2H9PA

Wdr5 in complex with trimethylated h3k4 peptide
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
304
structure length
304
Chain Sequence
VKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIKIWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQSNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLIDDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, gene regulation
molecule keywords WD-repeat protein 5
publication title Structural basis for molecular recognition and presentation of histone H3 By WDR5.
pubmed doi rcsb
source organism Homo sapiens
total genus 104
structure length 304
sequence length 304
ec nomenclature
pdb deposition date 2006-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00400 WD40 WD domain, G-beta repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2h9pA00
5FKRA 5CYKA 2Z2PA 3EI1A 4L9OA 3NVXA 4X63B 4X60B 1N6DA 2G99A 5A2Qg 5I5JA 4U1EI 3PVWB 4GZ8A 4JXMA 4ZOVA 5FKTA 2H13A 4FAVD 5EAMA 4J77A 3PXSD 5IGQA 1JMZB 3JZGA 2Z2NA 3AFCA 4OWRA 3UVOA 1YFQA 5HYNB 2Q7QA 3RFHA 3V5WB 5I5IA 2IWFA 3FGBA 4FWWA 3PSLA 4CZXA 2HXCA 2CNXA 4PXWA 4BUJC 3NVNA 4A09B 3JB9L 4J0WA 3GFCA 3EMHA 2HKMA 1N6FA 2B5NA 4FAND 2OVPB 4CI2A 5TF2A 4JT6C 1XIPA 2P9SC 2P9LC 3RN1D 2YMUA 5EMKB 1Q47A 3K27A 4J78A 5TEEA 3RMZD 4A09A 2OK4A 4L3HD 2QC5A 3RLMD 2YNPA 3KRWB 3ORVD 5AJAA 4R7AB 4CY2A 3EU7A 2H9PA 2GC4A 2PBIB 2CO0A 3UKUC 2IUPA 5SXMA 1PGUA 5K19A 2O9KA 3IJ0A 5EARA 2H68A 3UVNA 3JZNA 2J57G 5CXCA 1SQ9A 2B5LA 1PEVA 4JSPC 1JOFA 4JSNC 2J56H 3SWSD 1N6EA 2CE9A 4JD2C 3IJ1A 2CN3A 3BWSA 3N0DA 3SBPA 3I7NA 3SHFA 3NVQA 3SVWD 3CIKB 3BG0A 3UR4A 5IJ8E 2G9AA 3RRMC 3N0EA 4EWRA 4A08B 3ODTA 1SQJA 3MZKA 4JSXC 3DWLC 4J0XA 3PSCB 1MG2A 2MTAH 3OL2B 3U4YA 2OVRB 1MG3A 2YB8B 3OKTA 3A0FA 2IWKA 3SBQA 3V9FA 4OZUA 5JWZA 4GGAA 3CFSB 3JROA 4A08A 4BH6A 3MMYA 2PM6B 4FB1D 3SJLD 3OL2A 3EI4B 4FA4D 4ERYA 3EI3B 3PXWD 4FHLA 4K3ID 3DSMA 3SCYA 2GC7A 1B9YA 2P9UC 4A2MA 3MZLA 2XL2A 1JJUB 4PBZA 2I0RA 3EI4A 4ZOXA 2B5MA 5H14A 3EI3A 5FQDA 4ZOYA 5FLXg 3AH8B 1PI6A 4NSXA 4FA5D 3F3FA 5I5MA 3EWEA 5C9ZB 4A0AB 1S4UX 1ERJA 3J81g 2AGXA 5CXBA 3DXMC 2AGWA 2PM9B 4PC0A 3VA6A 3IIWA 5EAPA 4HDJA 4A0AA 2TRCB 5GXHA 4ZN4A 3IJCA 4O45A 4QRJA 1JMXB 4FA1D 5EMJB 3KRXB 3OTTA 1RI6A 2B4EA 3SFZA 2IUVA 4J73A 4CI8A 2PM9A 2XL3A 2BCJB 3VH0A 3UVKA 4GM8A 3I8EA 5B4WA 5EMMB 1NEXB 1K8KC 4A7JA 3FRXA 2H3XA 4N14A 4BL0A 4J8GA 4D6VA 4ESGA 5CXCB 4J86A 4L3GD 4CZVA 2IURA 2H6QA 3C75H 4X3EA 3C5MA 5H17A 5KDOB 5GMKn 1NR0A 4QQEA 2PM7B 5HQGA 1R5MA 2H9LA 1GP2B 2UZXB 3PXTD 4CY3A 1TYQC 2H9NA 3I7HA 4E5ZB 3I89A 1A0RB 1XKSA 3AL8B 4A0BB 4CC9A 1VYHC 2IAAA 2P9PC 4Z8LA 2OIZA 4IMMA 2W18A 3JRPA 3I7LA 3OW8A 4GGCA 4PBYA 3DM0A 1GOTB 3I8CA 5K1CC 2H47A 3SMRA 4E5ZA 4CI1A 3ZWLB 4D0KA 3HFQA 3AL8A 3I7OA 2HJBA 4AOWA 4A0BA 2HJ4A 2AQ5A 1B9XA 3PE7A 3RSEC 3UVMA 2Z2OA 3GREA 4MK0B 4J81A 2I3TA 2HESX 4LG9A 2XYIA 5IT9g 2AGLA 4Y5RD 2XU7A 2AH0A 4A11B 1XHMA 2I0TA 5GSAA 3F3GA 5TDHB 3UVLA 4PSWB 2AH1A 4G56B 3V7DB 4CY1A 4CY5A 5HE2B 3W15A 4A11A 4LGNA 3RFGA 5CXBB 3VGZA 4H5JA 1OLZA 4CI3A 4GM9A 5GXIA 5FKQA 2I0SA 2IUQA 1OMWB 1SHYB 4TZ4A 4K3JB 5EMLB 4PSXB 2CE8A 3EI2B 3JPXA 4U7AA 5C2WB 1P22A 4A2LA 1U2VC 4J8BA 3I2NA 5HE1B 4UI9R 5AFU3 3J80g 4H5IA 3B7FA 3EI2A 4KFMB 4AEZA 3PVUB 3BG1A 4PNKB 4YVDA 3SBRA 3SLED 3C9CA 3MKQA 3CFVA 2HYEA 4O1QD 5H1MA 3RN0D 3F3PA 3JAMg 2AGYA 3JZHA 4GQ1A 4J79A 3L4OD 2I3SA 4Y7RA 2QXVA 3I7PA 3SXTD 1U4CA 1GG2B 2HKRA 5TEFA 5EM2B 2YNOA 4IA9A 