5IT9g

Structure of the yeast kluyveromyces lactis small ribosomal subunit in complex with the cricket paralysis virus ires.
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
324
structure length
318
Chain Sequence
SSNIMLVLRGTLEGHNGWVTSLSTSAAQPNLLVSGSRDKTLISWRLTENEQQFGVPVRSYKGHSHIVQDVVVSADGNYAVSASWDKTLRLWNLATGNSEARFVGHTGDVLSVAIDANSSKIISASRDKTIRVWNTVGDCAYVLLGHTDWVTKVRVAPKNLVDDGRITFVSAGMDKIVRSWSLNSYRIEADFIGHNNYINVVQPSPDGSLAASAGKDGQIYVWNLKHKSAFMNFDAKDEVFALAFSPSRFWLTAATASGIKIYDLENEVLIDELKPEFAGYTKAQDPHAVSLAWSADGQTLFAGYTDNVIRVWQVMTAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords Ribosomal protein uS2
publication title Structural characterization of ribosome recruitment and translocation by type IV IRES.
pubmed doi rcsb
source organism Cricket paralysis virus
total genus 52
structure length 318
sequence length 324
ec nomenclature
pdb deposition date 2016-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
g PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5it9g01
5JWZA 5K1CC 3PVWB 1GOTB 4PSXB 5HE0B 3JAMg 2P9LC 2HYEA 3GREA 4ERYA 3IJ1A 4E5ZB 2AGLA 3SFZA 4G56B 2OVQB 4L9OA 3EI1A 2I0RA 2G9AA 2HXCA 2OK4A 2YNNA 4AEZA 4FA1D 4QRJA 4GMBA 4J77A 3BG0A 4Y5RD 4A0BA 4J86A 2PM6B 2PM9A 2Z2OA 4ES0A 3JPXA 3L4MD 3K26A 2OIZA 2XYIA 3KRXB 2IUPA 2H6QA 3OTTA 4U7AA 3AL9A 5SXMA 1GP2B 2YBAA 3MXXA 2YNOA 3SLED 4JD2C 3JZHA 4PBYA 5AFU3 4ZOZA 4E54A 3FM0A 4GGDA 4L1QD 5EALA 4EWRA 4ERZA 5K19A 2IAAA 3I7LA 4CY3A 3SJLD 4FA4D 4OWRA 2I0TA 3CFVA 2TRCB 3PVUB 4K3ID 2OJYA 4Z8LA 2Z2NA 4A09B 5C2VB 2AQ5A 5GMKn 4A11B 1A0RB 4H5JA 4HDJA 5FLXg 2CNXA 3MMYA 4LG8A 3SBQA 4KFMB 3PSLA 1XIPA 4CI8A 2Q7QA 2Z2PA 5H17A 2EBSA 5CXBB 1SQJA 4PBZA 4Y7RA 1OMWB 4GQ1A 3V9FA 4CZYA 4QL1A 1RI6A 4JSXC 5EAPA 2PBIB 4CI2A 3ORVD 5IGQA 2AGZA 1S4UX 3AH8B 2J57G 4A08B 1L0QA 4FAVD 4J84A 3MKQA 4CZXA 2QXVA 2H13A 5I5IA 3K27A 5FQDA 5TDHB 2IWKA 3ZWLB 2GC4A 2J56H 3AL8A 5HQGA 3RN0D 1R5MA 3FRXA 3UKRC 3RLMD 3C5MA 4K3JB 4E5ZA 3I7NA 3IIYA 3CFSB 3UVMA 5IGOA 4PXWA 4FB1D 3IJCA 4J73A 4D6VA 2YMUA 4J87A 3RFHA 3J80g 3DWLC 1Q47A 5GXIA 3IIWA 3I7OA 2P9UC 1GG2B 3SCYA 3U4YA 1TBGA 4J81A 4LG9A 4O3TB 4GGAA 1JJUB 3OKYB 4N14A 3C75H 3I8CA 4MK0B 4CY5A 1N6DA 3OKWA 5FA5B 4CC9A 1QNIA 3JROA 1VYHC 3EI4B 4IMMA 4X3EA 3L4OD 4BL0A 4X63B 4JSVC 5I5MA 3SN6B 1NR0A 4FA5D 4BH6A 2XL2A 1B9XA 4U1EI 3OW8A 5CYKA 5C9ZB 3DXMC 2PM9B 5IT9g 4GGCA 2P9KC 4UI9R 4A09A 5FKTA 1K8KC 2UZXB 5HE2B 3JZGA 1PBYB 4J79A 4H5IA 3CIKB 3N0EA 1GXRA 2PM7B 4ZN4A 3GFCA 3UVNA 1SQ9A 3MKSB 2AH1A 3FGBA 5FKQA 2W18A 5CXBA 1PI6A 5CXCB 2CO0C 2H9MA 4ZOVA 5FKSA 4O9DA 3ODTA 5C2WB 4A7JA 2IURA 3SXTD 4JT5C 5H1MA 3EI2A 1N6FA 5IJ8E 3E0CA 3HFQA 4ERQA 2HESX 3PSCB 1JOFA 3I7PA 3VGZA 2XU7A 2B5NA 1SHYB 5TF2A 3F3PA 4QT8A 3SVWD 1NEXB 4A0AB 2CO0A 3C9CA 2IUVA 2OVPB 3NVQA 2HKRA 2HJBA 3UVOA 4NSXA 4CI1A 4AOWA 4CI3A 2G99A 2H47A 4OZUA 2HJ4A 1MG3A 3OL2B 4FA9D 4ZOYA 5EM2B 2YNPA 3F3FA 5EARA 2H9LA 5THAA 4QQEA 3RRMC 3N0DA 4GQBB 3V7DB 5GSAA 4L3HD 1ERJA 3VA6A 4PSWB 3EG6A 3EWEA 3UVKA 3J81g 5EAMA 3EI3B 5TEFA 4J78A 3PXWD 4X60B 2XL3A 4J0WA 3SHFA 2P9NC 5FKRA 3MZKA 1MG2A 5GXHA 2H9NA 2AH0A 5TEEA 5B4WA 3JRPA 2GC7A 2H9PA 4L3GD 4JSPC 3RN1D 3EU7A 3AL8B 2QC5A 1OLZA 4J82A 3I7KA 5EMKB 2MTAH 4GM8A 5EMMB 4CY2A 3PXTD 1JMZB 5IJ7E 3EI4A 4GM3A 5A2Qg 2OK6A 2CE9A 1YFQA 2B5MA 4ZOXA 2GNQA 3DSMA 3ULEC 2BBKH 1TYQC 2CN2A 3EI1B 4J8GA 1P22A 2P9IC 3I7HA 3RSEC 1MDAH 4X61B 3MZLA 3BG1A 3I2NA 3NVNA 3RFGA 2P9SC 4A0BB 3A0FA 3W15A 1PEVA 4A2MA 4XEIC 