2H9PA

Wdr5 in complex with trimethylated h3k4 peptide
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
304
structure length
304
Chain Sequence
VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords WD-repeat protein 5
publication title Structural basis for molecular recognition and presentation of histone H3 By WDR5.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural genomics, gene regulation
total genus 104
structure length 304
sequence length 304
ec nomenclature
pdb deposition date 2006-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2h9pA00
1MG3A 2J57G 3DWLC 3AL8B 3OKTA 4GGAA 2AGXA 3DXKC 5CYKB 3AFCA 3I2NA 4I79A 1A0RB 4A09A 4CY5A 4ERQA 4ES0A 4FA9D 5HE2B 2HJ4A 4J81A 3JAMg 5I5MA 3GREA 3MMYA 1YFQA 5KDOB 2I0SA 4A08A 3SCYA 2IWFA 3K27A 3J81g 3SVWD 4QRJA 3RLMD 4QL1A 5IGQA 3RN1D 3OKYA 3A0FA 4JSNC 1NR0A 2I0RA 5A2Qg 1L0QA 2AGZA 4E54A 3FM0A 3NVNA 4J0WA 4YVDA 1JMXB 3NVQA 4GGDA 3I7HA 4JSPC 4CY2A 4Y7RA 4BL0A 5EMLB 4GZ8A 2IUPA 4A11A 3OKWA 5GSAA 2GC7A 3JZGA 4U7AA 3PSLA 4LG9A 2P9LC 2IAAA 2B5MA 4J0XA 3OL2B 3V9FA 5C2WB 5I5JA 4X3EA 4E5ZA 1N6FA 4HDJA 2OIZA 3EI3A 2G9AA 4PBZA 3SN6B 4CI3A 3UVOA 4FWWA 2P9KC 5JWZA 4XEIC 1NEXB 4QQEA 2P9PC 4IMMA 4N14A 4EWRA 3JZNA 4ZOZA 2XYIA 5IJ7E 5EMKB 4O3UB 1XIPA 3JROA 2I3TA 3CFSB 4PXWA 5EAPA 3EG6A 4FAND 2H6NA 4GQ2P 4ESGA 4FAVD 3SMRA 2H14A 3EI2A 2YB8B 5IJ8E 3I7KA 4J73A 5IT9g 4GQ1A 4ZOVA 2H9LA 4A0AB 2G99A 4BH6A 5EARA 4ZN4A 5HE0B 2EBSA 3F3PA 4O1QD 2HJBA 4L1QD 3UKUC 5AMSA 4O45A 2IUQA 3OW8A 3I7PA 5GXIA 5HYNB 2CNXA 1QNIA 1S4UX 3JZHA 1N6DA 5C9ZB 4ZOYA 3VH0A 3DSMA 3EI4B 2Z2OA 3JRPA 4GM3A 3UKRC 4XYIA 2OVQB 4U1EI 5HE1B 2Q7QA 3RFGA 3ORVD 5FKSA 1JMZB 3UVNA 4X61B 3SBRA 2XL3A 3I7LA 1K8KC 4LGNA 2XL2A 3IIYA 2AH0A 2OJYA 3CFVA 1SHYB 3JPXA 3W15A 3MZKA 5TF2A 3PXTD 2CE9A 3EU7A 5K1CC 3IKOA 4CC9A 5FKQA 4J84A 5FQDA 4PNKB 2PM9B 5FA5B 3ULEC 3P4FA 2W18A 2B5LA 3L4MD 4H5JA 1PGUA 1GXRA 4FA5D 1TBGA 3PE7A 1OMWB 4CZYA 4A0BB 2AGYA 2YNOA 3KRWB 4FB1D 3PVUB 4GQBB 3SHFA 3IJ0A 2PM7B 4BUJC 1RI6A 3PVWB 2B4EA 2QC5A 2AGLA 1B9YA 3PSCB 1ERJA 1R5MA 5FKTA 3ODTA 4TZ4A 3N0EA 2H13A 2J55H 4JT5C 2HYEA 3SLED 5TDHB 4QT8A 1GOTB 5CXCA 2H3XA 5FKRA 3EMHA 2H9MA 3EI4A 5EM2B 3SWSD 3EI1B 2H47A 5K19A 4J78A 1P22A 2HKRA 3MXXA 3L4OD 4O9DA 2H6KA 2YBAA 3JB9L 3MKSB 3SJLD 2CN2A 3FRXA 3AL8A 4K3JB 4A09B 2CN3A 5CXBB 4GGCA 4D6VA 3DXMC 1N6EA 5CYKA 4FA1D 1PI6A 3F3GA 4PC0A 1U4CA 4J86A 4GM8A 4A08B 5THAA 2MTAH 2B5NA 5TEFA 3K26A 1XKSA 3OKYB 4X63B 4J77A 2OK4A 3OTTA 1PBYB 3FGBA 4CY1A 4CY3A 1MDAH 4MK0B 3CIKB 2CO0C 1JJUB 3I89A 2H9PA 2AH1A 2IUVA 2CE8A 2BBKH 3DM0A 1GP2B 5EMMB 3KRXB 5SXMA 4A11B 4J79A 3EWEA 2IURA 2P9NC 3SXTD 2XU7A 5H1MA 4AEZA 2BCJB 4K3ID 2I3SA 3C99A 3GFCA 2J56H 3F3FA 3I7NA 4E5ZB 3HFQA 2OK6A 4AOWA 3OL2A 3EI3B 3PXSD 1SQ9A 4GM9A 2IWKA 2TRCB 3IJ1A 3I7OA 5C2VB 3C9CA 4CI1A 4H5IA 3BG0A 5EALA 5EAMA 5AFU3 5I5IA 2O9KA 3EI2B 2H6QA 4CI8A 4L3HD 4PBYA 2Z2PA 5CXBA 3NVXA 2OVPB 2Z2NA 4A0AA 4G56B 3RSEC 5IC7A 4D0KA 2AQ5A 4ZOXA 3RRMC 2HESX 3J80g 4JSXC 2YNNA 4JT6C 5GXHA 4XYHA 4CZXA 4L3GD 2P9UC 1GG2B 2OVRB 4JSVC 4A2LA 3MKQA 2PBIB 4NSXA 1XHMA 1U2VC 2GC4A 3AL9A 2GNQA 1PEVA 3VGZA 5FLXg 5B4WA 5IGOA 4JD2C 4JXMA 4CZVA 5GMKn 3AH8B 3MZLA 4IA9A 2PM6B 3SFZA 4Z8LA 5HE3B 4PSWB 3BG1A 2QXVA 2CO0A 4GMBA 3RN0D 3PXWD 4A7JA 3SBPA 4UI9R 2AGWA 4KFMB 1TYQC 3B7FA 3IJCA 5HQGA 2UZXB 2HXCA 4LG8A 5FXYA 4J8BA 3UVLA 2P9SC 3SBQA 4J82A 1MG2A 2I0TA 4Y5RD 2PM9A 4R7AB 4O3TB 3UVKA 5H14A 1JOFA 4A2MA 4E54B 3VA6A 4OWRA 3U4YA 4A0BA 3C75H 4L9OA 4J87A 4OZUA 2YMUA 1K32A 3I8EA 4ERYA 2H68A 1OLZA 2P9IC 3IIWA 2UZYB 1B9XA 3E0CA 1VYHC 4PSXB 3RFHA 3I8CA 1FWXA 4CI2A 5CXCB 5TEEA 5AJAA 4FHLA 4X60B 5EMJB 3ZWLB 3V5WB 3UR4A 2YNPA 3N0DA 2H9NA 1SQJA 3C5MA 5EM2A 4J8GA 3V7DB 2HKMA 3EI1A 3BWSA 3RMZD 4FA4D 1Q47A 5H17A 4ERZA 3UVMA
