5IT9g

Structure of the yeast kluyveromyces lactis small ribosomal subunit in complex with the cricket paralysis virus ires.
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
324
structure length
318
Chain Sequence
SSNIMLVLRGTLEGHNGWVTSLSTSAAQPNLLVSGSRDKTLISWRLTENEQQFGVPVRSYKGHSHIVQDVVVSADGNYAVSASWDKTLRLWNLATGNSEARFVGHTGDVLSVAIDANSSKIISASRDKTIRVWNTVGDCAYVLLGHTDWVTKVRVAPKNLVDDGRITFVSAGMDKIVRSWSLNSYRIEADFIGHNNYINVVQPSPDGSLAASAGKDGQIYVWNLKHKSAFMNFDAKDEVFALAFSPSRFWLTAATASGIKIYDLENEVLIDELKPEFAGYTKAQDPHAVSLAWSADGQTLFAGYTDNVIRVWQVMTAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of ribosome recruitment and translocation by type IV IRES.
pubmed doi rcsb
source organism Cricket paralysis virus
molecule tags Ribosome
molecule keywords Ribosomal protein uS2
total genus 52
structure length 318
sequence length 324
ec nomenclature
pdb deposition date 2016-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
g PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5it9g01
3EI3A 3SMRA 2B4EA 3BWSA 5C9ZB 2H9MA 3U4YA 2XL3A 4HDJA 4ES0A 4A11B 4O1QD 5IC7A 4FAND 4FHLA 3MZKA 3JROA 4CZXA 1B9XA 3RMZD 2TRCB 5FKRA 5K19A 3PSCB 2CN3A 2OVQB 4CI8A 2HJ4A 1JMZB 4ERZA 3I2NA 3MKSB 2CE8A 2HXCA 2CNXA 3IKOA 3ORVD 3SCYA 1GOTB 2H9NA 5GXIA 4E54B 1N6FA 2QXVA 3NVNA 3I8EA 4CZYA 3JAMg 3JB9L 2Q7QA 4GM9A 4FA5D 1SQ9A 5EMKB 1QNIA 3C5MA 3I7OA 3JPXA 2HKRA 4A0AB 2YBAA 3PXSD 4I79A 4O3TB 3SN6B 2H6NA 5A2Qg 4JT5C 2P9NC 5B4WA 3V7DB 2H13A 4LGNA 5AMSA 1L0QA 3L4MD 4GGDA 3VGZA 4U7AA 2OJYA 2Z2NA 2HYEA 2P9IC 4Y7RA 4PC0A 1NEXB 3N0DA 5HE3B 3I89A 1SQJA 5TEFA 1GP2B 3B7FA 4A2MA 1U4CA 2I3SA 4U1EI 4A08B 3OKYA 2OIZA 5H17A 2J57G 3MXXA 5IT9g 3DM0A 3ULEC 4UI9R 2G99A 4QT8A 3EI2A 3C9CA 4J77A 1PGUA 4BH6A 4GGCA 3SHFA 5IJ7E 2YB8B 2PM7B 2IWFA 3UKRC 4L3HD 1K32A 5EARA 3CIKB 4EWRA 5K1CC 4A2LA 4ZN4A 4J8BA 5AJAA 3OL2A 1MG2A 3DXMC 3V9FA 5JWZA 3P4FA 5EMLB 3PVWB 1P22A 4MK0B 3SBQA 1S4UX 2H6QA 2PM6B 4PXWA 2I0SA 1FWXA 4J86A 4L1QD 2PM9A 4JT6C 2IURA 4CI3A 3K27A 3DSMA 4JD2C 4NSXA 3OTTA 1JMXB 4PSXB 3F3FA 5HQGA 4ZOVA 3BG0A 3SWSD 4XEIC 4FWWA 2AGLA 3W15A 5HE1B 1TBGA 5EM2B 4QRJA 2IUPA 4ESGA 2AQ5A 4CY1A 3AFCA 4GQ1A 3V5WB 3SVWD 2BBKH 5IGOA 5TEEA 4Z8LA 2H47A 3OKTA 4XYIA 3SBPA 3PVUB 4LG9A 2IUVA 4JSNC 2GC4A 4ZOYA 3UVLA 2H6KA 4H5IA 4XYHA 2IUQA 2MTAH 3JRPA 5TF2A 3KRWB 3JZNA 2CN2A 2GNQA 3RN1D 5EAMA 5GSAA 5TDHB 4X61B 2I0RA 3HFQA 2XU7A 3ZWLB 3IJ1A 4FAVD 3IIWA 3K26A 4J79A 4GM8A 5AFU3 4Y5RD 2B5NA 3UKUC 3OL2B 2I3TA 2AH1A 2HESX 3L4OD 2AH0A 5H1MA 5THAA 2BCJB 5IGQA 2P9SC 3EI1B 2P9PC 4N14A 3J81g 4E54A 3E0CA 4X60B 2YNOA 2P9LC 3UVKA 4AEZA 2H9LA 4GZ8A 1VYHC 4O3UB 4CY3A 3EI4A 1A0RB 4L9OA 2PBIB 1GXRA 3SJLD 4A11A 1OLZA 4J0WA 3F3GA 4GM3A 5C2VB 1K8KC 3AL8B 1N6DA 5I5IA 1PEVA 5EALA 3IJCA 4X63B 2B5LA 1B9YA 4JSPC 2AGZA 3GREA 3EMHA 3FGBA 3KRXB 4PSWB 5FKQA 1XKSA 2QC5A 2W18A 3CFSB 4ERQA 2HJBA 4J8GA 3SBRA 1ERJA 3RN0D 5I5JA 3A0FA 4H5JA 3C99A 5HE2B 4E5ZB 4BL0A 4BUJC 5FXYA 3C75H 3GFCA 2P9KC 1U2VC 3PXTD 4A08A 5CXCB 3IJ0A 1YFQA 4ZOXA 2OK6A 5EM2A 4JSVC 3I7LA 3NVXA 3UR4A 5IJ8E 4G56B 2B5MA 5EAPA 2YMUA 3I7KA 3AL8A 1GG2B 3RFHA 5GXHA 4FA1D 2GC7A 3RLMD 4R7AB 4J0XA 4FB1D 3NVQA 5KDOB 4IMMA 2IAAA 1R5MA 3VH0A 2OVPB 3DXKC 2OVRB 2P9UC 2EBSA 5GMKn 2CE9A 4K3JB 4QL1A 1JOFA 4AOWA 1RI6A 2YNPA 3OKWA 3EG6A 4JXMA 4FA9D 1PI6A 5CYKA 3I7NA 3N0EA 4ZOZA 4CI1A 3IIYA 1JJUB 3BG1A 4A0AA 3SLED 2O9KA 4LG8A 3EI2B 3ODTA 3JZHA 3PSLA 4A09A 4K3ID 4J73A 3I8CA 4L3GD 5CXBA 3UVMA 5FA5B 3SXTD 