5M5SA

Clathrin heavy chain n-terminal domain bound to amphiphysin clathrin-box motif
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
360
structure length
360
Chain Sequence
ILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSNPIRRPISADSAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTVALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVGAMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTGNQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRISGETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAGAEEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis
molecule keywords Clathrin heavy chain 1
publication title Cellular and viral peptides bind multiple sites on the N-terminal domain of clathrin.
pubmed doi rcsb
source organism Bos taurus
total genus 87
structure length 360
sequence length 360
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01394 Clathrin_propel Clathrin propeller repeat
A PF09268 Clathrin-link Clathrin, heavy-chain linker
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.110 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H Clathrin heavy-chain terminal domain 5m5sA00
1C9IA 1C9LA 3GD1I 4G55A 3GC3B 5M61A 5M5SA 5M5VA 5M5TA 1UTCA 2XZGA 5M5RA 1BPOA 5M5UA
chains in the Genus database with same CATH superfamily
4J84A 2PBIB 5M5SA 2QR5A 5C2VB 2VDNA 4PXWA 1UOPA 3FGBA 4FA4D 1JMXB 3RSEC 3U4YA 2UZYB 4DNUA 4FHLA 2XZGA 3ZDYA 1S4UX 3NIFA 4A11B 3I7KA 4NENA 3F3FA 1E8MA 4BCDA 4DNWA 3UKRC 1H2XA 1VE7A 2VDOA 1RI6A 2YMUA 5CXCB 5H17A 5CXBA 1OLZA 5B4WA 2H6KA 3JROA 1PEVA 1MG3A 4E54B 2P9UC 4JHNA 2P9IC 5IGOA 5EMLB 5AMSA 5K1CC 5M61A 2HU8A 2H13A 4BUJC 2YBAA 2QZPA 4IA9A 5FFOA 1L0QA 4O02A 3EQ9A 1U8CA 3VI4A 4H5JA 3SFZA 1FWXA 2VDMA 3EI1A 4GM9A 1K32A 1B9YA 2OVRB 2VDKA 3I8EA 4J0WA 4J78A 5C2WB 5EM2B 1H2YA 2HJBA 3EQ8A 4L3HD 4ZOXA 1TYEA 5FKTA 3RMZD 5EALA 4J86A 2Z2PA 4AOWA 2OVQB 3C75H 1OMWB 5HYNB 2JKXA 2XYIA 2B5NA 3IKOA 4YVDA 2IURA 4BCBA 1VZ2A 3K26A 3I7OA 2CO0A 4WK0A 3AL9A 3PSCB 3OL2A 1P22A 2H6QA 4J79A 4JSXC 3JRPA 