHPSKPDPSGECNPDLRLRGHQKEGYGLSWNPNLSGHLLSASDDHTICLWDISAVPKEGKVVDAKTIFTGHTAVVEDVSWHLLHESLFGSVADDQKLMIWDTRSNNTSKPSHSVDAHTAEVNCLSFNPYSEFILATGSADKTVALWDLRNLKLKLHSFESHKDEIFQVQWSPHNETILASSGTDRRLNVWDLSKIGEEQSEDGPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQVWQMAENIYN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights Into Association of the Nurd Complex with Fog-1 from the Crystal Structure of an Rbap48-Fog- 1 Complex.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords HISTONE-BINDING PROTEIN RBBP4
total genus 104
structure length 360
sequence length 395
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
A PF12265 CAF1C_H4-bd Histone-binding protein RBBP4 or subunit C of CAF1 complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2xu7A00
2O9KA 5EM2B 5GXHA 4X63B 3EI2A 1XKSA 2EBSA 4GZ8A 4J79A 5IGOA 2CE8A 4J77A 2OJYA 3OKYB 2P9UC 5HE1B 2H14A 3CFVA 3W15A 4H5JA 5K1CC 3UVNA 5EALA 5AFU3 4D0KA 2W18A 3P4FA 5KDOB 4EWRA 4H5IA 2B4EA 5FXYA 2HKMA 4A09A 4XYIA 4A09B 1PGUA 3VH0A 2I3SA 4J8BA 1FWXA 3SHFA 2PBIB 4JSVC 3PE7A 4JXMA 5AMSA 3FRXA 3EI4A 3DXMC 1PBYB 3I7HA 3JPXA 5K19A 4J0WA 4LG8A 4J78A 4MK0B 1JMZB 2IWFA 4CZXA 3I7PA 1A0RB 4ERZA 4J81A 3EI1B 3MXXA 4O9DA 2HJ4A 4AOWA 4O3UB 2AGZA 5TF2A 3V7DB 4FA9D 2B5NA 4PBYA 2HYEA 4FB1D 4FA4D 4JT5C 5EMLB 1Q47A 5HE3B 2BCJB 3SN6B 2Z2NA 1SQJA 4JSNC 3ULEC 4A2LA 2YB8B 2HXCA 5CXBB 3CIKB 2Z2OA 1GXRA 3ODTA 4FA5D 3C5MA 4O3TB 2PM9A 4CY1A 2HJBA 2P9SC 3SLED 3VA6A 2B5MA 3UKUC 3JZHA 5IJ8E 2TRCB 4Y7RA 3J81g 3RSEC 3AFCA 4CI1A 2G9AA 5IT9g 2J55H 3I7NA 2Q7QA 3L4MD 2YBAA 1L0QA 2QXVA 2IUQA 1NR0A 3FGBA 2IUVA 4ERQA 4CZVA 1JMXB 4E5ZA 2IUPA 1SHYB 1N6EA 5C2VB 2AGLA 3NVQA 2OK4A 2HESX 3DM0A 3IJCA 4IMMA 3UVOA 4E54A 1YFQA 2B5LA 2YNNA 3EI3A 4U1EI 2AH1A 2AQ5A 4PBZA 4CY5A 4LG9A 4X3EA 3V5WB 4ZN4A 4QRJA 4J0XA 2I0TA 3EI2B 3SWSD 4JD2C 1QNIA 3CFSB 4K3JB 2XU7A 3UKRC 3IIYA 4L3HD 2QC5A 5CYKA 5FKRA 2YNPA 3I8CA 4GQ2P 4TZ4A 3BG1A 3E0CA 4BUJC 4E5ZB 1MG2A 3OKWA 5GSAA 1GP2B 2H6KA 4UI9R 4R7AB 5TDHB 4CI8A 4O1QD 2H9NA 3BWSA 3OKTA 3RFGA 4GQ1A 1S4UX 4FWWA 2J56H 2GC7A 3HFQA 5I5IA 1OMWB 4A2MA 4ES0A 3MZKA 3PSLA 4XEIC 2H47A 3IJ0A 3FM0A 1K32A 3RRMC 4A7JA 1TYQC 3L4OD 4ZOXA 5HE2B 2OIZA 4CY2A 4QQEA 5FKSA 3EU7A 1VYHC 2H3XA 4PXWA 5THAA 5EMJB 5IC7A 1B9YA 4E54B 3C9CA 4GQBB 2CE9A 4XYHA 2AGXA 3JZNA 5EM2A 2CN2A 4Z8LA 3AL9A 3EMHA 5CXCA 3JRPA 1P22A 4X61B 1TBGA 3EI4B 3ORVD 5FQDA 5HE0B 5I5JA 4A0BA 3C99A 4A0BB 5A2Qg 3I8EA 3J80g 4JSPC 2I0SA 2Z2PA 4I79A 2AH0A 4YVDA 1GOTB 3KRWB 4OZUA 2P9PC 4J73A 5EARA 5HQGA 2BBKH 3I2NA 5HYNB 4BL0A 3AH8B 4L1QD 3V9FA 3MZLA 4J82A 5SXMA 2P9KC 3KRXB 3BG0A 4ZOVA 4GM9A 3I7LA 3VGZA 3PVWB 5I5MA 5CYKB 1ERJA 3PXTD 3PXSD 2CNXA 3UVMA 4U7AA 4GGAA 4CC9A 3SVWD 4A08B 3RFHA 3SBPA 4A11A 2CO0C 2H9PA 3EWEA 4ESGA 3RMZD 2PM9B 4X60B 4L3GD 2PM6B 3MKSB 2IURA 2H9LA 3A0FA 4HDJA 4PSXB 2P9LC 4GM3A 4D6VA 1PI6A 3C75H 2P9NC 2XL3A 2MTAH 4QL1A 4J87A 4L9OA 4A11B 2IAAA 3U4YA 4A0AA 4K3ID 5JWZA 2IWKA 4FAVD 3DWLC 3RN0D 3DXKC 5B4WA 4KFMB 5FKTA 2CO0A 3F3FA 5IJ7E 3SMRA 3NVNA 2GC4A 2XYIA 4N14A 4LGNA 3UVKA 5GXIA 1JJUB 3OTTA 2HKRA 3ZWLB 2H6QA 5AJAA 5H17A 2OVQB 4GMBA 3SFZA 3OKYA 3RLMD 2H13A 1R5MA 2H6NA 2OK6A 5C9ZB 4IA9A 3PXWD 5EAPA 4CI2A 3IIWA 3PVUB 3MMYA 4ZOZA 5EMMB 3JAMg 5FA5B 4JT6C 3AL8B 3EI1A 3K27A 2OVPB 1U4CA 4ERYA 4PC0A 4J86A 1N6DA 3F3GA 3N0DA 3UVLA 5GMKn 1GG2B 4GGCA 3SXTD 5EMKB 4PNKB 4FHLA 2UZYB 2YNOA 1XIPA 3SJLD 3PSCB 5FKQA 3SBQA 1B9XA 5IGQA 