5IT9g

Structure of the yeast kluyveromyces lactis small ribosomal subunit in complex with the cricket paralysis virus ires.
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
324
structure length
318
Chain Sequence
SSNIMLVLRGTLEGHNGWVTSLSTSAAQPNLLVSGSRDKTLISWRLTENEQQFGVPVRSYKGHSHIVQDVVVSADGNYAVSASWDKTLRLWNLATGNSEARFVGHTGDVLSVAIDANSSKIISASRDKTIRVWNTVGDCAYVLLGHTDWVTKVRVAPKNLVDDGRITFVSAGMDKIVRSWSLNSYRIEADFIGHNNYINVVQPSPDGSLAASAGKDGQIYVWNLKHKSAFMNFDAKDEVFALAFSPSRFWLTAATASGIKIYDLENEVLIDELKPEFAGYTKAQDPHAVSLAWSADGQTLFAGYTDNVIRVWQVMTAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosomal protein uS2
publication title Structural characterization of ribosome recruitment and translocation by type IV IRES.
pubmed doi rcsb
source organism Cricket paralysis virus
molecule tags Ribosome
total genus 52
structure length 318
sequence length 324
ec nomenclature
pdb deposition date 2016-03-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
g PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 5it9g01
2HKMA 3PVUB 4A09B 3AFCA 2I3SA 3I7OA 3PSLA 3SBPA 3NVQA 4JD2C 3SMRA 2CO0A 3V7DB 1OLZA 3EI1B 4U1EI 5GMKn 4O45A 5EMJB 4PBYA 4ZOZA 4D0KA 4IA9A 5IGQA 3FM0A 3BG1A 5EARA 3OKYB 4CY1A 2XL3A 3I8CA 5SXMA 2OVQB 4JSNC 5CYKB 5FLXg 4A11B 2AGYA 4N14A 1OMWB 2P9NC 2J55H 4JSVC 3AL9A 3L4OD 3V9FA 1FWXA 5FKQA 5AFU3 2H9MA 2G99A 5C9ZB 4GQ2P 5I5JA 5GXHA 2AGZA 3VGZA 4A0BB 5B4WA 2I3TA 2HESX 3C5MA 4CY5A 3SHFA 4J82A 4JSXC 4A7JA 1A0RB 3FRXA 3V5WB 4LGNA 4K3JB 4D6VA 3PXWD 4J86A 2MTAH 4CI3A 3E0CA 3IIYA 4KFMB 5IC7A 5EM2A 5TEEA 3HFQA 4QT8A 1TYQC 3PSCB 2CNXA 3RFHA 3RN0D 3JZHA 3FGBA 5EALA 3GFCA 3RFGA 3CFSB 3NVXA 2B5MA 3MMYA 4IMMA 2P9KC 2P9IC 4XEIC 3AL8B 2AGXA 2OVPB 4J77A 1B9XA 3GREA 1K8KC 1L0QA 4GM9A 3MZKA 3RSEC 3EI2B 4BUJC 2H13A 5I5MA 2PBIB 1S4UX 3DWLC 2UZYB 3CFVA 2H6NA 4FWWA 4X60B 2H47A 4HDJA 5GXIA 2OVRB 3J80g 2Q7QA 3SCYA 4A2MA 3N0DA 1SQ9A 3OL2B 1U4CA 3K26A 4FAVD 3I89A 1RI6A 4K3ID 4R7AB 4Y5RD 3SFZA 2O9KA 4G56B 3PE7A 4GMBA 2OK6A 4J81A 5TF2A 1SQJA 2BCJB 2GC7A 2GC4A 2I0TA 5AMSA 3I7KA 4OZUA 2I0SA 4GM3A 1P22A 2IAAA 1N6EA 5IT9g 3UVLA 1MG3A 4O9DA 1PI6A 4GGCA 1VYHC 2XL2A 4OWRA 1R5MA 4Z8LA 2B5NA 3UVMA 2OK4A 1NEXB 1N6FA 2HJ4A 4O3UB 2J56H 3VH0A 3MXXA 3IJ0A 4FHLA 4A09A 1GOTB 3ORVD 2IURA 2IUPA 3EWEA 4L9OA 3EI1A 2IWKA 4FAND 2CE9A 3EI4B 5JWZA 3SBRA 4PNKB 3OKTA 4QL1A 4A0AB 3EG6A 4J0XA 3OKYA 2IWFA 1K32A 4ESGA 5HE0B 3SJLD 5FQDA 3SLED 3IJCA 5CYKA 3J81g 4A11A 2I0RA 1PEVA 4L3HD 2YMUA 3PXTD 4FA1D 3NVNA 5EAMA 3RLMD 2H9LA 4GQ1A 3I2NA 4E54B 2CN2A 3UVNA 4A0BA 4CY2A 2H9NA 4I79A 3SXTD 2BBKH 3DM0A 4BH6A 1XKSA 4H5JA 1Q47A 3AH8B 2AGWA 4JT5C 4A2LA 2OIZA 3EMHA 5H17A 4L1QD 3MKSB 4FA9D 3BG0A 4AOWA 5CXCB 4EWRA 3ODTA 5HQGA 4PC0A 4GZ8A 3UKRC 4LG9A 2H3XA 1TBGA 4LG8A 4J0WA 4BL0A 5FKSA 1N6DA 3UR4A 3C9CA 4GQBB 3EU7A 5A2Qg 5HE2B 3PXSD 3EI3B 5EMLB 3AL8A 5C2WB 5CXBB 1JJUB 2J57G 3JB9L 4X63B 2YBAA 3K27A 2YNOA 2PM7B 3JPXA 3F3PA 3I7NA 3EI2A 4CY3A 2Z2NA 2CN3A 4E5ZB 2AH1A 4PBZA 4MK0B 2HKRA 3OL2A 2UZXB 4JSPC 3VA6A 2H14A 1NR0A 1ERJA 2YNNA 3DXMC 3I7HA 3OW8A 3JZGA 3F3GA 2PM9B 4YVDA 2XU7A 2AGLA 4PSXB 4CI2A 1JOFA 4A08B 4QQEA 4PSWB 5H14A 1MG2A 2QXVA 4Y7RA 5AJAA 1PBYB 4JXMA 4CI1A 2W18A 4FB1D 4X61B 3I7PA 5FXYA 2IUQA 5HE3B 1JMZB 4XYHA 4ERZA 2AQ5A 5FA5B 4ES0A 5IJ8E 2HXCA 3PVWB 1YFQA 3N0EA 4J73A 5HYNB 3EI4A 4J87A 2P9SC 5EMKB 3CIKB 5HE1B 4J8GA 1MDAH 5KDOB 4A0AA 2AH0A 4FA5D 1SHYB 1GG2B 2P9UC 3SVWD 2CO0C 3C99A 4ERYA 3KRXB 4O3TB 5IJ7E 2YB8B 