chains in the Genus database with same CATH superfamily
1MG3A 2J57G 3DWLC 3AL8B 5E6RA 3OKTA 4GGAA 4NBMA 2AGXA 3DXKC 1H2XA 5CYKB 3AFCA 4AN1A 3I2NA 4I79A 1A0RB 4A09A 1M1XA 4CY5A 1TYEA 4ERQA 4ES0A 4FA9D 5HE2B 2HJ4A 3IULA 4J81A 3V4PA 5I5MA 3JAMg 3GREA 3MMYA 1YFQA 5KDOB 2I0SA 4A08A 5M5RA 3SCYA 1O6GA 2IWFA 3NIGA 1UOPA 3K27A 3ZE1A 3J81g 3SVWD 4QRJA 3RLMD 4QL1A 5IGQA 3RN1D 3OKYA 3A0FA 4JSNC 1NR0A 2I0RA 2EIBA 3EQ8A 5A2Qg 1L0QA 4RE6A 2AGZA 4E54A 3FM0A 3NVNA 4J0WA 4JHNA 1JMXB 4YVDA 3NVQA 4GGDA 3I7HA 4JSPC 4CY2A 4Y7RA 4BL0A 5EMLB 3NIDA 4GZ8A 3T3PA 1L5GA 2IUPA 4A11A 3ZDYA 3OKWA 4G55A 5GSAA 2GC7A 4JHPC 3JZGA 4U7AA 3PSLA 4LG9A 2P9LC 3FCUA 2IAAA 2JKXA 1A12A 2VDMA 2B5MA 4J0XA 3OL2B 3V9FA 5C2WB 5I5JA 5M5UA 4X3EA 4E5ZA 1N6FA 4HDJA 2OIZA 3EI3A 2G9AA 4PBZA 3SN6B 5FFGA 4CI3A 3DDUA 3UVOA 4FWWA 2P9KC 5JWZA 4XEIC 1NEXB 4QQEA 2P9PC 2VDQA 4IMMA 4N14A 4EWRA 3JZNA 2HU5A 3K71A 4ZOZA 2XYIA 5IJ7E 5EMKB 4O3UB 1QFSA 1XIPA 3JROA 2I3TA 3CFSB 4PXWA 5EAPA 3EG6A 3ZE0A 2H6NA 4GQ2P 4ESGA 4FAND 4Z7NA 4FAVD 4Z7OA 3SMRA 4O2WA 5HDBA 2H14A 3EI2A 2YB8B 5IJ8E 3I7KA 4J73A 2HU7A 5IT9g 4GQ1A 4ZOVA 2H9LA 4A0AB 2G99A 1H2YA 1VZ2A 4BH6A 5EARA 4ZN4A 5HE0B 2EBSA 3F3PA 4O1QD 1GOFA 2HJBA 4L1QD 4WK4A 3IUQA 3UKUC 5AMSA 4O45A 2IUQA 3IUJA 1U8CA 3I7PA 3OW8A 5GXIA 5HYNB 2CNXA 1QNIA 1S4UX 3JZHA 1N6DA 5C9ZB 4ZOYA 4WK2A 1O6FA 3VH0A 3DSMA 3EI4B 2Z2OA 3JRPA 4GM3A 3UKRC 4XYIA 5M5TA 4BP8A 2OVQB 4U1EI 5HE1B 2Q7QA 3RFGA 3ORVD 5FKSA 1C9LA 1JMZB 4L1MA 4X61B 3UVNA 3SBRA 3IVMA 1E8NA 2QR5A 4Z7QA 2XL3A 3ZE2A 3I7LA 1K8KC 4LGNA 2XL2A 3IIYA 2AH0A 2OJYA 3CFVA 1SHYB 2EIDA 3IJEA 3JPXA 3W15A 3MZKA 5TF2A 3PXTD 2CE9A 3EU7A 3VI3A 5K1CC 3IKOA 4CC9A 4G1MA 5FKQA 3IUNA 4J84A 5FQDA 1K3IA 4PNKB 2PM9B 5FA5B 3ULEC 3P4FA 2W18A 2B5LA 3L4MD 4H5JA 1PGUA 1GXRA 4FA5D 3OF7A 1TBGA 3PE7A 1OMWB 4CZYA 5C92A 2AGYA 2YNOA 3KRWB 3K6SA 4A0BB 4FB1D 3PVUB 1GOHA 4GQBB 3SHFA 3IJ0A 2PM7B 2VZ3A 4BUJC 1RI6A 3PVWB 3QHYB 2B4EA 2QC5A 2AGLA 1B9YA 3PSCB 1ERJA 1R5MA 4RE5A 5FKTA 3ODTA 3EQ9A 3N0EA 4TZ4A 4UM8A 2H13A 2J55H 2VDNA 4WJKA 4JT5C 2HYEA 3SLED 5TDHB 2XZGA 4QT8A 3FCSA 1GOTB 5CXCA 2H3XA 5FKRA 3EMHA 2H9MA 3EI4A 3GD1I 5EM2B 3SWSD 3EI1B 2XDWA 2H47A 5K19A 4J78A 1P22A 5C86A 4BCCA 2HKRA 3MXXA 3GC3B 3L4OD 3O4HA 3EQ7A 4O9DA 5M5VA 2H6KA 2YBAA 3MVDK 3JB9L 3MKSB 3SJLD 2CN2A 3FRXA 1JTDB 3AL8A 4K3JB 4A09B 2CN3A 5CXBB 1C9IA 4GGCA 4D6VA 3QI0A 4NENA 3DXMC 1N6EA 5CYKA 4FA1D 3MUNA 4BP9A 1PI6A 3F3GA 4PC0A 4AMZA 1U4CA 4J86A 4GM8A 2VDKA 4A08B 2EICA 5THAA 2MTAH 1BPOA 3NIFA 2B5NA 5TEFA 3K26A 1XKSA 3OKYB 4X63B 3VI4A 4J77A 2OK4A 3OTTA 1PBYB 3FGBA 4CY1A 4CY3A 2VC2A 1YR2A 1MDAH 2BKLA 4MK0B 3CIKB 2CO0C 4WK0A 1JJUB 3I89A 2H9PA 2AH1A 3K72A 2IUVA 2QZPA 2CE8A 2BBKH 2VDPA 3DM0A 3MUOA 1GP2B 5EMMB 3KRXB 5SXMA 4A11B 4J79A 3EWEA 2IURA 2P9NC 4QAMA 4DNUA 3SXTD 2XU7A 5H1MA 4AEZA 5E6SA 2BCJB 3O4GA 4K3ID 2I3SA 3C99A 3GFCA 2J56H 3F3FA 3I7NA 3T3MA 1UOOA 3IUMA 4NAAA 3HFQA 4NC4A 4E5ZB 1H2ZA 2OK6A 2XE4A 4AOWA 3OL2A 3EI3B 3PXSD 3ZDXA 1SQ9A 4GM9A 2IWKA 1JV2A 2TRCB 3IJ1A 3I7OA 5C2VB 3C9CA 4CI1A 4H5IA 3BG0A 5EALA 