2OVQB 5C2VB 2CO0C 2AGZA 3L4MD 2H9MA 4GQ2P 4O9DA 4ERQA 4QT8A 3IKOA 2GNQA 1MDAH 2J55H 2CN2A 1PBYB 4GM3A 2BBKH 4CZYA 5IJ7E 5EM2A 3IIYA 3E0CA 2OJYA 4J82A 1GXRA 2H6KA 3FM0A 3MXXA 4ERZA 5IGOA 3C99A 4O3UB 3MKSB 2YNNA 3EG6A 4I79A 4XYHA 4J84A 4E54B 4GGDA 3UKRC 2P9KC 4J87A 4XEIC 2EBSA 3OKYB 5IC7A 4X61B 2YBAA 2OK6A 4O3TB 4XYIA 5HE0B 4LG8A 5EALA 5FA5B 4E54A 3I7KA 3SN6B 2H6NA 2UZYB 4ZOZA 3AL9A 3OKWA 3OKYA 4GQBB 4JSVC 4ES0A 2P9NC 4JT5C 5AMSA 1K32A 3P4FA 1L0QA 5FKSA 1TBGA 5FXYA 3ULEC 3K26A 5CYKB 2P9IC 2H14A 4L1QD 4FA9D 5HE3B 3EI1B 4QL1A 3DXKC 1FWXA 1QNIA 4GMBA 5THAA
chains in the Genus database with same CATH superfamily
3NIFA 5FKRA 5CYKA 1H2YA 2Z2PA 3V4VA 4MMYA 5FFGA 3EI1A 4L9OA 3NVXA 4X63B 4X60B 1N6DA 2G99A 5A2Qg 5I5JA 4U1EI 3PVWB 4GZ8A 4JXMA 4ZOVA 1A12A 5FKTA 2H13A 4FAVD 5EAMA 4J77A 3PXSD 5IGQA 1JMZB 1C9IA 3IULA 3JZGA 2Z2NA 3AFCA 4OWRA 3O4GA 1YFQA 3UVOA 5HYNB 3O4IA 2Q7QA 3RFHA 3V5WB 5I5IA 2IWFA 3FGBA 4FWWA 3ZDYA 3PSLA 4CZXA 2HXCA 2CNXA 4PXWA 4BUJC 3NVNA 4A09B 3JB9L 1TYEA 4J0WA 3GFCA 3EMHA 2WQ8A 2HKMA 1N6FA 2B5NA 2VZ1A 4FAND 2OVPB 4CI2A 5TF2A 4JT6C 1UOQA 1XIPA 2P9SC 2P9LC 3RN1D 2YMUA 5EMKB 1Q47A 1H2WA 3K27A 4J78A 5TEEA 3RMZD 3MVDK 4A09A 2OK4A 4L3HD 2QC5A 2XE4A 3RLMD 2YNPA 3KRWB 3ORVD 5AJAA 4R7AB 4CY2A 5M5UA 4JHPC 3EU7A 2H9PA 2GC4A 2PBIB 2CO0A 3UKUC 2IUPA 1T2XA 5SXMA 1PGUA 3FCSA 4AMYA 5K19A 2O9KA 3NIGA 3IJ0A 5EARA 4QAMA 1UOPA 2H68A 3UVNA 3JZNA 2J57G 4NBMA 1SQ9A 2B5LA 5CXCA 4JHNA 1PEVA 2BKLA 4JSPC 1JOFA 4JSNC 2J56H 3SWSD 3O4HA 1N6EA 2CE9A 4JD2C 3IJ1A 2CN3A 3BWSA 3N0DA 3SBPA 3I7NA 2VDKA 3SHFA 3NVQA 3SVWD 3CIKB 3IUNA 3BG0A 3UR4A 5IJ8E 2G9AA 3RRMC 4Z7QA 3N0EA 4EWRA 4A08B 1YR2A 3ODTA 1SQJA 3IVMA 2VC2A 3MZKA 3DWLC 4J0XA 3PSCB 4JSXC 1MG2A 2MTAH 3OL2B 3EQ9A 3U4YA 2OVRB 1MG3A 2YB8B 3OKTA 4AX4A 3A0FA 2IWKA 3SBQA 3V9FA 4OZUA 4AN1A 5JWZA 4GGAA 3CFSB 3JROA 4A08A 4BH6A 3MMYA 3K71A 2PM6B 4FB1D 3SJLD 3OL2A 3EI4B 4RE5A 3K6SA 4FA4D 4ERYA 4RE6A 3EI3B 3PXWD 4FHLA 4K3ID 3DSMA 4BCBA 1GOFA 1QFSA 3SCYA 2GC7A 1B9YA 2P9UC 4A2MA 3V4PA 3MZLA 2XL2A 1JJUB 2HU5A 4PBZA 2I0RA 3EI4A 4ZOXA 4O2WA 2B5MA 5H14A 3EI3A 1U8CA 5HDBA 1VE7A 5FQDA 4ZOYA 2XDWA 5FLXg 3AH8B 1PI6A 4NSXA 4FA5D 3F3FA 5I5MA 3EWEA 5C9ZB 4A0AB 4BP8A 1S4UX 1ERJA 4DNUA 3J81g 2AGXA 5CXBA 3DXMC 1JTDB 2AGWA 2PM9B 5C86A 1VZ2A 4PC0A 3VA6A 1H2ZA 1E8NA 3IIWA 5EAPA 4HDJA 4A0AA 2TRCB 5GXHA 4ZN4A 3IJCA 4O45A 4QRJA 1JMXB 4G1EA 4FA1D 4WK4A 3EQ7A 5EMJB 3KRXB 3OTTA 1O6FA 1RI6A 2B4EA 3SFZA 2IUVA 4J73A 4CI8A 2PM9A 3VI4A 2XL3A 3K72A 2BCJB 3VH0A 3UVKA 4GM8A 3I8EA 5B4WA 5EMMB 2EIDA 2VDLA 2QR5A 3OF7A 1NEXB 1K8KC 4A7JA 3FRXA 2H3XA 4N14A 4BL0A 4J8GA 2VDNA 3VI3A 4D6VA 3IJEA 4ESGA 5CXCB 4J86A 4L3GD 5E6SA 4CZVA 2HU7A 3IUMA 2IURA 2H6QA 4O02A 1M1XA 3C75H 4X3EA 4BCCA 3C5MA 5H17A 5KDOB 5GMKn 1NR0A 4QQEA 2PM7B 5HQGA 1R5MA 2H9LA 1GP2B 2UZXB 1C9LA 3PXTD 4CY3A 1TYQC 2H9NA 3I7HA 3KCIA 4E5ZB 3I89A 1A0RB 2VDPA 1K3IA 1XKSA 3AL8B 4A0BB 4CC9A 1VYHC 2IAAA 2JKXA 2P9PC 4Z8LA 2OIZA 4IMMA 2W18A 3JRPA 3I7LA 3OW8A 4GGCA 4PBYA 5M5SA 2VDQA 3DM0A 1GOTB 3I8CA 5K1CC 2H47A 3SMRA 4E5ZA 4CI1A 3ZWLB 4D0KA 5E6UA 3HFQA 3AL8A 3I7OA 2HJBA 4AOWA 4A0BA 2HJ4A 3DDUA 2AQ5A 1B9XA 3PE7A 3RSEC 3UVMA 2Z2OA 3GREA 5M5VA 4MK0B 4J81A 4D9SA 2I3TA 4NC4A 2HESX 4LG9A 2XYIA 5IT9g 2AGLA 4Y5RD 1O6GA 1JV2A 2XU7A 2AH0A 4A11B 4DNWA 1XHMA 1QFMA 2I0TA 5GSAA 3EQ8A 3F3GA 5TDHB 3UVLA 3ZDXA 2VDRA 4PSWB 1VZ3A 2AH1A 4G56B 3V7DB 4CY1A 4CY5A 5HE2B 3W15A 4A11A 4LGNA 3RFGA 5CXBB 3VGZA 