4Z7QA 2H68A 1MDAH 2VZ3A 3UVMA 5FKSA 1GG2B 5M5VA 3FCSA 1UTCA 3IURA 3JZNA 3MUOA 5HDBA 3OKYB 1JJUB 3VI3A 4JHPC 3F3GA 3MMYA 1PGUA 1E5TA 2QXVA 4PNKB 3EG6A 4QL1A 1JOFA 3ZDZA 3ZWLB 2OK6A 3V4VA 2GNQA 2PM9B 3OW8A 2WQ8A 4CY1A 5IJ8E 3K72A 2I0SA 3SLED 2I3SA 1H2WA 4PSWB 5FA5B 4J8GA 5FKRA 3RFGA 3UVLA 4WK2A 5CYKB 3EI2A 4CI2A 5HE3B 1UOQA 3IJ1A 2W18A 1U4CA 1GP2B 2IUPA 5E6RA 4JT5C 3P4FA 4I79A 3UVNA 4BH6A 2I0TA 4BP9A 3SHFA 3IUQA 4NC4A 2UZXB 2HYEA 4PBZA 4GGAA 3FRXA 3JPXA 3K27A 4O3TB 5HQGA 4BCCA 4OWRA 2PM7B 3O4GA 4IMMA 4WK4A 5H14A 4X63B 3C9CA 4CY3A 4A0BA 1JTDB 1T2XA 2OJYA 2YB8B 3IUMA 5TF2A 4WJKA 3V4PA 1K8KC 3JB9L 4MMYA 2CN3A 5FFGA 4A09B 4A08B 3CFVA 2HESX 2VZ1A 4A0AB 1O6FA 3O4HA 3C5MA 2IWFA 3NIGA 3GC3B 4E5ZB 3QHYB 2VC2A 4CZYA 2VDRA 3O4IA 2AGYA 4HDJA 4ERQA 3I7LA 2CO0C 4FA1D 3T3PA 1N6FA 4ESGA 2OVPB 3CFSB 5M5UA 1VYHC 3OKWA 1SQJA 3UKUC 2CE9A 3PXWD 3I7HA 5CYKA 2B4EA 4A2LA 4UI9R 5M5RA 3HFQA 4AMYA 4O3UB 2EICA 4GQ2P 5KDOB 5SXMA 5EMKB 3ZDXA 1U2VC 3J81g 4NSXA 1Q47A 4A2MA 4GZ8A 3VH0A 2YNOA 3IJCA 3OF7A 4J73A 5TEEA 3SXTD 2Q7QA 3SVWD 3V9FA 3BG1A 3EU7A 4RE6A 4CI8A 1JMZB 4EWRA 2EIEA 5IT9g 3EWEA 3W15A 2GC7A 1ERJA 5H1MA 5THAA 4QQEA 1GOHA 4K3ID 4L3GD 3SWSD 2IUVA 2P9PC 3UVOA 4LGNA 5GXHA 3MKSB 1QFMA 4A0AA 5E6UA 1R5MA 4AMZA 4E5ZA 3AH8B 4G1MA 3EI4B 3MZKA 3DXKC 2VDPA 3F3PA 3ORVD 4LG9A 4AEZA 4AX4A 4ERZA 4G1EA 3EI3B 4CZVA 1GOGA 2CN2A 2HU5A 5HE1B 4A11A 1A0RB 4O9DA 1YR2A 4UM9A 3J80g 2AH1A 1O6GA 3MZLA 4U1EI 3A0FA 3JZHA 5CXCA 3B7FA 5FLXg 1SHYB 4PSXB 1TBGA 4ZOYA 4J77A 2AGLA 3L4MD 4E54A 4XYIA 3RFHA 5JWZA 2H3XA 1L5GA 2QC5A 5FQDA 4CI1A 1PI6A 5IJ7E 5HE0B 3C99A 4QAMA 3MKQA 2OIZA 5C92A 4D9SA 4FAVD 2XL3A 2YNPA 2H9MA 3VA6A 4Z7NA 3PVUB 5EM2A 4L9OA 4PBYA 4CY2A 4X61B 4L1QD 1PBYB 4JT6C 1A12A 5I5JA 5GMKn 4CI3A 2G99A 4BP8A 3K6SA 3DWLC 1YFQA 3KCIA 3RN1D 4L1MA 4CY5A 3UVKA 3I89A 4XEIC 1VE6A 4U7AA 4ZN4A 3RRMC 2XL2A 3ULEC 3ODTA 1QNIA 2VDQA 3OKYA 2YNNA 4GM3A 4J82A 5E6SA 2I3TA 5C86A 2BBKH 5EMJB 1MG2A 1GOFA 3JAMg 3ZE0A 5I5MA 3SBPA 3PXSD 1BPOA 2P9NC 4JXMA 4Y7RA 2PM9A 4MMXA 3EI1B 4AN0A 3SJLD 2B5MA 1XHMA 2Z2OA 3NIDA 2J55H 