4D9SA 5EAMA 2WQ8A 1VZ3A 2VDLA 5AFU3 5M5SA 5I5IA 2O9KA 3EI2B 2H6QA 4CI8A 4L3HD 4PBYA 3ZDZA 2Z2PA 5CXBA 3NVXA 2OVPB 2Z2NA 4A0AA 4G56B 3RSEC 4MMXA 5IC7A 4D0KA 2AQ5A 1E8MA 3O4IA 4ZOXA 3RRMC 2HESX 3J80g 4JSXC 2HU8A 2YNNA 4JT6C 5GXHA 4XYHA 4CZXA 4UM9A 4L3GD 3O4JA 2P9UC 1GG2B 2OVRB 4JSVC 4A2LA 3MKQA 2PBIB 4NSXA 1XHMA 1U2VC 2GC4A 3AL9A 5FFOA 2GNQA 1PEVA 3VGZA 5FLXg 5B4WA 5IGOA 4JD2C 4JXMA 4CZVA 5GMKn 3AH8B 4MMZA 3MZLA 4IA9A 2PM6B 3SFZA 4Z8LA 5HE3B 4PSWB 3BG1A 2QXVA 2CO0A 5E6UA 4GMBA 1T2XA 3RN0D 3PXWD 4A7JA 3SBPA 4UI9R 2AGWA 1H2WA 4KFMB 1TYQC 3B7FA 3IJCA 5HQGA 4MMYA 2UZXB 2HXCA 4LG8A 5FXYA 4J8BA 1I2MB 3UVLA 2P9SC 3SBQA 4J82A 1UTCA 1MG2A 2I0TA 4Y5RD 2PM9A 5M61A 3IURA 4G1EA 4R7AB 4O3TB 3UVKA 5H14A 1UOQA 1JOFA 4IRZA 4A2MA 4E54B 2VDOA 3VA6A 4OWRA 3U4YA 4A0BA 3C75H 4L9OA 4J87A 4OZUA 2YMUA 4AN0A 1K32A 3I8EA 4ERYA 2H68A 4BCBA 1OLZA 2EIEA 2P9IC 3IIWA 1E5TA 2UZYB 1B9XA 3E0CA 1VYHC 4PSXB 1VE7A 2VDRA 3RFHA 3I8CA 3V4VA 1FWXA 4AX4A 1VE6A 4CI2A 5CXCB 5TEEA 5AJAA 4BCDA 1GOGA 4FHLA 4X60B 5EMJB 3ZWLB 4AMYA 3V5WB 3UR4A 2YNPA 3N0DA 2H9NA 1SQJA 3C5MA 4O02A 5EM2A 4J8GA 3V7DB 4DNVA 2HKMA 3EI1A 3BWSA 3RMZD 2VZ1A 1QFMA 4FA4D 3KCIA 1Q47A 4DNWA 5H17A 4ERZA 3UVMA
chains in the Genus database with same CATH topology
1MG3A 2J57G 3DWLC 3AL8B 3OKTA 4GGAA 2AGXA 3DXKC 5CYKB 3AFCA 3I2NA 4I79A 1A0RB 4A09A 4CY5A 4ERQA 4ES0A 4FA9D 5HE2B 2HJ4A 4J81A 3JAMg 5I5MA 3GREA 3MMYA 1YFQA 5KDOB 2I0SA 4A08A 3SCYA 2IWFA 3K27A 3J81g 3SVWD 4QRJA 3RLMD 4QL1A 5IGQA 3RN1D 3OKYA 3A0FA 4JSNC 1NR0A 2I0RA 5A2Qg 1L0QA 2AGZA 4E54A 3FM0A 3NVNA 4J0WA 4YVDA 1JMXB 3NVQA 4GGDA 3I7HA 4JSPC 4CY2A 4Y7RA 4BL0A 5EMLB 4GZ8A 2IUPA 4A11A 3OKWA 5GSAA 2GC7A 3JZGA 4U7AA 3PSLA 4LG9A 2P9LC 2IAAA 2B5MA 4J0XA 3OL2B 3V9FA 5C2WB 5I5JA 4X3EA 4E5ZA 1N6FA 4HDJA 2OIZA 3EI3A 2G9AA 4PBZA 3SN6B 4CI3A 3UVOA 4FWWA 2P9KC 5JWZA 4XEIC 1NEXB 4QQEA 2P9PC 4IMMA 4N14A 4EWRA 3JZNA 4ZOZA 2XYIA 5IJ7E 5EMKB 4O3UB 1XIPA 3JROA 2I3TA 3CFSB 4PXWA 5EAPA 3EG6A 4FAND 2H6NA 4GQ2P 4ESGA 4FAVD 3SMRA 2H14A 3EI2A 2YB8B 5IJ8E 3I7KA 4J73A 5IT9g 4GQ1A 4ZOVA 2H9LA 4A0AB 2G99A 4BH6A 5EARA 4ZN4A 5HE0B 2EBSA 3F3PA 4O1QD 2HJBA 4L1QD 3UKUC 5AMSA 4O45A 2IUQA 3OW8A 3I7PA 5GXIA 5HYNB 2CNXA 1QNIA 1S4UX 3JZHA 1N6DA 5C9ZB 4ZOYA 3VH0A 3DSMA 3EI4B 2Z2OA 3JRPA 4GM3A 3UKRC 4XYIA 2OVQB 4U1EI 5HE1B 2Q7QA 3RFGA 3ORVD 5FKSA 1JMZB 3UVNA 4X61B 3SBRA 2XL3A 3I7LA 1K8KC 4LGNA 2XL2A 3IIYA 2AH0A 2OJYA 3CFVA 1SHYB 3JPXA 3W15A 3MZKA 5TF2A 3PXTD 2CE9A 3EU7A 5K1CC 3IKOA 4CC9A 5FKQA 4J84A 5FQDA 4PNKB 2PM9B 5FA5B 3ULEC 3P4FA 2W18A 2B5LA 3L4MD 4H5JA 1PGUA 1GXRA 4FA5D 1TBGA 3PE7A 1OMWB 4CZYA 4A0BB 2AGYA 2YNOA 3KRWB 4FB1D 3PVUB 4GQBB 3SHFA 3IJ0A 2PM7B 4BUJC 1RI6A 3PVWB 2B4EA 2QC5A 2AGLA 1B9YA 3PSCB 1ERJA 1R5MA 5FKTA 3ODTA 4TZ4A 3N0EA 2H13A 2J55H 4JT5C 2HYEA 3SLED 5TDHB 4QT8A 1GOTB 5CXCA 2H3XA 5FKRA 3EMHA 2H9MA 3EI4A 5EM2B 3SWSD 3EI1B 2H47A 5K19A 4J78A 1P22A 2HKRA 3MXXA 3L4OD 4O9DA 2H6KA 2YBAA 3JB9L 3MKSB 3SJLD 2CN2A 3FRXA 3AL8A 4K3JB 4A09B 2CN3A 5CXBB 4GGCA 4D6VA 3DXMC 1N6EA 5CYKA 4FA1D 1PI6A 3F3GA 4PC0A 1U4CA 4J86A 4GM8A 4A08B 5THAA 2MTAH 2B5NA 5TEFA 3K26A 1XKSA 3OKYB 4X63B 4J77A 2OK4A 3OTTA 1PBYB 3FGBA 4CY1A 4CY3A 1MDAH 4MK0B 3CIKB 2CO0C 1JJUB 3I89A 2H9PA 2AH1A 2IUVA 2CE8A 2BBKH 3DM0A 1GP2B 5EMMB 3KRXB 5SXMA 4A11B 4J79A 3EWEA 2IURA 2P9NC 3SXTD 2XU7A 5H1MA 4AEZA 2BCJB 4K3ID 2I3SA 3C99A 3GFCA 2J56H 3F3FA 3I7NA 4E5ZB 3HFQA 2OK6A 4AOWA 