5IT9g

Structure of the yeast kluyveromyces lactis small ribosomal subunit in complex with the cricket paralysis virus ires.
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
324
structure length
318
Chain Sequence
SSNIMLVLRGTLEGHNGWVTSLSTSAAQPNLLVSGSRDKTLISWRLTENEQQFGVPVRSYKGHSHIVQDVVVSADGNYAVSASWDKTLRLWNLATGNSEARFVGHTGDVLSVAIDANSSKIISASRDKTIRVWNTVGDCAYVLLGHTDWVTKVRVAPKNLVDDGRITFVSAGMDKIVRSWSLNSYRIEADFIGHNNYINVVQPSPDGSLAASAGKDGQIYVWNLKHKSAFMNFDAKDEVFALAFSPSRFWLTAATASGIKIYDLENEVLIDELKPEFAGYTKAQDPHAVSLAWSADGQTLFAGYTDNVIRVWQVMTAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosomal protein uS2
publication title Structural characterization of ribosome recruitment and translocation by type IV IRES.
pubmed doi rcsb
source organism Cricket paralysis virus
molecule tags Ribosome
total genus 52
structure length 318
sequence length 324
ec nomenclature
pdb deposition date 2016-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
g PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5it9g01
4LG9A 2AH1A 2H3XA 5THAA 1U4CA 1B9YA 2HJBA 2H47A 3OKTA 3I8CA 4GM9A 5AJAA 5A2Qg 2W18A 3EI3B 3ODTA 2H68A 3I7NA 3RSEC 2AGLA 3PXSD 5HE0B 1XKSA 2AH0A 4OZUA 4XEIC 4FWWA 5EMJB 2XL2A 3I89A 4E54B 3OL2B 1ERJA 5EAMA 3OKWA 2OK4A 1RI6A 3MKQA 3SXTD 4J77A 5IT9g 3MZLA 1SHYB 4J84A 3OKYB 2Z2OA 3F3PA 1PGUA 3DWLC 4ZN4A 2I3TA 3EI1A 4A11A 4A08B 1JOFA 1N6EA 5IC7A 5GSAA 5SXMA 4CY3A 4LG8A 2PM6B 2TRCB 1K8KC 3JZGA 4IMMA 3NVQA 5FKRA 1GOTB 3EI4B 3RMZD 4JSNC 3E0CA 1XHMA 2IUPA 3I8EA 4FA9D 4CY2A 4U1EI 4J79A 5FLXg 5I5JA 4ZOYA 2P9PC 4J78A 3IJ0A 3PSCB 1JMZB 2J55H 4H5IA 2BCJB 4O3TB 2B5NA 4KFMB 3DXMC 4PC0A 3C75H 3SBQA 3CFSB 1MG2A 1NR0A 3EWEA 5TEEA 4GQBB 4PBZA 2P9UC 3IJ1A 4PNKB 4TZ4A 1TYQC 4A7JA 3K27A 2H6QA 3RFHA 4A2MA 3EMHA 4J0XA 4AEZA 4J81A 2CNXA 5AMSA 3L4OD 4CZVA 1K32A 3CFVA 4A08A 3EG6A 4QRJA 5FKSA 3JPXA 1NEXB 4J8BA 3ULEC 5EMLB 3IIWA 3UKUC 3EU7A 5FKTA 2GC7A 2CN3A 3I7KA 4G56B 4PXWA 3AL8A 3EI4A 4E5ZA 4LGNA 2HKMA 3SBPA 3UR4A 4A11B 2H9LA 1Q47A 4O9DA 1FWXA 4JXMA 3C5MA 3P4FA 5IJ8E 5HE2B 2IAAA 4QT8A 2IUQA 3DXKC 2GC4A 4X63B 5FA5B 2HYEA 1SQJA 5I5IA 4FHLA 1PBYB 3SCYA 1PI6A 2XU7A 4R7AB 2J56H 2QXVA 4PSXB 3SLED 3JAMg 1N6DA 4JT5C 2QC5A 2OVPB 3C9CA 2XYIA 2BBKH 2HXCA 5CXBA 1MDAH 2I0TA 4FA5D 2UZYB 4L3GD 5HE3B 2OVRB 1P22A 4GMBA 5IGOA 2P9NC 4CY5A 5GXIA 4JSPC 5TEFA 3MMYA 5IGQA 5IJ7E 4D0KA 4O45A 5HQGA 2CO0A 4FAND 5K19A 2H9PA 3SHFA 2H6NA 3I2NA 3I7LA 4CI2A 4PSWB 3J80g 1GG2B 3F3FA 1OMWB 4O3UB 4J82A 2G99A 4CY1A 4IA9A 1QNIA 4GGDA 4E5ZB 5FQDA 3AL8B 3MKSB 2AQ5A 4OWRA 1B9XA 3MZKA 5EMKB 3NVNA 4CC9A 3RLMD 4J0WA 2PM9B 2YB8B 4EWRA 2IURA 4QL1A 3DSMA 3SBRA 2OVQB 4XYIA 3JZHA 2HESX 3AFCA 2PM7B 4ZOZA 4ERZA 5B4WA 5CXBB 3HFQA 3RRMC 4FA4D 2P9IC 4X60B 1S4UX 3W15A 3BG0A 4U7AA 2I0SA 3J81g 2Q7QA 4L9OA 4J86A 5GMKn 2EBSA 4J87A 1OLZA 2XL3A 1YFQA 3CIKB 4HDJA 3VA6A 2P9SC 3BWSA 4K3ID 3UVMA 4FA1D 2B5LA 5EALA 3GREA 4BL0A 3PXWD 2UZXB 1VYHC 2OJYA 5H14A 4ESGA 3FM0A 3BG1A 3L4MD 4L1QD 5JWZA 3NVXA 2PM9A 4GM3A 1R5MA 3IKOA 2Z2NA 3UVLA 4CZXA 4GM8A 3SJLD 5EAPA 4A0BB 2P9KC 1U2VC 4L3HD 3JRPA 2O9KA 4GGAA 2I3SA 4UI9R 4ZOVA 2H6KA 4CZYA 3JZNA 5CXCA 2CE8A 5HE1B 3RN1D 2J57G 2OK6A 3GFCA 3A0FA 3I7PA 2H14A 3UKRC 2PBIB 3I7HA 4QQEA 3V9FA 4ERQA 3SVWD 3EI2B 3SMRA 4A0AB 3JB9L 3K26A 3ZWLB 3V7DB 5H1MA 4K3JB 2YBAA 3UVNA 4ZOXA 4CI1A 3SN6B 4Y5RD 3KRXB 2I0RA 3B7FA 4H5JA 2MTAH 2H9NA 5CYKB 2H9MA 2IWFA 3RN0D 3FRXA 3VGZA 2AGZA 1A0RB 3IJCA 2CE9A 2AGXA 3OW8A 3OTTA 