3I89A 2P9IC 4NSXA 1PEVA 3I7OA 4J84A 1SQ9A 3EI3B 3K26A 4AEZA 4QT8A 1OLZA 3GREA 5CXCB 4ZOYA 3IJ1A 3JB9L 2UZXB 1JOFA 4GGDA 1U2VC 5CXBA 3DSMA 2I0RA 4CZYA 5FLXg 4A08A 2XL2A 2H68A 4Y5RD 2AGYA 3JROA 4G56B 3EG6A 2PM7B 5H14A 3OL2A 4GM8A 1RI6A 4J8GA 3GFCA 3RN1D 1N6FA 1K8KC 4A0AB 1NEXB 3AL8A 2H9MA 4O45A 4FA1D 3B7FA 2I3TA 3SCYA 3SBRA 4CI3A 2AGWA 2CN3A 3OW8A 3IKOA 1MG3A 2G99A 3F3PA 5H1MA 4OWRA 2GNQA 2OVRB 3JZGA 5TEEA 4CY3A 1MDAH 3NVXA 5EAMA 4FAND 3UR4A 4PSWB 4JSXC 3MKQA 5TEFA 3OL2B 2J57G 2YMUA 5C2WB 1XHMA 3I7KA 3N0EA 4BH6A
chains in the Genus database with same CATH superfamily
2O9KA 2XE4A 5EM2B 2VDQA 2EIEA 5GXHA 4X63B 3EI2A 1XKSA 4DNVA 4DNUA 2EBSA 2QR5A 4GZ8A 4J79A 5IGOA 2CE8A 4WK2A 4J77A 2OJYA 3OKYB 2P9UC 1M1XA 5HE1B 2H14A 3CFVA 3W15A 5C92A 4H5JA 3K6SA 5K1CC 3ZDYA 3UVNA 5EALA 1I2MB 5AFU3 4D0KA 2W18A 1UTCA 3KCIA 3P4FA 5KDOB 4EWRA 4H5IA 2B4EA 5FXYA 2HKMA 4A09A 4XYIA 4A09B 1BPOA 4O02A 4BCCA 1PGUA 4L1MA 3VH0A 4G55A 2I3SA 4J8BA 1FWXA 3SHFA 2PBIB 4JSVC 3PE7A 4JXMA 5AMSA 3FRXA 3EI4A 3DXMC 1PBYB 3I7HA 3JPXA 2EIDA 5K19A 4J0WA 4Z7OA 4LG8A 3EQ8A 4J78A 4MK0B 1JMZB 2IWFA 4CZXA 3IUQA 3I7PA 1A0RB 4ERZA 4J81A 3EI1B 3MXXA 4O9DA 2HJ4A 4AOWA 4Z7QA 4O3UB 4WK0A 2AGZA 5TF2A 3IURA 3V7DB 4FA9D 2B5NA 3K72A 4PBYA 2HYEA 4FB1D 4FA4D 4JT5C 5EMLB 1Q47A 5HE3B 2BCJB 3SN6B 2Z2NA 1SQJA 4JSNC 3ULEC 4A2LA 2YB8B 2HXCA 5CXBB 3CIKB 5FFGA 2Z2OA 1GXRA 3ODTA 1YR2A 4FA5D 3C5MA 4RE6A 2XZGA 4O3TB 2PM9A 4CY1A 2HJBA 2P9SC 3SLED 3VA6A 2B5MA 3UKUC 3JZHA 4Z7NA 5IJ8E 2TRCB 4Y7RA 3J81g 3RSEC 3AFCA 4CI1A 2G9AA 5IT9g 4QAMA 1O6FA 2J55H 1H2YA 3I7NA 2Q7QA 3L4MD 2YBAA 5M5VA 1L0QA 2QXVA 2IUQA 1NR0A 4MMXA 3FGBA 4MMZA 2IUVA 4ERQA 3QHYB 4CZVA 1JMXB 4E5ZA 2IUPA 1GOHA 1SHYB 2VDNA 4IRZA 1N6EA 5M5RA 5C2VB 2AGLA 3NVQA 2OK4A 2HESX 3DM0A 3IJCA 4IMMA 3UVOA 4E54A 1YFQA 3O4IA 2B5LA 2YNNA 5HDBA 3EI3A 4U1EI 2AH1A 2AQ5A 4PBZA 2VDLA 3IUNA 4CY5A 4LG9A 4X3EA 3V5WB 4ZN4A 4QRJA 4J0XA 2I0TA 3EI2B 3SWSD 4JD2C 1QNIA 3CFSB 2VDMA 4K3JB 4NBMA 2XU7A 3UKRC 3IIYA 4L3HD 2QC5A 5CYKA 5FKRA 2YNPA 3I8CA 2VDPA 4GQ2P 4TZ4A 3BG1A 3E0CA 4BUJC 3ZDXA 1MG2A 4E5ZB 3OKWA 5GSAA 3DDUA 1GP2B 4BP9A 2H6KA 4UI9R 4R7AB 1H2ZA 4AN1A 5TDHB 2HU8A 4CI8A 4O1QD 2H9NA 3BWSA 3OKTA 1QFSA 3RFGA 4GQ1A 1S4UX 4FWWA 2J56H 2GC7A 3HFQA 4O2WA 3ZE0A 5I5IA 1OMWB 4A2MA 1UOPA 4ES0A 3MZKA 3PSLA 4NC4A 4XEIC 2H47A 3IJ0A 3FM0A 1K32A 1C9LA 3O4GA 3RRMC 4A7JA 3QI0A 1TYQC 3L4OD 4ZOXA 5HE2B 2OIZA 4CY2A 4QQEA 5FKSA 3EU7A 1VYHC 2H3XA 4PXWA 5THAA 3MUOA 4RE5A 5EMJB 5IC7A 1B9YA 2VZ3A 4E54B 3C9CA 2HU5A 4GQBB 2CE9A 4XYHA 2AGXA 3JZNA 5EM2A 2CN2A 2JKXA 3EQ9A 4G1EA 4Z8LA 3AL9A 3EQ7A 4WK4A 2HU7A 3EMHA 5CXCA 3JRPA 1P22A 4X61B 3IUMA 1TBGA 4G1MA 3EI4B 3ORVD 5FQDA 5HE0B 5I5JA 4A0BA 3C99A 4A0BB 5A2Qg 1A12A 3I8EA 3J80g 4JHPC 4JSPC 3T3PA 4D9SA 2I0SA 2Z2PA 4I79A 2AH0A 4YVDA 2VZ1A 1GOTB 3KRWB 4OZUA 2P9PC 4J73A 5EARA 5HQGA 2BBKH 3I2NA 5HYNB 4BL0A 3AH8B 4L1QD 3V9FA 3MZLA 4J82A 1T2XA 5SXMA 2P9KC 3KRXB 3K71A 3BG0A 4ZOVA 4GM9A 3IUJA 3I7LA 3V4PA 3VGZA 1K3IA 3PVWB 5I5MA 5CYKB 1ERJA 3PXTD 3PXSD 2CNXA 4UM8A 3UVMA 4U7AA 4GGAA 4CC9A 3SVWD 4UM9A 4A08B 3RFHA 4NENA 1C9IA 3SBPA 4A11A 2CO0C 2H9PA 3EWEA 4ESGA 2EIBA 3RMZD 3NIGA 2PM9B 4X60B 3O4JA 4L3GD 5E6RA 2PM6B 1H2WA 3MKSB 4AX4A 2IURA 3FCSA 5E6UA 3ZE1A 2H9LA 3A0FA 3IJEA 4HDJA 5FFOA 4PSXB 2P9LC 4GM3A 4D6VA 1PI6A 3C75H 2P9NC 2XL3A 2MTAH 4QL1A 3VI3A 4J87A 3FCUA 4L9OA 4A11B 5M5TA 1QFMA 2IAAA 2VC2A 3U4YA 4A0AA 2BKLA 4K3ID 1VZ3A 5JWZA 2IWKA 