3SWSD 2H6NA 4IA9A 5I5JA 5AMSA 5H14A 4A11A 3IKOA 3EMHA 5EMJB 4LGNA 2I0SA 5KDOB 3SMRA 1XHMA 5FXYA 2OVRB 5CXCA 4ESGA 2B4EA 2IUQA 4YVDA 3BWSA 4GM9A 2YB8B 4A2LA 4BUJC 4PC0A 2H6KA 1K32A 2H14A 4E54B 3RMZD 3SBRA 1N6EA 2O9KA 3JZNA 4J0XA 5CYKB 2H3XA 3B7FA 2P9PC 2AGWA 3UVLA 2UZYB 4A0AA 4O3UB 4O45A 2CE8A 3PXSD 1PGUA 4A08A 3I8EA 3NVXA 4CZVA 5HE3B 2H68A 4GQ2P 4JXMA 5AJAA 4R7AB 2CN3A 5HE1B 4J8BA 5EMLB 2I3SA 4O1QD 4FAND 4XYIA 1U2VC 3F3GA 5EM2A 3OL2A 3C99A 3KRWB 4JSNC 2B5LA 2J55H 4CY1A 1U4CA 1XKSA 3I89A 4JT6C 3EI2B 2HKMA 3P4FA 4PNKB 3EI3A 3VH0A 3PE7A 4XYHA 4FHLA 3JB9L 2I3TA 5HYNB 1FWXA 1JMXB 3AFCA 3DXKC 4TZ4A 3V5WB 3SBPA 3UKUC 5IC7A 2AGXA 1B9YA 4I79A 3DM0A 4GZ8A 3IJ0A 2AGYA 2IWFA 2BCJB 4FWWA 3OKTA 3OKYA 3UR4A 4D0KA
chains in the Genus database with same CATH superfamily
5JWZA 5K1CC 3PVWB 1GOTB 4PSXB 5HE0B 3JAMg 2P9LC 4AN0A 2HYEA 3GREA 2QZPA 4ERYA 2HU5A 3IJ1A 4E5ZB 2AGLA 4G55A 3SFZA 3IUJA 4G56B 2OVQB 4L9OA 1I2MB 3EI1A 2I0RA 2G9AA 2HXCA 4WJKA 2OK4A 2YNNA 4AEZA 2VDKA 4FA1D 1H2YA 4GMBA 4QRJA 4J77A 3BG0A 4Y5RD 4A0BA 4J86A 2PM6B 2PM9A 2Z2OA 4ES0A 3JPXA 3L4MD 3K26A 5M5SA 2VDNA 2OIZA 2VZ3A 1UTCA 2XYIA 4Z7OA 3KRXB 2IUPA 4NAAA 2H6QA 3OTTA 4U7AA 3AL9A 5SXMA 1GP2B 2YBAA 3MXXA 5M5UA 2YNOA 3SLED 4AMZA 1C9IA 4JD2C 2VDRA 3V4VA 3JZHA 4PBYA 5AFU3 4ZOZA 4E54A 3O4IA 3FM0A 4GGDA 4L1QD 4BCCA 4AMYA 5EALA 4EWRA 4ERZA 4Z7QA 5K19A 2IAAA 3OF7A 3I7LA 4CY3A 3SJLD 4FA4D 4QAMA 2I0TA 4OWRA 1H2WA 4NC4A 3CFVA 2TRCB 3PVUB 4K3ID 2OJYA 1L5GA 4Z8LA 2Z2NA 4A09B 5C2VB 2AQ5A 5GMKn 3O4HA 4A11B 1A0RB 4H5JA 4HDJA 1T2XA 3QHYB 5FLXg 2CNXA 3MMYA 4LG8A 3DDUA 3SBQA 4UM9A 4KFMB 4DNWA 3PSLA 4JHNA 1H2ZA 1XIPA 4DNVA 4CI8A 2Q7QA 2Z2PA 3IUMA 5H17A 2EBSA 5E6UA 5CXBB 1SQJA 5E6SA 4PBZA 4Y7RA 1OMWB 2QR5A 4GQ1A 3V9FA 3GC3B 4CZYA 4QL1A 1RI6A 4JSXC 5EAPA 2PBIB 3ZDXA 1VE6A 3KCIA 1K3IA 4CI2A 3ORVD 5IGQA 2AGZA 1S4UX 1UOPA 3NIGA 2VDMA 3FCSA 3AH8B 2J57G 4DNUA 4A08B 1VZ3A 2EIDA 1L0QA 4FAVD 4J84A 3MKQA 5C92A 4CZXA 2QXVA 2H13A 5I5IA 3K27A 1M1XA 5FQDA 2IWKA 5TDHB 3ZWLB 2GC4A 2J56H 3AL8A 5HQGA 3RN0D 1R5MA 3FRXA 3UKRC 3RLMD 3C5MA 5FFGA 4K3JB 4E5ZA 3MUNA 3IULA 3I7NA 3IIYA 3CFSB 3UVMA 3ZDZA 5C86A 5IGOA 4PXWA 4FB1D 3IJCA 4J73A 3K6SA 5E6RA 4D6VA 2YMUA 3O4JA 4J87A 3RFHA 3J80g 3DWLC 4BCDA 1GOHA 1Q47A 3FCUA 5GXIA 3IIWA 3I7OA 2P9UC 1GG2B 3SCYA 3U4YA 2XDWA 1TBGA 2JKXA 4J81A 4LG9A 4O3TB 4GGAA 1JJUB 3OKYB 3C75H 3I8CA 4N14A 4MK0B 4CY5A 1N6DA 3OKWA 5FA5B 1JTDB 4CC9A 3GD1I 1QNIA 3JROA 1VYHC 3EI4B 4IMMA 4L1MA 3MVDK 4X3EA 2WQ8A 3L4OD 4BL0A 4X63B 4JSVC 5I5MA 3SN6B 1NR0A 4FA5D 4BH6A 2XL2A 5M61A 1B9XA 4U1EI 3OW8A 5CYKA 5C9ZB 2BKLA 2PM9B 3DXMC 3MUOA 5IT9g 4GGCA 2P9KC 4UI9R 4A09A 5FKTA 1K8KC 2HU8A 2UZXB 3JZGA 5HE2B 1PBYB 4J79A 4MMXA 4H5IA 3NIFA 1GOGA 3CIKB 3N0EA 1GXRA 2PM7B 4ZN4A 5HDBA 3GFCA 3UVNA 1BPOA 1SQ9A 3MKSB 3T3PA 2HU7A 2AH1A 3FGBA 4JHPC 4AN1A 5FKQA 2VDQA 2W18A 5CXBA 1PI6A 5CXCB 3IVMA 2CO0C 3ZE1A 2H9MA 4ZOVA 5FKSA 4O9DA 3K72A 4D9SA 3ODTA 5C2WB 4A7JA 2VDOA 2IURA 3SXTD 4JT5C 5H1MA 3EI2A 1QFSA 1N6FA 5IJ8E 3E0CA 4MMZA 3HFQA 4ERQA 2HESX 3PSCB 1JOFA 4MMYA 3I7PA 3VGZA 2XU7A 2B5NA 3VI3A 1SHYB 5TF2A 3F3PA 4QT8A 3SVWD 1NEXB 4A0AB 2CO0A 3C9CA 2IUVA 2OVPB 3NVQA 2HKRA 2HJBA 3UVOA 4NSXA 4CI1A 4AOWA 4CI3A 2G99A 2H47A 4OZUA 1QFMA 2HJ4A 3IJEA 1MG3A 3OL2B 4G1MA 4FA9D 4ZOYA 5EM2B 2YNPA 3F3FA 5EARA 2H9LA 5THAA 1E5TA 1UOOA 3T3MA 2VDLA 4QQEA 3RRMC 2EICA 3N0DA 4GQBB 3V7DB 5GSAA 4L3HD 1ERJA 3VA6A 4PSWB 3EG6A 3EWEA 3UVKA 3J81g 1H2XA 5EAMA 3EI3B 3IUNA 