3OL2A 3EI3B 3PXSD 1SQ9A 4GM9A 2IWKA 2TRCB 3IJ1A 3I7OA 5C2VB 3C9CA 4CI1A 4H5IA 3BG0A 5EALA 5EAMA 5AFU3 5I5IA 2O9KA 3EI2B 2H6QA 4CI8A 4L3HD 4PBYA 2Z2PA 5CXBA 3NVXA 2OVPB 2Z2NA 4A0AA 4G56B 3RSEC 5IC7A 4D0KA 2AQ5A 4ZOXA 3RRMC 2HESX 3J80g 4JSXC 2YNNA 4JT6C 5GXHA 4XYHA 4CZXA 4L3GD 2P9UC 1GG2B 2OVRB 4JSVC 4A2LA 3MKQA 2PBIB 4NSXA 1XHMA 1U2VC 2GC4A 3AL9A 2GNQA 1PEVA 3VGZA 5FLXg 5B4WA 5IGOA 4JD2C 4JXMA 4CZVA 5GMKn 3AH8B 3MZLA 4IA9A 2PM6B 3SFZA 4Z8LA 5HE3B 4PSWB 3BG1A 2QXVA 2CO0A 4GMBA 3RN0D 3PXWD 4A7JA 3SBPA 4UI9R 2AGWA 4KFMB 1TYQC 3B7FA 3IJCA 5HQGA 2UZXB 2HXCA 4LG8A 5FXYA 4J8BA 3UVLA 2P9SC 3SBQA 4J82A 1MG2A 2I0TA 4Y5RD 2PM9A 4R7AB 4O3TB 3UVKA 5H14A 1JOFA 4A2MA 4E54B 3VA6A 4OWRA 3U4YA 4A0BA 3C75H 4L9OA 4J87A 4OZUA 2YMUA 1K32A 3I8EA 4ERYA 2H68A 1OLZA 2P9IC 3IIWA 2UZYB 1B9XA 3E0CA 1VYHC 4PSXB 3RFHA 3I8CA 1FWXA 4CI2A 5CXCB 5TEEA 5AJAA 4FHLA 4X60B 5EMJB 3ZWLB 3V5WB 3UR4A 2YNPA 3N0DA 2H9NA 1SQJA 3C5MA 5EM2A 4J8GA 3V7DB 2HKMA 3EI1A 3BWSA 3RMZD 4FA4D 1Q47A 5H17A 4ERZA 3UVMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MG3 A;  2J57 G;  3DWL C;  3AL8 B;  3OKT A;  4GGA A;  2AGX A;  3DXK C;  5CYK B;  3AFC A;  3I2N A;  4I79 A;  1A0R B;  4A09 A;  4CY5 A;  4ERQ A;  4ES0 A;  4FA9 D;  5HE2 B;  2HJ4 A;  4J81 A;  3JAM g;  5I5M A;  3GRE A;  3MMY A;  1YFQ A;  5KDO B;  2I0S A;  4A08 A;  3SCY A;  2IWF A;  3K27 A;  3J81 g;  3SVW D;  4QRJ A;  3RLM D;  4QL1 A;  5IGQ A;  3RN1 D;  3OKY A;  3A0F A;  4JSN C;  1NR0 A;  2I0R A;  5A2Q g;  1L0Q A;  2AGZ A;  4E54 A;  3FM0 A;  3NVN A;  4J0W A;  4YVD A;  1JMX B;  3NVQ A;  4GGD A;  3I7H A;  4JSP C;  4CY2 A;  4Y7R A;  4BL0 A;  5EML B;  4GZ8 A;  2IUP A;  4A11 A;  3OKW A;  5GSA A;  2GC7 A;  3JZG A;  4U7A A;  3PSL A;  4LG9 A;  2P9L C;  2IAA A;  2B5M A;  4J0X A;  3OL2 B;  3V9F A;  5C2W B;  5I5J A;  4X3E A;  4E5Z A;  1N6F A;  4HDJ A;  2OIZ A;  3EI3 A;  2G9A A;  4PBZ A;  3SN6 B;  4CI3 A;  3UVO A;  4FWW A;  2P9K C;  5JWZ A;  4XEI C;  1NEX B;  4QQE A;  2P9P C;  4IMM A;  4N14 A;  4EWR A;  3JZN A;  4ZOZ A;  2XYI A;  5IJ7 E;  5EMK B;  4O3U B;  1XIP A;  3JRO A;  2I3T A;  3CFS B;  4PXW A;  5EAP A;  3EG6 A;  4FAN D;  2H6N A;  4GQ2 P;  4ESG A;  4FAV D;  3SMR A;  2H14 A;  3EI2 A;  2YB8 B;  5IJ8 E;  3I7K A;  4J73 A;  5IT9 g;  4GQ1 A;  4ZOV A;  2H9L A;  4A0A B;  2G99 A;  4BH6 A;  5EAR A;  4ZN4 A;  5HE0 B;  2EBS A;  3F3P A;  4O1Q D;  2HJB A;  4L1Q D;  3UKU C;  5AMS A;  4O45 A;  2IUQ A;  3OW8 A;  3I7P A;  5GXI A;  5HYN B;  2CNX A;  1QNI A;  1S4U X;  3JZH A;  1N6D A;  5C9Z B;  4ZOY A;  3VH0 A;  3DSM A;  3EI4 B;  2Z2O A;  3JRP A;  4GM3 A;  3UKR C;  4XYI A;  2OVQ B;  4U1E I;  5HE1 B;  2Q7Q A;  3RFG A;  3ORV D;  5FKS A;  1JMZ B;  3UVN A;  4X61 B;  3SBR A;  2XL3 A;  3I7L A;  1K8K C;  4LGN A;  2XL2 A;  3IIY A;  2AH0 A;  2OJY A;  3CFV A;  1SHY B;  3JPX A;  3W15 A;  3MZK A;  5TF2 A;  3PXT D;  2CE9 A;  3EU7 A;  5K1C C;  3IKO A;  4CC9 A;  5FKQ A;  4J84 A;  5FQD A;  4PNK B;  2PM9 B;  5FA5 B;  3ULE C;  3P4F A;  2W18 A;  2B5L A;  3L4M D;  4H5J A;  1PGU A;  1GXR A;  4FA5 D;  1TBG A;  3PE7 A;  1OMW B;  4CZY A;  4A0B B;  2AGY A;  2YNO A;  3KRW B;  4FB1 D;  3PVU B;  4GQB B;  3SHF A;  3IJ0 A;  2PM7 B;  4BUJ C;  1RI6 A;  3PVW B;  2B4E A;  2QC5 A;  2AGL A;  1B9Y A;  3PSC B;  1ERJ A;  1R5M A;  5FKT A;  3ODT A;  4TZ4 A;  3N0E A;  2H13 A;  2J55 H;  4JT5 C;  2HYE A;  3SLE D;  5TDH B;  4QT8 A;  1GOT B;  5CXC A;  