3I8EA 3RN1D 4CZYA 5EAPA 5TDHB 3JRPA 4H5IA 4E54A 5EMMB 3SBQA 3OTTA 5FKTA 3IKOA 4ZOYA 1GP2B 4GM8A 3SN6B 2OJYA 1B9YA 3SWSD 1XHMA 3ULEC 5FKRA 1QNIA 2HJBA 3I7LA 3UVKA 3RMZD 5I5IA 4PXWA 2CE8A 1XIPA 4JT6C 5CXCA 1PGUA 5EM2B 4CZXA 2H6KA 4FA4D 5IGOA 2H9PA 2XYIA 2G9AA 3JAMg 3B7FA 5H1MA 2P9LC 4GGAA 2IUVA 3EI3A 1GXRA 4AEZA 4U7AA 2YNPA 5CXBA 2GNQA 4ERQA 3MKQA 3UVOA 4NSXA 4X3EA 2H6QA 3F3FA 5THAA 5TEFA 3MZLA 3IIWA 5K1CC 3W15A 3P4FA 4GGDA 4E5ZA 4UI9R 4J78A 1U2VC 3C75H 2H68A 4O1QD 3UKUC 1JMXB 4ZN4A 4J8BA 3A0FA 4XYIA 2B4EA 2PM9A 3DXKC 3JZNA 2B5LA 3BWSA 4QRJA 5K19A 3DSMA 4CC9A 4ZOXA 4CZVA 2EBSA 3IJ1A 4J84A 4A08A 3JROA 5GSAA 2Z2PA 4CI8A 3RRMC 3U4YA 5C2VB 2TRCB 4ZOVA 2HYEA 3L4MD 2Z2OA 2PM6B 4J79A 3KRWB 2P9PC 3OKWA 3ZWLB 4L3GD 4TZ4A 2QC5A
chains in the Genus database with same CATH superfamily
2HKMA 3ZDXA 3PVUB 4A09B 3AFCA 2I3SA 3I7OA 3PSLA 3SBPA 3NVQA 4JD2C 3SMRA 2CO0A 3V7DB 1O6FA 1OLZA 3EI1B 4U1EI 3NIFA 4O02A 5GMKn 5FFGA 4O45A 5EMJB 4PBYA 4ZOZA 4D0KA 4IA9A 3VI3A 5FFOA 5IGQA 3FM0A 3BG1A 4AN1A 5EARA 3OKYB 3MUNA 4CY1A 2XL3A 3I8CA 5SXMA 3V4VA 3EQ9A 2OVQB 4NC4A 2VDRA 4JSNC 5CYKB 5FLXg 4A11B 1A12A 2AGYA 4N14A 2VDMA 1OMWB 2P9NC 2J55H 4JSVC 3AL9A 3L4OD 4BP9A 3V9FA 5E6RA 1FWXA 5FKQA 5C92A 5AFU3 2H9MA 2G99A 5C9ZB 4GQ2P 5I5JA 5GXHA 1GOFA 2AGZA 2VDNA 3VGZA 4A0BB 5B4WA 2I3TA 2HESX 3C5MA 4CY5A 3SHFA 3QI0A 4G55A 3K71A 4J82A 4JSXC 4A7JA 1A0RB 3FRXA 1VZ2A 3V5WB 4LGNA 2HU7A 4K3JB 4D6VA 3PXWD 4J86A 2MTAH 4CI3A 3E0CA 3IIYA 4KFMB 5IC7A 5EM2A 5TEEA 3HFQA 4QT8A 1TYQC 5HDBA 3PSCB 4Z7OA 2CNXA 2WQ8A 3RFHA 3RN0D 3JZHA 3FGBA 5EALA 2EIEA 3GFCA 3RFGA 2VDLA 3CFSB 3NVXA 2B5MA 4WK4A 3MMYA 4IMMA 2P9KC 3O4JA 2P9IC 4XEIC 3MVDK 3O4GA 3AL8B 2AGXA 2OVPB 4J77A 4L1MA 1B9XA 3GREA 5M5TA 1K8KC 1L0QA 4GM9A 3MZKA 3RSEC 1L5GA 4BUJC 2H13A 5I5MA 3EI2B 2PBIB 1S4UX 3DWLC 2UZYB 5E6UA 3CFVA 4WK2A 2H6NA 4FWWA 2VDPA 4X60B 2H47A 4HDJA 5GXIA 2OVRB 3J80g 2Q7QA 2EICA 3SCYA 4A2MA 3N0DA 1SQ9A 3OL2B 1U4CA 3K26A 4FAVD 3I89A 3IJEA 1RI6A 1K3IA 4K3ID 4R7AB 4Y5RD 3SFZA 2O9KA 4G56B 2XE4A 3PE7A 4GMBA 2OK6A 4J81A 1YR2A 5TF2A 1SQJA 1VZ3A 2BCJB 2GC7A 2GC4A 2I0TA 5AMSA 4O2WA 3I7KA 4OZUA 2I0SA 4GM3A 1P22A 2IAAA 1N6EA 5IT9g 1GOHA 3UVLA 1E8NA 1MG3A 4O9DA 3EQ8A 1PI6A 4NENA 4GGCA 5M5VA 1VYHC 2XL2A 4OWRA 1R5MA 4G1EA 4Z8LA 2B5NA 3OF7A 2OK4A 1NEXB 1N6FA 3UVMA 2HJ4A 4O3UB 2J56H 3VH0A 1BPOA 3MXXA 3O4HA 3IJ0A 4FHLA 2VDKA 4A09A 1GOTB 3ORVD 1C9LA 2IURA 2IUPA 1M1XA 1VE6A 3EWEA 4L9OA 1C9IA 3EI1A 2IWKA 4FAND 3QHYB 4UM8A 2JKXA 2CE9A 1UOPA 3EI4B 5JWZA 3SBRA 4PNKB 3FCUA 3OKTA 4QL1A 4A0AB 3EG6A 4J0XA 3OKYA 2IWFA 1K32A 4ESGA 5HE0B 3SJLD 5FQDA 3SLED 3IJCA 5CYKA 3IUQA 4RE5A 3J81g 4A11A 2I0RA 1QFMA 3NIDA 1PEVA 4L3HD 2YMUA 3PXTD 3MUOA 4FA1D 3NVNA 5EAMA 3RLMD 3T3MA 2H9LA 4GQ1A 3I2NA 5M5UA 4E54B 4WJKA 2CN2A 3UVNA 1E8MA 1GOGA 4A0BA 4CY2A 2H9NA 4I79A 3ZE1A 3IULA 3SXTD 2BBKH 3DM0A 4BH6A 1XKSA 4H5JA 1H2ZA 1Q47A 3AH8B 2AGWA 4JT5C 4A2LA 1E5TA 1JTDB 2OIZA 3EMHA 5H17A 2BKLA 4L1QD 3MKSB 4FA9D 3BG0A 4AOWA 5CXCB 3O4IA 3IUNA 3ODTA 4EWRA 5C86A 5HQGA 1UTCA 4PC0A 4GZ8A 3UKRC 2VC2A 4LG9A 2H3XA 1TBGA 4LG8A 4J0WA 4BL0A 5FKSA 1N6DA 3UR4A 3C9CA 4GQBB 3EU7A 5A2Qg 3IVMA 5HE2B 3PXSD 3EI3B 5EMLB 3AL8A 2EIDA 5C2WB 3GC3B 5CXBB 1JJUB 2J57G 3JB9L 4X63B 2YBAA 3K27A 1H2YA 2YNOA 2PM7B 3JPXA 3F3PA 3I7NA 3EI2A 2XZGA 4AMYA 4CY3A 2Z2NA 3ZDYA 2CN3A 4E5ZB 2AH1A 4PBZA 4MK0B 2HKRA 3OL2A 4MMXA 2UZXB 4JSPC 2HU5A 3VA6A 2H14A 1NR0A 1ERJA 2YNNA 3DXMC 3I7HA 3OW8A 2HU8A 3JZGA 3F3GA 2PM9B 4YVDA 