1JJUB 2Z2PA 4O1QD 2YMUA 5C2VB 5GXHA 4CI3A 4GGCA 4Y7RA 4A09A 5EARA 2AGWA 3KRWB 4N14A 4D6VA 5EMMB 4PBYA 2CO0C 5EM2A 3N0EA 3SFZA 4A0BA 5I5MA 3AH8B 1JMXB 4ERYA 3PVWB 4GZ8A 4BUJC 3IIYA 2B4EA 3C99A 3U4YA 4J73A 2IWKA 3PSLA 4GQ2P 1XIPA 3EI2A 5C2WB 4A0AA 4J8GA 3EI3A 5CXCB 4A2LA 4X3EA 2G9AA 5FXYA 4AOWA 3I7OA 4Z8LA 3DM0A 2HKRA 2GNQA 3PXTD 1PEVA 1TBGA 4ES0A 3VH0A 5C9ZB 5AFU3 4FAVD 4BH6A 3AL9A 3PE7A 4GQ1A 5CYKA 4JSXC 1SQ9A 4NSXA 4CI8A 4JT6C 5HYNB 2B5MA 4JSVC 4E54A 4X61B 2CN2A 3OL2A 3ORVD 1N6FA 3PVUB 5K1CC 2OIZA 5TDHB 3SWSD 3RFGA 3V5WB 4XYHA 3OKYA 4I79A 5TF2A 3UVKA 2HJ4A 1MG3A 5KDOB 2H13A 4A09B 4YVDA 1GP2B 4MK0B 3MXXA 2YNOA 1GXRA 2P9LC 1L0QA 5H17A 5EM2B 4FB1D 3EI1B 4JD2C 3FGBA 3F3GA 3JROA 5FKQA 2YNPA 3UVOA 3N0DA 2YNNA 2IUVA 2AGYA
chains in the Genus database with same CATH superfamily
4LG9A 2AH1A 2H3XA 5THAA 1U4CA 1B9YA 2HJBA 2H47A 3IUJA 3OKTA 3I8CA 4GM9A 5AJAA 2VDLA 4AN0A 1M1XA 5A2Qg 2W18A 3EI3B 3ODTA 4WK0A 2H68A 5C92A 3I7NA 3RSEC 2AGLA 1UOQA 3NIDA 3PXSD 5HE0B 1XKSA 2AH0A 4OZUA 4XEIC 4FWWA 5EMJB 2XL2A 3I89A 4E54B 3OL2B 4DNVA 1ERJA 5EAMA 3OKWA 1U8CA 2OK4A 1E8NA 1RI6A 3MKQA 4J77A 3NIFA 3MZLA 3SXTD 5M5VA 5IT9g 1SHYB 4J84A 3OKYB 2Z2OA 1JV2A 3F3PA 1PGUA 1BPOA 3DWLC 4ZN4A 2I3TA 3EI1A 3IURA 3V4VA 1H2XA 4A11A 4A08B 1JOFA 1N6EA 3KCIA 5IC7A 5GSAA 4MMYA 1GOFA 5SXMA 4CY3A 4LG8A 2HU7A 1K3IA 2PM6B 2TRCB 1K8KC 3ZDZA 3JZGA 4IMMA 3NVQA 5FKRA 1GOTB 3EI4B 5M5RA 3RMZD 3O4JA 2EIEA 4JSNC 3E0CA 1E5TA 1XHMA 2IUPA 3I8EA 4FA9D 4CY2A 4U1EI 4J79A 4AX4A 5FLXg 5I5JA 1H2ZA 4ZOYA 2P9PC 4J78A 3IJ0A 3PSCB 1JMZB 2J55H 4L1MA 4H5IA 2BCJB 3O4GA 4O3TB 2B5NA 4KFMB 3DXMC 4PC0A 3C75H 3SBQA 3CFSB 1MG2A 1NR0A 3EWEA 5TEEA 4GQBB 4NENA 4PBZA 2P9UC 5HDBA 2WQ8A 3IJ1A 4PNKB 4TZ4A 3IULA 1TYQC 4A7JA 1UTCA 1O6FA 3K27A 2H6QA 3RFHA 4A2MA 3EMHA 3QI0A 4J0XA 4AEZA 3VI3A 4J81A 2CNXA 5AMSA 3L4OD 4CZVA 4JHNA 1K32A 4Z7OA 4G1MA 3CFVA 4A08A 3EG6A 4QRJA 5FKSA 3JPXA 1NEXB 3T3MA 4J8BA 3ULEC 5EMLB 3IIWA 4BP9A 4WK4A 3O4HA 3UKUC 3EU7A 5FKTA 2GC7A 2CN3A 3I7KA 4G56B 4PXWA 1VE7A 3AL8A 3EI4A 4E5ZA 4LGNA 2HKMA 3SBPA 3UR4A 4A11B 2H9LA 1Q47A 4O9DA 3IUMA 2BKLA 1FWXA 4JXMA 3C5MA 3P4FA 5FFGA 5IJ8E 5HE2B 2IAAA 5E6SA 4QT8A 2IUQA 1YR2A 3DXKC 2EIBA 2GC4A 3DDUA 3GC3B 4X63B 5FA5B 3K6SA 2HYEA 1SQJA 3IUQA 5I5IA 4FHLA 1PBYB 3SCYA 1PI6A 4MMXA 2XU7A 4R7AB 4MMZA 2J56H 2QXVA 4PSXB 3SLED 3JAMg 4G55A 1N6DA 4JT5C 2QC5A 1GOHA 2OVPB 3ZDYA 3C9CA 5E6RA 2XYIA 2BBKH 2HXCA 5CXBA 1MDAH 1C9IA 3EQ7A 2I0TA 4FA5D 2UZYB 4L3GD 5HE3B 4Z7NA 3K72A 2OVRB 1P22A 4GMBA 5M5SA 5IGOA 3ZE0A 2P9NC 4CY5A 5GXIA 2JKXA 3O4IA 4JSPC 5TEFA 3MMYA 5IGQA 5IJ7E 4D0KA 4O45A 5HQGA 2CO0A 4FAND 4WJKA 5K19A 2H9PA 4AN1A 3SHFA 2H6NA 3I2NA 3I7LA 4CI2A 5C86A 1I2MB 1E8MA 4PSWB 3J80g 1GG2B 3F3FA 1OMWB 4O3UB 4J82A 2G99A 5M61A 4IA9A 4CY1A 1A12A 1QNIA 4AMZA 4BP8A 2QR5A 4GGDA 4E5ZB 2EIDA 5FQDA 3AL8B 3MKSB 2AQ5A 4WK2A 4OWRA 1B9XA 3MZKA 4RE5A 5EMKB 3NVNA 4CC9A 2QZPA 3RLMD 4J0WA 2PM9B 2YB8B 5FFOA 4DNWA 4EWRA 5M5UA 2HU5A 3EQ8A 2IURA 4UM9A 4QL1A 3DSMA 3SBRA 2OVQB 1H2YA 4XYIA 4AMYA 3JZHA 2HESX 3MUOA 3AFCA 2VDPA 1VE6A 2PM7B 1UOPA 4ZOZA 4ERZA 4IRZA 5M5TA 5B4WA 5CXBB 3K71A 3VI4A 3HFQA 3RRMC 4FA4D 2P9IC 4X60B 1S4UX 3W15A 3BG0A 4U7AA 4UM8A 2I0SA 1L5GA 3J81g 2Q7QA 4L9OA 4J86A 5GMKn 1TYEA 2EBSA 2VDKA 4J87A 1OLZA 2XL3A 1YFQA 3CIKB 4HDJA 3VA6A 2P9SC 3BWSA 4K3ID 4G1EA 3UVMA 4FA1D 3IJEA 1T2XA 2B5LA 5EALA 3GREA 4BL0A 3PXWD 2UZXB 1VYHC 2OJYA 5H14A 1H2WA 4ESGA 3FM0A 3BG1A 3L4MD 4L1QD 5JWZA 3NVXA 2PM9A 4GM3A 