4FAVD 2VDKA 1VZ2A 4AN0A 3DWLC 3RN0D 3DXKC 5B4WA 4KFMB 5FKTA 3IVMA 2CO0A 3F3FA 5IJ7E 3SMRA 5E6SA 3NVNA 1TYEA 2GC4A 2XYIA 5M5UA 4N14A 4LGNA 3UVKA 5GXIA 1JJUB 3OTTA 2HKRA 3T3MA 3ZE2A 3ZWLB 2H6QA 5AJAA 5H17A 2OVQB 4GMBA 3SFZA 3OKYA 3RLMD 3O4HA 2H13A 1R5MA 2H6NA 2QZPA 2VDRA 2OK6A 5C9ZB 4IA9A 3PXWD 5EAPA 4BP8A 4CI2A 3IIWA 3PVUB 3MMYA 4ZOZA 5EMMB 3JAMg 5FA5B 4JT6C 3AL8B 3EI1A 3K27A 2OVPB 5M61A 1U4CA 1JV2A 4ERYA 1VE6A 4PC0A 4J86A 1N6DA 3F3GA 3N0DA 3GC3B 1GOGA 4AMYA 1GOFA 1E8MA 3UVLA 2VDOA 5GMKn 2XDWA 3NIDA 1GG2B 4WJKA 3NIFA 4GGCA 3MVDK 3SXTD 2EICA 5EMKB 4PNKB 4DNWA 4FHLA 4MMYA 2UZYB 2YNOA 1XIPA 5C86A 3ZDZA 3SJLD 3OF7A 3PSCB 5FKQA 3SBQA 3V4VA 1B9XA 5IGQA 3I89A 2P9IC 4NSXA 1PEVA 3I7OA 4J84A 1SQ9A 3EI3B 3K26A 1H2XA 4AEZA 4BCBA 4NAAA 4QT8A 1OLZA 3GREA 5CXCB 4ZOYA 3IJ1A 3JB9L 2UZXB 1JOFA 4GGDA 1U2VC 1E8NA 5CXBA 3DSMA 2I0RA 4CZYA 5FLXg 4A08A 2XL2A 1E5TA 4JHNA 2H68A 4Y5RD 2AGYA 3JROA 4G56B 3EG6A 2PM7B 5H14A 3VI4A 3OL2A 4GM8A 1RI6A 4J8GA 3GFCA 3RN1D 4BCDA 1N6FA 1K8KC 4A0AB 4AMZA 1NEXB 3IULA 3AL8A 2WQ8A 1VE7A 1JTDB 2H9MA 5M5SA 4O45A 4FA1D 3B7FA 2I3TA 3SCYA 1UOOA 3SBRA 4CI3A 2AGWA 2CN3A 3OW8A 3IKOA 1UOQA 1MG3A 2G99A 3F3PA 5H1MA 4OWRA 2GNQA 2OVRB 3JZGA 5TEEA 4CY3A 1MDAH 1U8CA 3NVXA 5EAMA 4FAND 3UR4A 4PSWB 3GD1I 4JSXC 3MKQA 5TEFA 3OL2B 1L5GA 2J57G 2YMUA 5C2WB 1XHMA 3I7KA 1O6GA 3N0EA 3MUNA 4BH6A
chains in the Genus database with same CATH topology
2O9KA 5EM2B 5GXHA 4X63B 3EI2A 1XKSA 2EBSA 4GZ8A 4J79A 5IGOA 2CE8A 4J77A 2OJYA 3OKYB 2P9UC 5HE1B 2H14A 3CFVA 3W15A 4H5JA 5K1CC 3UVNA 5EALA 5AFU3 4D0KA 2W18A 3P4FA 5KDOB 4EWRA 4H5IA 2B4EA 5FXYA 2HKMA 4A09A 4XYIA 4A09B 1PGUA 3VH0A 2I3SA 4J8BA 1FWXA 3SHFA 2PBIB 4JSVC 3PE7A 4JXMA 5AMSA 3FRXA 3EI4A 3DXMC 1PBYB 3I7HA 3JPXA 5K19A 4J0WA 4LG8A 4J78A 4MK0B 1JMZB 2IWFA 4CZXA 3I7PA 1A0RB 4ERZA 4J81A 3EI1B 3MXXA 4O9DA 2HJ4A 4AOWA 4O3UB 2AGZA 5TF2A 3V7DB 4FA9D 2B5NA 4PBYA 2HYEA 4FB1D 4FA4D 4JT5C 5EMLB 1Q47A 5HE3B 2BCJB 3SN6B 2Z2NA 1SQJA 4JSNC 3ULEC 4A2LA 2YB8B 2HXCA 5CXBB 3CIKB 2Z2OA 1GXRA 3ODTA 4FA5D 3C5MA 4O3TB 2PM9A 4CY1A 2HJBA 2P9SC 3SLED 3VA6A 2B5MA 3UKUC 3JZHA 5IJ8E 2TRCB 4Y7RA 3J81g 3RSEC 3AFCA 4CI1A 2G9AA 5IT9g 2J55H 3I7NA 2Q7QA 3L4MD 2YBAA 1L0QA 2QXVA 2IUQA 1NR0A 3FGBA 2IUVA 4ERQA 4CZVA 1JMXB 4E5ZA 2IUPA 1SHYB 1N6EA 5C2VB 2AGLA 3NVQA 2OK4A 2HESX 3DM0A 3IJCA 4IMMA 3UVOA 4E54A 1YFQA 2B5LA 2YNNA 3EI3A 4U1EI 2AH1A 2AQ5A 4PBZA 4CY5A 4LG9A 4X3EA 3V5WB 4ZN4A 4QRJA 4J0XA 2I0TA 3EI2B 3SWSD 4JD2C 1QNIA 3CFSB 4K3JB 2XU7A 3UKRC 3IIYA 4L3HD 2QC5A 5CYKA 5FKRA 2YNPA 3I8CA 4GQ2P 4TZ4A 3BG1A 3E0CA 4BUJC 4E5ZB 1MG2A 3OKWA 5GSAA 1GP2B 2H6KA 4UI9R 4R7AB 5TDHB 4CI8A 4O1QD 2H9NA 3BWSA 3OKTA 3RFGA 4GQ1A 1S4UX 4FWWA 2J56H 2GC7A 3HFQA 5I5IA 1OMWB 4A2MA 4ES0A 3MZKA 3PSLA 4XEIC 2H47A 3IJ0A 3FM0A 1K32A 3RRMC 4A7JA 1TYQC 3L4OD 4ZOXA 5HE2B 2OIZA 4CY2A 4QQEA 5FKSA 3EU7A 1VYHC 2H3XA 4PXWA 5THAA 5EMJB 5IC7A 1B9YA 4E54B 3C9CA 4GQBB 2CE9A 4XYHA 2AGXA 3JZNA 5EM2A 2CN2A 4Z8LA 3AL9A 3EMHA 5CXCA 3JRPA 1P22A 4X61B 1TBGA 3EI4B 3ORVD 5FQDA 5HE0B 5I5JA 4A0BA 3C99A 4A0BB 5A2Qg 3I8EA 3J80g 4JSPC 2I0SA 2Z2PA 4I79A 2AH0A 4YVDA 1GOTB 3KRWB 4OZUA 2P9PC 4J73A 5EARA 5HQGA 2BBKH 3I2NA 5HYNB 4BL0A 3AH8B 4L1QD 3V9FA 3MZLA 4J82A 5SXMA 2P9KC 3KRXB 3BG0A 4ZOVA 4GM9A 3I7LA 3VGZA 3PVWB 5I5MA 5CYKB 1ERJA 3PXTD 3PXSD 2CNXA 3UVMA 4U7AA 4GGAA 4CC9A 3SVWD 4A08B 3RFHA 3SBPA 4A11A 2CO0C 2H9PA 3EWEA 4ESGA 3RMZD 2PM9B 4X60B 4L3GD 2PM6B 3MKSB 2IURA 2H9LA 