4YVDA 2AGYA 3AL9A 1MG3A 3JZGA 2J55H 5H14A 5FQDA 3I7HA 4D6VA 2YNNA 2UZYB 2XYIA 4OZUA 1SHYB 3EI4B 3J80g 4KFMB 4TZ4A 5FKSA 3EU7A 1TYQC 4A7JA 1XIPA 2PM9B 4J78A 2HKMA 4O9DA 3OKYB 2AGXA 1MDAH 2UZXB 1NR0A 4GMBA 1OMWB 1Q47A 2H68A 5CXBB 3CFVA 4QQEA 4O45A 2I0TA 2CO0A 4GGAA 5HE0B 3UVOA 1PBYB 2J56H 3FM0A 3OW8A 2Z2PA 3MKQA 5EMMB 3PXWD 5SXMA 3RSEC 3EWEA 4X3EA 4JSXC 4GQBB 3MZLA 1XHMA 2Z2OA 4CY5A 4J82A 4J84A 4CC9A 2IWKA 2OK4A 4GQ2P 4A0BB 4A09B 4CI2A 2G9AA 3VA6A 3F3PA 3FRXA 5CYKB 4CZVA 3EI1A 5FKTA 4OWRA 4J81A 1N6EA 2AGWA 2H3XA 4ERYA 4PBZA 2CO0C 5FLXg 4CY2A 4PBYA 3I7PA 3EI3B 5C2WB 5CXCA 5EMJB 3RFGA 2XL2A 3DWLC 3AH8B 4FA4D 2H14A 5HYNB 4A0BA 4E5ZA 3SFZA 4J87A 4D0KA 3UVNA 5I5MA 4PNKB 3MMYA 2H9PA 3PE7A 4IA9A 3RRMC
chains in the Genus database with same CATH superfamily
4MMYA 3O4GA 3EI3A 4JHNA 1YR2A 3VI4A 3SMRA 4WK0A 2B4EA 3BWSA 4UM9A 4MMXA 5C9ZB 2H9MA 3U4YA 4BCDA 2XL3A 4HDJA 4ES0A 4A11B 4O1QD 2VZ3A 4WJKA 5IC7A 4FAND 4FHLA 3MZKA 3JROA 4CZXA 1B9XA 2EIEA 3RMZD 2TRCB 5FKRA 5K19A 3PSCB 2CN3A 2OVQB 4CI8A 5M5TA 2HJ4A 1JMZB 4ERZA 3I2NA 4UM8A 3MKSB 2CE8A 2HXCA 2WQ8A 2CNXA 3IKOA 1A12A 1U8CA 3ORVD 3SCYA 5M5UA 1GOTB 4DNUA 2H9NA 5GXIA 4E54B 1N6FA 2QXVA 3NVNA 3I8EA 1UTCA 4CZYA 3JAMg 3MVDK 3JB9L 2Q7QA 4GM9A 4FA5D 1JV2A 1SQ9A 5EMKB 3O4IA 1QNIA 3C5MA 3I7OA 3JPXA 2HKRA 4A0AB 2YBAA 3MUOA 3PXSD 4I79A 4O3TB 3SN6B 2H6NA 3EQ8A 5A2Qg 3MUNA 4JT5C 2P9NC 5B4WA 1TYEA 3V7DB 2H13A 4LGNA 5AMSA 1L0QA 3L4MD 4GGDA 5M61A 4U7AA 3VGZA 2OJYA 2Z2NA 2HYEA 2P9IC 4Y7RA 4PC0A 1NEXB 2VDPA 3N0DA 5HE3B 3I89A 1SQJA 2XE4A 5TEFA 1GP2B 3B7FA 4A2MA 1U4CA 4IRZA 2I3SA 4U1EI 4A08B 3OKYA 2OIZA 5H17A 2J57G 3MXXA 5IT9g 3DM0A 3ULEC 1QFSA 4UI9R 2G99A 4QT8A 3EI2A 3C9CA 1VE7A 3GD1I 4J77A 1PGUA 4BH6A 4GGCA 3IURA 3SHFA 4Z7OA 5IJ7E 2YB8B 2PM7B 2IWFA 2QR5A 1QFMA 3UKRC 4L3HD 1E5TA 1K32A 5EARA 3CIKB 4EWRA 3DDUA 5K1CC 4A2LA 4ZN4A 4J8BA 5AJAA 3OL2A 1MG2A 3DXMC 3V9FA 5JWZA 3P4FA 5EMLB 3PVWB 4NC4A 1L5GA 1P22A 4MK0B 3SBQA 4DNVA 1S4UX 2H6QA 2PM6B 5FFGA 4PXWA 2I0SA 1FWXA 4J86A 4L1QD 2PM9A 4JT6C 3ZDXA 2IURA 4CI3A 1O6GA 3K27A 3DSMA 4JD2C 4NSXA 5E6SA 1H2YA 3OTTA 1C9LA 1JMXB 4PSXB 1E8NA 3F3FA 5HQGA 4ZOVA 3BG0A 3SWSD 4XEIC 4FWWA 2AGLA 3W15A 5HE1B 3K72A 1TBGA 5EM2B 4QRJA 5M5VA 2IUPA 4ESGA 3QHYB 2AQ5A 4CY1A 3AFCA 4GQ1A 3V5WB 3SVWD 2BBKH 5IGOA 5TEEA 4Z8LA 1GOGA 2H47A 3IUJA 5C92A 3OKTA 4XYIA 3SBPA 3PVUB 4LG9A 4D9SA 2IUVA 4JSNC 2GC4A 4ZOYA 3UVLA 2H6KA 4H5IA 4AMYA 4XYHA 2IUQA 2MTAH 3JRPA 3NIGA 3KRWB 5TF2A 3JZNA 2CN2A 1GOFA 2GNQA 3RN1D 1I2MB 5EAMA 5GSAA 5TDHB 4X61B 2I0RA 3HFQA 3FCSA 2XU7A 2XZGA 3ZWLB 3IJ1A 2VC2A 4FAVD 3IIWA 3K26A 4BCBA 1H2WA 4J79A 1H2ZA 4GM8A 5AFU3 4Y5RD 2B5NA 5FFOA 1M1XA 3UKUC 3OL2B 4AN0A 2I3TA 2AH1A 2HESX 4RE5A 3L4OD 3K6SA 2AH0A 2VDMA 5H1MA 5THAA 2BCJB 5IGQA 2BKLA 2P9SC 3EI1B 2EIBA 2P9PC 4N14A 3J81g 3V4VA 4E54A 3E0CA 4X60B 2YNOA 2P9LC 3UVKA 2JKXA 4AEZA 3ZE0A 3VI3A 2H9LA 4GZ8A 1VYHC 4O3UB 4CY3A 4Z7QA 3EI4A 1A0RB 4L9OA 4WK2A 2PBIB 1GXRA 3SJLD 4A11A 1OLZA 1T2XA 4J0WA 3EQ7A 3F3GA 4GM3A 5C2VB 1K8KC 3AL8B 4BCCA 1N6DA 5I5IA 1UOPA 4RE6A 1PEVA 5EALA 3IJCA 1E8MA 4X63B 2B5LA 1B9YA 5M5RA 4JSPC 3T3PA 2AGZA 3GREA 3EMHA 3FGBA 3KRXB 4PSWB 3OF7A 5FKQA 1XKSA 2QC5A 2W18A 3FCUA 4MMZA 3CFSB 4ERQA 2VDQA 2HJBA 3O4JA 4NENA 4J8GA 4O02A 3SBRA 1ERJA 3RN0D 4DNWA 5I5JA 3A0FA 3NIFA 3ZE2A 4H5JA 3C99A 5HE2B 4E5ZB 2EIDA 4BL0A 4BUJC 5FXYA 1VZ2A 3C75H 3GFCA 1K3IA 5E6RA 2P9KC 1U2VC 3PXTD 4A08A 5CXCB 3IJ0A 1YFQA 3NIDA 4ZOXA 2OK6A 5EM2A 4JSVC 3I7LA 3NVXA 