2H3X A;  5FKR A;  3EMH A;  2H9M A;  3EI4 A;  5EM2 B;  3SWS D;  3EI1 B;  2H47 A;  5K19 A;  4J78 A;  1P22 A;  2HKR A;  3MXX A;  3L4O D;  4O9D A;  2H6K A;  2YBA A;  3JB9 L;  3MKS B;  3SJL D;  2CN2 A;  3FRX A;  3AL8 A;  4K3J B;  4A09 B;  2CN3 A;  5CXB B;  4GGC A;  4D6V A;  3DXM C;  1N6E A;  5CYK A;  4FA1 D;  1PI6 A;  3F3G A;  4PC0 A;  1U4C A;  4J86 A;  4GM8 A;  4A08 B;  5THA A;  2MTA H;  2B5N A;  5TEF A;  3K26 A;  1XKS A;  3OKY B;  4X63 B;  4J77 A;  2OK4 A;  3OTT A;  1PBY B;  3FGB A;  4CY1 A;  4CY3 A;  1MDA H;  4MK0 B;  3CIK B;  2CO0 C;  1JJU B;  3I89 A;  2H9P A;  2AH1 A;  2IUV A;  2CE8 A;  2BBK H;  3DM0 A;  1GP2 B;  5EMM B;  3KRX B;  5SXM A;  4A11 B;  4J79 A;  3EWE A;  2IUR A;  2P9N C;  3SXT D;  2XU7 A;  5H1M A;  4AEZ A;  2BCJ B;  4K3I D;  2I3S A;  3C99 A;  3GFC A;  2J56 H;  3F3F A;  3I7N A;  4E5Z B;  3HFQ A;  2OK6 A;  4AOW A;  3OL2 A;  3EI3 B;  3PXS D;  1SQ9 A;  4GM9 A;  2IWK A;  2TRC B;  3IJ1 A;  3I7O A;  5C2V B;  3C9C A;  4CI1 A;  4H5I A;  3BG0 A;  5EAL A;  5EAM A;  5AFU 3;  5I5I A;  2O9K A;  3EI2 B;  2H6Q A;  4CI8 A;  4L3H D;  4PBY A;  2Z2P A;  5CXB A;  3NVX A;  2OVP B;  2Z2N A;  4A0A A;  4G56 B;  3RSE C;  5IC7 A;  4D0K A;  2AQ5 A;  4ZOX A;  3RRM C;  2HES X;  3J80 g;  4JSX C;  2YNN A;  4JT6 C;  5GXH A;  4XYH A;  4CZX A;  4L3G D;  2P9U C;  1GG2 B;  2OVR B;  4JSV C;  4A2L A;  3MKQ A;  2PBI B;  4NSX A;  1XHM A;  1U2V C;  2GC4 A;  3AL9 A;  2GNQ A;  1PEV A;  3VGZ A;  5FLX g;  5B4W A;  5IGO A;  4JD2 C;  4JXM A;  4CZV A;  5GMK n;  3AH8 B;  3MZL A;  4IA9 A;  2PM6 B;  3SFZ A;  4Z8L A;  5HE3 B;  4PSW B;  3BG1 A;  2QXV A;  2CO0 A;  4GMB A;  3RN0 D;  3PXW D;  4A7J A;  3SBP A;  4UI9 R;  2AGW A;  4KFM B;  1TYQ C;  3B7F A;  3IJC A;  5HQG A;  2UZX B;  2HXC A;  4LG8 A;  5FXY A;  4J8B A;  3UVL A;  2P9S C;  3SBQ A;  4J82 A;  1MG2 A;  2I0T A;  4Y5R D;  2PM9 A;  4R7A B;  4O3T B;  3UVK A;  5H14 A;  1JOF A;  4A2M A;  4E54 B;  3VA6 A;  4OWR A;  3U4Y A;  4A0B A;  3C75 H;  4L9O A;  4J87 A;  4OZU A;  2YMU A;  1K32 A;  3I8E A;  4ERY A;  2H68 A;  1OLZ A;  2P9I C;  3IIW A;  2UZY B;  1B9X A;  3E0C A;  1VYH C;  4PSX B;  3RFH A;  3I8C A;  1FWX A;  4CI2 A;  5CXC B;  5TEE A;  5AJA A;  4FHL A;  4X60 B;  5EMJ B;  3ZWL B;  3V5W B;  3UR4 A;  2YNP A;  3N0D A;  2H9N A;  1SQJ A;  3C5M A;  5EM2 A;  4J8G A;  3V7D B;  2HKM A;  3EI1 A;  3BWS A;  3RMZ D;  4FA4 D;  1Q47 A;  5H17 A;  4ERZ A;  3UVM A; 
#chains in the Genus database with same CATH topology
 1MG3 A;  2J57 G;  3DWL C;  3AL8 B;  5E6R A;  3OKT A;  4GGA A;  4NBM A;  2AGX A;  3DXK C;  1H2X A;  5CYK B;  3AFC A;  4AN1 A;  3I2N A;  4I79 A;  1A0R B;  4A09 A;  1M1X A;  4CY5 A;  1TYE A;  4ERQ A;  4ES0 A;  4FA9 D;  5HE2 B;  2HJ4 A;  3IUL A;  4J81 A;  3V4P A;  5I5M A;  3JAM g;  3GRE A;  3MMY A;  1YFQ A;  5KDO B;  2I0S A;  4A08 A;  5M5R A;  3SCY A;  1O6G A;  2IWF A;  3NIG A;  1UOP A;  3K27 A;  3ZE1 A;  3J81 g;  3SVW D;  4QRJ A;  3RLM D;  4QL1 A;  5IGQ A;  3RN1 D;  3OKY A;  3A0F A;  4JSN C;  1NR0 A;  2I0R A;  2EIB A;  3EQ8 A;  5A2Q g;  1L0Q A;  4RE6 A;  2AGZ A;  4E54 A;  3FM0 A;  3NVN A;  4J0W A;  4JHN A;  1JMX B;  4YVD A;  3NVQ A;  4GGD A;  3I7H A;  4JSP C;  4CY2 A;  4Y7R A;  4BL0 A;  5EML B;  3NID A;  4GZ8 A;  3T3P A;  1L5G A;  2IUP A;  4A11 A;  3ZDY A;  3OKW A;  4G55 A;  5GSA A;  2GC7 A;  4JHP C;  3JZG A;  4U7A A;  3PSL A;  4LG9 A;  2P9L C;  3FCU A;  2IAA A;  2JKX A;  1A12 