3A0FA 4HDJA 4PSXB 2P9LC 4GM3A 4D6VA 1PI6A 3C75H 2P9NC 2XL3A 2MTAH 4QL1A 4J87A 4L9OA 4A11B 2IAAA 3U4YA 4A0AA 4K3ID 5JWZA 2IWKA 4FAVD 3DWLC 3RN0D 3DXKC 5B4WA 4KFMB 5FKTA 2CO0A 3F3FA 5IJ7E 3SMRA 3NVNA 2GC4A 2XYIA 4N14A 4LGNA 3UVKA 5GXIA 1JJUB 3OTTA 2HKRA 3ZWLB 2H6QA 5AJAA 5H17A 2OVQB 4GMBA 3SFZA 3OKYA 3RLMD 2H13A 1R5MA 2H6NA 2OK6A 5C9ZB 4IA9A 3PXWD 5EAPA 4CI2A 3IIWA 3PVUB 3MMYA 4ZOZA 5EMMB 3JAMg 5FA5B 4JT6C 3AL8B 3EI1A 3K27A 2OVPB 1U4CA 4ERYA 4PC0A 4J86A 1N6DA 3F3GA 3N0DA 3UVLA 5GMKn 1GG2B 4GGCA 3SXTD 5EMKB 4PNKB 4FHLA 2UZYB 2YNOA 1XIPA 3SJLD 3PSCB 5FKQA 3SBQA 1B9XA 5IGQA 3I89A 2P9IC 4NSXA 1PEVA 3I7OA 4J84A 1SQ9A 3EI3B 3K26A 4AEZA 4QT8A 1OLZA 3GREA 5CXCB 4ZOYA 3IJ1A 3JB9L 2UZXB 1JOFA 4GGDA 1U2VC 5CXBA 3DSMA 2I0RA 4CZYA 5FLXg 4A08A 2XL2A 2H68A 4Y5RD 2AGYA 3JROA 4G56B 3EG6A 2PM7B 5H14A 3OL2A 4GM8A 1RI6A 4J8GA 3GFCA 3RN1D 1N6FA 1K8KC 4A0AB 1NEXB 3AL8A 2H9MA 4O45A 4FA1D 3B7FA 2I3TA 3SCYA 3SBRA 4CI3A 2AGWA 2CN3A 3OW8A 3IKOA 1MG3A 2G99A 3F3PA 5H1MA 4OWRA 2GNQA 2OVRB 3JZGA 5TEEA 4CY3A 1MDAH 3NVXA 5EAMA 4FAND 3UR4A 4PSWB 4JSXC 3MKQA 5TEFA 3OL2B 2J57G 2YMUA 5C2WB 1XHMA 3I7KA 3N0EA 4BH6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O9K A;  5EM2 B;  5GXH A;  4X63 B;  3EI2 A;  1XKS A;  2EBS A;  4GZ8 A;  4J79 A;  5IGO A;  2CE8 A;  4J77 A;  2OJY A;  3OKY B;  2P9U C;  5HE1 B;  2H14 A;  3CFV A;  3W15 A;  4H5J A;  5K1C C;  3UVN A;  5EAL A;  5AFU 3;  4D0K A;  2W18 A;  3P4F A;  5KDO B;  4EWR A;  4H5I A;  2B4E A;  5FXY A;  2HKM A;  4A09 A;  4XYI A;  4A09 B;  1PGU A;  3VH0 A;  2I3S A;  4J8B A;  1FWX A;  3SHF A;  2PBI B;  4JSV C;  3PE7 A;  4JXM A;  5AMS A;  3FRX A;  3EI4 A;  3DXM C;  1PBY B;  3I7H A;  3JPX A;  5K19 A;  4J0W A;  4LG8 A;  4J78 A;  4MK0 B;  1JMZ B;  2IWF A;  4CZX A;  3I7P A;  1A0R B;  4ERZ A;  4J81 A;  3EI1 B;  3MXX A;  4O9D A;  2HJ4 A;  4AOW A;  4O3U B;  2AGZ A;  5TF2 A;  3V7D B;  4FA9 D;  2B5N A;  4PBY A;  2HYE A;  4FB1 D;  4FA4 D;  4JT5 C;  5EML B;  1Q47 A;  5HE3 B;  2BCJ B;  3SN6 B;  2Z2N A;  1SQJ A;  4JSN C;  3ULE C;  4A2L A;  2YB8 B;  2HXC A;  5CXB B;  3CIK B;  2Z2O A;  1GXR A;  3ODT A;  4FA5 D;  3C5M A;  4O3T B;  2PM9 A;  4CY1 A;  2HJB A;  2P9S C;  3SLE D;  3VA6 A;  2B5M A;  3UKU C;  3JZH A;  5IJ8 E;  2TRC B;  4Y7R A;  3J81 g;  3RSE C;  3AFC A;  4CI1 A;  2G9A A;  5IT9 g;  2J55 H;  3I7N A;  2Q7Q A;  3L4M D;  2YBA A;  1L0Q A;  2QXV A;  2IUQ A;  1NR0 A;  3FGB A;  2IUV A;  4ERQ A;  4CZV A;  1JMX B;  4E5Z A;  2IUP A;  1SHY B;  1N6E A;  5C2V B;  2AGL A;  3NVQ A;  2OK4 A;  2HES X;  3DM0 A;  3IJC A;  4IMM A;  3UVO A;  4E54 A;  1YFQ A;  2B5L A;  2YNN A;  3EI3 A;  4U1E I;  2AH1 A;  2AQ5 A;  4PBZ A;  4CY5 A;  4LG9 A;  4X3E A;  3V5W B;  4ZN4 A;  4QRJ A;  4J0X A;  2I0T A;  3EI2 B;  3SWS D;  4JD2 C;  1QNI A;  3CFS B;  4K3J B;  2XU7 A;  3UKR C;  3IIY A;  4L3H D;  2QC5 A;  5CYK A;  5FKR A;  2YNP A;  3I8C A;  4GQ2 P;  4TZ4 A;  3BG1 A;  3E0C A;  4BUJ C;  4E5Z B;  1MG2 A;  3OKW A;  5GSA A;  1GP2 B;  2H6K A;  4UI9 R;  4R7A B;  5TDH B;  4CI8 A;  4O1Q D;  2H9N A;  3BWS A;  3OKT A;  3RFG A;  4GQ1 A;  1S4U X;  4FWW A;  2J56 H;  2GC7 A;  3HFQ A;  5I5I A;  1OMW B;  4A2M A;  4ES0 A;  3MZK A;  3PSL A;  4XEI C;  2H47 A;  3IJ0 A;  3FM0 A;  1K32 A;  3RRM C;  4A7J A;  1TYQ C;  3L4O D;  4ZOX A;  5HE2 B;  2OIZ A;  4CY2 A;  4QQE A;  5FKS A;  3EU7 A;  1VYH C;  2H3X A;  4PXW A;  5THA A;  5EMJ B;  5IC7 A;  1B9Y A;  4E54 B;  3C9C A;  