2XU7A 2AGLA 4PSXB 4CI2A 4G1MA 3GD1I 1JOFA 4A08B 4QQEA 4PSWB 5H14A 5E6SA 1MG2A 4Z7QA 4WK0A 2QXVA 4RE6A 4Y7RA 5AJAA 1PBYB 4JXMA 4CI1A 2W18A 4FB1D 4X61B 3I7PA 5FXYA 1O6GA 2IUQA 5HE3B 1JV2A 1JMZB 4XYHA 4ERZA 2AQ5A 5FA5B 4ES0A 5IJ8E 2HXCA 3PVWB 1YFQA 3N0EA 4J73A 5HYNB 3EI4A 4J87A 2P9SC 5EMKB 3CIKB 3ZE2A 5HE1B 4J8GA 1MDAH 5KDOB 4A0AA 2AH0A 4FA5D 1SHYB 1GG2B 2P9UC 3IUJA 3DDUA 2CO0C 3SVWD 3C99A 4ERYA 3KRXB 4MMYA 2EIBA 4O3TB 4D9SA 5IJ7E 2YB8B 3I8EA 3RN1D 4CZYA 4NBMA 4AN0A 5EAPA 1I2MB 1VE7A 3IURA 5TDHB 3JRPA 4H5IA 4E54A 5EMMB 4DNVA 4Z7NA 3VI4A 3SBQA 4AMZA 4BCBA 3OTTA 5FKTA 3IKOA 3T3PA 4ZOYA 1GP2B 5M5RA 3KCIA 4GM8A 2VZ3A 3SN6B 2OJYA 1B9YA 3SWSD 4AX4A 4MMZA 1XHMA 3ULEC 5FKRA 1QNIA 2HJBA 3I7LA 3UVKA 3RMZD 5I5IA 4PXWA 2CE8A 1XIPA 4JT6C 3ZE0A 5CXCA 1PGUA 5EM2B 4JHPC 4CZXA 2H6KA 4FA4D 1T2XA 5IGOA 2H9PA 2VZ1A 2XYIA 2G9AA 3JAMg 4DNWA 1UOQA 4NAAA 3B7FA 5H1MA 2P9LC 4GGAA 4BCDA 2IUVA 3EI3A 1GXRA 4AEZA 2VDOA 4U7AA 2YNPA 5CXBA 2GNQA 4ERQA 3MKQA 3UVOA 4NSXA 4X3EA 1H2XA 2H6QA 3F3FA 5THAA 3ZDZA 2XDWA 3K72A 4QAMA 5TEFA 3MZLA 3IIWA 5K1CC 3W15A 3P4FA 4GGDA 4E5ZA 4UI9R 4J78A 1U2VC 3C75H 1H2WA 2H68A 4O1QD 3UKUC 4BP8A 1JMXB 3FCSA 3NIGA 1U8CA 4ZN4A 1QFSA 4J8BA 4DNUA 3A0FA 4XYIA 2B4EA 4JHNA 4UM9A 2PM9A 3DXKC 2QR5A 2B5LA 3BWSA 3JZNA 4QRJA 5M61A 3V4PA 4BCCA 3DSMA 5K19A 4CC9A 5M5SA 4ZOXA 4CZVA 2EBSA 3IJ1A 4J84A 4A08A 3JROA 1TYEA 5GSAA 3IUMA 2Z2PA 4CI8A 2QZPA 3RRMC 3U4YA 5C2VB 2TRCB 1UOOA 4ZOVA 2HYEA 4IRZA 3L4MD 2Z2OA 2PM6B 4J79A 3KRWB 2P9PC 2VDQA 3OKWA 3EQ7A 3ZWLB 3K6SA 4L3GD 4TZ4A 2QC5A
chains in the Genus database with same CATH topology
2HKMA 3PVUB 4A09B 3AFCA 2I3SA 3I7OA 3PSLA 3SBPA 3NVQA 4JD2C 3SMRA 2CO0A 3V7DB 1OLZA 3EI1B 4U1EI 5GMKn 4O45A 5EMJB 4PBYA 4ZOZA 4D0KA 4IA9A 5IGQA 3FM0A 3BG1A 5EARA 3OKYB 4CY1A 2XL3A 3I8CA 5SXMA 2OVQB 4JSNC 5CYKB 5FLXg 4A11B 2AGYA 4N14A 1OMWB 2P9NC 2J55H 4JSVC 3AL9A 3L4OD 3V9FA 1FWXA 5FKQA 5AFU3 2H9MA 2G99A 5C9ZB 4GQ2P 5I5JA 5GXHA 2AGZA 3VGZA 4A0BB 5B4WA 2I3TA 2HESX 3C5MA 4CY5A 3SHFA 4J82A 4JSXC 4A7JA 1A0RB 3FRXA 3V5WB 4LGNA 4K3JB 4D6VA 3PXWD 4J86A 2MTAH 4CI3A 3E0CA 3IIYA 4KFMB 5IC7A 5EM2A 5TEEA 3HFQA 4QT8A 1TYQC 3PSCB 2CNXA 3RFHA 3RN0D 3JZHA 3FGBA 5EALA 3GFCA 3RFGA 3CFSB 3NVXA 2B5MA 3MMYA 4IMMA 2P9KC 2P9IC 4XEIC 3AL8B 2AGXA 2OVPB 4J77A 1B9XA 3GREA 1K8KC 1L0QA 4GM9A 3MZKA 3RSEC 3EI2B 4BUJC 2H13A 5I5MA 2PBIB 1S4UX 3DWLC 2UZYB 3CFVA 2H6NA 4FWWA 4X60B 2H47A 4HDJA 5GXIA 2OVRB 3J80g 2Q7QA 3SCYA 4A2MA 3N0DA 1SQ9A 3OL2B 1U4CA 3K26A 4FAVD 3I89A 1RI6A 4K3ID 4R7AB 4Y5RD 3SFZA 2O9KA 4G56B 3PE7A 4GMBA 2OK6A 4J81A 5TF2A 1SQJA 2BCJB 2GC7A 2GC4A 2I0TA 5AMSA 3I7KA 4OZUA 2I0SA 4GM3A 1P22A 2IAAA 1N6EA 5IT9g 3UVLA 1MG3A 4O9DA 1PI6A 4GGCA 1VYHC 2XL2A 4OWRA 1R5MA 4Z8LA 2B5NA 3UVMA 2OK4A 1NEXB 1N6FA 2HJ4A 4O3UB 2J56H 3VH0A 3MXXA 3IJ0A 4FHLA 4A09A 1GOTB 3ORVD 2IURA 2IUPA 3EWEA 4L9OA 3EI1A 2IWKA 4FAND 2CE9A 3EI4B 5JWZA 3SBRA 4PNKB 3OKTA 4QL1A 4A0AB 3EG6A 4J0XA 3OKYA 2IWFA 1K32A 4ESGA 5HE0B 3SJLD 5FQDA 3SLED 3IJCA 5CYKA 3J81g 4A11A 2I0RA 1PEVA 4L3HD 2YMUA 3PXTD 4FA1D 3NVNA 5EAMA 3RLMD 2H9LA 4GQ1A 3I2NA 4E54B 2CN2A 3UVNA 4A0BA 4CY2A 2H9NA 4I79A 3SXTD 2BBKH 3DM0A 4BH6A 1XKSA 4H5JA 1Q47A 3AH8B 2AGWA 4JT5C 4A2LA 2OIZA 3EMHA 5H17A 4L1QD 3MKSB 4FA9D 3BG0A 4AOWA 5CXCB 4EWRA 3ODTA 5HQGA 4PC0A 4GZ8A 3UKRC 4LG9A 2H3XA 1TBGA 4LG8A 4J0WA 4BL0A 5FKSA 1N6DA 3UR4A 3C9CA 4GQBB 3EU7A 5A2Qg 5HE2B 3PXSD 3EI3B 5EMLB 3AL8A 5C2WB 5CXBB 1JJUB 2J57G 3JB9L 4X63B 2YBAA 3K27A 2YNOA 