1R5MA 3ZE2A 3IKOA 2Z2NA 3UVLA 1QFMA 4CZXA 4GM8A 3SJLD 5EAPA 1JTDB 2P9KC 4A0BB 1U2VC 4L3HD 3JRPA 2O9KA 4GGAA 2I3SA 2VDNA 4NAAA 4UI9R 4ZOVA 2H6KA 4CZYA 3JZNA 5CXCA 2CE8A 5HE1B 3RN1D 2J57G 2OK6A 3GFCA 3MUNA 4BCBA 3A0FA 3I7PA 2H14A 3UKRC 2PBIB 3I7HA 4QQEA 3V9FA 4ERQA 3SVWD 3EI2B 3SMRA 4A0AB 3JB9L 4O02A 3K26A 3ZWLB 1C9LA 3V7DB 4BCCA 5H1MA 4QAMA 4K3JB 2YBAA 3UVNA 4ZOXA 4CI1A 3SN6B 4Y5RD 3KRXB 2I0RA 3B7FA 4H5JA 2MTAH 2H9NA 4RE6A 5CYKB 2H9MA 2IWFA 3RN0D 3FRXA 3QHYB 3VGZA 2AGZA 1A0RB 3OF7A 3IJCA 2CE9A 2AGXA 3OW8A 3OTTA 1JJUB 2Z2PA 3FCSA 2XE4A 4O1QD 2YMUA 5C2VB 5GXHA 4CI3A 4GGCA 4Y7RA 4A09A 5EARA 2AGWA 3GD1I 3KRWB 4N14A 4D6VA 5EMMB 4PBYA 2CO0C 5EM2A 3N0EA 3SFZA 4A0BA 5E6UA 5I5MA 4JHPC 2VZ1A 3AH8B 1JMXB 4ERYA 3PVWB 4GZ8A 3ZE1A 4BUJC 3NIGA 3IIYA 2B4EA 3C99A 3U4YA 4J73A 3V4PA 2IWKA 3PSLA 3EQ9A 4DNUA 4GQ2P 4O2WA 1XIPA 3EI2A 5C2WB 4A0AA 2VDMA 2XZGA 4J8GA 3EI3A 5CXCB 4A2LA 2XDWA 4X3EA 2G9AA 5FXYA 4AOWA 3I7OA 4Z8LA 3DM0A 2HKRA 1UOOA 2GNQA 3PXTD 1PEVA 1TBGA 4ES0A 3VH0A 5C9ZB 5AFU3 2HU8A 4FAVD 4BH6A 3AL9A 3IUNA 3PE7A 2VZ3A 4GQ1A 5CYKA 4JSXC 1SQ9A 4NSXA 4CI8A 4JT6C 5HYNB 2B5MA 4JSVC 1QFSA 4X61B 4E54A 2CN2A 3OL2A 3ORVD 1N6FA 3PVUB 5K1CC 1VZ2A 2OIZA 5TDHB 3ZDXA 3SWSD 3RFGA 3V5WB 4XYHA 3OKYA 2EICA 1GOGA 4I79A 4NBMA 5TF2A 3UVKA 4NC4A 2HJ4A 3MVDK 1MG3A 2VDQA 2VDOA 5KDOB 2H13A 3FCUA 3IVMA 4A09B 1VZ3A 4YVDA 1GP2B 4MK0B 3T3PA 4BCDA 3MXXA 2YNOA 1GXRA 2P9LC 1L0QA 5H17A 5EM2B 4FB1D 4Z7QA 3EI1B 4JD2C 3FGBA 3F3GA 3JROA 2VC2A 5FKQA 2YNPA 3UVOA 3N0DA 1O6GA 4D9SA 2YNNA 2IUVA 2VDRA 2AGYA
chains in the Genus database with same CATH topology
4LG9A 2AH1A 2H3XA 5THAA 1U4CA 1B9YA 2HJBA 2H47A 3OKTA 3I8CA 4GM9A 5AJAA 5A2Qg 2W18A 3EI3B 3ODTA 2H68A 3I7NA 3RSEC 2AGLA 3PXSD 5HE0B 1XKSA 2AH0A 4OZUA 4XEIC 4FWWA 5EMJB 2XL2A 3I89A 4E54B 3OL2B 1ERJA 5EAMA 3OKWA 2OK4A 1RI6A 3MKQA 3SXTD 4J77A 5IT9g 3MZLA 1SHYB 4J84A 3OKYB 2Z2OA 3F3PA 1PGUA 3DWLC 4ZN4A 2I3TA 3EI1A 4A11A 4A08B 1JOFA 1N6EA 5IC7A 5GSAA 5SXMA 4CY3A 4LG8A 2PM6B 2TRCB 1K8KC 3JZGA 4IMMA 3NVQA 5FKRA 1GOTB 3EI4B 3RMZD 4JSNC 3E0CA 1XHMA 2IUPA 3I8EA 4FA9D 4CY2A 4U1EI 4J79A 5FLXg 5I5JA 4ZOYA 2P9PC 4J78A 3IJ0A 3PSCB 1JMZB 2J55H 4H5IA 2BCJB 4O3TB 2B5NA 4KFMB 3DXMC 4PC0A 3C75H 3SBQA 3CFSB 1MG2A 1NR0A 3EWEA 5TEEA 4GQBB 4PBZA 2P9UC 3IJ1A 4PNKB 4TZ4A 1TYQC 4A7JA 3K27A 2H6QA 3RFHA 4A2MA 3EMHA 4J0XA 4AEZA 4J81A 2CNXA 5AMSA 3L4OD 4CZVA 1K32A 3CFVA 4A08A 3EG6A 4QRJA 5FKSA 3JPXA 1NEXB 4J8BA 3ULEC 5EMLB 3IIWA 3UKUC 3EU7A 5FKTA 2GC7A 2CN3A 3I7KA 4G56B 4PXWA 3AL8A 3EI4A 4E5ZA 4LGNA 2HKMA 3SBPA 3UR4A 4A11B 2H9LA 1Q47A 4O9DA 1FWXA 4JXMA 3C5MA 3P4FA 5IJ8E 5HE2B 2IAAA 4QT8A 2IUQA 3DXKC 2GC4A 4X63B 5FA5B 2HYEA 1SQJA 5I5IA 4FHLA 1PBYB 3SCYA 1PI6A 2XU7A 4R7AB 2J56H 2QXVA 4PSXB 3SLED 3JAMg 1N6DA 4JT5C 2QC5A 2OVPB 3C9CA 2XYIA 2BBKH 2HXCA 5CXBA 1MDAH 2I0TA 4FA5D 2UZYB 4L3GD 5HE3B 2OVRB 1P22A 4GMBA 5IGOA 2P9NC 4CY5A 5GXIA 4JSPC 5TEFA 3MMYA 5IGQA 5IJ7E 4D0KA 4O45A 5HQGA 2CO0A 4FAND 5K19A 2H9PA 3SHFA 2H6NA 3I2NA 3I7LA 4CI2A 4PSWB 3J80g 1GG2B 3F3FA 1OMWB 4O3UB 4J82A 2G99A 4CY1A 4IA9A 1QNIA 4GGDA 4E5ZB 5FQDA 3AL8B 3MKSB 2AQ5A 4OWRA 1B9XA 3MZKA 5EMKB 3NVNA 4CC9A 3RLMD 4J0WA 2PM9B 2YB8B 4EWRA 2IURA 4QL1A 3DSMA 3SBRA 2OVQB 4XYIA 3JZHA 2HESX 3AFCA 2PM7B 4ZOZA 4ERZA 5B4WA 5CXBB 3HFQA 3RRMC 4FA4D 2P9IC 4X60B 1S4UX 3W15A 3BG0A 4U7AA 2I0SA 3J81g 2Q7QA 4L9OA 4J86A 5GMKn 2EBSA 4J87A 1OLZA 2XL3A 1YFQA 3CIKB 4HDJA 3VA6A 2P9SC 3BWSA 4K3ID 3UVMA 4FA1D 2B5LA 5EALA 3GREA 4BL0A 