4GQB B;  2CE9 A;  4XYH A;  2AGX A;  3JZN A;  5EM2 A;  2CN2 A;  4Z8L A;  3AL9 A;  3EMH A;  5CXC A;  3JRP A;  1P22 A;  4X61 B;  1TBG A;  3EI4 B;  3ORV D;  5FQD A;  5HE0 B;  5I5J A;  4A0B A;  3C99 A;  4A0B B;  5A2Q g;  3I8E A;  3J80 g;  4JSP C;  2I0S A;  2Z2P A;  4I79 A;  2AH0 A;  4YVD A;  1GOT B;  3KRW B;  4OZU A;  2P9P C;  4J73 A;  5EAR A;  5HQG A;  2BBK H;  3I2N A;  5HYN B;  4BL0 A;  3AH8 B;  4L1Q D;  3V9F A;  3MZL A;  4J82 A;  5SXM A;  2P9K C;  3KRX B;  3BG0 A;  4ZOV A;  4GM9 A;  3I7L A;  3VGZ A;  3PVW B;  5I5M A;  5CYK B;  1ERJ A;  3PXT D;  3PXS D;  2CNX A;  3UVM A;  4U7A A;  4GGA A;  4CC9 A;  3SVW D;  4A08 B;  3RFH A;  3SBP A;  4A11 A;  2CO0 C;  2H9P A;  3EWE A;  4ESG A;  3RMZ D;  2PM9 B;  4X60 B;  4L3G D;  2PM6 B;  3MKS B;  2IUR A;  2H9L A;  3A0F A;  4HDJ A;  4PSX B;  2P9L C;  4GM3 A;  4D6V A;  1PI6 A;  3C75 H;  2P9N C;  2XL3 A;  2MTA H;  4QL1 A;  4J87 A;  4L9O A;  4A11 B;  2IAA A;  3U4Y A;  4A0A A;  4K3I D;  5JWZ A;  2IWK A;  4FAV D;  3DWL C;  3RN0 D;  3DXK C;  5B4W A;  4KFM B;  5FKT A;  2CO0 A;  3F3F A;  5IJ7 E;  3SMR A;  3NVN A;  2GC4 A;  2XYI A;  4N14 A;  4LGN A;  3UVK A;  5GXI A;  1JJU B;  3OTT A;  2HKR A;  3ZWL B;  2H6Q A;  5AJA A;  5H17 A;  2OVQ B;  4GMB A;  3SFZ A;  3OKY A;  3RLM D;  2H13 A;  1R5M A;  2H6N A;  2OK6 A;  5C9Z B;  4IA9 A;  3PXW D;  5EAP A;  4CI2 A;  3IIW A;  3PVU B;  3MMY A;  4ZOZ A;  5EMM B;  3JAM g;  5FA5 B;  4JT6 C;  3AL8 B;  3EI1 A;  3K27 A;  2OVP B;  1U4C A;  4ERY A;  4PC0 A;  4J86 A;  1N6D A;  3F3G A;  3N0D A;  3UVL A;  5GMK n;  1GG2 B;  4GGC A;  3SXT D;  5EMK B;  4PNK B;  4FHL A;  2UZY B;  2YNO A;  1XIP A;  3SJL D;  3PSC B;  5FKQ A;  3SBQ A;  1B9X A;  5IGQ A;  3I89 A;  2P9I C;  4NSX A;  1PEV A;  3I7O A;  4J84 A;  1SQ9 A;  3EI3 B;  3K26 A;  4AEZ A;  4QT8 A;  1OLZ A;  3GRE A;  5CXC B;  4ZOY A;  3IJ1 A;  3JB9 L;  2UZX B;  1JOF A;  4GGD A;  1U2V C;  5CXB A;  3DSM A;  2I0R A;  4CZY A;  5FLX g;  4A08 A;  2XL2 A;  2H68 A;  4Y5R D;  2AGY A;  3JRO A;  4G56 B;  3EG6 A;  2PM7 B;  5H14 A;  3OL2 A;  4GM8 A;  1RI6 A;  4J8G A;  3GFC A;  3RN1 D;  1N6F A;  1K8K C;  4A0A B;  1NEX B;  3AL8 A;  2H9M A;  4O45 A;  4FA1 D;  3B7F A;  2I3T A;  3SCY A;  3SBR A;  4CI3 A;  2AGW A;  2CN3 A;  3OW8 A;  3IKO A;  1MG3 A;  2G99 A;  3F3P A;  5H1M A;  4OWR A;  2GNQ A;  2OVR B;  3JZG A;  5TEE A;  4CY3 A;  1MDA H;  3NVX A;  5EAM A;  4FAN D;  3UR4 A;  4PSW B;  4JSX C;  3MKQ A;  5TEF A;  3OL2 B;  2J57 G;  2YMU A;  5C2W B;  1XHM A;  3I7K A;  3N0E A;  4BH6 A; 
#chains in the Genus database with same CATH topology
 2O9K A;  2XE4 A;  5EM2 B;  2VDQ A;  2EIE A;  5GXH A;  4X63 B;  3EI2 A;  1XKS A;  4DNV A;  4DNU A;  2EBS A;  2QR5 A;  4GZ8 A;  4J79 A;  5IGO A;  2CE8 A;  4WK2 A;  4J77 A;  2OJY A;  3OKY B;  2P9U C;  1M1X A;  5HE1 B;  2H14 A;  3CFV A;  3W15 A;  5C92 A;  4H5J A;  3K6S A;  5K1C C;  3ZDY A;  3UVN A;  5EAL A;  1I2M B;  5AFU 3;  4D0K A;  2W18 A;  1UTC A;  3KCI A;  3P4F A;  5KDO B;  4EWR A;  4H5I A;  2B4E A;  5FXY A;  2HKM A;  4A09 A;  4XYI A;  4A09 B;  1BPO A;  4O02 A;  4BCC A;  1PGU A;  4L1M A;  3VH0 A;  4G55 A;  2I3S A;  4J8B A;  1FWX A;  3SHF A;  2PBI B;  4JSV C;  3PE7 A;  4JXM A;  5AMS A;  3FRX A;  3EI4 A;  3DXM C;  1PBY B;  3I7H A;  3JPX A;  2EID A;  5K19 A;  4J0W A;  4Z7O A;  4LG8 A;  3EQ8 A;  4J78 A;  4MK0 B;  1JMZ B;  2IWF A;  4CZX A;  3IUQ A;  3I7P A;  1A0R B;  4ERZ A;  4J81 A;  3EI1 B;  3MXX A;  