A;  2VDM A;  2B5M A;  4J0X A;  3OL2 B;  3V9F A;  5C2W B;  5I5J A;  5M5U A;  4X3E A;  4E5Z A;  1N6F A;  4HDJ A;  2OIZ A;  3EI3 A;  2G9A A;  4PBZ A;  3SN6 B;  5FFG A;  4CI3 A;  3DDU A;  3UVO A;  4FWW A;  2P9K C;  5JWZ A;  4XEI C;  1NEX B;  4QQE A;  2P9P C;  2VDQ A;  4IMM A;  4N14 A;  4EWR A;  3JZN A;  2HU5 A;  3K71 A;  4ZOZ A;  2XYI A;  5IJ7 E;  5EMK B;  4O3U B;  1QFS A;  1XIP A;  3JRO A;  2I3T A;  3CFS B;  4PXW A;  5EAP A;  3EG6 A;  3ZE0 A;  2H6N A;  4GQ2 P;  4ESG A;  4FAN D;  4Z7N A;  4FAV D;  4Z7O A;  3SMR A;  4O2W A;  5HDB A;  2H14 A;  3EI2 A;  2YB8 B;  5IJ8 E;  3I7K A;  4J73 A;  2HU7 A;  5IT9 g;  4GQ1 A;  4ZOV A;  2H9L A;  4A0A B;  2G99 A;  1H2Y A;  1VZ2 A;  4BH6 A;  5EAR A;  4ZN4 A;  5HE0 B;  2EBS A;  3F3P A;  4O1Q D;  1GOF A;  2HJB A;  4L1Q D;  4WK4 A;  3IUQ A;  3UKU C;  5AMS A;  4O45 A;  2IUQ A;  3IUJ A;  1U8C A;  3I7P A;  3OW8 A;  5GXI A;  5HYN B;  2CNX A;  1QNI A;  1S4U X;  3JZH A;  1N6D A;  5C9Z B;  4ZOY A;  4WK2 A;  1O6F A;  3VH0 A;  3DSM A;  3EI4 B;  2Z2O A;  3JRP A;  4GM3 A;  3UKR C;  4XYI A;  5M5T A;  4BP8 A;  2OVQ B;  4U1E I;  5HE1 B;  2Q7Q A;  3RFG A;  3ORV D;  5FKS A;  1C9L A;  1JMZ B;  4L1M A;  4X61 B;  3UVN A;  3SBR A;  3IVM A;  1E8N A;  2QR5 A;  4Z7Q A;  2XL3 A;  3ZE2 A;  3I7L A;  1K8K C;  4LGN A;  2XL2 A;  3IIY A;  2AH0 A;  2OJY A;  3CFV A;  1SHY B;  2EID A;  3IJE A;  3JPX A;  3W15 A;  3MZK A;  5TF2 A;  3PXT D;  2CE9 A;  3EU7 A;  3VI3 A;  5K1C C;  3IKO A;  4CC9 A;  4G1M A;  5FKQ A;  3IUN A;  4J84 A;  5FQD A;  1K3I A;  4PNK B;  2PM9 B;  5FA5 B;  3ULE C;  3P4F A;  2W18 A;  2B5L A;  3L4M D;  4H5J A;  1PGU A;  1GXR A;  4FA5 D;  3OF7 A;  1TBG A;  3PE7 A;  1OMW B;  4CZY A;  5C92 A;  2AGY A;  2YNO A;  3KRW B;  3K6S A;  4A0B B;  4FB1 D;  3PVU B;  1GOH A;  4GQB B;  3SHF A;  3IJ0 A;  2PM7 B;  2VZ3 A;  4BUJ C;  1RI6 A;  3PVW B;  3QHY B;  2B4E A;  2QC5 A;  2AGL A;  1B9Y A;  3PSC B;  1ERJ A;  1R5M A;  4RE5 A;  5FKT A;  3ODT A;  3EQ9 A;  3N0E A;  4TZ4 A;  4UM8 A;  2H13 A;  2J55 H;  2VDN A;  4WJK A;  4JT5 C;  2HYE A;  3SLE D;  5TDH B;  2XZG A;  4QT8 A;  3FCS A;  1GOT B;  5CXC A;  2H3X A;  5FKR A;  3EMH A;  2H9M A;  3EI4 A;  3GD1 I;  5EM2 B;  3SWS D;  3EI1 B;  2XDW A;  2H47 A;  5K19 A;  4J78 A;  1P22 A;  5C86 A;  4BCC A;  2HKR A;  3MXX A;  3GC3 B;  3L4O D;  3O4H A;  3EQ7 A;  4O9D A;  5M5V A;  2H6K A;  2YBA A;  3MVD K;  3JB9 L;  3MKS B;  3SJL D;  2CN2 A;  3FRX A;  1JTD B;  3AL8 A;  4K3J B;  4A09 B;  2CN3 A;  5CXB B;  1C9I A;  4GGC A;  4D6V A;  3QI0 A;  4NEN A;  3DXM C;  1N6E A;  5CYK A;  4FA1 D;  3MUN A;  4BP9 A;  1PI6 A;  3F3G A;  4PC0 A;  4AMZ A;  1U4C A;  4J86 A;  4GM8 A;  2VDK A;  4A08 B;  2EIC A;  5THA A;  2MTA H;  1BPO A;  3NIF A;  2B5N A;  5TEF A;  3K26 A;  1XKS A;  3OKY B;  4X63 B;  3VI4 A;  4J77 A;  2OK4 A;  3OTT A;  1PBY B;  3FGB A;  4CY1 A;  4CY3 A;  2VC2 A;  1YR2 A;  1MDA H;  2BKL A;  4MK0 B;  3CIK B;  2CO0 C;  4WK0 A;  1JJU B;  3I89 A;  2H9P A;  2AH1 A;  3K72 A;  2IUV A;  2QZP A;  2CE8 A;  2BBK H;  2VDP A;  3DM0 A;  3MUO A;  1GP2 B;  5EMM B;  3KRX B;  5SXM A;  4A11 B;  4J79 A;  3EWE A;  2IUR A;  2P9N C;  4QAM A;  4DNU A;  3SXT D;  2XU7 A;  5H1M A;  4AEZ A;  5E6S A;  2BCJ B;  3O4G A;  4K3I D;  2I3S A;  3C99 A;  3GFC A;  2J56 H;  3F3F A;  3I7N A;  3T3M A;  1UOO A;  3IUM A;  4NAA A;  3HFQ A;  4NC4 A;  4E5Z B;  1H2Z A;  2OK6 A;  2XE4 A;  4AOW A;  3OL2 A;  3EI3 B;  