3PXWD 2UZXB 1VYHC 2OJYA 5H14A 4ESGA 3FM0A 3BG1A 3L4MD 4L1QD 5JWZA 3NVXA 2PM9A 4GM3A 1R5MA 3IKOA 2Z2NA 3UVLA 4CZXA 4GM8A 3SJLD 5EAPA 4A0BB 2P9KC 1U2VC 4L3HD 3JRPA 2O9KA 4GGAA 2I3SA 4UI9R 4ZOVA 2H6KA 4CZYA 3JZNA 5CXCA 2CE8A 5HE1B 3RN1D 2J57G 2OK6A 3GFCA 3A0FA 3I7PA 2H14A 3UKRC 2PBIB 3I7HA 4QQEA 3V9FA 4ERQA 3SVWD 3EI2B 3SMRA 4A0AB 3JB9L 3K26A 3ZWLB 3V7DB 5H1MA 4K3JB 2YBAA 3UVNA 4ZOXA 4CI1A 3SN6B 4Y5RD 3KRXB 2I0RA 3B7FA 4H5JA 2MTAH 2H9NA 5CYKB 2H9MA 2IWFA 3RN0D 3FRXA 3VGZA 2AGZA 1A0RB 3IJCA 2CE9A 2AGXA 3OW8A 3OTTA 1JJUB 2Z2PA 4O1QD 2YMUA 5C2VB 5GXHA 4CI3A 4GGCA 4Y7RA 4A09A 5EARA 2AGWA 3KRWB 4N14A 4D6VA 5EMMB 4PBYA 2CO0C 5EM2A 3N0EA 3SFZA 4A0BA 5I5MA 3AH8B 1JMXB 4ERYA 3PVWB 4GZ8A 4BUJC 3IIYA 2B4EA 3C99A 3U4YA 4J73A 2IWKA 3PSLA 4GQ2P 1XIPA 3EI2A 5C2WB 4A0AA 4J8GA 3EI3A 5CXCB 4A2LA 4X3EA 2G9AA 5FXYA 4AOWA 3I7OA 4Z8LA 3DM0A 2HKRA 2GNQA 3PXTD 1PEVA 1TBGA 4ES0A 3VH0A 5C9ZB 5AFU3 4FAVD 4BH6A 3AL9A 3PE7A 4GQ1A 5CYKA 4JSXC 1SQ9A 4NSXA 4CI8A 4JT6C 5HYNB 2B5MA 4JSVC 4E54A 4X61B 2CN2A 3OL2A 3ORVD 1N6FA 3PVUB 5K1CC 2OIZA 5TDHB 3SWSD 3RFGA 3V5WB 4XYHA 3OKYA 4I79A 5TF2A 3UVKA 2HJ4A 1MG3A 5KDOB 2H13A 4A09B 4YVDA 1GP2B 4MK0B 3MXXA 2YNOA 1GXRA 2P9LC 1L0QA 5H17A 5EM2B 4FB1D 3EI1B 4JD2C 3FGBA 3F3GA 3JROA 5FKQA 2YNPA 3UVOA 3N0DA 2YNNA 2IUVA 2AGYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LG9 A;  2AH1 A;  2H3X A;  5THA A;  1U4C A;  1B9Y A;  2HJB A;  2H47 A;  3OKT A;  3I8C A;  4GM9 A;  5AJA A;  5A2Q g;  2W18 A;  3EI3 B;  3ODT A;  2H68 A;  3I7N A;  3RSE C;  2AGL A;  3PXS D;  5HE0 B;  1XKS A;  2AH0 A;  4OZU A;  4XEI C;  4FWW A;  5EMJ B;  2XL2 A;  3I89 A;  4E54 B;  3OL2 B;  1ERJ A;  5EAM A;  3OKW A;  2OK4 A;  1RI6 A;  3MKQ A;  3SXT D;  4J77 A;  5IT9 g;  3MZL A;  1SHY B;  4J84 A;  3OKY B;  2Z2O A;  3F3P A;  1PGU A;  3DWL C;  4ZN4 A;  2I3T A;  3EI1 A;  4A11 A;  4A08 B;  1JOF A;  1N6E A;  5IC7 A;  5GSA A;  5SXM A;  4CY3 A;  4LG8 A;  2PM6 B;  2TRC B;  1K8K C;  3JZG A;  4IMM A;  3NVQ A;  5FKR A;  1GOT B;  3EI4 B;  3RMZ D;  4JSN C;  3E0C A;  1XHM A;  2IUP A;  3I8E A;  4FA9 D;  4CY2 A;  4U1E I;  4J79 A;  5FLX g;  5I5J A;  4ZOY A;  2P9P C;  4J78 A;  3IJ0 A;  3PSC B;  1JMZ B;  2J55 H;  4H5I A;  2BCJ B;  4O3T B;  2B5N A;  4KFM B;  3DXM C;  4PC0 A;  3C75 H;  3SBQ A;  3CFS B;  1MG2 A;  1NR0 A;  3EWE A;  5TEE A;  4GQB B;  4PBZ A;  2P9U C;  3IJ1 A;  4PNK B;  4TZ4 A;  1TYQ C;  4A7J A;  3K27 A;  2H6Q A;  3RFH A;  4A2M A;  3EMH A;  4J0X A;  4AEZ A;  4J81 A;  2CNX A;  5AMS A;  3L4O D;  4CZV A;  1K32 A;  3CFV A;  4A08 A;  3EG6 A;  4QRJ A;  5FKS A;  3JPX A;  1NEX B;  4J8B A;  3ULE C;  5EML B;  3IIW A;  3UKU C;  3EU7 A;  5FKT A;  2GC7 A;  2CN3 A;  3I7K A;  4G56 B;  4PXW A;  3AL8 A;  3EI4 A;  4E5Z A;  4LGN A;  2HKM A;  3SBP A;  3UR4 A;  4A11 B;  2H9L A;  1Q47 A;  4O9D A;  1FWX A;  4JXM A;  3C5M A;  3P4F A;  5IJ8 E;  5HE2 B;  2IAA A;  4QT8 A;  2IUQ A;  3DXK C;  2GC4 A;  4X63 B;  5FA5 B;  2HYE A;  1SQJ A;  5I5I A;  4FHL A;  1PBY B;  3SCY A;  1PI6 A;  2XU7 A;  4R7A B;  2J56 H;  2QXV A;  4PSX B;  3SLE D;  3JAM g;  1N6D A;  4JT5 C;  2QC5 A;  2OVP B;  3C9C A;  2XYI A;  2BBK H;  2HXC A;  5CXB A;  1MDA H;  2I0T A;  4FA5 D;  2UZY B;  4L3G D;  5HE3 B;  2OVR B;  1P22 A;  4GMB A;  5IGO A;  2P9N C;  4CY5 A;  5GXI A;  4JSP C;  5TEF A;  3MMY A;  5IGQ A;  5IJ7 E;  4D0K A;  4O45 A;  5HQG A;  2CO0 A;  4FAN D;  5K19 A;  2H9P A;  3SHF A;  2H6N A;  3I2N A;  3I7L A;  4CI2 A;  4PSW B;  3J80 g;  