3UR4A 5IJ8E 4G56B 2B5MA 5EAPA 2YMUA 4BP9A 4JHPC 3O4HA 3I7KA 3AL8A 1GG2B 3RFHA 5GXHA 4FA1D 2QZPA 2GC7A 4AMZA 4G1MA 3RLMD 4R7AB 1UOOA 2HU8A 4J0XA 4FB1D 3NVQA 5KDOB 4IMMA 1VZ3A 3ZE1A 2IAAA 2HU7A 1R5MA 3VH0A 2OVPB 3DXKC 4L1MA 2OVRB 2P9UC 2EBSA 5GMKn 2CE9A 3EQ9A 4QAMA 4K3JB 4QL1A 1JOFA 4AOWA 1RI6A 2YNPA 3OKWA 3EG6A 4JXMA 4FA9D 1PI6A 5CYKA 3I7NA 3N0EA 4ZOZA 4CI1A 3IIYA 1JJUB 3BG1A 3QI0A 2VZ1A 3SLED 2O9KA 4LG8A 4NBMA 3ODTA 3EI2B 3JZHA 3KCIA 4A0AA 3PSLA 4A09A 4K3ID 4J73A 1UOQA 3V4PA 3I8CA 1BPOA 4L3GD 1C9IA 5CXBA 3UVMA 5FA5B 3SXTD 4YVDA 3IUMA 2AGYA 3AL9A 3GC3B 1MG3A 1H2XA 3JZGA 5E6UA 2J55H 5H14A 3IVMA 5FQDA 2EICA 3I7HA 4D6VA 1O6FA 2VDNA 2YNNA 2UZYB 2XYIA 4OZUA 1SHYB 3EI4B 3J80g 4KFMB 4TZ4A 5FKSA 3EU7A 1TYQC 2VDRA 4A7JA 1XIPA 2PM9B 4J78A 2HKMA 4O9DA 3OKYB 2AGXA 1MDAH 2UZXB 2VDOA 3T3MA 1NR0A 2VDKA 3ZDYA 4GMBA 1OMWB 1GOHA 1JTDB 1Q47A 2H68A 5CXBB 3CFVA 4NAAA 4QQEA 4O45A 2I0TA 2CO0A 4GGAA 5M5SA 5HE0B 4G1EA 3UVOA 1PBYB 5HDBA 2J56H 3K71A 3FM0A 3OW8A 3MKQA 2Z2PA 5EMMB 3PXWD 5SXMA 3RSEC 3EWEA 4X3EA 4JSXC 4GQBB 3MZLA 4BP8A 1XHMA 2Z2OA 4CY5A 4J82A 4J84A 4CC9A 2IWKA 2OK4A 4GQ2P 4A0BB 4A09B 2HU5A 4CI2A 2XDWA 2G9AA 3VA6A 3F3PA 3FRXA 3ZDZA 5CYKB 4CZVA 3EI1A 4O2WA 5FKTA 4AN1A 4OWRA 4J81A 1N6EA 2AGWA 2H3XA 4G55A 4ERYA 4PBZA 1VE6A 2CO0C 3IUNA 4WK4A 5FLXg 4CY2A 4PBYA 3I7PA 3EI3B 5C2WB 5CXCA 5EMJB 3RFGA 2XL2A 3DWLC 3IULA 3AH8B 4FA4D 2H14A 5HYNB 4A0BA 4E5ZA 4AX4A 3SFZA 5C86A 3IUQA 4J87A 2VDLA 4Z7NA 4D0KA 3UVNA 5I5MA 3IJEA 4PNKB 3MMYA 2H9PA 3PE7A 4IA9A 3RRMC
chains in the Genus database with same CATH topology
3EI3A 3SMRA 2B4EA 3BWSA 5C9ZB 2H9MA 3U4YA 2XL3A 4HDJA 4ES0A 4A11B 4O1QD 5IC7A 4FAND 4FHLA 3MZKA 3JROA 4CZXA 1B9XA 3RMZD 2TRCB 5FKRA 5K19A 3PSCB 2CN3A 2OVQB 4CI8A 2HJ4A 1JMZB 4ERZA 3I2NA 3MKSB 2CE8A 2HXCA 2CNXA 3IKOA 3ORVD 3SCYA 1GOTB 2H9NA 5GXIA 4E54B 1N6FA 2QXVA 3NVNA 3I8EA 4CZYA 3JAMg 3JB9L 2Q7QA 4GM9A 4FA5D 1SQ9A 5EMKB 1QNIA 3C5MA 3I7OA 3JPXA 2HKRA 4A0AB 2YBAA 3PXSD 4I79A 4O3TB 3SN6B 2H6NA 5A2Qg 4JT5C 2P9NC 5B4WA 3V7DB 2H13A 4LGNA 5AMSA 1L0QA 3L4MD 4GGDA 3VGZA 4U7AA 2OJYA 2Z2NA 2HYEA 2P9IC 4Y7RA 4PC0A 1NEXB 3N0DA 5HE3B 3I89A 1SQJA 5TEFA 1GP2B 3B7FA 4A2MA 1U4CA 2I3SA 4U1EI 4A08B 3OKYA 2OIZA 5H17A 2J57G 3MXXA 5IT9g 3DM0A 3ULEC 4UI9R 2G99A 4QT8A 3EI2A 3C9CA 4J77A 1PGUA 4BH6A 4GGCA 3SHFA 5IJ7E 2YB8B 2PM7B 2IWFA 3UKRC 4L3HD 1K32A 5EARA 3CIKB 4EWRA 5K1CC 4A2LA 4ZN4A 4J8BA 5AJAA 3OL2A 1MG2A 3DXMC 3V9FA 5JWZA 3P4FA 5EMLB 3PVWB 1P22A 4MK0B 3SBQA 1S4UX 2H6QA 2PM6B 4PXWA 2I0SA 1FWXA 4J86A 4L1QD 2PM9A 4JT6C 2IURA 4CI3A 3K27A 3DSMA 4JD2C 4NSXA 3OTTA 1JMXB 4PSXB 3F3FA 5HQGA 4ZOVA 3BG0A 3SWSD 4XEIC 4FWWA 2AGLA 3W15A 5HE1B 1TBGA 5EM2B 4QRJA 2IUPA 4ESGA 2AQ5A 4CY1A 3AFCA 4GQ1A 3V5WB 3SVWD 2BBKH 5IGOA 5TEEA 4Z8LA 2H47A 3OKTA 4XYIA 3SBPA 3PVUB 4LG9A 2IUVA 4JSNC 2GC4A 4ZOYA 3UVLA 2H6KA 4H5IA 4XYHA 2IUQA 2MTAH 3JRPA 5TF2A 3KRWB 3JZNA 2CN2A 2GNQA 3RN1D 5EAMA 5GSAA 5TDHB 4X61B 2I0RA 3HFQA 2XU7A 3ZWLB 3IJ1A 4FAVD 3IIWA 3K26A 4J79A 4GM8A 5AFU3 4Y5RD 2B5NA 3UKUC 3OL2B 2I3TA 2AH1A 2HESX 3L4OD 2AH0A 5H1MA 5THAA 2BCJB 5IGQA 2P9SC 3EI1B 2P9PC 4N14A 3J81g 4E54A 3E0CA 4X60B 2YNOA 2P9LC 3UVKA 4AEZA 2H9LA 4GZ8A 1VYHC 4O3UB 4CY3A 3EI4A 1A0RB 4L9OA 2PBIB 1GXRA 3SJLD 4A11A 1OLZA 4J0WA 3F3GA 4GM3A 5C2VB 1K8KC 3AL8B 1N6DA 5I5IA 1PEVA 5EALA 3IJCA 4X63B 2B5LA 1B9YA 4JSPC 2AGZA 3GREA 3EMHA 3FGBA 3KRXB 4PSWB 5FKQA 1XKSA 2QC5A 2W18A 3CFSB 4ERQA 2HJBA 4J8GA 3SBRA 1ERJA 3RN0D 5I5JA 3A0FA 4H5JA 