2PM7B 3JPXA 3F3PA 3I7NA 3EI2A 4CY3A 2Z2NA 2CN3A 4E5ZB 2AH1A 4PBZA 4MK0B 2HKRA 3OL2A 2UZXB 4JSPC 3VA6A 2H14A 1NR0A 1ERJA 2YNNA 3DXMC 3I7HA 3OW8A 3JZGA 3F3GA 2PM9B 4YVDA 2XU7A 2AGLA 4PSXB 4CI2A 1JOFA 4A08B 4QQEA 4PSWB 5H14A 1MG2A 2QXVA 4Y7RA 5AJAA 1PBYB 4JXMA 4CI1A 2W18A 4FB1D 4X61B 3I7PA 5FXYA 2IUQA 5HE3B 1JMZB 4XYHA 4ERZA 2AQ5A 5FA5B 4ES0A 5IJ8E 2HXCA 3PVWB 1YFQA 3N0EA 4J73A 5HYNB 3EI4A 4J87A 2P9SC 5EMKB 3CIKB 5HE1B 4J8GA 1MDAH 5KDOB 4A0AA 2AH0A 4FA5D 1SHYB 1GG2B 2P9UC 3SVWD 2CO0C 3C99A 4ERYA 3KRXB 4O3TB 5IJ7E 2YB8B 3I8EA 3RN1D 4CZYA 5EAPA 5TDHB 3JRPA 4H5IA 4E54A 5EMMB 3SBQA 3OTTA 5FKTA 3IKOA 4ZOYA 1GP2B 4GM8A 3SN6B 2OJYA 1B9YA 3SWSD 1XHMA 3ULEC 5FKRA 1QNIA 2HJBA 3I7LA 3UVKA 3RMZD 5I5IA 4PXWA 2CE8A 1XIPA 4JT6C 5CXCA 1PGUA 5EM2B 4CZXA 2H6KA 4FA4D 5IGOA 2H9PA 2XYIA 2G9AA 3JAMg 3B7FA 5H1MA 2P9LC 4GGAA 2IUVA 3EI3A 1GXRA 4AEZA 4U7AA 2YNPA 5CXBA 2GNQA 4ERQA 3MKQA 3UVOA 4NSXA 4X3EA 2H6QA 3F3FA 5THAA 5TEFA 3MZLA 3IIWA 5K1CC 3W15A 3P4FA 4GGDA 4E5ZA 4UI9R 4J78A 1U2VC 3C75H 2H68A 4O1QD 3UKUC 1JMXB 4ZN4A 4J8BA 3A0FA 4XYIA 2B4EA 2PM9A 3DXKC 3JZNA 2B5LA 3BWSA 4QRJA 5K19A 3DSMA 4CC9A 4ZOXA 4CZVA 2EBSA 3IJ1A 4J84A 4A08A 3JROA 5GSAA 2Z2PA 4CI8A 3RRMC 3U4YA 5C2VB 2TRCB 4ZOVA 2HYEA 3L4MD 2Z2OA 2PM6B 4J79A 3KRWB 2P9PC 3OKWA 3ZWLB 4L3GD 4TZ4A 2QC5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HKM A;  3PVU B;  4A09 B;  3AFC A;  2I3S A;  3I7O A;  3PSL A;  3SBP A;  3NVQ A;  4JD2 C;  3SMR A;  2CO0 A;  3V7D B;  1OLZ A;  3EI1 B;  4U1E I;  5GMK n;  4O45 A;  5EMJ B;  4PBY A;  4ZOZ A;  4D0K A;  4IA9 A;  5IGQ A;  3FM0 A;  3BG1 A;  5EAR A;  3OKY B;  4CY1 A;  2XL3 A;  3I8C A;  5SXM A;  2OVQ B;  4JSN C;  5CYK B;  5FLX g;  4A11 B;  2AGY A;  4N14 A;  1OMW B;  2P9N C;  2J55 H;  4JSV C;  3AL9 A;  3L4O D;  3V9F A;  1FWX A;  5FKQ A;  5AFU 3;  2H9M A;  2G99 A;  5C9Z B;  4GQ2 P;  5I5J A;  5GXH A;  2AGZ A;  3VGZ A;  4A0B B;  5B4W A;  2I3T A;  2HES X;  3C5M A;  4CY5 A;  3SHF A;  4J82 A;  4JSX C;  4A7J A;  1A0R B;  3FRX A;  3V5W B;  4LGN A;  4K3J B;  4D6V A;  3PXW D;  4J86 A;  2MTA H;  4CI3 A;  3E0C A;  3IIY A;  4KFM B;  5IC7 A;  5EM2 A;  5TEE A;  3HFQ A;  4QT8 A;  1TYQ C;  3PSC B;  2CNX A;  3RFH A;  3RN0 D;  3JZH A;  3FGB A;  5EAL A;  3GFC A;  3RFG A;  3CFS B;  3NVX A;  2B5M A;  3MMY A;  4IMM A;  2P9K C;  2P9I C;  4XEI C;  3AL8 B;  2AGX A;  2OVP B;  4J77 A;  1B9X A;  3GRE A;  1K8K C;  1L0Q A;  4GM9 A;  3MZK A;  3RSE C;  3EI2 B;  4BUJ C;  2H13 A;  5I5M A;  2PBI B;  1S4U X;  3DWL C;  2UZY B;  3CFV A;  2H6N A;  4FWW A;  4X60 B;  2H47 A;  4HDJ A;  5GXI A;  2OVR B;  3J80 g;  2Q7Q A;  3SCY A;  4A2M A;  3N0D A;  1SQ9 A;  3OL2 B;  1U4C A;  3K26 A;  4FAV D;  3I89 A;  1RI6 A;  4K3I D;  4R7A B;  4Y5R D;  3SFZ A;  2O9K A;  4G56 B;  3PE7 A;  4GMB A;  2OK6 A;  4J81 A;  5TF2 A;  1SQJ A;  2BCJ B;  2GC7 A;  2GC4 A;  2I0T A;  5AMS A;  3I7K A;  4OZU A;  2I0S A;  4GM3 A;  1P22 A;  2IAA A;  1N6E A;  5IT9 g;  3UVL A;  1MG3 A;  4O9D A;  1PI6 A;  4GGC A;  1VYH C;  2XL2 A;  4OWR A;  1R5M A;  4Z8L A;  2B5N A;  3UVM A;  2OK4 A;  1NEX B;  1N6F A;  2HJ4 A;  4O3U B;  2J56 H;  3VH0 A;  3MXX A;  3IJ0 A;  4FHL A;  4A09 A;  1GOT B;  3ORV D;  2IUR A;  2IUP A;  3EWE A;  4L9O A;  3EI1 A;  2IWK A;  4FAN D;  2CE9 A;  3EI4 B;  5JWZ A;  3SBR A;  4PNK B;  3OKT A;  4QL1 A;  4A0A B;  3EG6 A;  4J0X A;  3OKY A;  2IWF A;  1K32 A;  4ESG A;  5HE0 B;  3SJL D;  5FQD A;  3SLE D;  3IJC A;  5CYK A;  3J81 g;  4A11 A;  2I0R