3IIWA 4Z8LA 3VGZA 2XE4A 3GREA 3SBQA 4FB1D 3OTTA 4PC0A 1JV2A 3SBRA 2TRCB 4FA5D 3I8CA 3IVMA 4J0XA 3L4OD 2P9KC 2IWKA 4QRJA 3V5WB 2H6NA 3NVXA 4G55A 3DSMA 2J57G 4GGDA 1UOOA 3OL2B 1VZ3A 4N14A 5EAPA 2H9PA 5GSAA 2G9AA 3IJEA 4O1QD 3IUNA 4GMBA 1SQ9A 3EQ7A 3IIYA 3T3MA 3I7NA 3IJ0A 2OK4A 5AJAA 2HU7A 5IGQA 4R7AB 4UM8A 4DNVA 4A09A 3FM0A 4A08A 2J56H 4K3JB 1XIPA 3SN6B 4GQBB 4CZXA 4QT8A 1I2MB 2CNXA 3IULA 4JSVC 3O4JA 4Y5RD 3DDUA 4MMZA 5M5TA 3E0CA 5TDHB 2I0RA 4JSNC 3PVWB 4GGCA 3I2NA 4BL0A 4MK0B 3I7PA 3SCYA 1K3IA 1GOTB 4JD2C 3N0EA 3EI2B 5IC7A 3BWSA 1NR0A 4J8BA 5EAMA 5GXIA 3KRXB 1M1XA 2H47A 3ZE1A 3ZE2A 3MXXA 4Z7OA 4LG8A 1C9LA 3KRWB 4RE5A 2H9LA 4NBMA 4X60B 4FWWA 2EBSA 1N6EA 2HKMA 4TZ4A 5AFU3 4J87A 2GC4A 4G56B 5HE2B 3AFCA 4FA9D 4X3EA 4A7JA 3UR4A 4A0BB 1TYQC 4FAND 1N6DA 2H14A 3IUJA 2HKRA 3MUNA 5C9ZB 3DM0A 1B9XA 2O9KA 3AL8B 4D6VA 2AGXA 4ZOZA 2AGWA 4KFMB 5I5IA 3GD1I 4D0KA 2XDWA 5FXYA 3N0DA 3JZGA 4ZOVA 3PSLA 4O45A 1E8NA 2MTAH 5EARA 2HXCA 3CIKB 4GM8A 2P9SC 4J81A 1H2ZA 5FKQA 2XU7A 3BG0A 5K19A 2B5LA 3EI4A 3K71A 2CE8A 2AQ5A 1GXRA 2HJ4A 3DXMC 3PE7A 2P9LC 1C9IA 2BCJB 3EI3A 4GQ1A 4CC9A 4H5IA 3FCUA 3V7DB 4ERYA 5CXBB 1NEXB 3SMRA 5EMMB 2VDLA 2PM6B 2EIBA 3NVQA 2BKLA 3QI0A 3RLMD 3NVNA 3RN0D 4NAAA 2IAAA 5A2Qg 2EIDA 3MVDK 2AH0A 4XYHA 2AGZA 4JSPC 2H9NA 5TEFA 2Z2NA 3EMHA 4IRZA 4AN1A 3PXTD 1XKSA 1QFSA 2IUQA 4O2WA 4OZUA 3GFCA 3OKTA 4ES0A 3AL8A
chains in the Genus database with same CATH topology
1C9IA 1C9LA 3GD1I 4G55A 3GC3B 5M61A 5M5SA 5M5VA 5M5TA 1UTCA 2XZGA 5M5RA 1BPOA 5M5UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C9I A;  1C9L A;  3GD1 I;  4G55 A;  3GC3 B;  5M61 A;  5M5S A;  5M5V A;  5M5T A;  1UTC A;  2XZG A;  5M5R A;  1BPO A;  5M5U A; 
#chains in the Genus database with same CATH topology