4H5JA 1OLZA 4CI3A 4GM9A 5GXIA 3NIDA 5FKQA 4WK0A 2I0SA 2IUQA 1OMWB 3IUQA 3IURA 1SHYB 4TZ4A 4K3JB 5EMLB 4PSXB 3MUNA 2CE8A 3EI2B 3JPXA 4U7AA 5C2WB 1P22A 4A2LA 1U2VC 2EIBA 4J8BA 4NAAA 3I2NA 5HE1B 4UI9R 3O4JA 5AFU3 4NENA 3J80g 4H5IA 3B7FA 3EI2A 3QI0A 4KFMB 4AEZA 3PVUB 3BG1A 4PNKB 4YVDA 3MUOA 3SBRA 3ZE0A 3SLED 3C9CA 3MKQA 3CFVA 4WK2A 4MMZA 2HYEA 4O1QD 4Z7OA 5H1MA 3RN0D 3F3PA 3JAMg 2AGYA 3JZHA 4GQ1A 4L1MA 4J79A 3L4OD 2I3SA 4Y7RA 2QXVA 3I7PA 3SXTD 3T3PA 1U4CA 1GG2B 2HKRA 5FFOA 5TEFA 5EM2B 2YNOA 4IA9A 2OVQB 4Z7NA 1E5TA 5C2VB 2CO0C 2AGZA 1UTCA 3L4MD 2H9MA 1GOHA 4GQ2P 4O9DA 4ERQA 1H2XA 4QT8A 3IKOA 2GNQA 1MDAH 2J55H 2CN2A 1PBYB 4G55A 4GM3A 4AMZA 4AN0A 5C92A 2BBKH 4MMXA 3T3MA 4CZYA 5IJ7E 5EM2A 3ZE1A 3IIYA 4IRZA 3E0CA 2OJYA 4J82A 1GXRA 1VE6A 2QZPA 2H6KA 4DNVA 3FM0A 3MXXA 3ZDZA 4ERZA 5IGOA 3C99A 4G1MA 4O3UB 3MKSB 2YNNA 3EG6A 4I79A 4XYHA 4UM9A 3ZE2A 4J84A 4E54B 4GGDA 2VDMA 3UKRC 3FCUA 1UOOA 2P9KC 5M61A 4J87A 4XEIC 2EBSA 3OKYB 5IC7A 4X61B 1BPOA 2YBAA 5E6RA 2OK6A 4O3TB 4XYIA 5HE0B 4LG8A 5EALA 5FA5B 4E54A 3I7KA 3SN6B 2H6NA 2UZYB 5M5RA 4ZOZA 3AL9A 3OKWA 3OKYA 4GQBB 4JSVC 4ES0A 2P9NC 3GD1I 2VDOA 4JT5C 5AMSA 3QHYB 3GC3B 1K32A 1E8MA 3P4FA 1L0QA 5FKSA 1TBGA 4BCDA 2EIEA 5FXYA 3ULEC 3K26A 3IUJA 5CYKB 2P9IC 2H14A 4L1QD 4FA9D 2XZGA 4UM8A 1GOGA 2VZ3A 5HE3B 4BP9A 4QL1A 1L5GA 4WJKA 2HU8A 3DXKC 3EI1B 1FWXA 1QNIA 2EICA 5M5TA 4GMBA 5THAA 1I2MB
chains in the Genus database with same CATH topology
5FKRA 5CYKA 2Z2PA 3EI1A 4L9OA 3NVXA 4X63B 4X60B 1N6DA 2G99A 5A2Qg 5I5JA 4U1EI 3PVWB 4GZ8A 4JXMA 4ZOVA 5FKTA 2H13A 4FAVD 5EAMA 4J77A 3PXSD 5IGQA 1JMZB 3JZGA 2Z2NA 3AFCA 4OWRA 3UVOA 1YFQA 5HYNB 2Q7QA 3RFHA 3V5WB 5I5IA 2IWFA 3FGBA 4FWWA 3PSLA 4CZXA 2HXCA 2CNXA 4PXWA 4BUJC 3NVNA 4A09B 3JB9L 4J0WA 3GFCA 3EMHA 2HKMA 1N6FA 2B5NA 4FAND 2OVPB 4CI2A 5TF2A 4JT6C 1XIPA 2P9SC 2P9LC 3RN1D 2YMUA 5EMKB 1Q47A 3K27A 4J78A 5TEEA 3RMZD 4A09A 2OK4A 4L3HD 2QC5A 3RLMD 2YNPA 3KRWB 3ORVD 5AJAA 4R7AB 4CY2A 3EU7A 2H9PA 2GC4A 2PBIB 2CO0A 3UKUC 2IUPA 5SXMA 1PGUA 5K19A 2O9KA 3IJ0A 5EARA 2H68A 3UVNA 3JZNA 2J57G 5CXCA 1SQ9A 2B5LA 1PEVA 4JSPC 1JOFA 4JSNC 2J56H 3SWSD 1N6EA 2CE9A 4JD2C 3IJ1A 2CN3A 3BWSA 3N0DA 3SBPA 3I7NA 3SHFA 3NVQA 3SVWD 3CIKB 3BG0A 3UR4A 5IJ8E 2G9AA 3RRMC 3N0EA 4EWRA 4A08B 3ODTA 1SQJA 3MZKA 4JSXC 3DWLC 4J0XA 3PSCB 1MG2A 2MTAH 3OL2B 3U4YA 2OVRB 1MG3A 2YB8B 3OKTA 3A0FA 2IWKA 3SBQA 3V9FA 4OZUA 5JWZA 4GGAA 3CFSB 3JROA 4A08A 4BH6A 3MMYA 2PM6B 4FB1D 3SJLD 3OL2A 3EI4B 4FA4D 4ERYA 3EI3B 3PXWD 4FHLA 4K3ID 3DSMA 3SCYA 2GC7A 1B9YA 2P9UC 4A2MA 3MZLA 2XL2A 1JJUB 4PBZA 2I0RA 3EI4A 4ZOXA 2B5MA 5H14A 3EI3A 5FQDA 4ZOYA 5FLXg 3AH8B 1PI6A 4NSXA 4FA5D 3F3FA 5I5MA 3EWEA 5C9ZB 4A0AB 1S4UX 1ERJA 3J81g 2AGXA 5CXBA 3DXMC 2AGWA 2PM9B 4PC0A 3VA6A 3IIWA 5EAPA 4HDJA 4A0AA 2TRCB 5GXHA 4ZN4A 3IJCA 4O45A 4QRJA 1JMXB 4FA1D 5EMJB 3KRXB 3OTTA 1RI6A 2B4EA 3SFZA 2IUVA 4J73A 4CI8A 2PM9A 2XL3A 2BCJB 3VH0A 3UVKA 4GM8A 3I8EA 5B4WA 5EMMB 1NEXB 1K8KC 4A7JA 3FRXA 2H3XA 4N14A 4BL0A 4J8GA 4D6VA 4ESGA 5CXCB 4J86A 4L3GD 4CZVA 2IURA 2H6QA 3C75H 4X3EA 3C5MA 5H17A 5KDOB 5GMKn 1NR0A 4QQEA 2PM7B 5HQGA 1R5MA 2H9LA 1GP2B 2UZXB 3PXTD 4CY3A 1TYQC 2H9NA 3I7HA 4E5ZB 3I89A 1A0RB 1XKSA 3AL8B 4A0BB 4CC9A 1VYHC 2IAAA 2P9PC 4Z8LA 2OIZA 4IMMA 2W18A 3JRPA 3I7LA 3OW8A 4GGCA 4PBYA 3DM0A 1GOTB 3I8CA 5K1CC 2H47A 3SMRA 4E5ZA 4CI1A 3ZWLB 4D0KA 3HFQA 3AL8A 3I7OA 2HJBA 4AOWA 4A0BA 2HJ4A 2AQ5A 1B9XA 3PE7A 3RSEC 3UVMA 2Z2OA 3GREA 4MK0B 