A;  1PEV A;  4L3H D;  2YMU A;  3PXT D;  4FA1 D;  3NVN A;  5EAM A;  3RLM D;  2H9L A;  4GQ1 A;  3I2N A;  4E54 B;  2CN2 A;  3UVN A;  4A0B A;  4CY2 A;  2H9N A;  4I79 A;  3SXT D;  2BBK H;  3DM0 A;  4BH6 A;  1XKS A;  4H5J A;  1Q47 A;  3AH8 B;  2AGW A;  4JT5 C;  4A2L A;  2OIZ A;  3EMH A;  5H17 A;  4L1Q D;  3MKS B;  4FA9 D;  3BG0 A;  4AOW A;  5CXC B;  4EWR A;  3ODT A;  5HQG A;  4PC0 A;  4GZ8 A;  3UKR C;  4LG9 A;  2H3X A;  1TBG A;  4LG8 A;  4J0W A;  4BL0 A;  5FKS A;  1N6D A;  3UR4 A;  3C9C A;  4GQB B;  3EU7 A;  5A2Q g;  5HE2 B;  3PXS D;  3EI3 B;  5EML B;  3AL8 A;  5C2W B;  5CXB B;  1JJU B;  2J57 G;  3JB9 L;  4X63 B;  2YBA A;  3K27 A;  2YNO A;  2PM7 B;  3JPX A;  3F3P A;  3I7N A;  3EI2 A;  4CY3 A;  2Z2N A;  2CN3 A;  4E5Z B;  2AH1 A;  4PBZ A;  4MK0 B;  2HKR A;  3OL2 A;  2UZX B;  4JSP C;  3VA6 A;  2H14 A;  1NR0 A;  1ERJ A;  2YNN A;  3DXM C;  3I7H A;  3OW8 A;  3JZG A;  3F3G A;  2PM9 B;  4YVD A;  2XU7 A;  2AGL A;  4PSX B;  4CI2 A;  1JOF A;  4A08 B;  4QQE A;  4PSW B;  5H14 A;  1MG2 A;  2QXV A;  4Y7R A;  5AJA A;  1PBY B;  4JXM A;  4CI1 A;  2W18 A;  4FB1 D;  4X61 B;  3I7P A;  5FXY A;  2IUQ A;  5HE3 B;  1JMZ B;  4XYH A;  4ERZ A;  2AQ5 A;  5FA5 B;  4ES0 A;  5IJ8 E;  2HXC A;  3PVW B;  1YFQ A;  3N0E A;  4J73 A;  5HYN B;  3EI4 A;  4J87 A;  2P9S C;  5EMK B;  3CIK B;  5HE1 B;  4J8G A;  1MDA H;  5KDO B;  4A0A A;  2AH0 A;  4FA5 D;  1SHY B;  1GG2 B;  2P9U C;  3SVW D;  2CO0 C;  3C99 A;  4ERY A;  3KRX B;  4O3T B;  5IJ7 E;  2YB8 B;  3I8E A;  3RN1 D;  4CZY A;  5EAP A;  5TDH B;  3JRP A;  4H5I A;  4E54 A;  5EMM B;  3SBQ A;  3OTT A;  5FKT A;  3IKO A;  4ZOY A;  1GP2 B;  4GM8 A;  3SN6 B;  2OJY A;  1B9Y A;  3SWS D;  1XHM A;  3ULE C;  5FKR A;  1QNI A;  2HJB A;  3I7L A;  3UVK A;  3RMZ D;  5I5I A;  4PXW A;  2CE8 A;  1XIP A;  4JT6 C;  5CXC A;  1PGU A;  5EM2 B;  4CZX A;  2H6K A;  4FA4 D;  5IGO A;  2H9P A;  2XYI A;  2G9A A;  3JAM g;  3B7F A;  5H1M A;  2P9L C;  4GGA A;  2IUV A;  3EI3 A;  1GXR A;  4AEZ A;  4U7A A;  2YNP A;  5CXB A;  2GNQ A;  4ERQ A;  3MKQ A;  3UVO A;  4NSX A;  4X3E A;  2H6Q A;  3F3F A;  5THA A;  5TEF A;  3MZL A;  3IIW A;  5K1C C;  3W15 A;  3P4F A;  4GGD A;  4E5Z A;  4UI9 R;  4J78 A;  1U2V C;  3C75 H;  2H68 A;  4O1Q D;  3UKU C;  1JMX B;  4ZN4 A;  4J8B A;  3A0F A;  4XYI A;  2B4E A;  2PM9 A;  3DXK C;  3JZN A;  2B5L A;  3BWS A;  4QRJ A;  5K19 A;  3DSM A;  4CC9 A;  4ZOX A;  4CZV A;  2EBS A;  3IJ1 A;  4J84 A;  4A08 A;  3JRO A;  5GSA A;  2Z2P A;  4CI8 A;  3RRM C;  3U4Y A;  5C2V B;  2TRC B;  4ZOV A;  2HYE A;  3L4M D;  2Z2O A;  2PM6 B;  4J79 A;  3KRW B;  2P9P C;  3OKW A;  3ZWL B;  4L3G D;  4TZ4 A;  2QC5 A; 
#chains in the Genus database with same CATH topology
 2HKM A;  3ZDX A;  3PVU B;  4A09 B;  3AFC A;  2I3S A;  3I7O A;  3PSL A;  3SBP A;  3NVQ A;  4JD2 C;  3SMR A;  2CO0 A;  3V7D B;  1O6F A;  1OLZ A;  3EI1 B;  4U1E I;  3NIF A;  4O02 A;  5GMK n;  5FFG A;  4O45 A;  5EMJ B;  4PBY A;  4ZOZ A;  4D0K A;  4IA9 A;  3VI3 A;  5FFO A;  5IGQ A;  3FM0 A;  3BG1 A;  4AN1 A;  5EAR A;  3OKY B;  3MUN A;  4CY1 A;  2XL3 A;  3I8C A;  5SXM A;  3V4V A;  3EQ9 A;  2OVQ B;  4NC4 A;  2VDR A;  4JSN C;  5CYK B;  5FLX g;  4A11 B;  1A12 A;  2AGY A;  4N14 A;  2VDM A;  1OMW B;  2P9N C;  2J55 H;  4JSV C;  3AL9 A;  3L4O D;  4BP9 A;  3V9F A;  5E6R A;  1FWX A;  5FKQ A;  5C92 A;  5AFU 3;  2H9M A;  2G99 A;  5C9Z B;  4GQ2 P;  5I5J A;  5GXH A;  1GOF A;  2AGZ A;  2VDN A;  3VGZ A;  4A0B B;  5B4W A;  2I3T A;  