3PXS D;  3ZDX A;  1SQ9 A;  4GM9 A;  2IWK A;  1JV2 A;  2TRC B;  3IJ1 A;  3I7O A;  5C2V B;  3C9C A;  4CI1 A;  4H5I A;  3BG0 A;  5EAL A;  4D9S A;  5EAM A;  2WQ8 A;  1VZ3 A;  2VDL A;  5AFU 3;  5M5S A;  5I5I A;  2O9K A;  3EI2 B;  2H6Q A;  4CI8 A;  4L3H D;  4PBY A;  3ZDZ A;  2Z2P A;  5CXB A;  3NVX A;  2OVP B;  2Z2N A;  4A0A A;  4G56 B;  3RSE C;  4MMX A;  5IC7 A;  4D0K A;  2AQ5 A;  1E8M A;  3O4I A;  4ZOX A;  3RRM C;  2HES X;  3J80 g;  4JSX C;  2HU8 A;  2YNN A;  4JT6 C;  5GXH A;  4XYH A;  4CZX A;  4UM9 A;  4L3G D;  3O4J A;  2P9U C;  1GG2 B;  2OVR B;  4JSV C;  4A2L A;  3MKQ A;  2PBI B;  4NSX A;  1XHM A;  1U2V C;  2GC4 A;  3AL9 A;  5FFO A;  2GNQ A;  1PEV A;  3VGZ A;  5FLX g;  5B4W A;  5IGO A;  4JD2 C;  4JXM A;  4CZV A;  5GMK n;  3AH8 B;  4MMZ A;  3MZL A;  4IA9 A;  2PM6 B;  3SFZ A;  4Z8L A;  5HE3 B;  4PSW B;  3BG1 A;  2QXV A;  2CO0 A;  5E6U A;  4GMB A;  1T2X A;  3RN0 D;  3PXW D;  4A7J A;  3SBP A;  4UI9 R;  2AGW A;  1H2W A;  4KFM B;  1TYQ C;  3B7F A;  3IJC A;  5HQG A;  4MMY A;  2UZX B;  2HXC A;  4LG8 A;  5FXY A;  4J8B A;  1I2M B;  3UVL A;  2P9S C;  3SBQ A;  4J82 A;  1UTC A;  1MG2 A;  2I0T A;  4Y5R D;  2PM9 A;  5M61 A;  3IUR A;  4G1E A;  4R7A B;  4O3T B;  3UVK A;  5H14 A;  1UOQ A;  1JOF A;  4IRZ A;  4A2M A;  4E54 B;  2VDO A;  3VA6 A;  4OWR A;  3U4Y A;  4A0B A;  3C75 H;  4L9O A;  4J87 A;  4OZU A;  2YMU A;  4AN0 A;  1K32 A;  3I8E A;  4ERY A;  2H68 A;  4BCB A;  1OLZ A;  2EIE A;  2P9I C;  3IIW A;  1E5T A;  2UZY B;  1B9X A;  3E0C A;  1VYH C;  4PSX B;  1VE7 A;  2VDR A;  3RFH A;  3I8C A;  3V4V A;  1FWX A;  4AX4 A;  1VE6 A;  4CI2 A;  5CXC B;  5TEE A;  5AJA A;  4BCD A;  1GOG A;  4FHL A;  4X60 B;  5EMJ B;  3ZWL B;  4AMY A;  3V5W B;  3UR4 A;  2YNP A;  3N0D A;  2H9N A;  1SQJ A;  3C5M A;  4O02 A;  5EM2 A;  4J8G A;  3V7D B;  4DNV A;  2HKM A;  3EI1 A;  3BWS A;  3RMZ D;  2VZ1 A;  1QFM A;  4FA4 D;  3KCI A;  1Q47 A;  4DNW A;  5H17 A;  4ERZ A;  3UVM A; 
#chains in the Genus database with same CATH homology
 1MG3 A;  2J57 G;  3DWL C;  3AL8 B;  3OKT A;  4GGA A;  2AGX A;  3DXK C;  5CYK B;  3AFC A;  3I2N A;  4I79 A;  1A0R B;  4A09 A;  4CY5 A;  4ERQ A;  4ES0 A;  4FA9 D;  5HE2 B;  2HJ4 A;  4J81 A;  3JAM g;  5I5M A;  3GRE A;  3MMY A;  1YFQ A;  5KDO B;  2I0S A;  4A08 A;  3SCY A;  2IWF A;  3K27 A;  3J81 g;  3SVW D;  4QRJ A;  3RLM D;  4QL1 A;  5IGQ A;  3RN1 D;  3OKY A;  3A0F A;  4JSN C;  1NR0 A;  2I0R A;  5A2Q g;  1L0Q A;  2AGZ A;  4E54 A;  3FM0 A;  3NVN A;  4J0W A;  4YVD A;  1JMX B;  3NVQ A;  4GGD A;  3I7H A;  4JSP C;  4CY2 A;  4Y7R A;  4BL0 A;  5EML B;  4GZ8 A;  2IUP A;  4A11 A;  3OKW A;  5GSA A;  2GC7 A;  3JZG A;  4U7A A;  3PSL A;  4LG9 A;  2P9L C;  2IAA A;  2B5M A;  4J0X A;  3OL2 B;  3V9F A;  5C2W B;  5I5J A;  4X3E A;  4E5Z A;  1N6F A;  4HDJ A;  2OIZ A;  3EI3 A;  2G9A A;  4PBZ A;  3SN6 B;  4CI3 A;  3UVO A;  4FWW A;  2P9K C;  5JWZ A;  4XEI C;  1NEX B;  4QQE A;  2P9P C;  4IMM A;  4N14 A;  4EWR A;  3JZN A;  4ZOZ A;  2XYI A;  5IJ7 E;  5EMK B;  4O3U B;  1XIP A;  3JRO A;  2I3T A;  3CFS B;  4PXW A;  5EAP A;  3EG6 A;  4FAN D;  2H6N A;  4GQ2 P;  4ESG A;  4FAV D;  3SMR A;  2H14 A;  3EI2 A;  2YB8 B;  5IJ8 E;  3I7K A;  4J73 A;  5IT9 g;  4GQ1 A;  4ZOV A;  2H9L A;  4A0A B;  2G99 A;  4BH6 A;  5EAR A;  4ZN4 A;  5HE0 B;  2EBS A;  3F3P A;  4O1Q D;  2HJB A;  4L1Q D;  3UKU C;  5AMS A;  4O45 A;  2IUQ A;  3OW8 A;  3I7P A;  5GXI A;  