3C99A 5HE2B 4E5ZB 4BL0A 4BUJC 5FXYA 3C75H 3GFCA 2P9KC 1U2VC 3PXTD 4A08A 5CXCB 3IJ0A 1YFQA 4ZOXA 2OK6A 5EM2A 4JSVC 3I7LA 3NVXA 3UR4A 5IJ8E 4G56B 2B5MA 5EAPA 2YMUA 3I7KA 3AL8A 1GG2B 3RFHA 5GXHA 4FA1D 2GC7A 3RLMD 4R7AB 4J0XA 4FB1D 3NVQA 5KDOB 4IMMA 2IAAA 1R5MA 3VH0A 2OVPB 3DXKC 2OVRB 2P9UC 2EBSA 5GMKn 2CE9A 4K3JB 4QL1A 1JOFA 4AOWA 1RI6A 2YNPA 3OKWA 3EG6A 4JXMA 4FA9D 1PI6A 5CYKA 3I7NA 3N0EA 4ZOZA 4CI1A 3IIYA 1JJUB 3BG1A 4A0AA 3SLED 2O9KA 4LG8A 3EI2B 3ODTA 3JZHA 3PSLA 4A09A 4K3ID 4J73A 3I8CA 4L3GD 5CXBA 3UVMA 5FA5B 3SXTD 4YVDA 2AGYA 3AL9A 1MG3A 3JZGA 2J55H 5H14A 5FQDA 3I7HA 4D6VA 2YNNA 2UZYB 2XYIA 4OZUA 1SHYB 3EI4B 3J80g 4KFMB 4TZ4A 5FKSA 3EU7A 1TYQC 4A7JA 1XIPA 2PM9B 4J78A 2HKMA 4O9DA 3OKYB 2AGXA 1MDAH 2UZXB 1NR0A 4GMBA 1OMWB 1Q47A 2H68A 5CXBB 3CFVA 4QQEA 4O45A 2I0TA 2CO0A 4GGAA 5HE0B 3UVOA 1PBYB 2J56H 3FM0A 3OW8A 2Z2PA 3MKQA 5EMMB 3PXWD 5SXMA 3RSEC 3EWEA 4X3EA 4JSXC 4GQBB 3MZLA 1XHMA 2Z2OA 4CY5A 4J82A 4J84A 4CC9A 2IWKA 2OK4A 4GQ2P 4A0BB 4A09B 4CI2A 2G9AA 3VA6A 3F3PA 3FRXA 5CYKB 4CZVA 3EI1A 5FKTA 4OWRA 4J81A 1N6EA 2AGWA 2H3XA 4ERYA 4PBZA 2CO0C 5FLXg 4CY2A 4PBYA 3I7PA 3EI3B 5C2WB 5CXCA 5EMJB 3RFGA 2XL2A 3DWLC 3AH8B 4FA4D 2H14A 5HYNB 4A0BA 4E5ZA 3SFZA 4J87A 4D0KA 3UVNA 5I5MA 4PNKB 3MMYA 2H9PA 3PE7A 4IA9A 3RRMC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EI3 A;  3SMR A;  2B4E A;  3BWS A;  5C9Z B;  2H9M A;  3U4Y A;  2XL3 A;  4HDJ A;  4ES0 A;  4A11 B;  4O1Q D;  5IC7 A;  4FAN D;  4FHL A;  3MZK A;  3JRO A;  4CZX A;  1B9X A;  3RMZ D;  2TRC B;  5FKR A;  5K19 A;  3PSC B;  2CN3 A;  2OVQ B;  4CI8 A;  2HJ4 A;  1JMZ B;  4ERZ A;  3I2N A;  3MKS B;  2CE8 A;  2HXC A;  2CNX A;  3IKO A;  3ORV D;  3SCY A;  1GOT B;  2H9N A;  5GXI A;  4E54 B;  1N6F A;  2QXV A;  3NVN A;  3I8E A;  4CZY A;  3JAM g;  3JB9 L;  2Q7Q A;  4GM9 A;  4FA5 D;  1SQ9 A;  5EMK B;  1QNI A;  3C5M A;  3I7O A;  3JPX A;  2HKR A;  4A0A B;  2YBA A;  3PXS D;  4I79 A;  4O3T B;  3SN6 B;  2H6N A;  5A2Q g;  4JT5 C;  2P9N C;  5B4W A;  3V7D B;  2H13 A;  4LGN A;  5AMS A;  1L0Q A;  3L4M D;  4GGD A;  3VGZ A;  4U7A A;  2OJY A;  2Z2N A;  2HYE A;  2P9I C;  4Y7R A;  4PC0 A;  1NEX B;  3N0D A;  5HE3 B;  3I89 A;  1SQJ A;  5TEF A;  1GP2 B;  3B7F A;  4A2M A;  1U4C A;  2I3S A;  4U1E I;  4A08 B;  3OKY A;  2OIZ A;  5H17 A;  2J57 G;  3MXX A;  5IT9 g;  3DM0 A;  3ULE C;  4UI9 R;  2G99 A;  4QT8 A;  3EI2 A;  3C9C A;  4J77 A;  1PGU A;  4BH6 A;  4GGC A;  3SHF A;  5IJ7 E;  2YB8 B;  2PM7 B;  2IWF A;  3UKR C;  4L3H D;  1K32 A;  5EAR A;  3CIK B;  4EWR A;  5K1C C;  4A2L A;  4ZN4 A;  4J8B A;  5AJA A;  3OL2 A;  1MG2 A;  3DXM C;  3V9F A;  5JWZ A;  3P4F A;  5EML B;  3PVW B;  1P22 A;  4MK0 B;  3SBQ A;  1S4U X;  2H6Q A;  2PM6 B;  4PXW A;  2I0S A;  1FWX A;  4J86 A;  4L1Q D;  2PM9 A;  4JT6 C;  2IUR A;  4CI3 A;  3K27 A;  3DSM A;  4JD2 C;  4NSX A;  3OTT A;  1JMX B;  4PSX B;  3F3F A;  5HQG A;  4ZOV A;  3BG0 A;  3SWS D;  4XEI C;  4FWW A;  2AGL A;  3W15 A;  5HE1 B;  1TBG A;  5EM2 B;  4QRJ A;  2IUP A;  4ESG A;  2AQ5 A;  4CY1 A;  3AFC A;  4GQ1 A;  3V5W B;  3SVW D;  2BBK H;  5IGO A;  5TEE A;  4Z8L A;  2H47 A;  3OKT A;  4XYI A;  3SBP A;  3PVU B;  4LG9 A;  2IUV A;  4JSN C;  2GC4 A;  4ZOY A;  3UVL A;  2H6K A;  4H5I A;  4XYH A;  2IUQ A;  2MTA H;  3JRP A;  5TF2 A;  3KRW B;  3JZN A;  2CN2 A;  2GNQ A;  3RN1 D;  5EAM A;  5GSA A;  5TDH B;  4X61 B;  2I0R A;  3HFQ A;  2XU7 A;  3ZWL B;  3IJ1 A;  4FAV D;  3IIW A;  3K26 A;  4J79 A;  4GM8 A;  