2HES X;  3C5M A;  4CY5 A;  3SHF A;  3QI0 A;  4G55 A;  3K71 A;  4J82 A;  4JSX C;  4A7J A;  1A0R B;  3FRX A;  1VZ2 A;  3V5W B;  4LGN A;  2HU7 A;  4K3J B;  4D6V A;  3PXW D;  4J86 A;  2MTA H;  4CI3 A;  3E0C A;  3IIY A;  4KFM B;  5IC7 A;  5EM2 A;  5TEE A;  3HFQ A;  4QT8 A;  1TYQ C;  5HDB A;  3PSC B;  4Z7O A;  2CNX A;  2WQ8 A;  3RFH A;  3RN0 D;  3JZH A;  3FGB A;  5EAL A;  2EIE A;  3GFC A;  3RFG A;  2VDL A;  3CFS B;  3NVX A;  2B5M A;  4WK4 A;  3MMY A;  4IMM A;  2P9K C;  3O4J A;  2P9I C;  4XEI C;  3MVD K;  3O4G A;  3AL8 B;  2AGX A;  2OVP B;  4J77 A;  4L1M A;  1B9X A;  3GRE A;  5M5T A;  1K8K C;  1L0Q A;  4GM9 A;  3MZK A;  3RSE C;  1L5G A;  4BUJ C;  2H13 A;  5I5M A;  3EI2 B;  2PBI B;  1S4U X;  3DWL C;  2UZY B;  5E6U A;  3CFV A;  4WK2 A;  2H6N A;  4FWW A;  2VDP A;  4X60 B;  2H47 A;  4HDJ A;  5GXI A;  2OVR B;  3J80 g;  2Q7Q A;  2EIC A;  3SCY A;  4A2M A;  3N0D A;  1SQ9 A;  3OL2 B;  1U4C A;  3K26 A;  4FAV D;  3I89 A;  3IJE A;  1RI6 A;  1K3I A;  4K3I D;  4R7A B;  4Y5R D;  3SFZ A;  2O9K A;  4G56 B;  2XE4 A;  3PE7 A;  4GMB A;  2OK6 A;  4J81 A;  1YR2 A;  5TF2 A;  1SQJ A;  1VZ3 A;  2BCJ B;  2GC7 A;  2GC4 A;  2I0T A;  5AMS A;  4O2W A;  3I7K A;  4OZU A;  2I0S A;  4GM3 A;  1P22 A;  2IAA A;  1N6E A;  5IT9 g;  1GOH A;  3UVL A;  1E8N A;  1MG3 A;  4O9D A;  3EQ8 A;  1PI6 A;  4NEN A;  4GGC A;  5M5V A;  1VYH C;  2XL2 A;  4OWR A;  1R5M A;  4G1E A;  4Z8L A;  2B5N A;  3OF7 A;  2OK4 A;  1NEX B;  1N6F A;  3UVM A;  2HJ4 A;  4O3U B;  2J56 H;  3VH0 A;  1BPO A;  3MXX A;  3O4H A;  3IJ0 A;  4FHL A;  2VDK A;  4A09 A;  1GOT B;  3ORV D;  1C9L A;  2IUR A;  2IUP A;  1M1X A;  1VE6 A;  3EWE A;  4L9O A;  1C9I A;  3EI1 A;  2IWK A;  4FAN D;  3QHY B;  4UM8 A;  2JKX A;  2CE9 A;  1UOP A;  3EI4 B;  5JWZ A;  3SBR A;  4PNK B;  3FCU A;  3OKT A;  4QL1 A;  4A0A B;  3EG6 A;  4J0X A;  3OKY A;  2IWF A;  1K32 A;  4ESG A;  5HE0 B;  3SJL D;  5FQD A;  3SLE D;  3IJC A;  5CYK A;  3IUQ A;  4RE5 A;  3J81 g;  4A11 A;  2I0R A;  1QFM A;  3NID A;  1PEV A;  4L3H D;  2YMU A;  3PXT D;  3MUO A;  4FA1 D;  3NVN A;  5EAM A;  3RLM D;  3T3M A;  2H9L A;  4GQ1 A;  3I2N A;  5M5U A;  4E54 B;  4WJK A;  2CN2 A;  3UVN A;  1E8M A;  1GOG A;  4A0B A;  4CY2 A;  2H9N A;  4I79 A;  3ZE1 A;  3IUL A;  3SXT D;  2BBK H;  3DM0 A;  4BH6 A;  1XKS A;  4H5J A;  1H2Z A;  1Q47 A;  3AH8 B;  2AGW A;  4JT5 C;  4A2L A;  1E5T A;  1JTD B;  2OIZ A;  3EMH A;  5H17 A;  2BKL A;  4L1Q D;  3MKS B;  4FA9 D;  3BG0 A;  4AOW A;  5CXC B;  3O4I A;  3IUN A;  3ODT A;  4EWR A;  5C86 A;  5HQG A;  1UTC A;  4PC0 A;  4GZ8 A;  3UKR C;  2VC2 A;  4LG9 A;  2H3X A;  1TBG A;  4LG8 A;  4J0W A;  4BL0 A;  5FKS A;  1N6D A;  3UR4 A;  3C9C A;  4GQB B;  3EU7 A;  5A2Q g;  3IVM A;  5HE2 B;  3PXS D;  3EI3 B;  5EML B;  3AL8 A;  2EID A;  5C2W B;  3GC3 B;  5CXB B;  1JJU B;  2J57 G;  3JB9 L;  4X63 B;  2YBA A;  3K27 A;  1H2Y A;  2YNO A;  2PM7 B;  3JPX A;  3F3P A;  3I7N A;  3EI2 A;  2XZG A;  4AMY A;  4CY3 A;  2Z2N A;  3ZDY A;  2CN3 A;  4E5Z B;  2AH1 A;  4PBZ A;  4MK0 B;  2HKR A;  3OL2 A;  4MMX A;  2UZX B;  4JSP C;  2HU5 A;  3VA6 A;  2H14 A;  1NR0 A;  1ERJ A;  2YNN A;  3DXM C;  3I7H A;  3OW8 A;  2HU8 A;  3JZG A;  3F3G A;  2PM9 B;  4YVD A;  2XU7 A;  2AGL A;  4PSX B;  4CI2 A;  4G1M A;  3GD1 I;  1JOF A;  4A08 B;  4QQE A;  4PSW B;  5H14 A;  5E6S A;  1MG2 A;  4Z7Q A;  4WK0 A;  2QXV A;  4RE6 A;  4Y7R A;  5AJA A;  1PBY B;  4JXM A;  4CI1 A;  2W18 A;  4FB1 D;  4X61 B;  3I7P A;  5FXY A;  1O6G