4J81A 2I3TA 2HESX 4LG9A 2XYIA 5IT9g 2AGLA 4Y5RD 2XU7A 2AH0A 4A11B 1XHMA 2I0TA 5GSAA 3F3GA 5TDHB 3UVLA 4PSWB 2AH1A 4G56B 3V7DB 4CY1A 4CY5A 5HE2B 3W15A 4A11A 4LGNA 3RFGA 5CXBB 3VGZA 4H5JA 1OLZA 4CI3A 4GM9A 5GXIA 5FKQA 2I0SA 2IUQA 1OMWB 1SHYB 4TZ4A 4K3JB 5EMLB 4PSXB 2CE8A 3EI2B 3JPXA 4U7AA 5C2WB 1P22A 4A2LA 1U2VC 4J8BA 3I2NA 5HE1B 4UI9R 5AFU3 3J80g 4H5IA 3B7FA 3EI2A 4KFMB 4AEZA 3PVUB 3BG1A 4PNKB 4YVDA 3SBRA 3SLED 3C9CA 3MKQA 3CFVA 2HYEA 4O1QD 5H1MA 3RN0D 3F3PA 3JAMg 2AGYA 3JZHA 4GQ1A 4J79A 3L4OD 2I3SA 4Y7RA 2QXVA 3I7PA 3SXTD 1U4CA 1GG2B 2HKRA 5TEFA 5EM2B 2YNOA 4IA9A 2OVQB 5C2VB 2CO0C 2AGZA 3L4MD 2H9MA 4GQ2P 4O9DA 4ERQA 4QT8A 3IKOA 2GNQA 1MDAH 2J55H 2CN2A 1PBYB 4GM3A 2BBKH 4CZYA 5IJ7E 5EM2A 3IIYA 3E0CA 2OJYA 4J82A 1GXRA 2H6KA 3FM0A 3MXXA 4ERZA 5IGOA 3C99A 4O3UB 3MKSB 2YNNA 3EG6A 4I79A 4XYHA 4J84A 4E54B 4GGDA 3UKRC 2P9KC 4J87A 4XEIC 2EBSA 3OKYB 5IC7A 4X61B 2YBAA 2OK6A 4O3TB 4XYIA 5HE0B 4LG8A 5EALA 5FA5B 4E54A 3I7KA 3SN6B 2H6NA 2UZYB 4ZOZA 3AL9A 3OKWA 3OKYA 4GQBB 4JSVC 4ES0A 2P9NC 4JT5C 5AMSA 1K32A 3P4FA 1L0QA 5FKSA 1TBGA 5FXYA 3ULEC 3K26A 5CYKB 2P9IC 2H14A 4L1QD 4FA9D 5HE3B 3EI1B 4QL1A 3DXKC 1FWXA 1QNIA 4GMBA 5THAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FKR A;  5CYK A;  2Z2P A;  3EI1 A;  4L9O A;  3NVX A;  4X63 B;  4X60 B;  1N6D A;  2G99 A;  5A2Q g;  5I5J A;  4U1E I;  3PVW B;  4GZ8 A;  4JXM A;  4ZOV A;  5FKT A;  2H13 A;  4FAV D;  5EAM A;  4J77 A;  3PXS D;  5IGQ A;  1JMZ B;  3JZG A;  2Z2N A;  3AFC A;  4OWR A;  3UVO A;  1YFQ A;  5HYN B;  2Q7Q A;  3RFH A;  3V5W B;  5I5I A;  2IWF A;  3FGB A;  4FWW A;  3PSL A;  4CZX A;  2HXC A;  2CNX A;  4PXW A;  4BUJ C;  3NVN A;  4A09 B;  3JB9 L;  4J0W A;  3GFC A;  3EMH A;  2HKM A;  1N6F A;  2B5N A;  4FAN D;  2OVP B;  4CI2 A;  5TF2 A;  4JT6 C;  1XIP A;  2P9S C;  2P9L C;  3RN1 D;  2YMU A;  5EMK B;  1Q47 A;  3K27 A;  4J78 A;  5TEE A;  3RMZ D;  4A09 A;  2OK4 A;  4L3H D;  2QC5 A;  3RLM D;  2YNP A;  3KRW B;  3ORV D;  5AJA A;  4R7A B;  4CY2 A;  3EU7 A;  2H9P A;  2GC4 A;  2PBI B;  2CO0 A;  3UKU C;  2IUP A;  5SXM A;  1PGU A;  5K19 A;  2O9K A;  3IJ0 A;  5EAR A;  2H68 A;  3UVN A;  3JZN A;  2J57 G;  5CXC A;  1SQ9 A;  2B5L A;  1PEV A;  4JSP C;  1JOF A;  4JSN C;  2J56 H;  3SWS D;  1N6E A;  2CE9 A;  4JD2 C;  3IJ1 A;  2CN3 A;  3BWS A;  3N0D A;  3SBP A;  3I7N A;  3SHF A;  3NVQ A;  3SVW D;  3CIK B;  3BG0 A;  3UR4 A;  5IJ8 E;  2G9A A;  3RRM C;  3N0E A;  4EWR A;  4A08 B;  3ODT A;  1SQJ A;  3MZK A;  4JSX C;  3DWL C;  4J0X A;  3PSC B;  1MG2 A;  2MTA H;  3OL2 B;  3U4Y A;  2OVR B;  1MG3 A;  2YB8 B;  3OKT A;  3A0F A;  2IWK A;  3SBQ A;  3V9F A;  4OZU A;  5JWZ A;  4GGA A;  3CFS B;  3JRO A;  4A08 A;  4BH6 A;  3MMY A;  2PM6 B;  4FB1 D;  3SJL D;  3OL2 A;  3EI4 B;  4FA4 D;  4ERY A;  3EI3 B;  3PXW D;  4FHL A;  4K3I D;  3DSM A;  3SCY A;  2GC7 A;  1B9Y A;  2P9U C;  4A2M A;  3MZL A;  2XL2 A;  1JJU B;  4PBZ A;  2I0R A;  3EI4 A;  4ZOX A;  2B5M A;  5H14 A;  3EI3 A;  5FQD A;  4ZOY A;  5FLX g;  3AH8 B;  1PI6 A;  4NSX A;  4FA5 D;  3F3F A;  5I5M A;  3EWE A;  5C9Z B;  4A0A B;  1S4U X;  1ERJ A;  3J81 g;  2AGX A;  5CXB A;  3DXM C;  2AGW A;  2PM9 B;  4PC0 A;  3VA6 A;  3IIW A;  5EAP A;  4HDJ A;  4A0A A;  2TRC B;  5GXH A;  4ZN4 A;  3IJC A;  4O45 A;  4QRJ A;  1JMX B;  4FA1 D;  5EMJ B;  3KRX B;  3OTT A;  1RI6 A;  2B4E A;  3SFZ A;  2IUV A;  4J73 A;  4CI8 A;  2PM9 A;  2XL3 A;  2BCJ B;  3VH0 A;  3UVK A;  4GM8 A;  3I8E A;  