4O9D A;  2HJ4 A;  4AOW A;  4Z7Q A;  4O3U B;  4WK0 A;  2AGZ A;  5TF2 A;  3IUR A;  3V7D B;  4FA9 D;  2B5N A;  3K72 A;  4PBY A;  2HYE A;  4FB1 D;  4FA4 D;  4JT5 C;  5EML B;  1Q47 A;  5HE3 B;  2BCJ B;  3SN6 B;  2Z2N A;  1SQJ A;  4JSN C;  3ULE C;  4A2L A;  2YB8 B;  2HXC A;  5CXB B;  3CIK B;  5FFG A;  2Z2O A;  1GXR A;  3ODT A;  1YR2 A;  4FA5 D;  3C5M A;  4RE6 A;  2XZG A;  4O3T B;  2PM9 A;  4CY1 A;  2HJB A;  2P9S C;  3SLE D;  3VA6 A;  2B5M A;  3UKU C;  3JZH A;  4Z7N A;  5IJ8 E;  2TRC B;  4Y7R A;  3J81 g;  3RSE C;  3AFC A;  4CI1 A;  2G9A A;  5IT9 g;  4QAM A;  1O6F A;  2J55 H;  1H2Y A;  3I7N A;  2Q7Q A;  3L4M D;  2YBA A;  5M5V A;  1L0Q A;  2QXV A;  2IUQ A;  1NR0 A;  4MMX A;  3FGB A;  4MMZ A;  2IUV A;  4ERQ A;  3QHY B;  4CZV A;  1JMX B;  4E5Z A;  2IUP A;  1GOH A;  1SHY B;  2VDN A;  4IRZ A;  1N6E A;  5M5R A;  5C2V B;  2AGL A;  3NVQ A;  2OK4 A;  2HES X;  3DM0 A;  3IJC A;  4IMM A;  3UVO A;  4E54 A;  1YFQ A;  3O4I A;  2B5L A;  2YNN A;  5HDB A;  3EI3 A;  4U1E I;  2AH1 A;  2AQ5 A;  4PBZ A;  2VDL A;  3IUN A;  4CY5 A;  4LG9 A;  4X3E A;  3V5W B;  4ZN4 A;  4QRJ A;  4J0X A;  2I0T A;  3EI2 B;  3SWS D;  4JD2 C;  1QNI A;  3CFS B;  2VDM A;  4K3J B;  4NBM A;  2XU7 A;  3UKR C;  3IIY A;  4L3H D;  2QC5 A;  5CYK A;  5FKR A;  2YNP A;  3I8C A;  2VDP A;  4GQ2 P;  4TZ4 A;  3BG1 A;  3E0C A;  4BUJ C;  3ZDX A;  1MG2 A;  4E5Z B;  3OKW A;  5GSA A;  3DDU A;  1GP2 B;  4BP9 A;  2H6K A;  4UI9 R;  4R7A B;  1H2Z A;  4AN1 A;  5TDH B;  2HU8 A;  4CI8 A;  4O1Q D;  2H9N A;  3BWS A;  3OKT A;  1QFS A;  3RFG A;  4GQ1 A;  1S4U X;  4FWW A;  2J56 H;  2GC7 A;  3HFQ A;  4O2W A;  3ZE0 A;  5I5I A;  1OMW B;  4A2M A;  1UOP A;  4ES0 A;  3MZK A;  3PSL A;  4NC4 A;  4XEI C;  2H47 A;  3IJ0 A;  3FM0 A;  1K32 A;  1C9L A;  3O4G A;  3RRM C;  4A7J A;  3QI0 A;  1TYQ C;  3L4O D;  4ZOX A;  5HE2 B;  2OIZ A;  4CY2 A;  4QQE A;  5FKS A;  3EU7 A;  1VYH C;  2H3X A;  4PXW A;  5THA A;  3MUO A;  4RE5 A;  5EMJ B;  5IC7 A;  1B9Y A;  2VZ3 A;  4E54 B;  3C9C A;  2HU5 A;  4GQB B;  2CE9 A;  4XYH A;  2AGX A;  3JZN A;  5EM2 A;  2CN2 A;  2JKX A;  3EQ9 A;  4G1E A;  4Z8L A;  3AL9 A;  3EQ7 A;  4WK4 A;  2HU7 A;  3EMH A;  5CXC A;  3JRP A;  1P22 A;  4X61 B;  3IUM A;  1TBG A;  4G1M A;  3EI4 B;  3ORV D;  5FQD A;  5HE0 B;  5I5J A;  4A0B A;  3C99 A;  4A0B B;  5A2Q g;  1A12 A;  3I8E A;  3J80 g;  4JHP C;  4JSP C;  3T3P A;  4D9S A;  2I0S A;  2Z2P A;  4I79 A;  2AH0 A;  4YVD A;  2VZ1 A;  1GOT B;  3KRW B;  4OZU A;  2P9P C;  4J73 A;  5EAR A;  5HQG A;  2BBK H;  3I2N A;  5HYN B;  4BL0 A;  3AH8 B;  4L1Q D;  3V9F A;  3MZL A;  4J82 A;  1T2X A;  5SXM A;  2P9K C;  3KRX B;  3K71 A;  3BG0 A;  4ZOV A;  4GM9 A;  3IUJ A;  3I7L A;  3V4P A;  3VGZ A;  1K3I A;  3PVW B;  5I5M A;  5CYK B;  1ERJ A;  3PXT D;  3PXS D;  2CNX A;  4UM8 A;  3UVM A;  4U7A A;  4GGA A;  4CC9 A;  3SVW D;  4UM9 A;  4A08 B;  3RFH A;  4NEN A;  1C9I A;  3SBP A;  4A11 A;  2CO0 C;  2H9P A;  3EWE A;  4ESG A;  2EIB A;  3RMZ D;  3NIG A;  2PM9 B;  4X60 B;  3O4J A;  4L3G D;  5E6R A;  2PM6 B;  1H2W A;  3MKS B;  4AX4 A;  2IUR A;  3FCS A;  5E6U A;  3ZE1 A;  2H9L A;  3A0F A;  3IJE A;  4HDJ A;  5FFO A;  4PSX B;  2P9L C;  4GM3 A;  4D6V A;  1PI6 A;  3C75 H;  2P9N C;  2XL3 A;  2MTA H;  4QL1 A;  3VI3 A;  4J87 A;  3FCU A;  4L9O A;  4A11 B;  5M5T A;  1QFM A;  2IAA A;  2VC2 A;  3U4Y A;  4A0A A;  2BKL A;  4K3I D;  1VZ3 A;  5JWZ A;  2IWK A;  4FAV D;  2VDK A;  1VZ2 A;  4AN0 A;  3DWL