5AFU 3;  4Y5R D;  2B5N A;  3UKU C;  3OL2 B;  2I3T A;  2AH1 A;  2HES X;  3L4O D;  2AH0 A;  5H1M A;  5THA A;  2BCJ B;  5IGQ A;  2P9S C;  3EI1 B;  2P9P C;  4N14 A;  3J81 g;  4E54 A;  3E0C A;  4X60 B;  2YNO A;  2P9L C;  3UVK A;  4AEZ A;  2H9L A;  4GZ8 A;  1VYH C;  4O3U B;  4CY3 A;  3EI4 A;  1A0R B;  4L9O A;  2PBI B;  1GXR A;  3SJL D;  4A11 A;  1OLZ A;  4J0W A;  3F3G A;  4GM3 A;  5C2V B;  1K8K C;  3AL8 B;  1N6D A;  5I5I A;  1PEV A;  5EAL A;  3IJC A;  4X63 B;  2B5L A;  1B9Y A;  4JSP C;  2AGZ A;  3GRE A;  3EMH A;  3FGB A;  3KRX B;  4PSW B;  5FKQ A;  1XKS A;  2QC5 A;  2W18 A;  3CFS B;  4ERQ A;  2HJB A;  4J8G A;  3SBR A;  1ERJ A;  3RN0 D;  5I5J A;  3A0F A;  4H5J A;  3C99 A;  5HE2 B;  4E5Z B;  4BL0 A;  4BUJ C;  5FXY A;  3C75 H;  3GFC A;  2P9K C;  1U2V C;  3PXT D;  4A08 A;  5CXC B;  3IJ0 A;  1YFQ A;  4ZOX A;  2OK6 A;  5EM2 A;  4JSV C;  3I7L A;  3NVX A;  3UR4 A;  5IJ8 E;  4G56 B;  2B5M A;  5EAP A;  2YMU A;  3I7K A;  3AL8 A;  1GG2 B;  3RFH A;  5GXH A;  4FA1 D;  2GC7 A;  3RLM D;  4R7A B;  4J0X A;  4FB1 D;  3NVQ A;  5KDO B;  4IMM A;  2IAA A;  1R5M A;  3VH0 A;  2OVP B;  3DXK C;  2OVR B;  2P9U C;  2EBS A;  5GMK n;  2CE9 A;  4K3J B;  4QL1 A;  1JOF A;  4AOW A;  1RI6 A;  2YNP A;  3OKW A;  3EG6 A;  4JXM A;  4FA9 D;  1PI6 A;  5CYK A;  3I7N A;  3N0E A;  4ZOZ A;  4CI1 A;  3IIY A;  1JJU B;  3BG1 A;  4A0A A;  3SLE D;  2O9K A;  4LG8 A;  3EI2 B;  3ODT A;  3JZH A;  3PSL A;  4A09 A;  4K3I D;  4J73 A;  3I8C A;  4L3G D;  5CXB A;  3UVM A;  5FA5 B;  3SXT D;  4YVD A;  2AGY A;  3AL9 A;  1MG3 A;  3JZG A;  2J55 H;  5H14 A;  5FQD A;  3I7H A;  4D6V A;  2YNN A;  2UZY B;  2XYI A;  4OZU A;  1SHY B;  3EI4 B;  3J80 g;  4KFM B;  4TZ4 A;  5FKS A;  3EU7 A;  1TYQ C;  4A7J A;  1XIP A;  2PM9 B;  4J78 A;  2HKM A;  4O9D A;  3OKY B;  2AGX A;  1MDA H;  2UZX B;  1NR0 A;  4GMB A;  1OMW B;  1Q47 A;  2H68 A;  5CXB B;  3CFV A;  4QQE A;  4O45 A;  2I0T A;  2CO0 A;  4GGA A;  5HE0 B;  3UVO A;  1PBY B;  2J56 H;  3FM0 A;  3OW8 A;  2Z2P A;  3MKQ A;  5EMM B;  3PXW D;  5SXM A;  3RSE C;  3EWE A;  4X3E A;  4JSX C;  4GQB B;  3MZL A;  1XHM A;  2Z2O A;  4CY5 A;  4J82 A;  4J84 A;  4CC9 A;  2IWK A;  2OK4 A;  4GQ2 P;  4A0B B;  4A09 B;  4CI2 A;  2G9A A;  3VA6 A;  3F3P A;  3FRX A;  5CYK B;  4CZV A;  3EI1 A;  5FKT A;  4OWR A;  4J81 A;  1N6E A;  2AGW A;  2H3X A;  4ERY A;  4PBZ A;  2CO0 C;  5FLX g;  4CY2 A;  4PBY A;  3I7P A;  3EI3 B;  5C2W B;  5CXC A;  5EMJ B;  3RFG A;  2XL2 A;  3DWL C;  3AH8 B;  4FA4 D;  2H14 A;  5HYN B;  4A0B A;  4E5Z A;  3SFZ A;  4J87 A;  4D0K A;  3UVN A;  5I5M A;  4PNK B;  3MMY A;  2H9P A;  3PE7 A;  4IA9 A;  3RRM C; 
#chains in the Genus database with same CATH topology
 4MMY A;  3O4G A;  3EI3 A;  4JHN A;  1YR2 A;  3VI4 A;  3SMR A;  4WK0 A;  2B4E A;  3BWS A;  4UM9 A;  4MMX A;  5C9Z B;  2H9M A;  3U4Y A;  4BCD A;  2XL3 A;  4HDJ A;  4ES0 A;  4A11 B;  4O1Q D;  2VZ3 A;  4WJK A;  5IC7 A;  4FAN D;  4FHL A;  3MZK A;  3JRO A;  4CZX A;  1B9X A;  2EIE A;  3RMZ D;  2TRC B;  5FKR A;  5K19 A;  3PSC B;  2CN3 A;  2OVQ B;  4CI8 A;  5M5T A;  2HJ4 A;  1JMZ B;  4ERZ A;  3I2N A;  4UM8 A;  3MKS B;  2CE8 A;  2HXC A;  2WQ8 A;  2CNX A;  3IKO A;  1A12 A;  1U8C A;  3ORV D;  3SCY A;  5M5U A;  1GOT B;  4DNU A;  2H9N A;  5GXI A;  4E54 B;  1N6F A;  2QXV A;  3NVN A;  3I8E A;  1UTC A;  4CZY A;  3JAM g;  3MVD K;  3JB9 L;  2Q7Q A;  4GM9 A;  4FA5 D;  1JV2 A;  1SQ9 A;  5EMK B;  3O4I A;  1QNI A;  3C5M A;  3I7O A;  3JPX A;  2HKR