5B4W A;  5EMM B;  1NEX B;  1K8K C;  4A7J A;  3FRX A;  2H3X A;  4N14 A;  4BL0 A;  4J8G A;  4D6V A;  4ESG A;  5CXC B;  4J86 A;  4L3G D;  4CZV A;  2IUR A;  2H6Q A;  3C75 H;  4X3E A;  3C5M A;  5H17 A;  5KDO B;  5GMK n;  1NR0 A;  4QQE A;  2PM7 B;  5HQG A;  1R5M A;  2H9L A;  1GP2 B;  2UZX B;  3PXT D;  4CY3 A;  1TYQ C;  2H9N A;  3I7H A;  4E5Z B;  3I89 A;  1A0R B;  1XKS A;  3AL8 B;  4A0B B;  4CC9 A;  1VYH C;  2IAA A;  2P9P C;  4Z8L A;  2OIZ A;  4IMM A;  2W18 A;  3JRP A;  3I7L A;  3OW8 A;  4GGC A;  4PBY A;  3DM0 A;  1GOT B;  3I8C A;  5K1C C;  2H47 A;  3SMR A;  4E5Z A;  4CI1 A;  3ZWL B;  4D0K A;  3HFQ A;  3AL8 A;  3I7O A;  2HJB A;  4AOW A;  4A0B A;  2HJ4 A;  2AQ5 A;  1B9X A;  3PE7 A;  3RSE C;  3UVM A;  2Z2O A;  3GRE A;  4MK0 B;  4J81 A;  2I3T A;  2HES X;  4LG9 A;  2XYI A;  5IT9 g;  2AGL A;  4Y5R D;  2XU7 A;  2AH0 A;  4A11 B;  1XHM A;  2I0T A;  5GSA A;  3F3G A;  5TDH B;  3UVL A;  4PSW B;  2AH1 A;  4G56 B;  3V7D B;  4CY1 A;  4CY5 A;  5HE2 B;  3W15 A;  4A11 A;  4LGN A;  3RFG A;  5CXB B;  3VGZ A;  4H5J A;  1OLZ A;  4CI3 A;  4GM9 A;  5GXI A;  5FKQ A;  2I0S A;  2IUQ A;  1OMW B;  1SHY B;  4TZ4 A;  4K3J B;  5EML B;  4PSX B;  2CE8 A;  3EI2 B;  3JPX A;  4U7A A;  5C2W B;  1P22 A;  4A2L A;  1U2V C;  4J8B A;  3I2N A;  5HE1 B;  4UI9 R;  5AFU 3;  3J80 g;  4H5I A;  3B7F A;  3EI2 A;  4KFM B;  4AEZ A;  3PVU B;  3BG1 A;  4PNK B;  4YVD A;  3SBR A;  3SLE D;  3C9C A;  3MKQ A;  3CFV A;  2HYE A;  4O1Q D;  5H1M A;  3RN0 D;  3F3P A;  3JAM g;  2AGY A;  3JZH A;  4GQ1 A;  4J79 A;  3L4O D;  2I3S A;  4Y7R A;  2QXV A;  3I7P A;  3SXT D;  1U4C A;  1GG2 B;  2HKR A;  5TEF A;  5EM2 B;  2YNO A;  4IA9 A;  2OVQ B;  5C2V B;  2CO0 C;  2AGZ A;  3L4M D;  2H9M A;  4GQ2 P;  4O9D A;  4ERQ A;  4QT8 A;  3IKO A;  2GNQ A;  1MDA H;  2J55 H;  2CN2 A;  1PBY B;  4GM3 A;  2BBK H;  4CZY A;  5IJ7 E;  5EM2 A;  3IIY A;  3E0C A;  2OJY A;  4J82 A;  1GXR A;  2H6K A;  3FM0 A;  3MXX A;  4ERZ A;  5IGO A;  3C99 A;  4O3U B;  3MKS B;  2YNN A;  3EG6 A;  4I79 A;  4XYH A;  4J84 A;  4E54 B;  4GGD A;  3UKR C;  2P9K C;  4J87 A;  4XEI C;  2EBS A;  3OKY B;  5IC7 A;  4X61 B;  2YBA A;  2OK6 A;  4O3T B;  4XYI A;  5HE0 B;  4LG8 A;  5EAL A;  5FA5 B;  4E54 A;  3I7K A;  3SN6 B;  2H6N A;  2UZY B;  4ZOZ A;  3AL9 A;  3OKW A;  3OKY A;  4GQB B;  4JSV C;  4ES0 A;  2P9N C;  4JT5 C;  5AMS A;  1K32 A;  3P4F A;  1L0Q A;  5FKS A;  1TBG A;  5FXY A;  3ULE C;  3K26 A;  5CYK B;  2P9I C;  2H14 A;  4L1Q D;  4FA9 D;  5HE3 B;  3EI1 B;  4QL1 A;  3DXK C;  1FWX A;  1QNI A;  4GMB A;  5THA A; 
#chains in the Genus database with same CATH topology
 3NIF A;  5FKR A;  5CYK A;  1H2Y A;  2Z2P A;  3V4V A;  4MMY A;  5FFG A;  3EI1 A;  4L9O A;  3NVX A;  4X63 B;  4X60 B;  1N6D A;  2G99 A;  5A2Q g;  5I5J A;  4U1E I;  3PVW B;  4GZ8 A;  4JXM A;  4ZOV A;  1A12 A;  5FKT A;  2H13 A;  4FAV D;  5EAM A;  4J77 A;  3PXS D;  5IGQ A;  1JMZ B;  1C9I A;  3IUL A;  3JZG A;  2Z2N A;  3AFC A;  4OWR A;  3O4G A;  1YFQ A;  3UVO A;  5HYN B;  3O4I A;  2Q7Q A;  3RFH A;  3V5W B;  5I5I A;  2IWF A;  3FGB A;  4FWW A;  3ZDY A;  3PSL A;  4CZX A;  2HXC A;  2CNX A;  4PXW A;  4BUJ C;  3NVN A;  4A09 B;  3JB9 L;  1TYE A;  4J0W A;  3GFC A;  3EMH A;  2WQ8 A;  2HKM A;  1N6F A;  2B5N A;  2VZ1 A;  4FAN D;  2OVP B;  4CI2 A;  5TF2 A;  4JT6 C;  1UOQ A;  1XIP A;  2P9S C;  2P9L C;  3RN1 D;  2YMU A;  5EMK B;  1Q47 A;  1H2W A;  3K27 A;  4J78 A;  5TEE A;  3RMZ D;  3MVD K;  4A09 A;  2OK4 A;  4L3H D;  2QC5 A;  2XE4 A;  3RLM D;  2YNP A;  3KRW B;  3ORV D;  5AJA A;  4R7A B;  4CY2 A;  5M5U A;  4JHP C;  3EU7 A;  2H9P A;  2GC4 A;  2PBI B;  2CO0 A;  3UKU C;  2IUP A;  1T2X A;  5SXM A;  1PGU A;  3FCS A;  4AMY A;  5K19 A;  2O9K A;  3NIG A;  3IJ0 A;  5EAR A;  4QAM A;  1UOP A;  2H68 A;  3UVN A;  3JZN A;  2J57 G;  4NBM A;  1SQ9 A;  2B5L A;  5CXC A;  4JHN A;  1PEV A;  2BKL A;  4JSP C;  1JOF A;  4JSN C;  2J56 H;  3SWS D;  3O4H A;  1N6E A;  2CE9 A;  4JD2 C;  3IJ1 A;  2CN3 A;  3BWS A;  3N0D A;  3SBP A;  3I7N A;  2VDK A;  3SHF A;  3NVQ A;  3SVW D;  3CIK B;  3IUN A;  3BG0 A;  3UR4 A;  5IJ8 E;  2G9A A;  3RRM C;  4Z7Q A;  3N0E A;  4EWR A;  4A08 B;  1YR2 A;  3ODT A;  1SQJ A;  3IVM A;  2VC2 A;  3MZK A;  3DWL C;  4J0X A;  3PSC B;  4JSX C;  1MG2 A;  2MTA H;  3OL2 B;  3EQ9 A;  3U4Y A;  2OVR B;  1MG3 A;  2YB8 B;  3OKT A;  4AX4 A;  3A0F A;  2IWK A;  3SBQ A;  3V9F A;  4OZU A;  4AN1 A;  5JWZ A;  4GGA A;  3CFS B;  3JRO A;  4A08 A;  4BH6 A;  3MMY A;  3K71 A;  2PM6 B;  4FB1 D;  3SJL D;  3OL2 A;  3EI4 B;  4RE5 A;  3K6S A;  4FA4 D;  4ERY A;  4RE6 A;  3EI3 B;  3PXW D;  4FHL A;  4K3I D;  3DSM A;  4BCB A;  1GOF A;  1QFS A;  3SCY A;  2GC7 A;  1B9Y A;  2P9U C;  4A2M A;  3V4P A;  3MZL A;  2XL2 A;  1JJU B;  2HU5 A;  4PBZ A;  2I0R A;  3EI4 A;  4ZOX A;  4O2W A;  2B5M A;  5H14 A;  3EI3 A;  1U8C A;  5HDB A;  1VE7 A;  5FQD A;  4ZOY A;  2XDW A;  5FLX g;  3AH8 B;  1PI6 A;  4NSX A;  4FA5 D;  3F3F A;  5I5M A;  3EWE A;  5C9Z B;  4A0A B;  4BP8 A;  1S4U X;  1ERJ A;  4DNU A;  3J81 g;  2AGX A;  5CXB A;  3DXM C;  1JTD B;  2AGW A;  2PM9 B;  5C86 A;  1VZ2 A;  4PC0 A;  3VA6 A;  1H2Z A;  1E8N A;  3IIW A;  5EAP A;  4HDJ A;  4A0A A;  2TRC B;  5GXH A;  4ZN4 A;  3IJC A;  4O45 A;  4QRJ A;  1JMX B;  4G1E A;  4FA1 D;  4WK4 A;  3EQ7 A;  5EMJ B;  3KRX B;  3OTT A;  1O6F A;  1RI6 A;  2B4E A;  3SFZ A;  2IUV A;  4J73 A;  4CI8 A;  2PM9 A;  3VI4 A;  2XL3 A;  3K72 A;  2BCJ B;  3VH0 A;  3UVK A;  4GM8 A;  3I8E A;  5B4W A;  5EMM B;  2EID A;  2VDL A;  2QR5 A;  3OF7 A;  1NEX B;  1K8K C;  4A7J A;  3FRX A;  2H3X A;  4N14 A;  4BL0 A;  4J8G A;  2VDN A;  3VI3 A;  4D6V A;  3IJE A;  4ESG A;  5CXC B;  4J86 A;  4L3G D;  5E6S A;  4CZV A;  2HU7 A;  3IUM A;  2IUR A;  2H6Q A;  4O02 A;  1M1X A;  3C75 H;  4X3E A;  4BCC A;  3C5M A;  5H17 A;  5KDO B;  5GMK n;  1NR0 A;  4QQE A;  2PM7 B;  5HQG A;  1R5M A;  2H9L A;  1GP2 B;  2UZX B;  1C9L A;  3PXT D;  4CY3 A;  1TYQ C;  2H9N A;  3I7H A;  3KCI A;  4E5Z B;  3I89 A;  1A0R B;  2VDP A;  1K3I A;  1XKS A;  3AL8 B;  4A0B B;  4CC9 A;  1VYH C;  2IAA A;  2JKX A;  2P9P C;  4Z8L A;  2OIZ A;  4IMM A;  2W18 A;  3JRP A;  3I7L A;  3OW8 A;  4GGC A;  4PBY A;  5M5S A;  2VDQ A;  3DM0 A;  1GOT B;  3I8C A;  5K1C C;  2H47 A;  3SMR A;  4E5Z A;  4CI1 A;  3ZWL B;  4D0K A;  5E6U A;  3HFQ A;  3AL8 A;  3I7O A;  2HJB A;  4AOW A;  4A0B A;  2HJ4 A;  3DDU A;  2AQ5 A;  1B9X A;  3PE7 A;  3RSE C;  3UVM A;  2Z2O A;  3GRE A;  5M5V A;  4MK0 B;  4J81 A;  4D9S A;  2I3T A;  4NC4 A;  2HES X;  4LG9 A;  2XYI A;  5IT9 g;  2AGL A;  4Y5R D;  1O6G A;  1JV2 A;  2XU7 A;  2AH0 A;  4A11 B;  4DNW A;  1XHM A;  1QFM A;  2I0T A;  5GSA A;  3EQ8 A;  3F3G A;  5TDH B;  3UVL A;  3ZDX A;  2VDR A;  4PSW B;  1VZ3 A;  2AH1 A;  4G56 B;  3V7D B;  4CY1 A;  4CY5 A;  5HE2 B;  3W15 A;  4A11 A;  4LGN A;  3RFG A;  5CXB B;  3VGZ A;  4H5J A;  1OLZ A;  4CI3 A;  4GM9 A;  5GXI A;  3NID A;  5FKQ A;  4WK0 A;  2I0S A;  