5TEFA 4J78A 3PXWD 4X60B 2XL3A 4J0WA 3SHFA 2P9NC 5FKRA 4G1EA 3VI4A 3MZKA 1MG2A 2XE4A 5GXHA 3ZDYA 2H9NA 2AH0A 5TEEA 5B4WA 4BP9A 4RE5A 3JRPA 2GC7A 2H9PA 4L3GD 4JSPC 3RN1D 1U8CA 3EU7A 3AL8B 2QC5A 1OLZA 4J82A 5M5VA 3I7KA 5EMKB 4Z7NA 2MTAH 4GM8A 5EMMB 4CY2A 3PXTD 1JMZB 5IJ7E 1E8NA 3EI4A 4GM3A 5A2Qg 2OK6A 3IURA 4WK4A 2CE9A 1YFQA 2B5MA 4ZOXA 2GNQA 3DSMA 3ULEC 3EQ7A 2BBKH 1TYQC 2CN2A 3QI0A 1VZ2A 4BCBA 3EI1B 4J8GA 1P22A 2P9IC 3NIDA 3I7HA 3RSEC 1MDAH 4NBMA 4X61B 4NENA 3MZLA 3BG1A 3I2NA 3NVNA 3RFGA 1E8MA 2P9SC 5M5TA 4A0BB 4RE6A 3A0FA 3W15A 3O4GA 1PEVA 1YR2A 4A2MA 4XEIC 3SWSD 2H6NA 4IA9A 5I5JA 5AMSA 5H14A 4A11A 3IKOA 3EMHA 5EMJB 4LGNA 2I0SA 5KDOB 3SMRA 1XHMA 5FXYA 3EQ9A 2OVRB 5CXCA 4ESGA 4WK0A 2B4EA 2IUQA 1O6FA 4YVDA 3BWSA 4GM9A 2YB8B 4O02A 4A2LA 4BUJC 4PC0A 2H6KA 1K32A 2H14A 4E54B 3RMZD 3SBRA 1N6EA 2O9KA 3K71A 3JZNA 4J0XA 5CYKB 2H3XA 3B7FA 1GOFA 2P9PC 2AGWA 2VC2A 3UVLA 2UZYB 4A0AA 4O3UB 4O45A 2CE8A 3PXSD 1PGUA 4A08A 4AX4A 3I8EA 3NVXA 1UOQA 4CZVA 5HE3B 2H68A 4GQ2P 4JXMA 5AJAA 4R7AB 3ZE0A 2CN3A 5HE1B 4J8BA 5EMLB 2I3SA 4O1QD 4FAND 4XYIA 1U2VC 3F3GA 5EM2A 3OL2A 4O2WA 1O6GA 3C99A 3KRWB 4JSNC 2B5LA 2J55H 2VZ1A 4CY1A 1U4CA 1C9LA 1XKSA 3I89A 4JT6C 1JV2A 3ZE2A 3EI2B 3EQ8A 2HKMA 3P4FA 1VE7A 4PNKB 2EIEA 3IUQA 3EI3A 3VH0A 3PE7A 4XYHA 4FHLA 3JB9L 2I3TA 5HYNB 1A12A 1FWXA 1JMXB 3AFCA 3DXKC 2XZGA 1TYEA 4TZ4A 4UM8A 3V5WB 2VDPA 4WK2A 4IRZA 3SBPA 3UKUC 2EIBA 5IC7A 2AGXA 3V4PA 5FFOA 1B9YA 4I79A 3DM0A 4GZ8A 3IJ0A 2AGYA 2IWFA 2BCJB 4FWWA 3OKTA 3OKYA 5M5RA 3UR4A 4D0KA 4BP8A
chains in the Genus database with same CATH topology
5JWZA 5K1CC 3PVWB 1GOTB 4PSXB 5HE0B 3JAMg 2P9LC 2HYEA 3GREA 4ERYA 3IJ1A 4E5ZB 2AGLA 3SFZA 4G56B 2OVQB 4L9OA 3EI1A 2I0RA 2G9AA 2HXCA 2OK4A 2YNNA 4AEZA 4FA1D 4QRJA 4GMBA 4J77A 3BG0A 4Y5RD 4A0BA 4J86A 2PM6B 2PM9A 2Z2OA 4ES0A 3JPXA 3L4MD 3K26A 2OIZA 2XYIA 3KRXB 2IUPA 2H6QA 3OTTA 4U7AA 3AL9A 5SXMA 1GP2B 2YBAA 3MXXA 2YNOA 3SLED 4JD2C 3JZHA 4PBYA 5AFU3 4ZOZA 4E54A 3FM0A 4GGDA 4L1QD 5EALA 4EWRA 4ERZA 5K19A 2IAAA 3I7LA 4CY3A 3SJLD 4FA4D 4OWRA 2I0TA 3CFVA 2TRCB 3PVUB 4K3ID 2OJYA 4Z8LA 2Z2NA 4A09B 5C2VB 2AQ5A 5GMKn 4A11B 1A0RB 4H5JA 4HDJA 5FLXg 2CNXA 3MMYA 4LG8A 3SBQA 4KFMB 3PSLA 1XIPA 4CI8A 2Q7QA 2Z2PA 5H17A 2EBSA 5CXBB 1SQJA 4PBZA 4Y7RA 1OMWB 4GQ1A 3V9FA 4CZYA 4QL1A 1RI6A 4JSXC 5EAPA 2PBIB 4CI2A 3ORVD 5IGQA 2AGZA 1S4UX 3AH8B 2J57G 4A08B 1L0QA 4FAVD 4J84A 3MKQA 4CZXA 2QXVA 2H13A 5I5IA 3K27A 5FQDA 5TDHB 2IWKA 3ZWLB 2GC4A 2J56H 3AL8A 5HQGA 3RN0D 1R5MA 3FRXA 3UKRC 3RLMD 3C5MA 4K3JB 4E5ZA 3I7NA 3IIYA 3CFSB 3UVMA 5IGOA 4PXWA 4FB1D 3IJCA 4J73A 4D6VA 2YMUA 4J87A 3RFHA 3J80g 3DWLC 1Q47A 5GXIA 3IIWA 3I7OA 2P9UC 1GG2B 3SCYA 3U4YA 1TBGA 4J81A 4LG9A 4O3TB 4GGAA 1JJUB 3OKYB 4N14A 3C75H 3I8CA 4MK0B 4CY5A 1N6DA 3OKWA 5FA5B 4CC9A 1QNIA 3JROA 1VYHC 3EI4B 4IMMA 4X3EA 3L4OD 4BL0A 4X63B 4JSVC 5I5MA 3SN6B 1NR0A 4FA5D 4BH6A 2XL2A 1B9XA 4U1EI 3OW8A 5CYKA 5C9ZB 3DXMC 2PM9B 5IT9g 4GGCA 2P9KC 4UI9R 4A09A 5FKTA 1K8KC 2UZXB 5HE2B 3JZGA 1PBYB 4J79A 4H5IA 3CIKB 3N0EA 1GXRA 2PM7B 4ZN4A 3GFCA 3UVNA 1SQ9A 3MKSB 2AH1A 3FGBA 5FKQA 2W18A 5CXBA 1PI6A 5CXCB 2CO0C 2H9MA 4ZOVA 5FKSA 4O9DA 3ODTA 5C2WB 4A7JA 2IURA 3SXTD 4JT5C 5H1MA 3EI2A 1N6FA 5IJ8E 3E0CA 3HFQA 4ERQA 2HESX 3PSCB 1JOFA 3I7PA 3VGZA 2XU7A 2B5NA 1SHYB 5TF2A 3F3PA 4QT8A 3SVWD 1NEXB 4A0AB 2CO0A 3C9CA 2IUVA 2OVPB 3NVQA 2HKRA 2HJBA 3UVOA 4NSXA 4CI1A 4AOWA 4CI3A 2G99A 2H47A 4OZUA 2HJ4A 1MG3A 3OL2B 4FA9D 4ZOYA 5EM2B 2YNPA 3F3FA 5EARA 