A;  4A0A B;  2YBA A;  3MUO A;  3PXS D;  4I79 A;  4O3T B;  3SN6 B;  2H6N A;  3EQ8 A;  5A2Q g;  3MUN A;  4JT5 C;  2P9N C;  5B4W A;  1TYE A;  3V7D B;  2H13 A;  4LGN A;  5AMS A;  1L0Q A;  3L4M D;  4GGD A;  5M61 A;  4U7A A;  3VGZ A;  2OJY A;  2Z2N A;  2HYE A;  2P9I C;  4Y7R A;  4PC0 A;  1NEX B;  2VDP A;  3N0D A;  5HE3 B;  3I89 A;  1SQJ A;  2XE4 A;  5TEF A;  1GP2 B;  3B7F A;  4A2M A;  1U4C A;  4IRZ A;  2I3S A;  4U1E I;  4A08 B;  3OKY A;  2OIZ A;  5H17 A;  2J57 G;  3MXX A;  5IT9 g;  3DM0 A;  3ULE C;  1QFS A;  4UI9 R;  2G99 A;  4QT8 A;  3EI2 A;  3C9C A;  1VE7 A;  3GD1 I;  4J77 A;  1PGU A;  4BH6 A;  4GGC A;  3IUR A;  3SHF A;  4Z7O A;  5IJ7 E;  2YB8 B;  2PM7 B;  2IWF A;  2QR5 A;  1QFM A;  3UKR C;  4L3H D;  1E5T A;  1K32 A;  5EAR A;  3CIK B;  4EWR A;  3DDU A;  5K1C C;  4A2L A;  4ZN4 A;  4J8B A;  5AJA A;  3OL2 A;  1MG2 A;  3DXM C;  3V9F A;  5JWZ A;  3P4F A;  5EML B;  3PVW B;  4NC4 A;  1L5G A;  1P22 A;  4MK0 B;  3SBQ A;  4DNV A;  1S4U X;  2H6Q A;  2PM6 B;  5FFG A;  4PXW A;  2I0S A;  1FWX A;  4J86 A;  4L1Q D;  2PM9 A;  4JT6 C;  3ZDX A;  2IUR A;  4CI3 A;  1O6G A;  3K27 A;  3DSM A;  4JD2 C;  4NSX A;  5E6S A;  1H2Y A;  3OTT A;  1C9L A;  1JMX B;  4PSX B;  1E8N A;  3F3F A;  5HQG A;  4ZOV A;  3BG0 A;  3SWS D;  4XEI C;  4FWW A;  2AGL A;  3W15 A;  5HE1 B;  3K72 A;  1TBG A;  5EM2 B;  4QRJ A;  5M5V A;  2IUP A;  4ESG A;  3QHY B;  2AQ5 A;  4CY1 A;  3AFC A;  4GQ1 A;  3V5W B;  3SVW D;  2BBK H;  5IGO A;  5TEE A;  4Z8L A;  1GOG A;  2H47 A;  3IUJ A;  5C92 A;  3OKT A;  4XYI A;  3SBP A;  3PVU B;  4LG9 A;  4D9S A;  2IUV A;  4JSN C;  2GC4 A;  4ZOY A;  3UVL A;  2H6K A;  4H5I A;  4AMY A;  4XYH A;  2IUQ A;  2MTA H;  3JRP A;  3NIG A;  3KRW B;  5TF2 A;  3JZN A;  2CN2 A;  1GOF A;  2GNQ A;  3RN1 D;  1I2M B;  5EAM A;  5GSA A;  5TDH B;  4X61 B;  2I0R A;  3HFQ A;  3FCS A;  2XU7 A;  2XZG A;  3ZWL B;  3IJ1 A;  2VC2 A;  4FAV D;  3IIW A;  3K26 A;  4BCB A;  1H2W A;  4J79 A;  1H2Z A;  4GM8 A;  5AFU 3;  4Y5R D;  2B5N A;  5FFO A;  1M1X A;  3UKU C;  3OL2 B;  4AN0 A;  2I3T A;  2AH1 A;  2HES X;  4RE5 A;  3L4O D;  3K6S A;  2AH0 A;  2VDM A;  5H1M A;  5THA A;  2BCJ B;  5IGQ A;  2BKL A;  2P9S C;  3EI1 B;  2EIB A;  2P9P C;  4N14 A;  3J81 g;  3V4V A;  4E54 A;  3E0C A;  4X60 B;  2YNO A;  2P9L C;  3UVK A;  2JKX A;  4AEZ A;  3ZE0 A;  3VI3 A;  2H9L A;  4GZ8 A;  1VYH C;  4O3U B;  4CY3 A;  4Z7Q A;  3EI4 A;  1A0R B;  4L9O A;  4WK2 A;  2PBI B;  1GXR A;  3SJL D;  4A11 A;  1OLZ A;  1T2X A;  4J0W A;  3EQ7 A;  3F3G A;  4GM3 A;  5C2V B;  1K8K C;  3AL8 B;  4BCC A;  1N6D A;  5I5I A;  1UOP A;  4RE6 A;  1PEV A;  5EAL A;  3IJC A;  1E8M A;  4X63 B;  2B5L A;  1B9Y A;  5M5R A;  4JSP C;  3T3P A;  2AGZ A;  3GRE A;  3EMH A;  3FGB A;  3KRX B;  4PSW B;  3OF7 A;  5FKQ A;  1XKS A;  2QC5 A;  2W18 A;  3FCU A;  4MMZ A;  3CFS B;  4ERQ A;  2VDQ A;  2HJB A;  3O4J A;  4NEN A;  4J8G A;  4O02 A;  3SBR A;  1ERJ A;  3RN0 D;  4DNW A;  5I5J A;  3A0F A;  3NIF A;  3ZE2 A;  4H5J A;  3C99 A;  5HE2 B;  4E5Z B;  2EID A;  4BL0 A;  4BUJ C;  5FXY A;  1VZ2 A;  3C75 H;  3GFC A;  1K3I A;  5E6R A;  2P9K C;  1U2V C;  3PXT D;  4A08 A;  5CXC B;  3IJ0 A;  1YFQ A;  3NID A;  4ZOX A;  2OK6 A;  5EM2 A;  4JSV C;  3I7L A;  3NVX A;  3UR4 A;  5IJ8 E;  4G56 B;  2B5M A;  5EAP A;  2YMU A;  4BP9 A;  4JHP C;  3O4H A;  3I7K A;  3AL8 A;  1GG2 B;  3RFH A;  5GXH A;  4FA1 D;  2QZP A;  2GC7 A;  4AMZ A;  4G1M A;  3RLM D;  4R7A B;  1UOO A;  2HU8 A;  4J0X A;  4FB1 