2IUQ A;  1OMW B;  3IUQ A;  3IUR A;  1SHY B;  4TZ4 A;  4K3J B;  5EML B;  4PSX B;  3MUN A;  2CE8 A;  3EI2 B;  3JPX A;  4U7A A;  5C2W B;  1P22 A;  4A2L A;  1U2V C;  2EIB A;  4J8B A;  4NAA A;  3I2N A;  5HE1 B;  4UI9 R;  3O4J A;  5AFU 3;  4NEN A;  3J80 g;  4H5I A;  3B7F A;  3EI2 A;  3QI0 A;  4KFM B;  4AEZ A;  3PVU B;  3BG1 A;  4PNK B;  4YVD A;  3MUO A;  3SBR A;  3ZE0 A;  3SLE D;  3C9C A;  3MKQ A;  3CFV A;  4WK2 A;  4MMZ A;  2HYE A;  4O1Q D;  4Z7O A;  5H1M A;  3RN0 D;  3F3P A;  3JAM g;  2AGY A;  3JZH A;  4GQ1 A;  4L1M A;  4J79 A;  3L4O D;  2I3S A;  4Y7R A;  2QXV A;  3I7P A;  3SXT D;  3T3P A;  1U4C A;  1GG2 B;  2HKR A;  5FFO A;  5TEF A;  5EM2 B;  2YNO A;  4IA9 A;  2OVQ B;  4Z7N A;  1E5T A;  5C2V B;  2CO0 C;  2AGZ A;  1UTC A;  3L4M D;  2H9M A;  1GOH A;  4GQ2 P;  4O9D A;  4ERQ A;  1H2X A;  4QT8 A;  3IKO A;  2GNQ A;  1MDA H;  2J55 H;  2CN2 A;  1PBY B;  4G55 A;  4GM3 A;  4AMZ A;  4AN0 A;  5C92 A;  2BBK H;  4MMX A;  3T3M A;  4CZY A;  5IJ7 E;  5EM2 A;  3ZE1 A;  3IIY A;  4IRZ A;  3E0C A;  2OJY A;  4J82 A;  1GXR A;  1VE6 A;  2QZP A;  2H6K A;  4DNV A;  3FM0 A;  3MXX A;  3ZDZ A;  4ERZ A;  5IGO A;  3C99 A;  4G1M A;  4O3U B;  3MKS B;  2YNN A;  3EG6 A;  4I79 A;  4XYH A;  4UM9 A;  3ZE2 A;  4J84 A;  4E54 B;  4GGD A;  2VDM A;  3UKR C;  3FCU A;  1UOO A;  2P9K C;  5M61 A;  4J87 A;  4XEI C;  2EBS A;  3OKY B;  5IC7 A;  4X61 B;  1BPO A;  2YBA A;  5E6R A;  2OK6 A;  4O3T B;  4XYI A;  5HE0 B;  4LG8 A;  5EAL A;  5FA5 B;  4E54 A;  3I7K A;  3SN6 B;  2H6N A;  2UZY B;  5M5R A;  4ZOZ A;  3AL9 A;  3OKW A;  3OKY A;  4GQB B;  4JSV C;  4ES0 A;  2P9N C;  3GD1 I;  2VDO A;  4JT5 C;  5AMS A;  3QHY B;  3GC3 B;  1K32 A;  1E8M A;  3P4F A;  1L0Q A;  5FKS A;  1TBG A;  4BCD A;  2EIE A;  5FXY A;  3ULE C;  3K26 A;  3IUJ A;  5CYK B;  2P9I C;  2H14 A;  4L1Q D;  4FA9 D;  2XZG A;  4UM8 A;  1GOG A;  2VZ3 A;  5HE3 B;  4BP9 A;  4QL1 A;  1L5G A;  4WJK A;  2HU8 A;  3DXK C;  3EI1 B;  1FWX A;  1QNI A;  2EIC A;  5M5T A;  4GMB A;  5THA A;  1I2M B; 
#chains in the Genus database with same CATH homology
 5FKR A;  5CYK A;  2Z2P A;  3EI1 A;  4L9O A;  3NVX A;  4X63 B;  4X60 B;  1N6D A;  2G99 A;  5A2Q g;  5I5J A;  4U1E I;  3PVW B;  4GZ8 A;  4JXM A;  4ZOV A;  5FKT A;  2H13 A;  4FAV D;  5EAM A;  4J77 A;  3PXS D;  5IGQ A;  1JMZ B;  3JZG A;  2Z2N A;  3AFC A;  4OWR A;  3UVO A;  1YFQ A;  5HYN B;  2Q7Q A;  3RFH A;  3V5W B;  5I5I A;  2IWF A;  3FGB A;  4FWW A;  3PSL A;  4CZX A;  2HXC A;  2CNX A;  4PXW A;  4BUJ C;  3NVN A;  4A09 B;  3JB9 L;  4J0W A;  3GFC A;  3EMH A;  2HKM A;  1N6F A;  2B5N A;  4FAN D;  2OVP B;  4CI2 A;  5TF2 A;  4JT6 C;  1XIP A;  2P9S C;  2P9L C;  3RN1 D;  2YMU A;  5EMK B;  1Q47 A;  3K27 A;  4J78 A;  5TEE A;  3RMZ D;  4A09 A;  2OK4 A;  4L3H D;  2QC5 A;  3RLM D;  2YNP A;  3KRW B;  3ORV D;  5AJA A;  4R7A B;  4CY2 A;  3EU7 A;  2H9P A;  2GC4 A;  2PBI B;  2CO0 A;  3UKU C;  2IUP A;  5SXM A;  1PGU A;  5K19 A;  2O9K A;  3IJ0 A;  5EAR A;  2H68 A;  3UVN A;  3JZN A;  2J57 G;  5CXC A;  1SQ9 A;  2B5L A;  1PEV A;  4JSP C;  1JOF A;  4JSN C;  2J56 H;  3SWS D;  1N6E A;  2CE9 A;  4JD2 C;  3IJ1 A;  2CN3 A;  3BWS A;  3N0D A;  3SBP A;  3I7N A;  3SHF A;  3NVQ A;  3SVW D;  3CIK B;  3BG0 A;  3UR4 A;  5IJ8 E;  2G9A A;  3RRM C;  3N0E A;  4EWR A;  4A08 B;  3ODT A;  1SQJ A;  3MZK A;  4JSX C;  3DWL C;  4J0X A;  3PSC B;  1MG2 A;  2MTA H;  3OL2 B;  3U4Y A;  2OVR B;  1MG3 A;  2YB8 B;  3OKT A;  3A0F