 4J84 A;  2PBI B;  5M5S A;  2QR5 A;  5C2V B;  2VDN A;  4PXW A;  1UOP A;  3FGB A;  4FA4 D;  1JMX B;  3RSE C;  3U4Y A;  2UZY B;  4DNU A;  4FHL A;  2XZG A;  3ZDY A;  1S4U X;  3NIF A;  4A11 B;  3I7K A;  4NEN A;  3F3F A;  1E8M A;  4BCD A;  4DNW A;  3UKR C;  1H2X A;  1VE7 A;  2VDO A;  1RI6 A;  2YMU A;  5CXC B;  5H17 A;  5CXB A;  1OLZ A;  5B4W A;  2H6K A;  3JRO A;  1PEV A;  1MG3 A;  4E54 B;  2P9U C;  4JHN A;  2P9I C;  5IGO A;  5EML B;  5AMS A;  5K1C C;  5M61 A;  2HU8 A;  2H13 A;  4BUJ C;  2YBA A;  2QZP A;  4IA9 A;  5FFO A;  1L0Q A;  4O02 A;  3EQ9 A;  1U8C A;  3VI4 A;  4H5J A;  3SFZ A;  1FWX A;  2VDM A;  3EI1 A;  4GM9 A;  1K32 A;  1B9Y A;  2OVR B;  2VDK A;  3I8E A;  4J0W A;  4J78 A;  5C2W B;  5EM2 B;  1H2Y A;  2HJB A;  3EQ8 A;  4L3H D;  4ZOX A;  1TYE A;  5FKT A;  3RMZ D;  5EAL A;  4J86 A;  2Z2P A;  4AOW A;  2OVQ B;  3C75 H;  1OMW B;  5HYN B;  2JKX A;  2XYI A;  2B5N A;  3IKO A;  4YVD A;  2IUR A;  4BCB A;  1VZ2 A;  3K26 A;  3I7O A;  2CO0 A;  4WK0 A;  3AL9 A;  3PSC B;  3OL2 A;  1P22 A;  2H6Q A;  4J79 A;  4JSX C;  3JRP A;  4Z7Q A;  2H68 A;  1MDA H;  2VZ3 A;  3UVM A;  5FKS A;  1GG2 B;  5M5V A;  3FCS A;  1UTC A;  3IUR A;  3JZN A;  3MUO A;  5HDB A;  3OKY B;  1JJU B;  3VI3 A;  4JHP C;  3F3G A;  3MMY A;  1PGU A;  1E5T A;  2QXV A;  4PNK B;  3EG6 A;  4QL1 A;  1JOF A;  3ZDZ A;  3ZWL B;  2OK6 A;  3V4V A;  2GNQ A;  2PM9 B;  3OW8 A;  2WQ8 A;  4CY1 A;  5IJ8 E;  3K72 A;  2I0S A;  3SLE D;  2I3S A;  1H2W A;  4PSW B;  5FA5 B;  4J8G A;  5FKR A;  3RFG A;  3UVL A;  4WK2 A;  5CYK B;  3EI2 A;  4CI2 A;  5HE3 B;  1UOQ A;  3IJ1 A;  2W18 A;  1U4C A;  1GP2 B;  2IUP A;  5E6R A;  4JT5 C;  3P4F A;  4I79 A;  3UVN A;  4BH6 A;  2I0T A;  4BP9 A;  3SHF A;  3IUQ A;  4NC4 A;  2UZX B;  2HYE A;  4PBZ A;  4GGA A;  3FRX A;  3JPX A;  3K27 A;  4O3T B;  5HQG A;  4BCC A;  4OWR A;  2PM7 B;  3O4G A;  4IMM A;  4WK4 A;  5H14 A;  4X63 B;  3C9C A;  4CY3 A;  4A0B A;  1JTD B;  1T2X A;  2OJY A;  2YB8 B;  3IUM A;  5TF2 A;  4WJK A;  3V4P A;  1K8K C;  3JB9 L;  4MMY A;  2CN3 A;  5FFG A;  4A09 B;  4A08 B;  3CFV A;  2HES X;  2VZ1 A;  4A0A B;  1O6F A;  3O4H A;  3C5M A;  2IWF A;  3NIG A;  3GC3 B;  4E5Z B;  3QHY B;  2VC2 A;  4CZY A;  2VDR A;  3O4I A;  2AGY A;  4HDJ A;  4ERQ A;  3I7L A;  2CO0 C;  4FA1 D;  3T3P A;  1N6F A;  4ESG A;  2OVP B;  3CFS B;  5M5U A;  1VYH C;  3OKW A;  1SQJ A;  3UKU C;  