1GG2 B;  3F3F A;  1OMW B;  4O3U B;  4J82 A;  2G99 A;  4CY1 A;  4IA9 A;  1QNI A;  4GGD A;  4E5Z B;  5FQD A;  3AL8 B;  3MKS B;  2AQ5 A;  4OWR A;  1B9X A;  3MZK A;  5EMK B;  3NVN A;  4CC9 A;  3RLM D;  4J0W A;  2PM9 B;  2YB8 B;  4EWR A;  2IUR A;  4QL1 A;  3DSM A;  3SBR A;  2OVQ B;  4XYI A;  3JZH A;  2HES X;  3AFC A;  2PM7 B;  4ZOZ A;  4ERZ A;  5B4W A;  5CXB B;  3HFQ A;  3RRM C;  4FA4 D;  2P9I C;  4X60 B;  1S4U X;  3W15 A;  3BG0 A;  4U7A A;  2I0S A;  3J81 g;  2Q7Q A;  4L9O A;  4J86 A;  5GMK n;  2EBS A;  4J87 A;  1OLZ A;  2XL3 A;  1YFQ A;  3CIK B;  4HDJ A;  3VA6 A;  2P9S C;  3BWS A;  4K3I D;  3UVM A;  4FA1 D;  2B5L A;  5EAL A;  3GRE A;  4BL0 A;  3PXW D;  2UZX B;  1VYH C;  2OJY A;  5H14 A;  4ESG A;  3FM0 A;  3BG1 A;  3L4M D;  4L1Q D;  5JWZ A;  3NVX A;  2PM9 A;  4GM3 A;  1R5M A;  3IKO A;  2Z2N A;  3UVL A;  4CZX A;  4GM8 A;  3SJL D;  5EAP A;  4A0B B;  2P9K C;  1U2V C;  4L3H D;  3JRP A;  2O9K A;  4GGA A;  2I3S A;  4UI9 R;  4ZOV A;  2H6K A;  4CZY A;  3JZN A;  5CXC A;  2CE8 A;  5HE1 B;  3RN1 D;  2J57 G;  2OK6 A;  3GFC A;  3A0F A;  3I7P A;  2H14 A;  3UKR C;  2PBI B;  3I7H A;  4QQE A;  3V9F A;  4ERQ A;  3SVW D;  3EI2 B;  3SMR A;  4A0A B;  3JB9 L;  3K26 A;  3ZWL B;  3V7D B;  5H1M A;  4K3J B;  2YBA A;  3UVN A;  4ZOX A;  4CI1 A;  3SN6 B;  4Y5R D;  3KRX B;  2I0R A;  3B7F A;  4H5J A;  2MTA H;  2H9N A;  5CYK B;  2H9M A;  2IWF A;  3RN0 D;  3FRX A;  3VGZ A;  2AGZ A;  1A0R B;  3IJC A;  2CE9 A;  2AGX A;  3OW8 A;  3OTT A;  1JJU B;  2Z2P A;  4O1Q D;  2YMU A;  5C2V B;  5GXH A;  4CI3 A;  4GGC A;  4Y7R A;  4A09 A;  5EAR A;  2AGW A;  3KRW B;  4N14 A;  4D6V A;  5EMM B;  4PBY A;  2CO0 C;  5EM2 A;  3N0E A;  3SFZ A;  4A0B A;  5I5M A;  3AH8 B;  1JMX B;  4ERY A;  3PVW B;  4GZ8 A;  4BUJ C;  3IIY A;  2B4E A;  3C99 A;  3U4Y A;  4J73 A;  2IWK A;  3PSL A;  4GQ2 P;  1XIP A;  3EI2 A;  5C2W B;  4A0A A;  4J8G A;  3EI3 A;  5CXC B;  4A2L A;  4X3E A;  2G9A A;  5FXY A;  4AOW A;  3I7O A;  4Z8L A;  3DM0 A;  2HKR A;  2GNQ A;  3PXT D;  1PEV A;  1TBG A;  4ES0 A;  3VH0 A;  5C9Z B;  5AFU 3;  4FAV D;  4BH6 A;  3AL9 A;  3PE7 A;  4GQ1 A;  5CYK A;  4JSX C;  1SQ9 A;  4NSX A;  4CI8 A;  4JT6 C;  5HYN B;  2B5M A;  4JSV C;  4E54 A;  4X61 B;  2CN2 A;  3OL2 A;  3ORV D;  1N6F A;  3PVU B;  5K1C C;  2OIZ A;  5TDH B;  3SWS D;  3RFG A;  3V5W B;  4XYH A;  3OKY A;  4I79 A;  5TF2 A;  3UVK A;  2HJ4 A;  1MG3 A;  5KDO B;  2H13 A;  4A09 B;  4YVD A;  1GP2 B;  4MK0 B;  3MXX A;  2YNO A;  1GXR A;  2P9L C;  1L0Q A;  5H17 A;  5EM2 B;  4FB1 D;  3EI1 B;  4JD2 C;  3FGB A;  3F3G A;  3JRO A;  5FKQ A;  2YNP A;  3UVO A;  3N0D A;  2YNN A;  2IUV A;  2AGY A; 
#chains in the Genus database with same CATH topology
 4LG9 A;  2AH1 A;  2H3X A;  5THA A;  1U4C A;  1B9Y A;  2HJB A;  2H47 A;  3IUJ A;  3OKT A;  3I8C A;  4GM9 A;  5AJA A;  2VDL A;  4AN0 A;  1M1X A;  5A2Q g;  2W18 A;  3EI3 B;  3ODT A;  4WK0 A;  2H68 A;  5C92 A;  3I7N A;  3RSE C;  2AGL A;  1UOQ A;  3NID A;  3PXS D;  5HE0 B;  1XKS A;  2AH0 A;  4OZU A;  4XEI C;  4FWW A;  5EMJ B;  2XL2 A;  3I89 A;  4E54 B;  3OL2 B;  4DNV A;  1ERJ A;  5EAM A;  3OKW A;  1U8C A;  2OK4 A;  1E8N A;  1RI6 A;  3MKQ A;  4J77 A;  3NIF A;  3MZL A;  3SXT D;  5M5V A;  5IT9 g;  1SHY B;  4J84 A;  3OKY B;  2Z2O A;  1JV2 A;  3F3P A;  1PGU A;  1BPO A;  3DWL C;  4ZN4 A;  2I3T A;  3EI1 A;  3IUR A;  3V4V A;  1H2X A;  4A11 A;  4A08 B;  1JOF A;  1N6E A;  3KCI A;  5IC7 A;  5GSA A;  4MMY A;  1GOF A;  5SXM A;  