2H9LA 5THAA 4QQEA 3RRMC 3N0DA 4GQBB 3V7DB 5GSAA 4L3HD 1ERJA 3VA6A 4PSWB 3EG6A 3EWEA 3UVKA 3J81g 5EAMA 3EI3B 5TEFA 4J78A 3PXWD 4X60B 2XL3A 4J0WA 3SHFA 2P9NC 5FKRA 3MZKA 1MG2A 5GXHA 2H9NA 2AH0A 5TEEA 5B4WA 3JRPA 2GC7A 2H9PA 4L3GD 4JSPC 3RN1D 3EU7A 3AL8B 2QC5A 1OLZA 4J82A 3I7KA 5EMKB 2MTAH 4GM8A 5EMMB 4CY2A 3PXTD 1JMZB 5IJ7E 3EI4A 4GM3A 5A2Qg 2OK6A 2CE9A 1YFQA 2B5MA 4ZOXA 2GNQA 3DSMA 3ULEC 2BBKH 1TYQC 2CN2A 3EI1B 4J8GA 1P22A 2P9IC 3I7HA 3RSEC 1MDAH 4X61B 3MZLA 3BG1A 3I2NA 3NVNA 3RFGA 2P9SC 4A0BB 3A0FA 3W15A 1PEVA 4A2MA 4XEIC 3SWSD 2H6NA 4IA9A 5I5JA 5AMSA 5H14A 4A11A 3IKOA 3EMHA 5EMJB 4LGNA 2I0SA 5KDOB 3SMRA 1XHMA 5FXYA 2OVRB 5CXCA 4ESGA 2B4EA 2IUQA 4YVDA 3BWSA 4GM9A 2YB8B 4A2LA 4BUJC 4PC0A 2H6KA 1K32A 2H14A 4E54B 3RMZD 3SBRA 1N6EA 2O9KA 3JZNA 4J0XA 5CYKB 2H3XA 3B7FA 2P9PC 2AGWA 3UVLA 2UZYB 4A0AA 4O3UB 4O45A 2CE8A 3PXSD 1PGUA 4A08A 3I8EA 3NVXA 4CZVA 5HE3B 2H68A 4GQ2P 4JXMA 5AJAA 4R7AB 2CN3A 5HE1B 4J8BA 5EMLB 2I3SA 4O1QD 4FAND 4XYIA 1U2VC 3F3GA 5EM2A 3OL2A 3C99A 3KRWB 4JSNC 2B5LA 2J55H 4CY1A 1U4CA 1XKSA 3I89A 4JT6C 3EI2B 2HKMA 3P4FA 4PNKB 3EI3A 3VH0A 3PE7A 4XYHA 4FHLA 3JB9L 2I3TA 5HYNB 1FWXA 1JMXB 3AFCA 3DXKC 4TZ4A 3V5WB 3SBPA 3UKUC 5IC7A 2AGXA 1B9YA 4I79A 3DM0A 4GZ8A 3IJ0A 2AGYA 2IWFA 2BCJB 4FWWA 3OKTA 3OKYA 3UR4A 4D0KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JWZ A;  5K1C C;  3PVW B;  1GOT B;  4PSX B;  5HE0 B;  3JAM g;  2P9L C;  2HYE A;  3GRE A;  4ERY A;  3IJ1 A;  4E5Z B;  2AGL A;  3SFZ A;  4G56 B;  2OVQ B;  4L9O A;  3EI1 A;  2I0R A;  2G9A A;  2HXC A;  2OK4 A;  2YNN A;  4AEZ A;  4FA1 D;  4QRJ A;  4GMB A;  4J77 A;  3BG0 A;  4Y5R D;  4A0B A;  4J86 A;  2PM6 B;  2PM9 A;  2Z2O A;  4ES0 A;  3JPX A;  3L4M D;  3K26 A;  2OIZ A;  2XYI A;  3KRX B;  2IUP A;  2H6Q A;  3OTT A;  4U7A A;  3AL9 A;  5SXM A;  1GP2 B;  2YBA A;  3MXX A;  2YNO A;  3SLE D;  4JD2 C;  3JZH A;  4PBY A;  5AFU 3;  4ZOZ A;  4E54 A;  3FM0 A;  4GGD A;  4L1Q D;  5EAL A;  4EWR A;  4ERZ A;  5K19 A;  2IAA A;  3I7L A;  4CY3 A;  3SJL D;  4FA4 D;  4OWR A;  2I0T A;  3CFV A;  2TRC B;  3PVU B;  4K3I D;  2OJY A;  4Z8L A;  2Z2N A;  4A09 B;  5C2V B;  2AQ5 A;  5GMK n;  4A11 B;  1A0R B;  4H5J A;  4HDJ A;  5FLX g;  2CNX A;  3MMY A;  4LG8 A;  3SBQ A;  4KFM B;  3PSL A;  1XIP A;  4CI8 A;  2Q7Q A;  2Z2P A;  5H17 A;  2EBS A;  5CXB B;  1SQJ A;  4PBZ A;  4Y7R A;  1OMW B;  4GQ1 A;  3V9F A;  4CZY A;  4QL1 A;  1RI6 A;  4JSX C;  5EAP A;  2PBI B;  4CI2 A;  3ORV D;  5IGQ A;  2AGZ A;  1S4U X;  3AH8 B;  2J57 G;  4A08 B;  1L0Q A;  4FAV D;  4J84 A;  3MKQ A;  4CZX A;  2QXV A;  2H13 A;  5I5I A;  3K27 A;  5FQD A;  5TDH B;  2IWK A;  3ZWL B;  2GC4 A;  2J56 H;  3AL8 A;  5HQG A;  3RN0 D;  1R5M A;  3FRX A;  3UKR C;  3RLM D;  3C5M A;  4K3J B;  4E5Z A;  3I7N A;  3IIY A;  3CFS B;  3UVM A;  5IGO A;  4PXW A;  4FB1 D;  3IJC A;  4J73 A;  4D6V A;  2YMU A;  4J87 A;  3RFH A;  3J80 g;  3DWL C;  1Q47 A;  5GXI A;  3IIW A;  3I7O A;  2P9U C;  1GG2 B;  3SCY A;  3U4Y A;  1TBG A;  4J81 A;  4LG9 A;  4O3T B;  4GGA A;  1JJU B;  3OKY B;  4N14 A;  3C75 H;  3I8C A;  4MK0 B;  4CY5 A;  1N6D A;  3OKW A;  5FA5 B;  4CC9 A;  1QNI A;  3JRO A;  1VYH C;  3EI4 B;  4IMM A;  4X3E A;  3L4O D;  4BL0 A;  4X63 B;  4JSV C;  5I5M A;  3SN6 B;  1NR0 A;  4FA5 D;  4BH6 A;  2XL2 A;  1B9X A;  4U1E I;  3OW8 A;  5CYK A;  5C9Z B;  3DXM C;  2PM9 B;  5IT9 g;  4GGC A;  2P9K C;  4UI9 R;  4A09 A;  5FKT A;  1K8K C;  2UZX B;  5HE2 B;  3JZG A;  1PBY B;  4J79 A;  4H5I