D;  3NVQ A;  5KDO B;  4IMM A;  1VZ3 A;  3ZE1 A;  2IAA A;  2HU7 A;  1R5M A;  3VH0 A;  2OVP B;  3DXK C;  4L1M A;  2OVR B;  2P9U C;  2EBS A;  5GMK n;  2CE9 A;  3EQ9 A;  4QAM A;  4K3J B;  4QL1 A;  1JOF A;  4AOW A;  1RI6 A;  2YNP A;  3OKW A;  3EG6 A;  4JXM A;  4FA9 D;  1PI6 A;  5CYK A;  3I7N A;  3N0E A;  4ZOZ A;  4CI1 A;  3IIY A;  1JJU B;  3BG1 A;  3QI0 A;  2VZ1 A;  3SLE D;  2O9K A;  4LG8 A;  4NBM A;  3ODT A;  3EI2 B;  3JZH A;  3KCI A;  4A0A A;  3PSL A;  4A09 A;  4K3I D;  4J73 A;  1UOQ A;  3V4P A;  3I8C A;  1BPO A;  4L3G D;  1C9I A;  5CXB A;  3UVM A;  5FA5 B;  3SXT D;  4YVD A;  3IUM A;  2AGY A;  3AL9 A;  3GC3 B;  1MG3 A;  1H2X A;  3JZG A;  5E6U A;  2J55 H;  5H14 A;  3IVM A;  5FQD A;  2EIC A;  3I7H A;  4D6V A;  1O6F A;  2VDN A;  2YNN A;  2UZY B;  2XYI A;  4OZU A;  1SHY B;  3EI4 B;  3J80 g;  4KFM B;  4TZ4 A;  5FKS A;  3EU7 A;  1TYQ C;  2VDR A;  4A7J A;  1XIP A;  2PM9 B;  4J78 A;  2HKM A;  4O9D A;  3OKY B;  2AGX A;  1MDA H;  2UZX B;  2VDO A;  3T3M A;  1NR0 A;  2VDK A;  3ZDY A;  4GMB A;  1OMW B;  1GOH A;  1JTD B;  1Q47 A;  2H68 A;  5CXB B;  3CFV A;  4NAA A;  4QQE A;  4O45 A;  2I0T A;  2CO0 A;  4GGA A;  5M5S A;  5HE0 B;  4G1E A;  3UVO A;  1PBY B;  5HDB A;  2J56 H;  3K71 A;  3FM0 A;  3OW8 A;  3MKQ A;  2Z2P A;  5EMM B;  3PXW D;  5SXM A;  3RSE C;  3EWE A;  4X3E A;  4JSX C;  4GQB B;  3MZL A;  4BP8 A;  1XHM A;  2Z2O A;  4CY5 A;  4J82 A;  4J84 A;  4CC9 A;  2IWK A;  2OK4 A;  4GQ2 P;  4A0B B;  4A09 B;  2HU5 A;  4CI2 A;  2XDW A;  2G9A A;  3VA6 A;  3F3P A;  3FRX A;  3ZDZ A;  5CYK B;  4CZV A;  3EI1 A;  4O2W A;  5FKT A;  4AN1 A;  4OWR A;  4J81 A;  1N6E A;  2AGW A;  2H3X A;  4G55 A;  4ERY A;  4PBZ A;  1VE6 A;  2CO0 C;  3IUN A;  4WK4 A;  5FLX g;  4CY2 A;  4PBY A;  3I7P A;  3EI3 B;  5C2W B;  5CXC A;  5EMJ B;  3RFG A;  2XL2 A;  3DWL C;  3IUL A;  3AH8 B;  4FA4 D;  2H14 A;  5HYN B;  4A0B A;  4E5Z A;  4AX4 A;  3SFZ A;  5C86 A;  3IUQ A;  4J87 A;  2VDL A;  4Z7N A;  4D0K A;  3UVN A;  5I5M A;  3IJE A;  4PNK B;  3MMY A;  2H9P A;  3PE7 A;  4IA9 A;  3RRM C; 
#chains in the Genus database with same CATH homology
 3EI3 A;  3SMR A;  2B4E A;  3BWS A;  5C9Z B;  2H9M A;  3U4Y A;  2XL3 A;  4HDJ A;  4ES0 A;  4A11 B;  4O1Q D;  5IC7 A;  4FAN D;  4FHL A;  3MZK A;  3JRO A;  4CZX A;  1B9X A;  3RMZ D;  2TRC B;  5FKR A;  5K19 A;  3PSC B;  2CN3 A;  2OVQ B;  4CI8 A;  2HJ4 A;  1JMZ B;  4ERZ A;  3I2N A;  3MKS B;  2CE8 A;  2HXC A;  2CNX A;  3IKO A;  3ORV D;  3SCY A;  1GOT B;  2H9N A;  5GXI A;  4E54 B;  1N6F A;  2QXV A;  3NVN A;  3I8E A;  4CZY A;  3JAM g;  3JB9 L;  2Q7Q A;  4GM9 A;  4FA5 D;  1SQ9 A;  5EMK B;  1QNI A;  3C5M A;  3I7O A;  3JPX A;  2HKR A;  4A0A B;  2YBA A;  3PXS D;  4I79 A;  4O3T B;  3SN6 B;  2H6N A;  5A2Q g;  4JT5 C;  2P9N C;  5B4W A;  3V7D B;  2H13 A;  4LGN A;  5AMS A;  1L0Q A;  3L4M D;  4GGD A;  3VGZ A;  4U7A A;  2OJY A;  2Z2N A;  2HYE A;  2P9I C;  4Y7R A;  4PC0 A;  1NEX B;  3N0D A;  5HE3 B;  3I89 A;  1SQJ A;  5TEF A;  1GP2 B;  3B7F A;  4A2M A;  1U4C A;  2I3S A;  4U1E I;  4A08 B;  3OKY A;  2OIZ A;  5H17 A;  2J57 G;  3MXX A;  5IT9 g;  3DM0 A;  3ULE C;  4UI9 R;  2G99 A;  4QT8 A;  3EI2 A;  3C9C A;  4J77 A;  1PGU A;  4BH6 A;  4GGC A;  3SHF A;  5IJ7 E;  2YB8 B;  2PM7 B;  2IWF A;  3UKR C;  4L3H D;  1K32 A;  5EAR A;  3CIK B;  4EWR A;  5K1C C;  4A2L A;  4ZN4 A;  4J8B A;  5AJA A;  3OL2 A;  1MG2 A;  3DXM C;  3V9F A;  5JWZ A;  3P4F A;  5EML B;  3PVW B;  1P22 A;  4MK0 B;  3SBQ A;  1S4U X;  2H6Q A;  2PM6 B;  4PXW A;  2I0S A;  1FWX A;  4J86 A;  4L1Q D;  2PM9 A;  4JT6 C;  2IUR A;  4CI3 A;  3K27 A;  3DSM A;  4JD2 C;  4NSX A;  3OTT A;  1JMX B;  4PSX B;  3F3F A;  5HQG A;  4ZOV A;  3BG0 A;  3SWS D;  4XEI C;  4FWW A;  2AGL A;  3W15 A;  5HE1 B;  1TBG A;  5EM2 B;  4QRJ A;  2IUP A;  4ESG A;  2AQ5 A;  4CY1 A;  3AFC A;  4GQ1 A;  3V5W B;  3SVW D;  2BBK H;  5IGO A;  5TEE A;  4Z8L A;  2H47 A;  3OKT A;  4XYI A;  3SBP A;  3PVU B;  4LG9 A;  2IUV A;  4JSN C;  2GC4 A;  4ZOY A;  3UVL A;  2H6K A;  4H5I A;  4XYH A;  2IUQ A;  2MTA H;  3JRP A;  5TF2 A;  3KRW B;  3JZN A;  2CN2 A;  2GNQ A;  3RN1 D;  5EAM A;  5GSA A;  5TDH B;  4X61 B;  2I0R A;  3HFQ A;  2XU7 A;  3ZWL B;  3IJ1 A;  4FAV D;  3IIW A;  3K26 A;  4J79 A;  4GM8 A;  5AFU 3;  4Y5R D;  2B5N A;  3UKU C;  3OL2 B;  2I3T A;  2AH1 A;  2HES X;  3L4O D;  2AH0 A;  5H1M A;  5THA A;  2BCJ B;  5IGQ A;  2P9S C;  3EI1 B;  2P9P C;  4N14 A;  3J81 g;  4E54 A;  3E0C A;  4X60 B;  2YNO A;  2P9L C;  3UVK A;  4AEZ A;  2H9L A;  4GZ8 A;  1VYH C;  4O3U B;  4CY3 A;  3EI4 A;  1A0R B;  4L9O A;  2PBI B;  1GXR A;  3SJL D;  4A11 A;  1OLZ A;  4J0W A;  3F3G A;  4GM3 A;  5C2V B;  1K8K C;  3AL8 B;  1N6D A;  5I5I A;  1PEV A;  5EAL A;  3IJC A;  4X63 B;  2B5L A;  1B9Y A;  4JSP C;  2AGZ A;  3GRE A;  3EMH A;  3FGB A;  3KRX B;  4PSW B;  5FKQ A;  1XKS A;  2QC5 A;  2W18 A;  3CFS B;  4ERQ A;  2HJB A;  4J8G A;  3SBR A;  1ERJ A;  3RN0 D;  5I5J A;  3A0F A;  4H5J A;  3C99 A;  5HE2 B;  4E5Z B;  4BL0 A;  4BUJ C;  5FXY A;  3C75 H;  3GFC A;  2P9K C;  1U2V C;  3PXT D;  4A08 A;  5CXC B;  3IJ0 A;  1YFQ A;  4ZOX A;  2OK6 A;  5EM2 A;  4JSV C;  3I7L A;  3NVX A;  3UR4 A;  5IJ8 E;  4G56 B;  2B5M A;  5EAP A;  2YMU A;  3I7K A;  3AL8 A;  1GG2 B;  3RFH A;  5GXH A;  4FA1 D;  2GC7 A;  3RLM D;  4R7A B;  4J0X A;  4FB1 D;  3NVQ A;  5KDO B;  4IMM A;  2IAA A;  1R5M A;  3VH0 A;  2OVP B;  3DXK C;  2OVR B;  2P9U C;  2EBS A;  5GMK n;  2CE9 A;  4K3J B;  4QL1 A;  1JOF A;  4AOW A;  1RI6 A;  2YNP A;  3OKW A;  3EG6 A;  4JXM A;  4FA9 D;  1PI6 A;  5CYK A;  3I7N A;  3N0E A;  4ZOZ A;  4CI1 A;  3IIY A;  1JJU B;  3BG1 A;  4A0A A;  3SLE D;  2O9K A;  4LG8 A;  3EI2 B;  3ODT A;  3JZH A;  3PSL A;  4A09 A;  4K3I D;  4J73 A;  3I8C A;  4L3G D;  5CXB A;  3UVM A;  5FA5 B;  3SXT D;  4YVD A;  2AGY A;  3AL9 A;  1MG3 A;  3JZG A;  2J55 H;  5H14 A;  5FQD A;  3I7H A;  4D6V A;  2YNN A;  2UZY B;  2XYI A;  4OZU A;  1SHY B;  3EI4 B;  3J80 g;  4KFM B;  4TZ4 A;  5FKS A;  3EU7 A;  1TYQ C;  4A7J A;  1XIP A;  2PM9 B;  4J78 A;  2HKM A;  4O9D A;  3OKY B;  2AGX A;  1MDA H;  2UZX B;  1NR0 A;  4GMB A;  1OMW B;  1Q47 A;  2H68 A;  5CXB B;  3CFV A;  4QQE A;  4O45 A;  2I0T A;  2CO0 A;  4GGA A;  5HE0 B;  3UVO A;  1PBY B;  2J56 H;  3FM0 A;  3OW8 A;  2Z2P A;  3MKQ A;  5EMM B;  3PXW D;  5SXM A;  3RSE C;  3EWE A;  4X3E A;  4JSX C;  4GQB B;  3MZL A;  1XHM A;  2Z2O A;  4CY5 A;  4J82 A;  4J84 A;  4CC9 A;  2IWK A;  2OK4 A;  4GQ2 P;  4A0B B;  4A09 B;  4CI2 A;  2G9A A;  3VA6 A;  3F3P A;  3FRX A;  5CYK B;  4CZV A;  3EI1 A;  5FKT A;  4OWR A;  4J81 A;  1N6E A;  2AGW A;  2H3X A;  4ERY A;  4PBZ A;  2CO0 C;  5FLX g;  4CY2 A;  4PBY A;  3I7P A;  3EI3 B;  5C2W B;  5CXC A;  5EMJ B;  3RFG A;  2XL2 A;  3DWL C;  3AH8 B;  4FA4 D;  2H14 A;  5HYN B;  4A0B A;  4E5Z A;  3SFZ A;  4J87 A;  4D0K A;  3UVN A;  5I5M A;  4PNK B;  3MMY A;  2H9P A;  3PE7 A;  4IA9 A;  3RRM C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...