5HYN B;  2CNX A;  1QNI A;  1S4U X;  3JZH A;  1N6D A;  5C9Z B;  4ZOY A;  3VH0 A;  3DSM A;  3EI4 B;  2Z2O A;  3JRP A;  4GM3 A;  3UKR C;  4XYI A;  2OVQ B;  4U1E I;  5HE1 B;  2Q7Q A;  3RFG A;  3ORV D;  5FKS A;  1JMZ B;  3UVN A;  4X61 B;  3SBR A;  2XL3 A;  3I7L A;  1K8K C;  4LGN A;  2XL2 A;  3IIY A;  2AH0 A;  2OJY A;  3CFV A;  1SHY B;  3JPX A;  3W15 A;  3MZK A;  5TF2 A;  3PXT D;  2CE9 A;  3EU7 A;  5K1C C;  3IKO A;  4CC9 A;  5FKQ A;  4J84 A;  5FQD A;  4PNK B;  2PM9 B;  5FA5 B;  3ULE C;  3P4F A;  2W18 A;  2B5L A;  3L4M D;  4H5J A;  1PGU A;  1GXR A;  4FA5 D;  1TBG A;  3PE7 A;  1OMW B;  4CZY A;  4A0B B;  2AGY A;  2YNO A;  3KRW B;  4FB1 D;  3PVU B;  4GQB B;  3SHF A;  3IJ0 A;  2PM7 B;  4BUJ C;  1RI6 A;  3PVW B;  2B4E A;  2QC5 A;  2AGL A;  1B9Y A;  3PSC B;  1ERJ A;  1R5M A;  5FKT A;  3ODT A;  4TZ4 A;  3N0E A;  2H13 A;  2J55 H;  4JT5 C;  2HYE A;  3SLE D;  5TDH B;  4QT8 A;  1GOT B;  5CXC A;  2H3X A;  5FKR A;  3EMH A;  2H9M A;  3EI4 A;  5EM2 B;  3SWS D;  3EI1 B;  2H47 A;  5K19 A;  4J78 A;  1P22 A;  2HKR A;  3MXX A;  3L4O D;  4O9D A;  2H6K A;  2YBA A;  3JB9 L;  3MKS B;  3SJL D;  2CN2 A;  3FRX A;  3AL8 A;  4K3J B;  4A09 B;  2CN3 A;  5CXB B;  4GGC A;  4D6V A;  3DXM C;  1N6E A;  5CYK A;  4FA1 D;  1PI6 A;  3F3G A;  4PC0 A;  1U4C A;  4J86 A;  4GM8 A;  4A08 B;  5THA A;  2MTA H;  2B5N A;  5TEF A;  3K26 A;  1XKS A;  3OKY B;  4X63 B;  4J77 A;  2OK4 A;  3OTT A;  1PBY B;  3FGB A;  4CY1 A;  4CY3 A;  1MDA H;  4MK0 B;  3CIK B;  2CO0 C;  1JJU B;  3I89 A;  2H9P A;  2AH1 A;  2IUV A;  2CE8 A;  2BBK H;  3DM0 A;  1GP2 B;  5EMM B;  3KRX B;  5SXM A;  4A11 B;  4J79 A;  3EWE A;  2IUR A;  2P9N C;  3SXT D;  2XU7 A;  5H1M A;  4AEZ A;  2BCJ B;  4K3I D;  2I3S A;  3C99 A;  3GFC A;  2J56 H;  3F3F A;  3I7N A;  4E5Z B;  3HFQ A;  2OK6 A;  4AOW A;  3OL2 A;  3EI3 B;  3PXS D;  1SQ9 A;  4GM9 A;  2IWK A;  2TRC B;  3IJ1 A;  3I7O A;  5C2V B;  3C9C A;  4CI1 A;  4H5I A;  3BG0 A;  5EAL A;  5EAM A;  5AFU 3;  5I5I A;  2O9K A;  3EI2 B;  2H6Q A;  4CI8 A;  4L3H D;  4PBY A;  2Z2P A;  5CXB A;  3NVX A;  2OVP B;  2Z2N A;  4A0A A;  4G56 B;  3RSE C;  5IC7 A;  4D0K A;  2AQ5 A;  4ZOX A;  3RRM C;  2HES X;  3J80 g;  4JSX C;  2YNN A;  4JT6 C;  5GXH A;  4XYH A;  4CZX A;  4L3G D;  2P9U C;  1GG2 B;  2OVR B;  4JSV C;  4A2L A;  3MKQ A;  2PBI B;  4NSX A;  1XHM A;  1U2V C;  2GC4 A;  3AL9 A;  2GNQ A;  1PEV A;  3VGZ A;  5FLX g;  5B4W A;  5IGO A;  4JD2 C;  4JXM A;  4CZV A;  5GMK n;  3AH8 B;  3MZL A;  4IA9 A;  2PM6 B;  3SFZ A;  4Z8L A;  5HE3 B;  4PSW B;  3BG1 A;  2QXV A;  2CO0 A;  4GMB A;  3RN0 D;  3PXW D;  4A7J A;  3SBP A;  4UI9 R;  2AGW A;  4KFM B;  1TYQ C;  3B7F A;  3IJC A;  5HQG A;  2UZX B;  2HXC A;  4LG8 A;  5FXY A;  4J8B A;  3UVL A;  2P9S C;  3SBQ A;  4J82 A;  1MG2 A;  2I0T A;  4Y5R D;  2PM9 A;  4R7A B;  4O3T B;  3UVK A;  5H14 A;  1JOF A;  4A2M A;  4E54 B;  3VA6 A;  4OWR A;  3U4Y A;  4A0B A;  3C75 H;  4L9O A;  4J87 A;  4OZU A;  2YMU A;  1K32 A;  3I8E A;  4ERY A;  2H68 A;  1OLZ A;  2P9I C;  3IIW A;  2UZY B;  1B9X A;  3E0C A;  1VYH C;  4PSX B;  3RFH A;  3I8C A;  1FWX A;  4CI2 A;  5CXC B;  5TEE A;  5AJA A;  4FHL A;  4X60 B;  5EMJ B;  3ZWL B;  3V5W B;  3UR4 A;  2YNP A;  3N0D A;  2H9N A;  1SQJ A;  3C5M A;  5EM2 A;  4J8G A;  3V7D B;  2HKM A;  3EI1 A;  3BWS A;  3RMZ D;  4FA4 D;  1Q47 A;  5H17 A;  4ERZ A;  3UVM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...