A;  3CIK B;  3N0E A;  1GXR A;  2PM7 B;  4ZN4 A;  3GFC A;  3UVN A;  1SQ9 A;  3MKS B;  2AH1 A;  3FGB A;  5FKQ A;  2W18 A;  5CXB A;  1PI6 A;  5CXC B;  2CO0 C;  2H9M A;  4ZOV A;  5FKS A;  4O9D A;  3ODT A;  5C2W B;  4A7J A;  2IUR A;  3SXT D;  4JT5 C;  5H1M A;  3EI2 A;  1N6F A;  5IJ8 E;  3E0C A;  3HFQ A;  4ERQ A;  2HES X;  3PSC B;  1JOF A;  3I7P A;  3VGZ A;  2XU7 A;  2B5N A;  1SHY B;  5TF2 A;  3F3P A;  4QT8 A;  3SVW D;  1NEX B;  4A0A B;  2CO0 A;  3C9C A;  2IUV A;  2OVP B;  3NVQ A;  2HKR A;  2HJB A;  3UVO A;  4NSX A;  4CI1 A;  4AOW A;  4CI3 A;  2G99 A;  2H47 A;  4OZU A;  2HJ4 A;  1MG3 A;  3OL2 B;  4FA9 D;  4ZOY A;  5EM2 B;  2YNP A;  3F3F A;  5EAR A;  2H9L A;  5THA A;  4QQE A;  3RRM C;  3N0D A;  4GQB B;  3V7D B;  5GSA A;  4L3H D;  1ERJ A;  3VA6 A;  4PSW B;  3EG6 A;  3EWE A;  3UVK A;  3J81 g;  5EAM A;  3EI3 B;  5TEF A;  4J78 A;  3PXW D;  4X60 B;  2XL3 A;  4J0W A;  3SHF A;  2P9N C;  5FKR A;  3MZK A;  1MG2 A;  5GXH A;  2H9N A;  2AH0 A;  5TEE A;  5B4W A;  3JRP A;  2GC7 A;  2H9P A;  4L3G D;  4JSP C;  3RN1 D;  3EU7 A;  3AL8 B;  2QC5 A;  1OLZ A;  4J82 A;  3I7K A;  5EMK B;  2MTA H;  4GM8 A;  5EMM B;  4CY2 A;  3PXT D;  1JMZ B;  5IJ7 E;  3EI4 A;  4GM3 A;  5A2Q g;  2OK6 A;  2CE9 A;  1YFQ A;  2B5M A;  4ZOX A;  2GNQ A;  3DSM A;  3ULE C;  2BBK H;  1TYQ C;  2CN2 A;  3EI1 B;  4J8G A;  1P22 A;  2P9I C;  3I7H A;  3RSE C;  1MDA H;  4X61 B;  3MZL A;  3BG1 A;  3I2N A;  3NVN A;  3RFG A;  2P9S C;  4A0B B;  3A0F A;  3W15 A;  1PEV A;  4A2M A;  4XEI C;  3SWS D;  2H6N A;  4IA9 A;  5I5J A;  5AMS A;  5H14 A;  4A11 A;  3IKO A;  3EMH A;  5EMJ B;  4LGN A;  2I0S A;  5KDO B;  3SMR A;  1XHM A;  5FXY A;  2OVR B;  5CXC A;  4ESG A;  2B4E A;  2IUQ A;  4YVD A;  3BWS A;  4GM9 A;  2YB8 B;  4A2L A;  4BUJ C;  4PC0 A;  2H6K A;  1K32 A;  2H14 A;  4E54 B;  3RMZ D;  3SBR A;  1N6E A;  2O9K A;  3JZN A;  4J0X A;  5CYK B;  2H3X A;  3B7F A;  2P9P C;  2AGW A;  3UVL A;  2UZY B;  4A0A A;  4O3U B;  4O45 A;  2CE8 A;  3PXS D;  1PGU A;  4A08 A;  3I8E A;  3NVX A;  4CZV A;  5HE3 B;  2H68 A;  4GQ2 P;  4JXM A;  5AJA A;  4R7A B;  2CN3 A;  5HE1 B;  4J8B A;  5EML B;  2I3S A;  4O1Q D;  4FAN D;  4XYI A;  1U2V C;  3F3G A;  5EM2 A;  3OL2 A;  3C99 A;  3KRW B;  4JSN C;  2B5L A;  2J55 H;  4CY1 A;  1U4C A;  1XKS A;  3I89 A;  4JT6 C;  3EI2 B;  2HKM A;  3P4F A;  4PNK B;  3EI3 A;  3VH0 A;  3PE7 A;  4XYH A;  4FHL A;  3JB9 L;  2I3T A;  5HYN B;  1FWX A;  1JMX B;  3AFC A;  3DXK C;  4TZ4 A;  3V5W B;  3SBP A;  3UKU C;  5IC7 A;  2AGX A;  1B9Y A;  4I79 A;  3DM0 A;  4GZ8 A;  3IJ0 A;  2AGY A;  2IWF A;  2BCJ B;  4FWW A;  3OKT A;  3OKY A;  3UR4 A;  4D0K A; 
#chains in the Genus database with same CATH topology
 5JWZ A;  5K1C C;  3PVW B;  1GOT B;  4PSX B;  5HE0 B;  3JAM g;  2P9L C;  4AN0 A;  2HYE A;  3GRE A;  2QZP A;  4ERY A;  2HU5 A;  3IJ1 A;  4E5Z B;  2AGL A;  4G55 A;  3SFZ A;  3IUJ A;  4G56 B;  2OVQ B;  4L9O A;  1I2M B;  3EI1 A;  2I0R A;  2G9A A;  2HXC A;  4WJK A;  2OK4 A;  2YNN A;  4AEZ A;  2VDK A;  4FA1 D;  1H2Y A;  4GMB A;  4QRJ A;  4J77 A;  3BG0 A;  4Y5R D;  4A0B A;  4J86 A;  2PM6 B;  2PM9 A;  2Z2O A;  4ES0 A;  3JPX A;  3L4M D;  3K26 A;  5M5S A;  2VDN A;  2OIZ A;  2VZ3 A;  1UTC A;  2XYI A;  4Z7O A;  3KRX B;  2IUP A;  4NAA A;  2H6Q A;  3OTT A;  4U7A A;  3AL9 A;  5SXM A;  1GP2 B;  2YBA A;  3MXX A;  5M5U A;  2YNO A;  3SLE D;  4AMZ A;  1C9I A;  4JD2 C;  2VDR A;  3V4V A;  3JZH A;  4PBY A;  5AFU 3;  4ZOZ A;  4E54 A;  3O4I A;  