A;  2IUQ A;  5HE3 B;  1JV2 A;  1JMZ B;  4XYH A;  4ERZ A;  2AQ5 A;  5FA5 B;  4ES0 A;  5IJ8 E;  2HXC A;  3PVW B;  1YFQ A;  3N0E A;  4J73 A;  5HYN B;  3EI4 A;  4J87 A;  2P9S C;  5EMK B;  3CIK B;  3ZE2 A;  5HE1 B;  4J8G A;  1MDA H;  5KDO B;  4A0A A;  2AH0 A;  4FA5 D;  1SHY B;  1GG2 B;  2P9U C;  3IUJ A;  3DDU A;  2CO0 C;  3SVW D;  3C99 A;  4ERY A;  3KRX B;  4MMY A;  2EIB A;  4O3T B;  4D9S A;  5IJ7 E;  2YB8 B;  3I8E A;  3RN1 D;  4CZY A;  4NBM A;  4AN0 A;  5EAP A;  1I2M B;  1VE7 A;  3IUR A;  5TDH B;  3JRP A;  4H5I A;  4E54 A;  5EMM B;  4DNV A;  4Z7N A;  3VI4 A;  3SBQ A;  4AMZ A;  4BCB A;  3OTT A;  5FKT A;  3IKO A;  3T3P A;  4ZOY A;  1GP2 B;  5M5R A;  3KCI A;  4GM8 A;  2VZ3 A;  3SN6 B;  2OJY A;  1B9Y A;  3SWS D;  4AX4 A;  4MMZ A;  1XHM A;  3ULE C;  5FKR A;  1QNI A;  2HJB A;  3I7L A;  3UVK A;  3RMZ D;  5I5I A;  4PXW A;  2CE8 A;  1XIP A;  4JT6 C;  3ZE0 A;  5CXC A;  1PGU A;  5EM2 B;  4JHP C;  4CZX A;  2H6K A;  4FA4 D;  1T2X A;  5IGO A;  2H9P A;  2VZ1 A;  2XYI A;  2G9A A;  3JAM g;  4DNW A;  1UOQ A;  4NAA A;  3B7F A;  5H1M A;  2P9L C;  4GGA A;  4BCD A;  2IUV A;  3EI3 A;  1GXR A;  4AEZ A;  2VDO A;  4U7A A;  2YNP A;  5CXB A;  2GNQ A;  4ERQ A;  3MKQ A;  3UVO A;  4NSX A;  4X3E A;  1H2X A;  2H6Q A;  3F3F A;  5THA A;  3ZDZ A;  2XDW A;  3K72 A;  4QAM A;  5TEF A;  3MZL A;  3IIW A;  5K1C C;  3W15 A;  3P4F A;  4GGD A;  4E5Z A;  4UI9 R;  4J78 A;  1U2V C;  3C75 H;  1H2W A;  2H68 A;  4O1Q D;  3UKU C;  4BP8 A;  1JMX B;  3FCS A;  3NIG A;  1U8C A;  4ZN4 A;  1QFS A;  4J8B A;  4DNU A;  3A0F A;  4XYI A;  2B4E A;  4JHN A;  4UM9 A;  2PM9 A;  3DXK C;  2QR5 A;  2B5L A;  3BWS A;  3JZN A;  4QRJ A;  5M61 A;  3V4P A;  4BCC A;  3DSM A;  5K19 A;  4CC9 A;  5M5S A;  4ZOX A;  4CZV A;  2EBS A;  3IJ1 A;  4J84 A;  4A08 A;  3JRO A;  1TYE A;  5GSA A;  3IUM A;  2Z2P A;  4CI8 A;  2QZP A;  3RRM C;  3U4Y A;  5C2V B;  2TRC B;  1UOO A;  4ZOV A;  2HYE A;  4IRZ A;  3L4M D;  2Z2O A;  2PM6 B;  4J79 A;  3KRW B;  2P9P C;  2VDQ A;  3OKW A;  3EQ7 A;  3ZWL B;  3K6S A;  4L3G D;  4TZ4 A;  2QC5 A; 
#chains in the Genus database with same CATH homology
 2HKM A;  3PVU B;  4A09 B;  3AFC A;  2I3S A;  3I7O A;  3PSL A;  3SBP A;  3NVQ A;  4JD2 C;  3SMR A;  2CO0 A;  3V7D B;  1OLZ A;  3EI1 B;  4U1E I;  5GMK n;  4O45 A;  5EMJ B;  4PBY A;  4ZOZ A;  4D0K A;  4IA9 A;  5IGQ A;  3FM0 A;  3BG1 A;  5EAR A;  3OKY B;  4CY1 A;  2XL3 A;  3I8C A;  5SXM A;  2OVQ B;  4JSN C;  5CYK B;  5FLX g;  4A11 B;  2AGY A;  4N14 A;  1OMW B;  2P9N C;  2J55 H;  4JSV C;  3AL9 A;  3L4O D;  3V9F A;  1FWX A;  5FKQ A;  5AFU 3;  2H9M A;  2G99 A;  5C9Z B;  4GQ2 P;  5I5J A;  5GXH A;  2AGZ A;  3VGZ A;  4A0B B;  5B4W A;  2I3T A;  2HES X;  3C5M A;  4CY5 A;  3SHF A;  4J82 A;  4JSX C;  4A7J A;  1A0R B;  3FRX A;  3V5W B;  4LGN A;  4K3J B;  4D6V A;  3PXW D;  4J86 A;  2MTA H;  4CI3 A;  3E0C A;  3IIY A;  4KFM B;  5IC7 A;  5EM2 A;  5TEE A;  3HFQ A;  4QT8 A;  1TYQ C;  3PSC B;  2CNX A;  3RFH A;  3RN0 D;  3JZH A;  3FGB A;  5EAL A;  3GFC A;  3RFG A;  3CFS B;  3NVX A;  2B5M A;  3MMY A;  4IMM A;  2P9K C;  2P9I C;  4XEI C;  3AL8 B;  2AGX A;  2OVP B;  4J77 A;  1B9X A;  3GRE A;  1K8K C;  1L0Q A;  4GM9 A;  3MZK A;  3RSE C;  3EI2 B;  4BUJ C;  2H13 A;  5I5M A;  2PBI B;  1S4U X;  3DWL C;  2UZY B;  3CFV A;  2H6N A;  4FWW A;  4X60 B;  2H47 A;  4HDJ A;  5GXI A;  2OVR B;  3J80 g;  2Q7Q A;  3SCY A;  4A2M A;  3N0D A;  1SQ9 A;  3OL2 B;  1U4C A;  3K26 A;  4FAV D;  3I89 A;  