4CY3 A;  4LG8 A;  2HU7 A;  1K3I A;  2PM6 B;  2TRC B;  1K8K C;  3ZDZ A;  3JZG A;  4IMM A;  3NVQ A;  5FKR A;  1GOT B;  3EI4 B;  5M5R A;  3RMZ D;  3O4J A;  2EIE A;  4JSN C;  3E0C A;  1E5T A;  1XHM A;  2IUP A;  3I8E A;  4FA9 D;  4CY2 A;  4U1E I;  4J79 A;  4AX4 A;  5FLX g;  5I5J A;  1H2Z A;  4ZOY A;  2P9P C;  4J78 A;  3IJ0 A;  3PSC B;  1JMZ B;  2J55 H;  4L1M A;  4H5I A;  2BCJ B;  3O4G A;  4O3T B;  2B5N A;  4KFM B;  3DXM C;  4PC0 A;  3C75 H;  3SBQ A;  3CFS B;  1MG2 A;  1NR0 A;  3EWE A;  5TEE A;  4GQB B;  4NEN A;  4PBZ A;  2P9U C;  5HDB A;  2WQ8 A;  3IJ1 A;  4PNK B;  4TZ4 A;  3IUL A;  1TYQ C;  4A7J A;  1UTC A;  1O6F A;  3K27 A;  2H6Q A;  3RFH A;  4A2M A;  3EMH A;  3QI0 A;  4J0X A;  4AEZ A;  3VI3 A;  4J81 A;  2CNX A;  5AMS A;  3L4O D;  4CZV A;  4JHN A;  1K32 A;  4Z7O A;  4G1M A;  3CFV A;  4A08 A;  3EG6 A;  4QRJ A;  5FKS A;  3JPX A;  1NEX B;  3T3M A;  4J8B A;  3ULE C;  5EML B;  3IIW A;  4BP9 A;  4WK4 A;  3O4H A;  3UKU C;  3EU7 A;  5FKT A;  2GC7 A;  2CN3 A;  3I7K A;  4G56 B;  4PXW A;  1VE7 A;  3AL8 A;  3EI4 A;  4E5Z A;  4LGN A;  2HKM A;  3SBP A;  3UR4 A;  4A11 B;  2H9L A;  1Q47 A;  4O9D A;  3IUM A;  2BKL A;  1FWX A;  4JXM A;  3C5M A;  3P4F A;  5FFG A;  5IJ8 E;  5HE2 B;  2IAA A;  5E6S A;  4QT8 A;  2IUQ A;  1YR2 A;  3DXK C;  2EIB A;  2GC4 A;  3DDU A;  3GC3 B;  4X63 B;  5FA5 B;  3K6S A;  2HYE A;  1SQJ A;  3IUQ A;  5I5I A;  4FHL A;  1PBY B;  3SCY A;  1PI6 A;  4MMX A;  2XU7 A;  4R7A B;  4MMZ A;  2J56 H;  2QXV A;  4PSX B;  3SLE D;  3JAM g;  4G55 A;  1N6D A;  4JT5 C;  2QC5 A;  1GOH A;  2OVP B;  3ZDY A;  3C9C A;  5E6R A;  2XYI A;  2BBK H;  2HXC A;  5CXB A;  1MDA H;  1C9I A;  3EQ7 A;  2I0T A;  4FA5 D;  2UZY B;  4L3G D;  5HE3 B;  4Z7N A;  3K72 A;  2OVR B;  1P22 A;  4GMB A;  5M5S A;  5IGO A;  3ZE0 A;  2P9N C;  4CY5 A;  5GXI A;  2JKX A;  3O4I A;  4JSP C;  5TEF A;  3MMY A;  5IGQ A;  5IJ7 E;  4D0K A;  4O45 A;  5HQG A;  2CO0 A;  4FAN D;  4WJK A;  5K19 A;  2H9P A;  4AN1 A;  3SHF A;  2H6N A;  3I2N A;  3I7L A;  4CI2 A;  5C86 A;  1I2M B;  1E8M A;  4PSW B;  3J80 g;  1GG2 B;  3F3F A;  1OMW B;  4O3U B;  4J82 A;  2G99 A;  5M61 A;  4IA9 A;  4CY1 A;  1A12 A;  1QNI A;  4AMZ A;  4BP8 A;  2QR5 A;  4GGD A;  4E5Z B;  2EID A;  5FQD A;  3AL8 B;  3MKS B;  2AQ5 A;  4WK2 A;  4OWR A;  1B9X A;  3MZK A;  4RE5 A;  5EMK B;  3NVN A;  4CC9 A;  2QZP A;  3RLM D;  4J0W A;  2PM9 B;  2YB8 B;  5FFO A;  4DNW A;  4EWR A;  5M5U A;  2HU5 A;  3EQ8 A;  2IUR A;  4UM9 A;  4QL1 A;  3DSM A;  3SBR A;  2OVQ B;  1H2Y A;  4XYI A;  4AMY A;  3JZH A;  2HES X;  3MUO A;  3AFC A;  2VDP A;  1VE6 A;  2PM7 B;  1UOP A;  4ZOZ A;  4ERZ A;  4IRZ A;  5M5T A;  5B4W A;  5CXB B;  3K71 A;  3VI4 A;  3HFQ A;  3RRM C;  4FA4 D;  2P9I C;  4X60 B;  1S4U X;  3W15 A;  3BG0 A;  4U7A A;  4UM8 A;  2I0S A;  1L5G A;  3J81 g;  2Q7Q A;  4L9O A;  4J86 A;  5GMK n;  1TYE A;  2EBS A;  2VDK A;  4J87 A;  1OLZ A;  2XL3 A;  1YFQ A;  3CIK B;  4HDJ A;  3VA6 A;  2P9S C;  3BWS A;  4K3I D;  4G1E A;  3UVM A;  4FA1 D;  3IJE A;  1T2X A;  2B5L A;  5EAL A;  3GRE A;  4BL0 A;  3PXW D;  2UZX B;  1VYH C;  2OJY A;  5H14 A;  1H2W A;  4ESG A;  3FM0 A;  3BG1 A;  3L4M D;  4L1Q D;  5JWZ A;  3NVX A;  2PM9 A;  4GM3 A;  1R5M A;  3ZE2 A;  3IKO A;  2Z2N A;  3UVL A;  1QFM A;  4CZX A;  4GM8 A;  3SJL D;  5EAP A;  1JTD B;  2P9K C;  4A0B B;  1U2V C;  4L3H D;  3JRP A;  2O9K A;  4GGA A;  2I3S A;  2VDN A;  4NAA A;  4UI9 R;  4ZOV A;  2H6K A;  4CZY A;  3JZN A;  5CXC A;  2CE8 