3FM0 A;  4GGD A;  4L1Q D;  4BCC A;  4AMY A;  5EAL A;  4EWR A;  4ERZ A;  4Z7Q A;  5K19 A;  2IAA A;  3OF7 A;  3I7L A;  4CY3 A;  3SJL D;  4FA4 D;  4QAM A;  2I0T A;  4OWR A;  1H2W A;  4NC4 A;  3CFV A;  2TRC B;  3PVU B;  4K3I D;  2OJY A;  1L5G A;  4Z8L A;  2Z2N A;  4A09 B;  5C2V B;  2AQ5 A;  5GMK n;  3O4H A;  4A11 B;  1A0R B;  4H5J A;  4HDJ A;  1T2X A;  3QHY B;  5FLX g;  2CNX A;  3MMY A;  4LG8 A;  3DDU A;  3SBQ A;  4UM9 A;  4KFM B;  4DNW A;  3PSL A;  4JHN A;  1H2Z A;  1XIP A;  4DNV A;  4CI8 A;  2Q7Q A;  2Z2P A;  3IUM A;  5H17 A;  2EBS A;  5E6U A;  5CXB B;  1SQJ A;  5E6S A;  4PBZ A;  4Y7R A;  1OMW B;  2QR5 A;  4GQ1 A;  3V9F A;  3GC3 B;  4CZY A;  4QL1 A;  1RI6 A;  4JSX C;  5EAP A;  2PBI B;  3ZDX A;  1VE6 A;  3KCI A;  1K3I A;  4CI2 A;  3ORV D;  5IGQ A;  2AGZ A;  1S4U X;  1UOP A;  3NIG A;  2VDM A;  3FCS A;  3AH8 B;  2J57 G;  4DNU A;  4A08 B;  1VZ3 A;  2EID A;  1L0Q A;  4FAV D;  4J84 A;  3MKQ A;  5C92 A;  4CZX A;  2QXV A;  2H13 A;  5I5I A;  3K27 A;  1M1X A;  5FQD A;  2IWK A;  5TDH B;  3ZWL B;  2GC4 A;  2J56 H;  3AL8 A;  5HQG A;  3RN0 D;  1R5M A;  3FRX A;  3UKR C;  3RLM D;  3C5M A;  5FFG A;  4K3J B;  4E5Z A;  3MUN A;  3IUL A;  3I7N A;  3IIY A;  3CFS B;  3UVM A;  3ZDZ A;  5C86 A;  5IGO A;  4PXW A;  4FB1 D;  3IJC A;  4J73 A;  3K6S A;  5E6R A;  4D6V A;  2YMU A;  3O4J A;  4J87 A;  3RFH A;  3J80 g;  3DWL C;  4BCD A;  1GOH A;  1Q47 A;  3FCU A;  5GXI A;  3IIW A;  3I7O A;  2P9U C;  1GG2 B;  3SCY A;  3U4Y A;  2XDW A;  1TBG A;  2JKX A;  4J81 A;  4LG9 A;  4O3T B;  4GGA A;  1JJU B;  3OKY B;  3C75 H;  3I8C A;  4N14 A;  4MK0 B;  4CY5 A;  1N6D A;  3OKW A;  5FA5 B;  1JTD B;  4CC9 A;  3GD1 I;  1QNI A;  3JRO A;  1VYH C;  3EI4 B;  4IMM A;  4L1M A;  3MVD K;  4X3E A;  2WQ8 A;  3L4O D;  4BL0 A;  4X63 B;  4JSV C;  5I5M A;  3SN6 B;  1NR0 A;  4FA5 D;  4BH6 A;  2XL2 A;  5M61 A;  1B9X A;  4U1E I;  3OW8 A;  5CYK A;  5C9Z B;  2BKL A;  2PM9 B;  3DXM C;  3MUO A;  5IT9 g;  4GGC A;  2P9K C;  4UI9 R;  4A09 A;  5FKT A;  1K8K C;  2HU8 A;  2UZX B;  3JZG A;  5HE2 B;  1PBY B;  4J79 A;  4MMX A;  4H5I A;  3NIF A;  1GOG A;  3CIK B;  3N0E A;  1GXR A;  2PM7 B;  4ZN4 A;  5HDB A;  3GFC A;  3UVN A;  1BPO A;  1SQ9 A;  3MKS B;  3T3P A;  2HU7 A;  2AH1 A;  3FGB A;  4JHP C;  4AN1 A;  5FKQ A;  2VDQ A;  2W18 A;  5CXB A;  1PI6 A;  5CXC B;  3IVM A;  2CO0 C;  3ZE1 A;  2H9M A;  4ZOV A;  5FKS A;  4O9D A;  3K72 A;  4D9S A;  3ODT A;  5C2W B;  4A7J A;  2VDO A;  2IUR A;  3SXT D;  4JT5 C;  5H1M A;  3EI2 A;  1QFS A;  1N6F A;  5IJ8 E;  3E0C A;  4MMZ A;  3HFQ A;  4ERQ A;  2HES X;  3PSC B;  1JOF A;  4MMY A;  3I7P A;  3VGZ A;  2XU7 A;  2B5N A;  3VI3 A;  1SHY B;  5TF2 A;  3F3P A;  4QT8 A;  3SVW D;  1NEX B;  4A0A B;  2CO0 A;  3C9C A;  2IUV A;  2OVP B;  3NVQ A;  2HKR A;  2HJB A;  3UVO A;  4NSX A;  4CI1 A;  4AOW A;  4CI3 A;  2G99 A;  2H47 A;  4OZU A;  1QFM A;  2HJ4 A;  3IJE A;  1MG3 A;  3OL2 B;  4G1M A;  4FA9 D;  4ZOY A;  5EM2 B;  2YNP A;  3F3F A;  5EAR A;  2H9L A;  5THA A;  1E5T A;  1UOO A;  3T3M A;  2VDL A;  4QQE A;  3RRM C;  2EIC A;  3N0D A;  4GQB B;  3V7D B;  5GSA A;  4L3H D;  1ERJ A;  3VA6 A;  4PSW B;  3EG6 A;  3EWE A;  3UVK A;  3J81 g;  1H2X A;  5EAM A;  3EI3 B;  3IUN A;  5TEF A;  4J78 A;  3PXW D;  4X60 B;  2XL3 A;  4J0W A;  3SHF A;  2P9N C;  5FKR A;  4G1E A;  3VI4 A;  3MZK A;  1MG2 A;  2XE4 A;  5GXH A;  3ZDY A;  2H9N A;  2AH0 A;  5TEE A;  5B4W A;  4BP9 A;  4RE5 A;  3JRP A;  2GC7 A;  2H9P A;  4L3G D;  