A;  2IWK A;  3SBQ A;  3V9F A;  4OZU A;  5JWZ A;  4GGA A;  3CFS B;  3JRO A;  4A08 A;  4BH6 A;  3MMY A;  2PM6 B;  4FB1 D;  3SJL D;  3OL2 A;  3EI4 B;  4FA4 D;  4ERY A;  3EI3 B;  3PXW D;  4FHL A;  4K3I D;  3DSM A;  3SCY A;  2GC7 A;  1B9Y A;  2P9U C;  4A2M A;  3MZL A;  2XL2 A;  1JJU B;  4PBZ A;  2I0R A;  3EI4 A;  4ZOX A;  2B5M A;  5H14 A;  3EI3 A;  5FQD A;  4ZOY A;  5FLX g;  3AH8 B;  1PI6 A;  4NSX A;  4FA5 D;  3F3F A;  5I5M A;  3EWE A;  5C9Z B;  4A0A B;  1S4U X;  1ERJ A;  3J81 g;  2AGX A;  5CXB A;  3DXM C;  2AGW A;  2PM9 B;  4PC0 A;  3VA6 A;  3IIW A;  5EAP A;  4HDJ A;  4A0A A;  2TRC B;  5GXH A;  4ZN4 A;  3IJC A;  4O45 A;  4QRJ A;  1JMX B;  4FA1 D;  5EMJ B;  3KRX B;  3OTT A;  1RI6 A;  2B4E A;  3SFZ A;  2IUV A;  4J73 A;  4CI8 A;  2PM9 A;  2XL3 A;  2BCJ B;  3VH0 A;  3UVK A;  4GM8 A;  3I8E A;  5B4W A;  5EMM B;  1NEX B;  1K8K C;  4A7J A;  3FRX A;  2H3X A;  4N14 A;  4BL0 A;  4J8G A;  4D6V A;  4ESG A;  5CXC B;  4J86 A;  4L3G D;  4CZV A;  2IUR A;  2H6Q A;  3C75 H;  4X3E A;  3C5M A;  5H17 A;  5KDO B;  5GMK n;  1NR0 A;  4QQE A;  2PM7 B;  5HQG A;  1R5M A;  2H9L A;  1GP2 B;  2UZX B;  3PXT D;  4CY3 A;  1TYQ C;  2H9N A;  3I7H A;  4E5Z B;  3I89 A;  1A0R B;  1XKS A;  3AL8 B;  4A0B B;  4CC9 A;  1VYH C;  2IAA A;  2P9P C;  4Z8L A;  2OIZ A;  4IMM A;  2W18 A;  3JRP A;  3I7L A;  3OW8 A;  4GGC A;  4PBY A;  3DM0 A;  1GOT B;  3I8C A;  5K1C C;  2H47 A;  3SMR A;  4E5Z A;  4CI1 A;  3ZWL B;  4D0K A;  3HFQ A;  3AL8 A;  3I7O A;  2HJB A;  4AOW A;  4A0B A;  2HJ4 A;  2AQ5 A;  1B9X A;  3PE7 A;  3RSE C;  3UVM A;  2Z2O A;  3GRE A;  4MK0 B;  4J81 A;  2I3T A;  2HES X;  4LG9 A;  2XYI A;  5IT9 g;  2AGL A;  4Y5R D;  2XU7 A;  2AH0 A;  4A11 B;  1XHM A;  2I0T A;  5GSA A;  3F3G A;  5TDH B;  3UVL A;  4PSW B;  2AH1 A;  4G56 B;  3V7D B;  4CY1 A;  4CY5 A;  5HE2 B;  3W15 A;  4A11 A;  4LGN A;  3RFG A;  5CXB B;  3VGZ A;  4H5J A;  1OLZ A;  4CI3 A;  4GM9 A;  5GXI A;  5FKQ A;  2I0S A;  2IUQ A;  1OMW B;  1SHY B;  4TZ4 A;  4K3J B;  5EML B;  4PSX B;  2CE8 A;  3EI2 B;  3JPX A;  4U7A A;  5C2W B;  1P22 A;  4A2L A;  1U2V C;  4J8B A;  3I2N A;  5HE1 B;  4UI9 R;  5AFU 3;  3J80 g;  4H5I A;  3B7F A;  3EI2 A;  4KFM B;  4AEZ A;  3PVU B;  3BG1 A;  4PNK B;  4YVD A;  3SBR A;  3SLE D;  3C9C A;  3MKQ A;  3CFV A;  2HYE A;  4O1Q D;  5H1M A;  3RN0 D;  3F3P A;  3JAM g;  2AGY A;  3JZH A;  4GQ1 A;  4J79 A;  3L4O D;  2I3S A;  4Y7R A;  2QXV A;  3I7P A;  3SXT D;  1U4C A;  1GG2 B;  2HKR A;  5TEF A;  5EM2 B;  2YNO A;  4IA9 A;  2OVQ B;  5C2V B;  2CO0 C;  2AGZ A;  3L4M D;  2H9M A;  4GQ2 P;  4O9D A;  4ERQ A;  4QT8 A;  3IKO A;  2GNQ A;  1MDA H;  2J55 H;  2CN2 A;  1PBY B;  4GM3 A;  2BBK H;  4CZY A;  5IJ7 E;  5EM2 A;  3IIY A;  3E0C A;  2OJY A;  4J82 A;  1GXR A;  2H6K A;  3FM0 A;  3MXX A;  4ERZ A;  5IGO A;  3C99 A;  4O3U B;  3MKS B;  2YNN A;  3EG6 A;  4I79 A;  4XYH A;  4J84 A;  4E54 B;  4GGD A;  3UKR C;  2P9K C;  4J87 A;  4XEI C;  2EBS A;  3OKY B;  5IC7 A;  4X61 B;  2YBA A;  2OK6 A;  4O3T B;  4XYI A;  5HE0 B;  4LG8 A;  5EAL A;  5FA5 B;  4E54 A;  3I7K A;  3SN6 B;  2H6N A;  2UZY B;  4ZOZ A;  3AL9 A;  3OKW A;  3OKY A;  4GQB B;  4JSV C;  4ES0 A;  2P9N C;  4JT5 C;  5AMS A;  1K32 A;  3P4F A;  1L0Q A;  5FKS A;  1TBG A;  5FXY A;  3ULE C;  3K26 A;  5CYK B;  2P9I C;  2H14 A;  4L1Q D;  4FA9 D;  5HE3 B;  3EI1 B;  4QL1 A;  3DXK C;  1FWX A;  1QNI A;  4GMB A;  5THA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...