2CE9 A;  3PXW D;  3I7H A;  5CYK A;  2B4E A;  4A2L A;  4UI9 R;  5M5R A;  3HFQ A;  4AMY A;  4O3U B;  2EIC A;  4GQ2 P;  5KDO B;  5SXM A;  5EMK B;  3ZDX A;  1U2V C;  3J81 g;  4NSX A;  1Q47 A;  4A2M A;  4GZ8 A;  3VH0 A;  2YNO A;  3IJC A;  3OF7 A;  4J73 A;  5TEE A;  3SXT D;  2Q7Q A;  3SVW D;  3V9F A;  3BG1 A;  3EU7 A;  4RE6 A;  4CI8 A;  1JMZ B;  4EWR A;  2EIE A;  5IT9 g;  3EWE A;  3W15 A;  2GC7 A;  1ERJ A;  5H1M A;  5THA A;  4QQE A;  1GOH A;  4K3I D;  4L3G D;  3SWS D;  2IUV A;  2P9P C;  3UVO A;  4LGN A;  5GXH A;  3MKS B;  1QFM A;  4A0A A;  5E6U A;  1R5M A;  4AMZ A;  4E5Z A;  3AH8 B;  4G1M A;  3EI4 B;  3MZK A;  3DXK C;  2VDP A;  3F3P A;  3ORV D;  4LG9 A;  4AEZ A;  4AX4 A;  4ERZ A;  4G1E A;  3EI3 B;  4CZV A;  1GOG A;  2CN2 A;  2HU5 A;  5HE1 B;  4A11 A;  1A0R B;  4O9D A;  1YR2 A;  4UM9 A;  3J80 g;  2AH1 A;  1O6G A;  3MZL A;  4U1E I;  3A0F A;  3JZH A;  5CXC A;  3B7F A;  5FLX g;  1SHY B;  4PSX B;  1TBG A;  4ZOY A;  4J77 A;  2AGL A;  3L4M D;  4E54 A;  4XYI A;  3RFH A;  5JWZ A;  2H3X A;  1L5G A;  2QC5 A;  5FQD A;  4CI1 A;  1PI6 A;  5IJ7 E;  5HE0 B;  3C99 A;  4QAM A;  3MKQ A;  2OIZ A;  5C92 A;  4D9S A;  4FAV D;  2XL3 A;  2YNP A;  2H9M A;  3VA6 A;  4Z7N A;  3PVU B;  5EM2 A;  4L9O A;  4PBY A;  4CY2 A;  4X61 B;  4L1Q D;  1PBY B;  4JT6 C;  1A12 A;  5I5J A;  5GMK n;  4CI3 A;  2G99 A;  4BP8 A;  3K6S A;  3DWL C;  1YFQ A;  3KCI A;  3RN1 D;  4L1M A;  4CY5 A;  3UVK A;  3I89 A;  4XEI C;  1VE6 A;  4U7A A;  4ZN4 A;  3RRM C;  2XL2 A;  3ULE C;  3ODT A;  1QNI A;  2VDQ A;  3OKY A;  2YNN A;  4GM3 A;  4J82 A;  5E6S A;  2I3T A;  5C86 A;  2BBK H;  5EMJ B;  1MG2 A;  1GOF A;  3JAM g;  3ZE0 A;  5I5M A;  3SBP A;  3PXS D;  1BPO A;  2P9N C;  4JXM A;  4Y7R A;  2PM9 A;  4MMX A;  3EI1 B;  4AN0 A;  3SJL D;  2B5M A;  1XHM A;  2Z2O A;  3NID A;  2J55 H;  3IIW A;  4Z8L A;  3VGZ A;  2XE4 A;  3GRE A;  3SBQ A;  4FB1 D;  3OTT A;  4PC0 A;  1JV2 A;  3SBR A;  2TRC B;  4FA5 D;  3I8C A;  3IVM A;  4J0X A;  3L4O D;  2P9K C;  2IWK A;  4QRJ A;  3V5W B;  2H6N A;  3NVX A;  4G55 A;  3DSM A;  2J57 G;  4GGD