4JSP C;  3RN1 D;  1U8C A;  3EU7 A;  3AL8 B;  2QC5 A;  1OLZ A;  4J82 A;  5M5V A;  3I7K A;  5EMK B;  4Z7N A;  2MTA H;  4GM8 A;  5EMM B;  4CY2 A;  3PXT D;  1JMZ B;  5IJ7 E;  1E8N A;  3EI4 A;  4GM3 A;  5A2Q g;  2OK6 A;  3IUR A;  4WK4 A;  2CE9 A;  1YFQ A;  2B5M A;  4ZOX A;  2GNQ A;  3DSM A;  3ULE C;  3EQ7 A;  2BBK H;  1TYQ C;  2CN2 A;  3QI0 A;  1VZ2 A;  4BCB A;  3EI1 B;  4J8G A;  1P22 A;  2P9I C;  3NID A;  3I7H A;  3RSE C;  1MDA H;  4NBM A;  4X61 B;  4NEN A;  3MZL A;  3BG1 A;  3I2N A;  3NVN A;  3RFG A;  1E8M A;  2P9S C;  5M5T A;  4A0B B;  4RE6 A;  3A0F A;  3W15 A;  3O4G A;  1PEV A;  1YR2 A;  4A2M A;  4XEI C;  3SWS D;  2H6N A;  4IA9 A;  5I5J A;  5AMS A;  5H14 A;  4A11 A;  3IKO A;  3EMH A;  5EMJ B;  4LGN A;  2I0S A;  5KDO B;  3SMR A;  1XHM A;  5FXY A;  3EQ9 A;  2OVR B;  5CXC A;  4ESG A;  4WK0 A;  2B4E A;  2IUQ A;  1O6F A;  4YVD A;  3BWS A;  4GM9 A;  2YB8 B;  4O02 A;  4A2L A;  4BUJ C;  4PC0 A;  2H6K A;  1K32 A;  2H14 A;  4E54 B;  3RMZ D;  3SBR A;  1N6E A;  2O9K A;  3K71 A;  3JZN A;  4J0X A;  5CYK B;  2H3X A;  3B7F A;  1GOF A;  2P9P C;  2AGW A;  2VC2 A;  3UVL A;  2UZY B;  4A0A A;  4O3U B;  4O45 A;  2CE8 A;  3PXS D;  1PGU A;  4A08 A;  4AX4 A;  3I8E A;  3NVX A;  1UOQ A;  4CZV A;  5HE3 B;  2H68 A;  4GQ2 P;  4JXM A;  5AJA A;  4R7A B;  3ZE0 A;  2CN3 A;  5HE1 B;  4J8B A;  5EML B;  2I3S A;  4O1Q D;  4FAN D;  4XYI A;  1U2V C;  3F3G A;  5EM2 A;  3OL2 A;  4O2W A;  1O6G A;  3C99 A;  3KRW B;  4JSN C;  2B5L A;  2J55 H;  2VZ1 A;  4CY1 A;  1U4C A;  1C9L A;  1XKS A;  3I89 A;  4JT6 C;  1JV2 A;  3ZE2 A;  3EI2 B;  3EQ8 A;  2HKM A;  3P4F A;  1VE7 A;  4PNK B;  2EIE A;  3IUQ A;  3EI3 A;  3VH0 A;  3PE7 A;  4XYH A;  4FHL A;  3JB9 L;  2I3T A;  5HYN B;  1A12 A;  1FWX A;  1JMX B;  3AFC A;  3DXK C;  2XZG A;  1TYE A;  4TZ4 A;  4UM8 A;  3V5W B;  2VDP A;  4WK2 A;  4IRZ A;  3SBP A;  3UKU C;  2EIB A;  5IC7 A;  2AGX A;  3V4P A;  5FFO A;  1B9Y A;  4I79 A;  3DM0 A;  4GZ8 A;  3IJ0 A;  2AGY A;  2IWF A;  2BCJ B;  4FWW A;  3OKT A;  3OKY A;  5M5R A;  3UR4 A;  4D0K A;  4BP8 A; 
#chains in the Genus database with same CATH homology
 5JWZ A;  5K1C C;  3PVW B;  1GOT B;  4PSX B;  5HE0 B;  3JAM g;  2P9L C;  2HYE A;  3GRE A;  4ERY A;  3IJ1 A;  4E5Z B;  2AGL A;  3SFZ A;  4G56 B;  2OVQ B;  4L9O A;  3EI1 A;  2I0R A;  2G9A A;  2HXC A;  2OK4 A;  2YNN A;  4AEZ A;  4FA1 D;  4QRJ A;  4GMB A;  4J77 A;  3BG0 A;  4Y5R D;  4A0B A;  4J86 A;  2PM6 B;  2PM9 A;  2Z2O A;  4ES0 A;  3JPX A;  3L4M D;  3K26 A;  2OIZ A;  2XYI A;  3KRX B;  2IUP A;  2H6Q A;  3OTT A;  4U7A A;  3AL9 A;  5SXM A;  1GP2 B;  2YBA A;  3MXX A;  2YNO A;  3SLE D;  4JD2 C;  3JZH A;  4PBY A;  5AFU 3;  4ZOZ A;  4E54 A;  3FM0 A;  4GGD A;  4L1Q D;  5EAL A;  4EWR A;  4ERZ A;  5K19 A;  2IAA A;  3I7L A;  4CY3 A;  3SJL D;  4FA4 D;  4OWR A;  2I0T A;  3CFV A;  2TRC B;  3PVU B;  4K3I D;  2OJY A;  4Z8L A;  2Z2N A;  4A09 B;  5C2V B;  2AQ5 A;  5GMK n;  4A11 B;  1A0R B;  4H5J A;  4HDJ A;  5FLX g;  2CNX A;  3MMY A;  4LG8 A;  3SBQ A;  4KFM B;  3PSL A;  1XIP A;  4CI8 A;  2Q7Q A;  2Z2P A;  5H17 A;  2EBS A;  5CXB B;  1SQJ A;  4PBZ A;  4Y7R A;  1OMW B;  4GQ1 A;  3V9F A;  4CZY A;  4QL1 A;  1RI6 A;  4JSX C;  5EAP A;  2PBI B;  4CI2 A;  3ORV D;  5IGQ A;  2AGZ A;  1S4U X;  3AH8 B;  2J57 G;  4A08 B;  1L0Q A;  4FAV D;  4J84 A;  3MKQ A;  4CZX A;  2QXV A;  2H13 A;  5I5I A;  3K27 A;  5FQD A;  5TDH B;  2IWK A;  3ZWL B;  2GC4 A;  2J56 H;  3AL8 A;  5HQG A;  3RN0 D;  1R5M