C;  3RN0 D;  3DXK C;  5B4W A;  4KFM B;  5FKT A;  3IVM A;  2CO0 A;  3F3F A;  5IJ7 E;  3SMR A;  5E6S A;  3NVN A;  1TYE A;  2GC4 A;  2XYI A;  5M5U A;  4N14 A;  4LGN A;  3UVK A;  5GXI A;  1JJU B;  3OTT A;  2HKR A;  3T3M A;  3ZE2 A;  3ZWL B;  2H6Q A;  5AJA A;  5H17 A;  2OVQ B;  4GMB A;  3SFZ A;  3OKY A;  3RLM D;  3O4H A;  2H13 A;  1R5M A;  2H6N A;  2QZP A;  2VDR A;  2OK6 A;  5C9Z B;  4IA9 A;  3PXW D;  5EAP A;  4BP8 A;  4CI2 A;  3IIW A;  3PVU B;  3MMY A;  4ZOZ A;  5EMM B;  3JAM g;  5FA5 B;  4JT6 C;  3AL8 B;  3EI1 A;  3K27 A;  2OVP B;  5M61 A;  1U4C A;  1JV2 A;  4ERY A;  1VE6 A;  4PC0 A;  4J86 A;  1N6D A;  3F3G A;  3N0D A;  3GC3 B;  1GOG A;  4AMY A;  1GOF A;  1E8M A;  3UVL A;  2VDO A;  5GMK n;  2XDW A;  3NID A;  1GG2 B;  4WJK A;  3NIF A;  4GGC A;  3MVD K;  3SXT D;  2EIC A;  5EMK B;  4PNK B;  4DNW A;  4FHL A;  4MMY A;  2UZY B;  2YNO A;  1XIP A;  5C86 A;  3ZDZ A;  3SJL D;  3OF7 A;  3PSC B;  5FKQ A;  3SBQ A;  3V4V A;  1B9X A;  5IGQ A;  3I89 A;  2P9I C;  4NSX A;  1PEV A;  3I7O A;  4J84 A;  1SQ9 A;  3EI3 B;  3K26 A;  1H2X A;  4AEZ A;  4BCB A;  4NAA A;  4QT8 A;  1OLZ A;  3GRE A;  5CXC B;  4ZOY A;  3IJ1 A;  3JB9 L;  2UZX B;  1JOF A;  4GGD A;  1U2V C;  1E8N A;  5CXB A;  3DSM A;  2I0R A;  4CZY A;  5FLX g;  4A08 A;  2XL2 A;  1E5T A;  4JHN A;  2H68 A;  4Y5R D;  2AGY A;  3JRO A;  4G56 B;  3EG6 A;  2PM7 B;  5H14 A;  3VI4 A;  3OL2 A;  4GM8 A;  1RI6 A;  4J8G A;  3GFC A;  3RN1 D;  4BCD A;  1N6F A;  1K8K C;  4A0A B;  4AMZ A;  1NEX B;  3IUL A;  3AL8 A;  2WQ8 A;  1VE7 A;  1JTD B;  2H9M A;  5M5S A;  4O45 A;  4FA1 D;  3B7F A;  2I3T A;  3SCY A;  1UOO A;  3SBR A;  4CI3 A;  2AGW A;  2CN3 A;  3OW8 A;  3IKO A;  1UOQ A;  1MG3 A;  2G99 A;  3F3P A;  5H1M A;  4OWR A;  2GNQ A;  2OVR B;  3JZG A;  5TEE A;  4CY3 A;  1MDA H;  1U8C A;  3NVX A;  5EAM A;  4FAN D;  3UR4 A;  4PSW B;  3GD1 I;  4JSX C;  3MKQ A;  5TEF A;  3OL2 B;  1L5G A;  2J57 G;  2YMU A;  5C2W B;  1XHM A;  3I7K A;  1O6G A;  3N0E A;  3MUN A;  4BH6 A; 
#chains in the Genus database with same CATH homology
 2O9K A;  5EM2 B;  5GXH A;  4X63 B;  3EI2 A;  1XKS A;  2EBS A;  4GZ8 A;  4J79 A;  5IGO A;  2CE8 A;  4J77 A;  2OJY A;  3OKY B;  2P9U C;  5HE1 B;  2H14 A;  3CFV A;  3W15 A;  4H5J A;  5K1C C;  3UVN A;  5EAL A;  5AFU 3;  4D0K A;  2W18 A;  3P4F A;  5KDO B;  4EWR A;  4H5I A;  2B4E A;  5FXY A;  2HKM A;  4A09 A;  4XYI A;  4A09 B;  1PGU A;  3VH0 A;  2I3S A;  4J8B A;  1FWX A;  3SHF A;  2PBI B;  4JSV C;  3PE7 A;  4JXM A;  5AMS A;  3FRX A;  3EI4 A;  3DXM C;  1PBY B;  3I7H A;  3JPX A;  5K19 A;  4J0W A;  4LG8 A;  4J78 A;  4MK0 B;  1JMZ B;  2IWF A;  4CZX A;  3I7P A;  1A0R B;  4ERZ A;  4J81 A;  3EI1 B;  3MXX A;  4O9D A;  2HJ4 A;  4AOW A;  4O3U B;  2AGZ A;  5TF2 A;  3V7D B;  4FA9 D;  2B5N A;  4PBY A;  2HYE A;  4FB1 D;  4FA4 D;  4JT5 C;  5EML B;  1Q47 A;  5HE3 B;  2BCJ B;  3SN6 B;  2Z2N A;  1SQJ A;  4JSN C;  3ULE C;  4A2L A;  2YB8 B;  2HXC A;  5CXB B;  3CIK B;  2Z2O A;  1GXR A;  3ODT A;  4FA5 D;  3C5M A;  4O3T B;  2PM9 A;  4CY1 A;  2HJB A;  2P9S C;  3SLE D;  3VA6 A;  2B5M A;  3UKU C;  3JZH A;  5IJ8 E;  2TRC B;  4Y7R A;  3J81 g;  3RSE C;  3AFC A;  4CI1 A;  2G9A A;  5IT9 g;  2J55 H;  3I7N A;  2Q7Q A;  3L4M D;  2YBA A;  1L0Q A;  2QXV A;  2IUQ A;  1NR0 A;  3FGB A;  2IUV A;  4ERQ A;  4CZV A;  1JMX B;  4E5Z A;  2IUP A;  1SHY B;  1N6E A;  5C2V B;  2AGL A;  3NVQ A;  2OK4 A;  2HES X;  3DM0 A;  3IJC A;  4IMM