A;  1UOO A;  3OL2 B;  1VZ3 A;  4N14 A;  5EAP A;  2H9P A;  5GSA A;  2G9A A;  3IJE A;  4O1Q D;  3IUN A;  4GMB A;  1SQ9 A;  3EQ7 A;  3IIY A;  3T3M A;  3I7N A;  3IJ0 A;  2OK4 A;  5AJA A;  2HU7 A;  5IGQ A;  4R7A B;  4UM8 A;  4DNV A;  4A09 A;  3FM0 A;  4A08 A;  2J56 H;  4K3J B;  1XIP A;  3SN6 B;  4GQB B;  4CZX A;  4QT8 A;  1I2M B;  2CNX A;  3IUL A;  4JSV C;  3O4J A;  4Y5R D;  3DDU A;  4MMZ A;  5M5T A;  3E0C A;  5TDH B;  2I0R A;  4JSN C;  3PVW B;  4GGC A;  3I2N A;  4BL0 A;  4MK0 B;  3I7P A;  3SCY A;  1K3I A;  1GOT B;  4JD2 C;  3N0E A;  3EI2 B;  5IC7 A;  3BWS A;  1NR0 A;  4J8B A;  5EAM A;  5GXI A;  3KRX B;  1M1X A;  2H47 A;  3ZE1 A;  3ZE2 A;  3MXX A;  4Z7O A;  4LG8 A;  1C9L A;  3KRW B;  4RE5 A;  2H9L A;  4NBM A;  4X60 B;  4FWW A;  2EBS A;  1N6E A;  2HKM A;  4TZ4 A;  5AFU 3;  4J87 A;  2GC4 A;  4G56 B;  5HE2 B;  3AFC A;  4FA9 D;  4X3E A;  4A7J A;  3UR4 A;  4A0B B;  1TYQ C;  4FAN D;  1N6D A;  2H14 A;  3IUJ A;  2HKR A;  3MUN A;  5C9Z B;  3DM0 A;  1B9X A;  2O9K A;  3AL8 B;  4D6V A;  2AGX A;  4ZOZ A;  2AGW A;  4KFM B;  5I5I A;  3GD1 I;  4D0K A;  2XDW A;  5FXY A;  3N0D A;  3JZG A;  4ZOV A;  3PSL A;  4O45 A;  1E8N A;  2MTA H;  5EAR A;  2HXC A;  3CIK B;  4GM8 A;  2P9S C;  4J81 A;  1H2Z A;  5FKQ A;  2XU7 A;  3BG0 A;  5K19 A;  2B5L A;  3EI4 A;  3K71 A;  2CE8 A;  2AQ5 A;  1GXR A;  2HJ4 A;  3DXM C;  3PE7 A;  2P9L C;  1C9I A;  2BCJ B;  3EI3 A;  4GQ1 A;  4CC9 A;  4H5I A;  3FCU A;  3V7D B;  4ERY A;  5CXB B;  1NEX B;  3SMR A;  5EMM B;  2VDL A;  2PM6 B;  2EIB A;  3NVQ A;  2BKL A;  3QI0 A;  3RLM D;  3NVN A;  3RN0 D;  4NAA A;  2IAA A;  5A2Q g;  2EID A;  3MVD K;  2AH0 A;  4XYH A;  2AGZ A;  4JSP C;  2H9N A;  5TEF A;  2Z2N A;  3EMH A;  4IRZ A;  4AN1 A;  3PXT D;  1XKS A;  1QFS A;  2IUQ A;  4O2W A;  4OZU A;  3GFC A;  3OKT A;  4ES0 A;  3AL8 A; 
#chains in the Genus database with same CATH homology
 1C9I A;  1C9L A;  3GD1 I;  4G55 A;  3GC3 B;  5M61 A;  5M5S A;  5M5V A;  5M5T A;  1UTC A;  2XZG A;  5M5R A;  1BPO A;  5M5U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...