A;  5HE1 B;  3RN1 D;  2J57 G;  2OK6 A;  3GFC A;  3MUN A;  4BCB A;  3A0F A;  3I7P A;  2H14 A;  3UKR C;  2PBI B;  3I7H A;  4QQE A;  3V9F A;  4ERQ A;  3SVW D;  3EI2 B;  3SMR A;  4A0A B;  3JB9 L;  4O02 A;  3K26 A;  3ZWL B;  1C9L A;  3V7D B;  4BCC A;  5H1M A;  4QAM A;  4K3J B;  2YBA A;  3UVN A;  4ZOX A;  4CI1 A;  3SN6 B;  4Y5R D;  3KRX B;  2I0R A;  3B7F A;  4H5J A;  2MTA H;  2H9N A;  4RE6 A;  5CYK B;  2H9M A;  2IWF A;  3RN0 D;  3FRX A;  3QHY B;  3VGZ A;  2AGZ A;  1A0R B;  3OF7 A;  3IJC A;  2CE9 A;  2AGX A;  3OW8 A;  3OTT A;  1JJU B;  2Z2P A;  3FCS A;  2XE4 A;  4O1Q D;  2YMU A;  5C2V B;  5GXH A;  4CI3 A;  4GGC A;  4Y7R A;  4A09 A;  5EAR A;  2AGW A;  3GD1 I;  3KRW B;  4N14 A;  4D6V A;  5EMM B;  4PBY A;  2CO0 C;  5EM2 A;  3N0E A;  3SFZ A;  4A0B A;  5E6U A;  5I5M A;  4JHP C;  2VZ1 A;  3AH8 B;  1JMX B;  4ERY A;  3PVW B;  4GZ8 A;  3ZE1 A;  4BUJ C;  3NIG A;  3IIY A;  2B4E A;  3C99 A;  3U4Y A;  4J73 A;  3V4P A;  2IWK A;  3PSL A;  3EQ9 A;  4DNU A;  4GQ2 P;  4O2W A;  1XIP A;  3EI2 A;  5C2W B;  4A0A A;  2VDM A;  2XZG A;  4J8G A;  3EI3 A;  5CXC B;  4A2L A;  2XDW A;  4X3E A;  2G9A A;  5FXY A;  4AOW A;  3I7O A;  4Z8L A;  3DM0 A;  2HKR A;  1UOO A;  2GNQ A;  3PXT D;  1PEV A;  1TBG A;  4ES0 A;  3VH0 A;  5C9Z B;  5AFU 3;  2HU8 A;  4FAV D;  4BH6 A;  3AL9 A;  3IUN A;  3PE7 A;  2VZ3 A;  4GQ1 A;  5CYK A;  4JSX C;  1SQ9 A;  4NSX A;  4CI8 A;  4JT6 C;  5HYN B;  2B5M A;  4JSV C;  1QFS A;  4X61 B;  4E54 A;  2CN2 A;  3OL2 A;  3ORV D;  1N6F A;  3PVU B;  5K1C C;  1VZ2 A;  2OIZ A;  5TDH B;  3ZDX A;  3SWS D;  3RFG A;  3V5W B;  4XYH A;  3OKY A;  2EIC A;  1GOG A;  4I79 A;  4NBM A;  5TF2 A;  3UVK A;  4NC4 A;  2HJ4 A;  3MVD K;  1MG3 A;  2VDQ A;  2VDO A;  5KDO B;  2H13 A;  3FCU A;  3IVM A;  4A09 B;  1VZ3 A;  4YVD A;  1GP2 B;  4MK0 B;  3T3P A;  4BCD A;  3MXX A;  2YNO A;  1GXR A;  2P9L C;  1L0Q A;  5H17 A;  5EM2 B;  4FB1 D;  4Z7Q A;  3EI1 B;  4JD2 C;  3FGB A;  3F3G A;  3JRO A;  2VC2 A;  5FKQ A;  2YNP A;  3UVO A;  3N0D A;  1O6G A;  4D9S A;  2YNN A;  2IUV A;  2VDR A;  2AGY A; 
#chains in the Genus database with same CATH homology
 4LG9 A;  2AH1 A;  2H3X A;  5THA A;  1U4C A;  1B9Y A;  2HJB A;  2H47 A;  3OKT A;  3I8C A;  4GM9 A;  5AJA A;  5A2Q g;  2W18 A;  3EI3 B;  3ODT A;  2H68 A;  3I7N A;  3RSE C;  2AGL A;  3PXS D;  5HE0 B;  1XKS A;  2AH0 A;  4OZU A;  4XEI C;  4FWW A;  5EMJ B;  2XL2 A;  3I89 A;  4E54 B;  3OL2 B;  1ERJ A;  5EAM A;  3OKW A;  2OK4 A;  1RI6 A;  3MKQ A;  3SXT D;  4J77 A;  5IT9 g;  3MZL A;  1SHY B;  4J84 A;  3OKY B;  2Z2O A;  3F3P A;  1PGU A;  3DWL C;  4ZN4 A;  2I3T A;  3EI1 A;  4A11 A;  4A08 B;  1JOF A;  1N6E A;  5IC7 A;  5GSA A;  5SXM A;  4CY3 A;  4LG8 A;  2PM6 B;  2TRC B;  1K8K C;  3JZG A;  4IMM A;  3NVQ A;  5FKR A;  1GOT B;  3EI4 B;  3RMZ D;  4JSN C;  3E0C A;  1XHM A;  2IUP A;  3I8E A;  4FA9 D;  4CY2 A;  4U1E I;  4J79 A;  5FLX g;  5I5J A;  4ZOY A;  2P9P C;  4J78 A;  3IJ0 A;  3PSC B;  1JMZ B;  2J55 H;  4H5I A;  2BCJ B;  4O3T B;  2B5N A;  4KFM B;  3DXM C;  4PC0 A;  3C75 H;  3SBQ A;  3CFS B;  1MG2 A;  1NR0 A;  3EWE A;  5TEE A;  4GQB B;  4PBZ A;  2P9U C;  3IJ1 A;  4PNK B;  4TZ4 A;  1TYQ C;  4A7J A;  3K27 A;  2H6Q A;  3RFH A;  4A2M A;  3EMH A;  4J0X A;  4AEZ A;  4J81 A;  2CNX A;  5AMS A;  3L4O D;  4CZV A;  1K32 A;  3CFV A;  4A08 A;  3EG6 A;  4QRJ A;  5FKS A;  3JPX A;  1NEX B;  4J8B A;  3ULE C;  5EML B;  3IIW A;  3UKU C;  3EU7 A;  5FKT A;  2GC7 A;  2CN3 A;  3I7K A;  