A;  3UVO A;  4E54 A;  1YFQ A;  2B5L A;  2YNN A;  3EI3 A;  4U1E I;  2AH1 A;  2AQ5 A;  4PBZ A;  4CY5 A;  4LG9 A;  4X3E A;  3V5W B;  4ZN4 A;  4QRJ A;  4J0X A;  2I0T A;  3EI2 B;  3SWS D;  4JD2 C;  1QNI A;  3CFS B;  4K3J B;  2XU7 A;  3UKR C;  3IIY A;  4L3H D;  2QC5 A;  5CYK A;  5FKR A;  2YNP A;  3I8C A;  4GQ2 P;  4TZ4 A;  3BG1 A;  3E0C A;  4BUJ C;  4E5Z B;  1MG2 A;  3OKW A;  5GSA A;  1GP2 B;  2H6K A;  4UI9 R;  4R7A B;  5TDH B;  4CI8 A;  4O1Q D;  2H9N A;  3BWS A;  3OKT A;  3RFG A;  4GQ1 A;  1S4U X;  4FWW A;  2J56 H;  2GC7 A;  3HFQ A;  5I5I A;  1OMW B;  4A2M A;  4ES0 A;  3MZK A;  3PSL A;  4XEI C;  2H47 A;  3IJ0 A;  3FM0 A;  1K32 A;  3RRM C;  4A7J A;  1TYQ C;  3L4O D;  4ZOX A;  5HE2 B;  2OIZ A;  4CY2 A;  4QQE A;  5FKS A;  3EU7 A;  1VYH C;  2H3X A;  4PXW A;  5THA A;  5EMJ B;  5IC7 A;  1B9Y A;  4E54 B;  3C9C A;  4GQB B;  2CE9 A;  4XYH A;  2AGX A;  3JZN A;  5EM2 A;  2CN2 A;  4Z8L A;  3AL9 A;  3EMH A;  5CXC A;  3JRP A;  1P22 A;  4X61 B;  1TBG A;  3EI4 B;  3ORV D;  5FQD A;  5HE0 B;  5I5J A;  4A0B A;  3C99 A;  4A0B B;  5A2Q g;  3I8E A;  3J80 g;  4JSP C;  2I0S A;  2Z2P A;  4I79 A;  2AH0 A;  4YVD A;  1GOT B;  3KRW B;  4OZU A;  2P9P C;  4J73 A;  5EAR A;  5HQG A;  2BBK H;  3I2N A;  5HYN B;  4BL0 A;  3AH8 B;  4L1Q D;  3V9F A;  3MZL A;  4J82 A;  5SXM A;  2P9K C;  3KRX B;  3BG0 A;  4ZOV A;  4GM9 A;  3I7L A;  3VGZ A;  3PVW B;  5I5M A;  5CYK B;  1ERJ A;  3PXT D;  3PXS D;  2CNX A;  3UVM A;  4U7A A;  4GGA A;  4CC9 A;  3SVW D;  4A08 B;  3RFH A;  3SBP A;  4A11 A;  2CO0 C;  2H9P A;  3EWE A;  4ESG A;  3RMZ D;  2PM9 B;  4X60 B;  4L3G D;  2PM6 B;  3MKS B;  2IUR A;  2H9L A;  3A0F A;  4HDJ A;  4PSX B;  2P9L C;  4GM3 A;  4D6V A;  1PI6 A;  3C75 H;  2P9N C;  2XL3 A;  2MTA H;  4QL1 A;  4J87 A;  4L9O A;  4A11 B;  2IAA A;  3U4Y A;  4A0A A;  4K3I D;  5JWZ A;  2IWK A;  4FAV D;  3DWL C;  3RN0 D;  3DXK C;  5B4W A;  4KFM B;  5FKT A;  2CO0 A;  3F3F A;  5IJ7 E;  3SMR A;  3NVN A;  2GC4 A;  2XYI A;  4N14 A;  4LGN A;  3UVK A;  5GXI A;  1JJU B;  3OTT A;  2HKR A;  3ZWL B;  2H6Q A;  5AJA A;  5H17 A;  2OVQ B;  4GMB A;  3SFZ A;  3OKY A;  3RLM D;  2H13 A;  1R5M A;  2H6N A;  2OK6 A;  5C9Z B;  4IA9 A;  3PXW D;  5EAP A;  4CI2 A;  3IIW A;  3PVU B;  3MMY A;  4ZOZ A;  5EMM B;  3JAM g;  5FA5 B;  4JT6 C;  3AL8 B;  3EI1 A;  3K27 A;  2OVP B;  1U4C A;  4ERY A;  4PC0 A;  4J86 A;  1N6D A;  3F3G A;  3N0D A;  3UVL A;  5GMK n;  1GG2 B;  4GGC A;  3SXT D;  5EMK B;  4PNK B;  4FHL A;  2UZY B;  2YNO A;  1XIP A;  3SJL D;  3PSC B;  5FKQ A;  3SBQ A;  1B9X A;  5IGQ A;  3I89 A;  2P9I C;  4NSX A;  1PEV A;  3I7O A;  4J84 A;  1SQ9 A;  3EI3 B;  3K26 A;  4AEZ A;  4QT8 A;  1OLZ A;  3GRE A;  5CXC B;  4ZOY A;  3IJ1 A;  3JB9 L;  2UZX B;  1JOF A;  4GGD A;  1U2V C;  5CXB A;  3DSM A;  2I0R A;  4CZY A;  5FLX g;  4A08 A;  2XL2 A;  2H68 A;  4Y5R D;  2AGY A;  3JRO A;  4G56 B;  3EG6 A;  2PM7 B;  5H14 A;  3OL2 A;  4GM8 A;  1RI6 A;  4J8G A;  3GFC A;  3RN1 D;  1N6F A;  1K8K C;  4A0A B;  1NEX B;  3AL8 A;  2H9M A;  4O45 A;  4FA1 D;  3B7F A;  2I3T A;  3SCY A;  3SBR A;  4CI3 A;  2AGW A;  2CN3 A;  3OW8 A;  3IKO A;  1MG3 A;  2G99 A;  3F3P A;  5H1M A;  4OWR A;  2GNQ A;  2OVR B;  3JZG A;  5TEE A;  4CY3 A;  1MDA H;  3NVX A;  5EAM A;  4FAN D;  3UR4 A;  4PSW B;  4JSX C;  3MKQ A;  5TEF A;  3OL2 B;  2J57 G;  2YMU A;  5C2W B;  1XHM A;  3I7K A;  3N0E A;  4BH6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...