A;  3FRX A;  3UKR C;  3RLM D;  3C5M A;  4K3J B;  4E5Z A;  3I7N A;  3IIY A;  3CFS B;  3UVM A;  5IGO A;  4PXW A;  4FB1 D;  3IJC A;  4J73 A;  4D6V A;  2YMU A;  4J87 A;  3RFH A;  3J80 g;  3DWL C;  1Q47 A;  5GXI A;  3IIW A;  3I7O A;  2P9U C;  1GG2 B;  3SCY A;  3U4Y A;  1TBG A;  4J81 A;  4LG9 A;  4O3T B;  4GGA A;  1JJU B;  3OKY B;  4N14 A;  3C75 H;  3I8C A;  4MK0 B;  4CY5 A;  1N6D A;  3OKW A;  5FA5 B;  4CC9 A;  1QNI A;  3JRO A;  1VYH C;  3EI4 B;  4IMM A;  4X3E A;  3L4O D;  4BL0 A;  4X63 B;  4JSV C;  5I5M A;  3SN6 B;  1NR0 A;  4FA5 D;  4BH6 A;  2XL2 A;  1B9X A;  4U1E I;  3OW8 A;  5CYK A;  5C9Z B;  3DXM C;  2PM9 B;  5IT9 g;  4GGC A;  2P9K C;  4UI9 R;  4A09 A;  5FKT A;  1K8K C;  2UZX B;  5HE2 B;  3JZG A;  1PBY B;  4J79 A;  4H5I A;  3CIK B;  3N0E A;  1GXR A;  2PM7 B;  4ZN4 A;  3GFC A;  3UVN A;  1SQ9 A;  3MKS B;  2AH1 A;  3FGB A;  5FKQ A;  2W18 A;  5CXB A;  1PI6 A;  5CXC B;  2CO0 C;  2H9M A;  4ZOV A;  5FKS A;  4O9D A;  3ODT A;  5C2W B;  4A7J A;  2IUR A;  3SXT D;  4JT5 C;  5H1M A;  3EI2 A;  1N6F A;  5IJ8 E;  3E0C A;  3HFQ A;  4ERQ A;  2HES X;  3PSC B;  1JOF A;  3I7P A;  3VGZ A;  2XU7 A;  2B5N A;  1SHY B;  5TF2 A;  3F3P A;  4QT8 A;  3SVW D;  1NEX B;  4A0A B;  2CO0 A;  3C9C A;  2IUV A;  2OVP B;  3NVQ A;  2HKR A;  2HJB A;  3UVO A;  4NSX A;  4CI1 A;  4AOW A;  4CI3 A;  2G99 A;  2H47 A;  4OZU A;  2HJ4 A;  1MG3 A;  3OL2 B;  4FA9 D;  4ZOY A;  5EM2 B;  2YNP A;  3F3F A;  5EAR A;  2H9L A;  5THA A;  4QQE A;  3RRM C;  3N0D A;  4GQB B;  3V7D B;  5GSA A;  4L3H D;  1ERJ A;  3VA6 A;  4PSW B;  3EG6 A;  3EWE A;  3UVK A;  3J81 g;  5EAM A;  3EI3 B;  5TEF A;  4J78 A;  3PXW D;  4X60 B;  2XL3 A;  4J0W A;  3SHF A;  2P9N C;  5FKR A;  3MZK A;  1MG2 A;  5GXH A;  2H9N A;  2AH0 A;  5TEE A;  5B4W A;  3JRP A;  2GC7 A;  2H9P A;  4L3G D;  4JSP C;  3RN1 D;  3EU7 A;  3AL8 B;  2QC5 A;  1OLZ A;  4J82 A;  3I7K A;  5EMK B;  2MTA H;  4GM8 A;  5EMM B;  4CY2 A;  3PXT D;  1JMZ B;  5IJ7 E;  3EI4 A;  4GM3 A;  5A2Q g;  2OK6 A;  2CE9 A;  1YFQ A;  2B5M A;  4ZOX A;  2GNQ A;  3DSM A;  3ULE C;  2BBK H;  1TYQ C;  2CN2 A;  3EI1 B;  4J8G A;  1P22 A;  2P9I C;  3I7H A;  3RSE C;  1MDA H;  4X61 B;  3MZL A;  3BG1 A;  3I2N A;  3NVN A;  3RFG A;  2P9S C;  4A0B B;  3A0F A;  3W15 A;  1PEV A;  4A2M A;  4XEI C;  3SWS D;  2H6N A;  4IA9 A;  5I5J A;  5AMS A;  5H14 A;  4A11 A;  3IKO A;  3EMH A;  5EMJ B;  4LGN A;  2I0S A;  5KDO B;  3SMR A;  1XHM A;  5FXY A;  2OVR B;  5CXC A;  4ESG A;  2B4E A;  2IUQ A;  4YVD A;  3BWS A;  4GM9 A;  2YB8 B;  4A2L A;  4BUJ C;  4PC0 A;  2H6K A;  1K32 A;  2H14 A;  4E54 B;  3RMZ D;  3SBR A;  1N6E A;  2O9K A;  3JZN A;  4J0X A;  5CYK B;  2H3X A;  3B7F A;  2P9P C;  2AGW A;  3UVL A;  2UZY B;  4A0A A;  4O3U B;  4O45 A;  2CE8 A;  3PXS D;  1PGU A;  4A08 A;  3I8E A;  3NVX A;  4CZV A;  5HE3 B;  2H68 A;  4GQ2 P;  4JXM A;  5AJA A;  4R7A B;  2CN3 A;  5HE1 B;  4J8B A;  5EML B;  2I3S A;  4O1Q D;  4FAN D;  4XYI A;  1U2V C;  3F3G A;  5EM2 A;  3OL2 A;  3C99 A;  3KRW B;  4JSN C;  2B5L A;  2J55 H;  4CY1 A;  1U4C A;  1XKS A;  3I89 A;  4JT6 C;  3EI2 B;  2HKM A;  3P4F A;  4PNK B;  3EI3 A;  3VH0 A;  3PE7 A;  4XYH A;  4FHL A;  3JB9 L;  2I3T A;  5HYN B;  1FWX A;  1JMX B;  3AFC A;  3DXK C;  4TZ4 A;  3V5W B;  3SBP A;  3UKU C;  5IC7 A;  2AGX A;  1B9Y A;  4I79 A;  3DM0 A;  4GZ8 A;  3IJ0 A;  2AGY A;  2IWF A;  2BCJ B;  4FWW A;  3OKT A;  3OKY A;  3UR4 A;  4D0K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...