1RI6 A;  4K3I D;  4R7A B;  4Y5R D;  3SFZ A;  2O9K A;  4G56 B;  3PE7 A;  4GMB A;  2OK6 A;  4J81 A;  5TF2 A;  1SQJ A;  2BCJ B;  2GC7 A;  2GC4 A;  2I0T A;  5AMS A;  3I7K A;  4OZU A;  2I0S A;  4GM3 A;  1P22 A;  2IAA A;  1N6E A;  5IT9 g;  3UVL A;  1MG3 A;  4O9D A;  1PI6 A;  4GGC A;  1VYH C;  2XL2 A;  4OWR A;  1R5M A;  4Z8L A;  2B5N A;  3UVM A;  2OK4 A;  1NEX B;  1N6F A;  2HJ4 A;  4O3U B;  2J56 H;  3VH0 A;  3MXX A;  3IJ0 A;  4FHL A;  4A09 A;  1GOT B;  3ORV D;  2IUR A;  2IUP A;  3EWE A;  4L9O A;  3EI1 A;  2IWK A;  4FAN D;  2CE9 A;  3EI4 B;  5JWZ A;  3SBR A;  4PNK B;  3OKT A;  4QL1 A;  4A0A B;  3EG6 A;  4J0X A;  3OKY A;  2IWF A;  1K32 A;  4ESG A;  5HE0 B;  3SJL D;  5FQD A;  3SLE D;  3IJC A;  5CYK A;  3J81 g;  4A11 A;  2I0R A;  1PEV A;  4L3H D;  2YMU A;  3PXT D;  4FA1 D;  3NVN A;  5EAM A;  3RLM D;  2H9L A;  4GQ1 A;  3I2N A;  4E54 B;  2CN2 A;  3UVN A;  4A0B A;  4CY2 A;  2H9N A;  4I79 A;  3SXT D;  2BBK H;  3DM0 A;  4BH6 A;  1XKS A;  4H5J A;  1Q47 A;  3AH8 B;  2AGW A;  4JT5 C;  4A2L A;  2OIZ A;  3EMH A;  5H17 A;  4L1Q D;  3MKS B;  4FA9 D;  3BG0 A;  4AOW A;  5CXC B;  4EWR A;  3ODT A;  5HQG A;  4PC0 A;  4GZ8 A;  3UKR C;  4LG9 A;  2H3X A;  1TBG A;  4LG8 A;  4J0W A;  4BL0 A;  5FKS A;  1N6D A;  3UR4 A;  3C9C A;  4GQB B;  3EU7 A;  5A2Q g;  5HE2 B;  3PXS D;  3EI3 B;  5EML B;  3AL8 A;  5C2W B;  5CXB B;  1JJU B;  2J57 G;  3JB9 L;  4X63 B;  2YBA A;  3K27 A;  2YNO A;  2PM7 B;  3JPX A;  3F3P A;  3I7N A;  3EI2 A;  4CY3 A;  2Z2N A;  2CN3 A;  4E5Z B;  2AH1 A;  4PBZ A;  4MK0 B;  2HKR A;  3OL2 A;  2UZX B;  4JSP C;  3VA6 A;  2H14 A;  1NR0 A;  1ERJ A;  2YNN A;  3DXM C;  3I7H A;  3OW8 A;  3JZG A;  3F3G A;  2PM9 B;  4YVD A;  2XU7 A;  2AGL A;  4PSX B;  4CI2 A;  1JOF A;  4A08 B;  4QQE A;  4PSW B;  5H14 A;  1MG2 A;  2QXV A;  4Y7R A;  5AJA A;  1PBY B;  4JXM A;  4CI1 A;  2W18 A;  4FB1 D;  4X61 B;  3I7P A;  5FXY A;  2IUQ A;  5HE3 B;  1JMZ B;  4XYH A;  4ERZ A;  2AQ5 A;  5FA5 B;  4ES0 A;  5IJ8 E;  2HXC A;  3PVW B;  1YFQ A;  3N0E A;  4J73 A;  5HYN B;  3EI4 A;  4J87 A;  2P9S C;  5EMK B;  3CIK B;  5HE1 B;  4J8G A;  1MDA H;  5KDO B;  4A0A A;  2AH0 A;  4FA5 D;  1SHY B;  1GG2 B;  2P9U C;  3SVW D;  2CO0 C;  3C99 A;  4ERY A;  3KRX B;  4O3T B;  5IJ7 E;  2YB8 B;  3I8E A;  3RN1 D;  4CZY A;  5EAP A;  5TDH B;  3JRP A;  4H5I A;  4E54 A;  5EMM B;  3SBQ A;  3OTT A;  5FKT A;  3IKO A;  4ZOY A;  1GP2 B;  4GM8 A;  3SN6 B;  2OJY A;  1B9Y A;  3SWS D;  1XHM A;  3ULE C;  5FKR A;  1QNI A;  2HJB A;  3I7L A;  3UVK A;  3RMZ D;  5I5I A;  4PXW A;  2CE8 A;  1XIP A;  4JT6 C;  5CXC A;  1PGU A;  5EM2 B;  4CZX A;  2H6K A;  4FA4 D;  5IGO A;  2H9P A;  2XYI A;  2G9A A;  3JAM g;  3B7F A;  5H1M A;  2P9L C;  4GGA A;  2IUV A;  3EI3 A;  1GXR A;  4AEZ A;  4U7A A;  2YNP A;  5CXB A;  2GNQ A;  4ERQ A;  3MKQ A;  3UVO A;  4NSX A;  4X3E A;  2H6Q A;  3F3F A;  5THA A;  5TEF A;  3MZL A;  3IIW A;  5K1C C;  3W15 A;  3P4F A;  4GGD A;  4E5Z A;  4UI9 R;  4J78 A;  1U2V C;  3C75 H;  2H68 A;  4O1Q D;  3UKU C;  1JMX B;  4ZN4 A;  4J8B A;  3A0F A;  4XYI A;  2B4E A;  2PM9 A;  3DXK C;  3JZN A;  2B5L A;  3BWS A;  4QRJ A;  5K19 A;  3DSM A;  4CC9 A;  4ZOX A;  4CZV A;  2EBS A;  3IJ1 A;  4J84 A;  4A08 A;  3JRO A;  5GSA A;  2Z2P A;  4CI8 A;  3RRM C;  3U4Y A;  5C2V B;  2TRC B;  4ZOV A;  2HYE A;  3L4M D;  2Z2O A;  2PM6 B;  4J79 A;  3KRW B;  2P9P C;  3OKW A;  3ZWL B;  4L3G D;  4TZ4 A;  2QC5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...