4G56 B;  4PXW A;  3AL8 A;  3EI4 A;  4E5Z A;  4LGN A;  2HKM A;  3SBP A;  3UR4 A;  4A11 B;  2H9L A;  1Q47 A;  4O9D A;  1FWX A;  4JXM A;  3C5M A;  3P4F A;  5IJ8 E;  5HE2 B;  2IAA A;  4QT8 A;  2IUQ A;  3DXK C;  2GC4 A;  4X63 B;  5FA5 B;  2HYE A;  1SQJ A;  5I5I A;  4FHL A;  1PBY B;  3SCY A;  1PI6 A;  2XU7 A;  4R7A B;  2J56 H;  2QXV A;  4PSX B;  3SLE D;  3JAM g;  1N6D A;  4JT5 C;  2QC5 A;  2OVP B;  3C9C A;  2XYI A;  2BBK H;  2HXC A;  5CXB A;  1MDA H;  2I0T A;  4FA5 D;  2UZY B;  4L3G D;  5HE3 B;  2OVR B;  1P22 A;  4GMB A;  5IGO A;  2P9N C;  4CY5 A;  5GXI A;  4JSP C;  5TEF A;  3MMY A;  5IGQ A;  5IJ7 E;  4D0K A;  4O45 A;  5HQG A;  2CO0 A;  4FAN D;  5K19 A;  2H9P A;  3SHF A;  2H6N A;  3I2N A;  3I7L A;  4CI2 A;  4PSW B;  3J80 g;  1GG2 B;  3F3F A;  1OMW B;  4O3U B;  4J82 A;  2G99 A;  4CY1 A;  4IA9 A;  1QNI A;  4GGD A;  4E5Z B;  5FQD A;  3AL8 B;  3MKS B;  2AQ5 A;  4OWR A;  1B9X A;  3MZK A;  5EMK B;  3NVN A;  4CC9 A;  3RLM D;  4J0W A;  2PM9 B;  2YB8 B;  4EWR A;  2IUR A;  4QL1 A;  3DSM A;  3SBR A;  2OVQ B;  4XYI A;  3JZH A;  2HES X;  3AFC A;  2PM7 B;  4ZOZ A;  4ERZ A;  5B4W A;  5CXB B;  3HFQ A;  3RRM C;  4FA4 D;  2P9I C;  4X60 B;  1S4U X;  3W15 A;  3BG0 A;  4U7A A;  2I0S A;  3J81 g;  2Q7Q A;  4L9O A;  4J86 A;  5GMK n;  2EBS A;  4J87 A;  1OLZ A;  2XL3 A;  1YFQ A;  3CIK B;  4HDJ A;  3VA6 A;  2P9S C;  3BWS A;  4K3I D;  3UVM A;  4FA1 D;  2B5L A;  5EAL A;  3GRE A;  4BL0 A;  3PXW D;  2UZX B;  1VYH C;  2OJY A;  5H14 A;  4ESG A;  3FM0 A;  3BG1 A;  3L4M D;  4L1Q D;  5JWZ A;  3NVX A;  2PM9 A;  4GM3 A;  1R5M A;  3IKO A;  2Z2N A;  3UVL A;  4CZX A;  4GM8 A;  3SJL D;  5EAP A;  4A0B B;  2P9K C;  1U2V C;  4L3H D;  3JRP A;  2O9K A;  4GGA A;  2I3S A;  4UI9 R;  4ZOV A;  2H6K A;  4CZY A;  3JZN A;  5CXC A;  2CE8 A;  5HE1 B;  3RN1 D;  2J57 G;  2OK6 A;  3GFC A;  3A0F A;  3I7P A;  2H14 A;  3UKR C;  2PBI B;  3I7H A;  4QQE A;  3V9F A;  4ERQ A;  3SVW D;  3EI2 B;  3SMR A;  4A0A B;  3JB9 L;  3K26 A;  3ZWL B;  3V7D B;  5H1M A;  4K3J B;  2YBA A;  3UVN A;  4ZOX A;  4CI1 A;  3SN6 B;  4Y5R D;  3KRX B;  2I0R A;  3B7F A;  4H5J A;  2MTA H;  2H9N A;  5CYK B;  2H9M A;  2IWF A;  3RN0 D;  3FRX A;  3VGZ A;  2AGZ A;  1A0R B;  3IJC A;  2CE9 A;  2AGX A;  3OW8 A;  3OTT A;  1JJU B;  2Z2P A;  4O1Q D;  2YMU A;  5C2V B;  5GXH A;  4CI3 A;  4GGC A;  4Y7R A;  4A09 A;  5EAR A;  2AGW A;  3KRW B;  4N14 A;  4D6V A;  5EMM B;  4PBY A;  2CO0 C;  5EM2 A;  3N0E A;  3SFZ A;  4A0B A;  5I5M A;  3AH8 B;  1JMX B;  4ERY A;  3PVW B;  4GZ8 A;  4BUJ C;  3IIY A;  2B4E A;  3C99 A;  3U4Y A;  4J73 A;  2IWK A;  3PSL A;  4GQ2 P;  1XIP A;  3EI2 A;  5C2W B;  4A0A A;  4J8G A;  3EI3 A;  5CXC B;  4A2L A;  4X3E A;  2G9A A;  5FXY A;  4AOW A;  3I7O A;  4Z8L A;  3DM0 A;  2HKR A;  2GNQ A;  3PXT D;  1PEV A;  1TBG A;  4ES0 A;  3VH0 A;  5C9Z B;  5AFU 3;  4FAV D;  4BH6 A;  3AL9 A;  3PE7 A;  4GQ1 A;  5CYK A;  4JSX C;  1SQ9 A;  4NSX A;  4CI8 A;  4JT6 C;  5HYN B;  2B5M A;  4JSV C;  4E54 A;  4X61 B;  2CN2 A;  3OL2 A;  3ORV D;  1N6F A;  3PVU B;  5K1C C;  2OIZ A;  5TDH B;  3SWS D;  3RFG A;  3V5W B;  4XYH A;  3OKY A;  4I79 A;  5TF2 A;  3UVK A;  2HJ4 A;  1MG3 A;  5KDO B;  2H13 A;  4A09 B;  4YVD A;  1GP2 B;  4MK0 B;  3MXX A;  2YNO A;  1GXR A;  2P9L C;  1L0Q A;  5H17 A;  5EM2 B;  4FB1 D;  3EI1 B;  4JD2 C;  3FGB A;  3F3G A;  3JRO A;  5FKQ A;  2YNP A;  3UVO A;  3N0D A;  2YNN A;  2IUV A;  2AGY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...